1VQM1

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqm100
1VQOZ 3G711 1K9M2 3CCSZ 1YJNZ 3CPWY 1Q7Y2 3CCV1 1K731 3G6EZ 1QVFY 3CCU1 1W2BZ 1VQK1 1M1K1 3CCR1 1QVGY 3CC41 3I551 3CD6Z 3CPWZ 1Q861 2OTJ1 1Q821 3CCJZ 1VQ6Z 1K8A1 1QVFZ 1NJI2 1KC81 1QVGