1VQM1

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqm100
3CMAZ 1VQ5Z 2OTL1 1Q821 2QEX1 1S72Z 1W2BZ 1NJI1 3CMA1 1VQ51 3CCR1 3CD6Z 1VQ71 1YHQZ 1M902 3CCSZ 3CPWY 2OTJ1 3CCLZ 2OTLZ 1QVFY 1YJW1 3CCE1 3CXCZ 1K9M1 3G4SZ 1JJ2Z 3CC4Z 3CCL1 3CCRZ 1QVGY 1Q822 3G4S1 3CC41 1VQ7Z 3I55Z 2QA41 1Q7Y1 3CCJ1 2OTJZ 1NJI2 1K731 3I56Z 1YJWZ 3CCEZ 1VQMZ 3I551 1K8A1 1VQN1 1VQLZ 3I561 1K8A2 3CCQ1 1VQM1 1YIJZ 1YJ91 3G711 3CC2Z 3G6EZ 3CCV1 1KC81 1VQ81 1KQSY 1VQL1 2QA4Z 1K9M2 3CCJZ 1YIJ1 3CXCY 3G6E1 3CC21 1VQK1 1JJ2Y 1KD11 1VQ61 3CCM1 1M1K1 1VQNZ 1YIT1 1VQPZ 3OW2Z 1Q7Y2 3CCQZ 1W2BY 1YJN1 1K732 3G71Z 1YJ9Z 3CCVZ 1VQ8Z 1VQ9Z 1VQP1 1VQ41 3CCU1 3CC71 3CME1 1VQKZ 1VQ91 1VQ6Z 1Q861 3CCMZ 1Q811 1KC82 1YITZ 1Q862 1VQOZ 3CPWZ 1Q812 1M901 1S721 1QVFZ 1YJNZ 1N8R1 1KD12 1YI2Z 1VQO1 1N8R2 1VQ4Z 1M1K2 1KQSZ 3CD61 3CCUZ 1QVGZ 3CC7Z 3CMEZ 1YHQ1 1YI21 2QEXZ 3CCS1 3OW2Y
chains in the Genus database with same CATH superfamily
1Q821 2JNYA 3NH8A 4A3KI 3TE5B 2YU9I 4NBHA 1W2BZ 1NJI1 3CMA1 1VQ51 3CD6Z 2ZAEB 1WIIA 4DQYB 3GKQA 1ZB9A 2K5RA 3PO3I 2EGTA 3S16I 2QR1B 3NH4A 4HGZA 1K83I 4RVDA 3H0GI 2Q4ZA 3J80b 3CCL1 2BJOA 1QVGY 2GTIA 1N2FA 2V8KA 3FKII 3G4S1 4BBRI 1VQ7Z 4NBDA 1K731 2RBLA 2V3VA 4E2WA 3MONA 3CCEZ 1VQMZ 3HOZI 2IV2X 1X0TA 1K8A1 1VQN1 3I561 5C4XI 3CCQ1 5AN9F 3G711 1YJ91 2KI7B 5D1OB 1KQSY 2RHBA 1K9M2 2O53A 3CCJZ 3PO2I 1L1OC 5T64A 1VQK1 3IF8A 2PMZA 1M1K1 1KRLA 1VQPZ 4NFRA 3OW2Z 4NBBA 3CCVZ 5T6BA 2KPIA 1Y1VS 2R6MA 1Q16A 3CCU1 2O4HA 1Q861 3S2HI 2W03A 1RNIA 3VB9A 1VQOZ 2HU9A 1QVFZ 3IFUA 3CQZI 1KD12 2VPXA 2JA8I 1JWHC 3CD61 3RZOI 3J81b 3M4OI 3CC7Z 2JA6I 2QEXZ 3OW2Y 2JIRA 3S1RI 4DGLA 4Y52I 5IT9b 2WAQA 4NB9A 4XX2A 1VLAA 1Z02A 4BY1I 3IX0A 3I4NI 2QKDA 4TNUA 3GTPI 4E2XA 3J80f 4BBSI 1DL6A 1ZB8A 1VQ71 3CCSZ 3VMIA 4A3JI 2DE5A 2OTLZ 2JMOA 1QVFY 3CCE1 1WW9A 1WZNA 4A3DI 5D1PA 2GU2A 2JUBA 4MD7A 3CXCZ 3NDJA 2OZKA 1PFTA 4HH4A 1I3QI 3CC41 2PK7A 1USPB 3MZLB 3CCJ1 4MONA 3TDHB 3GTQI 4RVGA 3I551 1FDIA 1VQLZ 2AKLA 1K8A2 2E2HI 1YIJZ 2OOXB 3CC2Z 3G6EZ 3CCV1 1KC81 1NP6A 2QA4Z 1TWCI 3BG0B 5IP7I 3CXCY 1TWAI 4DK1A 4BY7I 2NVXI 3HOVI 3I07A 1Q7Y2 4MRIA 2I3CA 5FLXb 1W2BY 4CL1A 4A3FI 2VPYA 1R9TI 1QF8A 4A3MI 2M48A 3PO3S 2RT9A 3CC71 1VQ91 3J81f 1Q811 3HOXI 4RS4A 1YITZ 1Q862 3NH5A 2LEXA 4A3GI 3CPWZ 1SFOI 2WB1A 2QRCB 5IT9f 2E2II 1YJNZ 3QWUA 1I6HI 2H85A 1WJ2A 2JIOA 1YI2Z 1X3WA 3GTJI 2R7ZI 2LIYA 3NFZA 4E30A 3FQQA 3CCS1 1Y8CA 3CMAZ 1VQ5Z 2OTL1 2JS4A 2HF1A 3S14I 2VPZA 1S72Z 2F4OA 1ML8A 4RV9A 3P5JB 2DE6A 2NAPA 1YHQZ 2RPRA 1M902 3GTGI 1RLYA 3CPWY 2VF1A 3GTMI 3CCLZ 2J6AA 3KIFA 3HOUI 1K9M1 3G4SZ 1JJ2Z 3D6WA 3CCRZ 2JIQA 3F3PC 1Q822 2QA41 2DE7A 3VMGA 2OTJZ 1LQLA 1NJI2 1RO4A 3I56Z 1YJWZ 3NDIA 1Z03A 4BXXI 1TWHI 4X6AI 2P3YA 1VQM1 5FLMI 2LFUA 5FLXf 3GTLI 2R93I 3S1QI 2Y0SA 1TFIA 3VMHA 4NH1C 1JJ2Y 4NBEA 5C3EI 1KD11 3M3YI 1I50I 1YIT1 1NUIA 2M6NA 3F3FC 1RO0A 3HOYI 2QLVB 1YJN1 1K732 1ZH1A 1VQ8Z 5IP9I 2P28A 2E7ZA 1VQP1 1S7MA 4HGYA 4MXUA 1TWGI 5A2Qb 1VQ6Z 3CCMZ 4A3LI 3GTOI 1QYPA 2W04A 1Q812 1FDOA 5D1OA 1S721 1N8R1 3D9XA 1VQO1 3S1MI 1VQ4Z 1M1K2 4E2ZA 1KQSZ 3S1NI 3JAMb 2OOYB 2VUGA 3RZDI 4MD9A 3CMEZ 1YHQ1 4RVFA 3D2LA 4Y7NI 3MZKB 2NVQI 1QXFA 2K3RA 2QEX1 3J7A4 5LL6f 3S17I 1Y1VI 3CCR1 4E2YA 4QTUA 3H3VJ 3S2DI 2RIQA 4QTTA 4A93I 2E2JI 2QREB 1YUAA 2OTJ1 5C44I 1YJW1 4MH4A 2E9HA 3ESWA 3BG1B 3CC4Z 4NOZA 3GTKI 1RQFA 2Q51A 1X3ZA 2R92I 2AYDA 4RVHA 5C4JI 3I55Z 1Q7Y1 2GTHA 3HOWI 4E31A 2V45A 2B63I 2VPWA 2YADA 1SIWA 1TWFI 2JR6A 3FQMA 2V8JA 3GCFA 4NBGA 3EEDA 4E32A 3Q87A 4S1TA 1P9NA 3S15I 2JIMA 2JA5I 5CM2M 2VUMI 1VQ81 4EWCA 4NB8A 1VQL1 4NBFA 2NVTI 4A3II 1YIJ1 3CC21 3G6E1 2F4MA 1VQ61 1WCMI 5T67A 3U50C 3LUSA 3KIHA 3CCM1 5A2Qf 4A3BI 2QRDB 1VQNZ 1YUKA 2NVYI 3CCQZ 1RO2A 4AYBA 3IR7A 3G71Z 1YJ9Z 1VQ9Z 1USPA 3VTNA 1VQ41 4A3CI 1AA6A 4MD8A 2IZ3A 2JA7I 2PM9A 4E33A 3JAMf 3CME1 1VQKZ 4NBCA 2IZ4A 1KC82 3GTMS 2V8IA 1M901 4A3EI 2G2KA 3HKZA 3I4MI 1Z01A 1Y1WI 1N8R2 4NBAA 3CCUZ 1QVGZ 3EERA 3T4NB 2JIPA 1YI21 3K7AI
chains in the Genus database with same CATH topology
1Q821 2JNYA 3NH8A 4A3KI 3TE5B 2YU9I 4NBHA 1W2BZ 1NJI1 3CMA1 1VQ51 3CD6Z 2ZAEB 1WIIA 4DQYB 3GKQA 1ZB9A 2K5RA 3PO3I 2EGTA 3S16I 2QR1B 3NH4A 4HGZA 1K83I 4RVDA 3H0GI 2Q4ZA 3J80b 3CCL1 2BJOA 1QVGY 2GTIA 1N2FA 2V8KA 3FKII 3G4S1 4BBRI 1VQ7Z 4NBDA 1K731 2RBLA 4E2WA 3MONA 3CCEZ 1VQMZ 3HOZI 1X0TA 1K8A1 1VQN1 3I561 5C4XI 3CCQ1 5AN9F 3G711 1YJ91 2KI7B 5D1OB 1KQSY 2RHBA 1K9M2 2O53A 3CCJZ 3PO2I 1L1OC 5T64A 1VQK1 3IF8A 2PMZA 1M1K1 1KRLA 1VQPZ 4NFRA 3OW2Z 4NBBA 3CCVZ 5T6BA 2KPIA 1Y1VS 2R6MA 3CCU1 2O4HA 1Q861 3S2HI 2W03A 1RNIA 3VB9A 1VQOZ 2HU9A 1QVFZ 3IFUA 3CQZI 1KD12 2JA8I 1JWHC 3CD61 3RZOI 3J81b 3M4OI 3CC7Z 2JA6I 2QEXZ 3OW2Y 3S1RI 4DGLA 4Y52I 5IT9b 2WAQA 4NB9A 4XX2A 1VLAA 1Z02A 4BY1I 3IX0A 3I4NI 2QKDA 4TNUA 3GTPI 4E2XA 3J80f 4BBSI 1DL6A 1ZB8A 1VQ71 3CCSZ 3VMIA 4A3JI 2DE5A 2OTLZ 2JMOA 1QVFY 3CCE1 1WW9A 4A3DI 5D1PA 2JUBA 2GU2A 4MD7A 3CXCZ 3NDJA 2OZKA 1PFTA 4HH4A 1I3QI 3CC41 2PK7A 1USPB 3MZLB 3CCJ1 4MONA 3TDHB 3GTQI 4RVGA 3I551 1VQLZ 2AKLA 1K8A2 2E2HI 1YIJZ 2OOXB 3CC2Z 3G6EZ 3CCV1 1KC81 1NP6A 2QA4Z 1TWCI 3BG0B 5IP7I 3CXCY 1TWAI 4DK1A 4BY7I 2NVXI 3HOVI 3I07A 1Q7Y2 4MRIA 2I3CA 5FLXb 1W2BY 4CL1A 4A3FI 1R9TI 1QF8A 4A3MI 2M48A 3PO3S 2RT9A 3CC71 1VQ91 3J81f 1Q811 3HOXI 4RS4A 1YITZ 1Q862 3NH5A 4A3GI 3CPWZ 1SFOI 2WB1A 2QRCB 5IT9f 2E2II 1YJNZ 3QWUA 1I6HI 2H85A 1YI2Z 1X3WA 3GTJI 2R7ZI 2LIYA 3NFZA 4E30A 3FQQA 3CCS1 3CMAZ 1VQ5Z 2OTL1 2JS4A 2HF1A 3S14I 1S72Z 2F4OA 1ML8A 4RV9A 3P5JB 2DE6A 1YHQZ 2RPRA 1M902 3GTGI 1RLYA 3CPWY 2VF1A 3GTMI 3CCLZ 2J6AA 3KIFA 3HOUI 1K9M1 3G4SZ 1JJ2Z 3D6WA 3CCRZ 3F3PC 1Q822 2QA41 2DE7A 3VMGA 2OTJZ 1LQLA 1NJI2 1RO4A 3I56Z 1YJWZ 3NDIA 1Z03A 4BXXI 1TWHI 4X6AI 2P3YA 1VQM1 5FLMI 2LFUA 5FLXf 3GTLI 2R93I 3S1QI 2Y0SA 1TFIA 3VMHA 4NH1C 1JJ2Y 4NBEA 5C3EI 1KD11 3M3YI 1I50I 1YIT1 1NUIA 2M6NA 3F3FC 1RO0A 3HOYI 2QLVB 1YJN1 1K732 1ZH1A 1VQ8Z 5IP9I 2P28A 1VQP1 1S7MA 4HGYA 4MXUA 1TWGI 5A2Qb 1VQ6Z 3CCMZ 4A3LI 3GTOI 1QYPA 2W04A 1Q812 5D1OA 1S721 1N8R1 3D9XA 1VQO1 3S1MI 1VQ4Z 1M1K2 4E2ZA 1KQSZ 3S1NI 3JAMb 2OOYB 2VUGA 3RZDI 4MD9A 3CMEZ 1YHQ1 4RVFA 4Y7NI 3MZKB 2NVQI 2K3RA 2QEX1 3J7A4 5LL6f 3S17I 1Y1VI 3CCR1 4E2YA 4QTUA 3H3VJ 3S2DI 2RIQA 4QTTA 4A93I 2E2JI 2QREB 1YUAA 2OTJ1 5C44I 1YJW1 4MH4A 2E9HA 3ESWA 3BG1B 3CC4Z 4NOZA 3GTKI 1RQFA 2Q51A 1X3ZA 2R92I 4RVHA 5C4JI 3I55Z 1Q7Y1 2GTHA 3HOWI 4E31A 2B63I 2YADA 1TWFI 2JR6A 3FQMA 2V8JA 3GCFA 4NBGA 3EEDA 4E32A 3Q87A 4S1TA 1P9NA 3S15I 2JA5I 5CM2M 2VUMI 1VQ81 4EWCA 4NB8A 1VQL1 4NBFA 2NVTI 4A3II 1YIJ1 3CC21 3G6E1 2F4MA 1VQ61 1WCMI 5T67A 3U50C 3LUSA 3KIHA 3CCM1 5A2Qf 4A3BI 2QRDB 1VQNZ 1YUKA 2NVYI 3CCQZ 1RO2A 4AYBA 3G71Z 1YJ9Z 1VQ9Z 1USPA 3VTNA 1VQ41 4A3CI 4MD8A 2IZ3A 2JA7I 2PM9A 4E33A 3JAMf 3CME1 1VQKZ 4NBCA 2IZ4A 1KC82 3GTMS 2V8IA 1M901 4A3EI 2G2KA 3HKZA 3I4MI 1Z01A 1Y1WI 1N8R2 4NBAA 3CCUZ 1QVGZ 3EERA 3T4NB 1YI21 3K7AI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA Z;  1VQ5 Z;  2OTL 1;  1Q82 1;  2QEX 1;  1S72 Z;  1W2B Z;  1NJI 1;  3CMA 1;  1VQ5 1;  3CCR 1;  3CD6 Z;  1VQ7 1;  1YHQ Z;  1M90 2;  3CCS Z;  3CPW Y;  2OTJ 1;  3CCL Z;  2OTL Z;  1QVF Y;  1YJW 1;  3CCE 1;  3CXC Z;  1K9M 1;  3G4S Z;  1JJ2 Z;  3CC4 Z;  3CCL 1;  3CCR Z;  1QVG Y;  1Q82 2;  3G4S 1;  3CC4 1;  1VQ7 Z;  3I55 Z;  2QA4 1;  1Q7Y 1;  3CCJ 1;  2OTJ Z;  1NJI 2;  1K73 1;  3I56 Z;  1YJW Z;  3CCE Z;  1VQM Z;  3I55 1;  1K8A 1;  1VQN 1;  1VQL Z;  3I56 1;  1K8A 2;  3CCQ 1;  1VQM 1;  1YIJ Z;  1YJ9 1;  3G71 1;  3CC2 Z;  3G6E Z;  3CCV 1;  1KC8 1;  1VQ8 1;  1KQS Y;  1VQL 1;  2QA4 Z;  1K9M 2;  3CCJ Z;  1YIJ 1;  3CXC Y;  3G6E 1;  3CC2 1;  1VQK 1;  1JJ2 Y;  1KD1 1;  1VQ6 1;  3CCM 1;  1M1K 1;  1VQN Z;  1YIT 1;  1VQP Z;  3OW2 Z;  1Q7Y 2;  3CCQ Z;  1W2B Y;  1YJN 1;  1K73 2;  3G71 Z;  1YJ9 Z;  3CCV Z;  1VQ8 Z;  1VQ9 Z;  1VQP 1;  1VQ4 1;  3CCU 1;  3CC7 1;  3CME 1;  1VQK Z;  1VQ9 1;  1VQ6 Z;  1Q86 1;  3CCM Z;  1Q81 1;  1KC8 2;  1YIT Z;  1Q86 2;  1VQO Z;  3CPW Z;  1Q81 2;  1M90 1;  1S72 1;  1QVF Z;  1YJN Z;  1N8R 1;  1KD1 2;  1YI2 Z;  1VQO 1;  1N8R 2;  1VQ4 Z;  1M1K 2;  1KQS Z;  3CD6 1;  3CCU Z;  1QVG Z;  3CC7 Z;  3CME Z;  1YHQ 1;  1YI2 1;  2QEX Z;  3CCS 1;  3OW2 Y; 
#chains in the Genus database with same CATH topology
 1Q82 1;  2JNY A;  3NH8 A;  4A3K I;  3TE5 B;  2YU9 I;  4NBH A;  1W2B Z;  1NJI 1;  3CMA 1;  1VQ5 1;  3CD6 Z;  2ZAE B;  1WII A;  4DQY B;  3GKQ A;  1ZB9 A;  2K5R A;  3PO3 I;  2EGT A;  3S16 I;  2QR1 B;  3NH4 A;  4HGZ A;  1K83 I;  4RVD A;  3H0G I;  2Q4Z A;  3J80 b;  3CCL 1;  2BJO A;  1QVG Y;  2GTI A;  1N2F A;  2V8K A;  3FKI I;  3G4S 1;  4BBR I;  1VQ7 Z;  4NBD A;  1K73 1;  2RBL A;  2V3V A;  4E2W A;  3MON A;  3CCE Z;  1VQM Z;  3HOZ I;  2IV2 X;  1X0T A;  1K8A 1;  1VQN 1;  3I56 1;  5C4X I;  3CCQ 1;  5AN9 F;  3G71 1;  1YJ9 1;  2KI7 B;  5D1O B;  1KQS Y;  2RHB A;  1K9M 2;  2O53 A;  3CCJ Z;  3PO2 I;  1L1O C;  5T64 A;  1VQK 1;  3IF8 A;  2PMZ A;  1M1K 1;  1KRL A;  1VQP Z;  4NFR A;  3OW2 Z;  4NBB A;  3CCV Z;  5T6B A;  2KPI A;  1Y1V S;  2R6M A;  1Q16 A;  3CCU 1;  2O4H A;  1Q86 1;  3S2H I;  2W03 A;  1RNI A;  3VB9 A;  1VQO Z;  2HU9 A;  1QVF Z;  3IFU A;  3CQZ I;  1KD1 2;  2VPX A;  2JA8 I;  1JWH C;  3CD6 1;  3RZO I;  3J81 b;  3M4O I;  3CC7 Z;  2JA6 I;  2QEX Z;  3OW2 Y;  2JIR A;  3S1R I;  4DGL A;  4Y52 I;  5IT9 b;  2WAQ A;  4NB9 A;  4XX2 A;  1VLA A;  1Z02 A;  4BY1 I;  3IX0 A;  3I4N I;  2QKD A;  4TNU A;  3GTP I;  4E2X A;  3J80 f;  4BBS I;  1DL6 A;  1ZB8 A;  1VQ7 1;  3CCS Z;  3VMI A;  4A3J I;  2DE5 A;  2OTL Z;  2JMO A;  1QVF Y;  3CCE 1;  1WW9 A;  1WZN A;  4A3D I;  5D1P A;  2GU2 A;  2JUB A;  4MD7 A;  3CXC Z;  3NDJ A;  2OZK A;  1PFT A;  4HH4 A;  1I3Q I;  3CC4 1;  2PK7 A;  1USP B;  3MZL B;  3CCJ 1;  4MON A;  3TDH B;  3GTQ I;  4RVG A;  3I55 1;  1FDI A;  1VQL Z;  2AKL A;  1K8A 2;  2E2H I;  1YIJ Z;  2OOX B;  3CC2 Z;  3G6E Z;  3CCV 1;  1KC8 1;  1NP6 A;  2QA4 Z;  1TWC I;  3BG0 B;  5IP7 I;  3CXC Y;  1TWA I;  4DK1 A;  4BY7 I;  2NVX I;  3HOV I;  3I07 A;  1Q7Y 2;  4MRI A;  2I3C A;  5FLX b;  1W2B Y;  4CL1 A;  4A3F I;  2VPY A;  1R9T I;  1QF8 A;  4A3M I;  2M48 A;  3PO3 S;  2RT9 A;  3CC7 1;  1VQ9 1;  3J81 f;  1Q81 1;  3HOX I;  4RS4 A;  1YIT Z;  1Q86 2;  3NH5 A;  2LEX A;  4A3G I;  3CPW Z;  1SFO I;  2WB1 A;  2QRC B;  5IT9 f;  2E2I I;  1YJN Z;  3QWU A;  1I6H I;  2H85 A;  1WJ2 A;  2JIO A;  1YI2 Z;  1X3W A;  3GTJ I;  2R7Z I;  2LIY A;  3NFZ A;  4E30 A;  3FQQ A;  3CCS 1;  1Y8C A;  3CMA Z;  1VQ5 Z;  2OTL 1;  2JS4 A;  2HF1 A;  3S14 I;  2VPZ A;  1S72 Z;  2F4O A;  1ML8 A;  4RV9 A;  3P5J B;  2DE6 A;  2NAP A;  1YHQ Z;  2RPR A;  1M90 2;  3GTG I;  1RLY A;  3CPW Y;  2VF1 A;  3GTM I;  3CCL Z;  2J6A A;  3KIF A;  3HOU I;  1K9M 1;  3G4S Z;  1JJ2 Z;  3D6W A;  3CCR Z;  2JIQ A;  3F3P C;  1Q82 2;  2QA4 1;  2DE7 A;  3VMG A;  2OTJ Z;  1LQL A;  1NJI 2;  1RO4 A;  3I56 Z;  1YJW Z;  3NDI A;  1Z03 A;  4BXX I;  1TWH I;  4X6A I;  2P3Y A;  1VQM 1;  5FLM I;  2LFU A;  5FLX f;  3GTL I;  2R93 I;  3S1Q I;  2Y0S A;  1TFI A;  3VMH A;  4NH1 C;  1JJ2 Y;  4NBE A;  5C3E I;  1KD1 1;  3M3Y I;  1I50 I;  1YIT 1;  1NUI A;  2M6N A;  3F3F C;  1RO0 A;  3HOY I;  2QLV B;  1YJN 1;  1K73 2;  1ZH1 A;  1VQ8 Z;  5IP9 I;  2P28 A;  2E7Z A;  1VQP 1;  1S7M A;  4HGY A;  4MXU A;  1TWG I;  5A2Q b;  1VQ6 Z;  3CCM Z;  4A3L I;  3GTO I;  1QYP A;  2W04 A;  1Q81 2;  1FDO A;  5D1O A;  1S72 1;  1N8R 1;  3D9X A;  1VQO 1;  3S1M I;  1VQ4 Z;  1M1K 2;  4E2Z A;  1KQS Z;  3S1N I;  3JAM b;  2OOY B;  2VUG A;  3RZD I;  4MD9 A;  3CME Z;  1YHQ 1;  4RVF A;  3D2L A;  4Y7N I;  3MZK B;  2NVQ I;  1QXF A;  2K3R A;  2QEX 1;  3J7A 4;  5LL6 f;  3S17 I;  1Y1V I;  3CCR 1;  4E2Y A;  4QTU A;  3H3V J;  3S2D I;  2RIQ A;  4QTT A;  4A93 I;  2E2J I;  2QRE B;  1YUA A;  2OTJ 1;  5C44 I;  1YJW 1;  4MH4 A;  2E9H A;  3ESW A;  3BG1 B;  3CC4 Z;  4NOZ A;  3GTK I;  1RQF A;  2Q51 A;  1X3Z A;  2R92 I;  2AYD A;  4RVH A;  5C4J I;  3I55 Z;  1Q7Y 1;  2GTH A;  3HOW I;  4E31 A;  2V45 A;  2B63 I;  2VPW A;  2YAD A;  1SIW A;  1TWF I;  2JR6 A;  3FQM A;  2V8J A;  3GCF A;  4NBG A;  3EED A;  4E32 A;  3Q87 A;  4S1T A;  1P9N A;  3S15 I;  2JIM A;  2JA5 I;  5CM2 M;  2VUM I;  1VQ8 1;  4EWC A;  4NB8 A;  1VQL 1;  4NBF A;  2NVT I;  4A3I I;  1YIJ 1;  3CC2 1;  3G6E 1;  2F4M A;  1VQ6 1;  1WCM I;  5T67 A;  3U50 C;  3LUS A;  3KIH A;  3CCM 1;  5A2Q f;  4A3B I;  2QRD B;  1VQN Z;  1YUK A;  2NVY I;  3CCQ Z;  1RO2 A;  4AYB A;  3IR7 A;  3G71 Z;  1YJ9 Z;  1VQ9 Z;  1USP A;  3VTN A;  1VQ4 1;  4A3C I;  1AA6 A;  4MD8 A;  2IZ3 A;  2JA7 I;  2PM9 A;  4E33 A;  3JAM f;  3CME 1;  1VQK Z;  4NBC A;  2IZ4 A;  1KC8 2;  3GTM S;  2V8I A;  1M90 1;  4A3E I;  2G2K A;  3HKZ A;  3I4M I;  1Z01 A;  1Y1W I;  1N8R 2;  4NBA A;  3CCU Z;  1QVG Z;  3EER A;  3T4N B;  2JIP A;  1YI2 1;  3K7A I; 
#chains in the Genus database with same CATH homology
 1Q82 1;  2JNY A;  3NH8 A;  4A3K I;  3TE5 B;  2YU9 I;  4NBH A;  1W2B Z;  1NJI 1;  3CMA 1;  1VQ5 1;  3CD6 Z;  2ZAE B;  1WII A;  4DQY B;  3GKQ A;  1ZB9 A;  2K5R A;  3PO3 I;  2EGT A;  3S16 I;  2QR1 B;  3NH4 A;  4HGZ A;  1K83 I;  4RVD A;  3H0G I;  2Q4Z A;  3J80 b;  3CCL 1;  2BJO A;  1QVG Y;  2GTI A;  1N2F A;  2V8K A;  3FKI I;  3G4S 1;  4BBR I;  1VQ7 Z;  4NBD A;  1K73 1;  2RBL A;  4E2W A;  3MON A;  3CCE Z;  1VQM Z;  3HOZ I;  1X0T A;  1K8A 1;  1VQN 1;  3I56 1;  5C4X I;  3CCQ 1;  5AN9 F;  3G71 1;  1YJ9 1;  2KI7 B;  5D1O B;  1KQS Y;  2RHB A;  1K9M 2;  2O53 A;  3CCJ Z;  3PO2 I;  1L1O C;  5T64 A;  1VQK 1;  3IF8 A;  2PMZ A;  1M1K 1;  1KRL A;  1VQP Z;  4NFR A;  3OW2 Z;  4NBB A;  3CCV Z;  5T6B A;  2KPI A;  1Y1V S;  2R6M A;  3CCU 1;  2O4H A;  1Q86 1;  3S2H I;  2W03 A;  1RNI A;  3VB9 A;  1VQO Z;  2HU9 A;  1QVF Z;  3IFU A;  3CQZ I;  1KD1 2;  2JA8 I;  1JWH C;  3CD6 1;  3RZO I;  3J81 b;  3M4O I;  3CC7 Z;  2JA6 I;  2QEX Z;  3OW2 Y;  3S1R I;  4DGL A;  4Y52 I;  5IT9 b;  2WAQ A;  4NB9 A;  4XX2 A;  1VLA A;  1Z02 A;  4BY1 I;  3IX0 A;  3I4N I;  2QKD A;  4TNU A;  3GTP I;  4E2X A;  3J80 f;  4BBS I;  1DL6 A;  1ZB8 A;  1VQ7 1;  3CCS Z;  3VMI A;  4A3J I;  2DE5 A;  2OTL Z;  2JMO A;  1QVF Y;  3CCE 1;  1WW9 A;  4A3D I;  5D1P A;  2JUB A;  2GU2 A;  4MD7 A;  3CXC Z;  3NDJ A;  2OZK A;  1PFT A;  4HH4 A;  1I3Q I;  3CC4 1;  2PK7 A;  1USP B;  3MZL B;  3CCJ 1;  4MON A;  3TDH B;  3GTQ I;  4RVG A;  3I55 1;  1VQL Z;  2AKL A;  1K8A 2;  2E2H I;  1YIJ Z;  2OOX B;  3CC2 Z;  3G6E Z;  3CCV 1;  1KC8 1;  1NP6 A;  2QA4 Z;  1TWC I;  3BG0 B;  5IP7 I;  3CXC Y;  1TWA I;  4DK1 A;  4BY7 I;  2NVX I;  3HOV I;  3I07 A;  1Q7Y 2;  4MRI A;  2I3C A;  5FLX b;  1W2B Y;  4CL1 A;  4A3F I;  1R9T I;  1QF8 A;  4A3M I;  2M48 A;  3PO3 S;  2RT9 A;  3CC7 1;  1VQ9 1;  3J81 f;  1Q81 1;  3HOX I;  4RS4 A;  1YIT Z;  1Q86 2;  3NH5 A;  4A3G I;  3CPW Z;  1SFO I;  2WB1 A;  2QRC B;  5IT9 f;  2E2I I;  1YJN Z;  3QWU A;  1I6H I;  2H85 A;  1YI2 Z;  1X3W A;  3GTJ I;  2R7Z I;  2LIY A;  3NFZ A;  4E30 A;  3FQQ A;  3CCS 1;  3CMA Z;  1VQ5 Z;  2OTL 1;  2JS4 A;  2HF1 A;  3S14 I;  1S72 Z;  2F4O A;  1ML8 A;  4RV9 A;  3P5J B;  2DE6 A;  1YHQ Z;  2RPR A;  1M90 2;  3GTG I;  1RLY A;  3CPW Y;  2VF1 A;  3GTM I;  3CCL Z;  2J6A A;  3KIF A;  3HOU I;  1K9M 1;  3G4S Z;  1JJ2 Z;  3D6W A;  3CCR Z;  3F3P C;  1Q82 2;  2QA4 1;  2DE7 A;  3VMG A;  2OTJ Z;  1LQL A;  1NJI 2;  1RO4 A;  3I56 Z;  1YJW Z;  3NDI A;  1Z03 A;  4BXX I;  1TWH I;  4X6A I;  2P3Y A;  1VQM 1;  5FLM I;  2LFU A;  5FLX f;  3GTL I;  2R93 I;  3S1Q I;  2Y0S A;  1TFI A;  3VMH A;  4NH1 C;  1JJ2 Y;  4NBE A;  5C3E I;  1KD1 1;  3M3Y I;  1I50 I;  1YIT 1;  1NUI A;  2M6N A;  3F3F C;  1RO0 A;  3HOY I;  2QLV B;  1YJN 1;  1K73 2;  1ZH1 A;  1VQ8 Z;  5IP9 I;  2P28 A;  1VQP 1;  1S7M A;  4HGY A;  4MXU A;  1TWG I;  5A2Q b;  1VQ6 Z;  3CCM Z;  4A3L I;  3GTO I;  1QYP A;  2W04 A;  1Q81 2;  5D1O A;  1S72 1;  1N8R 1;  3D9X A;  1VQO 1;  3S1M I;  1VQ4 Z;  1M1K 2;  4E2Z A;  1KQS Z;  3S1N I;  3JAM b;  2OOY B;  2VUG A;  3RZD I;  4MD9 A;  3CME Z;  1YHQ 1;  4RVF A;  4Y7N I;  3MZK B;  2NVQ I;  2K3R A;  2QEX 1;  3J7A 4;  5LL6 f;  3S17 I;  1Y1V I;  3CCR 1;  4E2Y A;  4QTU A;  3H3V J;  3S2D I;  2RIQ A;  4QTT A;  4A93 I;  2E2J I;  2QRE B;  1YUA A;  2OTJ 1;  5C44 I;  1YJW 1;  4MH4 A;  2E9H A;  3ESW A;  3BG1 B;  3CC4 Z;  4NOZ A;  3GTK I;  1RQF A;  2Q51 A;  1X3Z A;  2R92 I;  4RVH A;  5C4J I;  3I55 Z;  1Q7Y 1;  2GTH A;  3HOW I;  4E31 A;  2B63 I;  2YAD A;  1TWF I;  2JR6 A;  3FQM A;  2V8J A;  3GCF A;  4NBG A;  3EED A;  4E32 A;  3Q87 A;  4S1T A;  1P9N A;  3S15 I;  2JA5 I;  5CM2 M;  2VUM I;  1VQ8 1;  4EWC A;  4NB8 A;  1VQL 1;  4NBF A;  2NVT I;  4A3I I;  1YIJ 1;  3CC2 1;  3G6E 1;  2F4M A;  1VQ6 1;  1WCM I;  5T67 A;  3U50 C;  3LUS A;  3KIH A;  3CCM 1;  5A2Q f;  4A3B I;  2QRD B;  1VQN Z;  1YUK A;  2NVY I;  3CCQ Z;  1RO2 A;  4AYB A;  3G71 Z;  1YJ9 Z;  1VQ9 Z;  1USP A;  3VTN A;  1VQ4 1;  4A3C I;  4MD8 A;  2IZ3 A;  2JA7 I;  2PM9 A;  4E33 A;  3JAM f;  3CME 1;  1VQK Z;  4NBC A;  2IZ4 A;  1KC8 2;  3GTM S;  2V8I A;  1M90 1;  4A3E I;  2G2K A;  3HKZ A;  3I4M I;  1Z01 A;  1Y1W I;  1N8R 2;  4NBA A;  3CCU Z;  1QVG Z;  3EER A;  3T4N B;  1YI2 1;  3K7A I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...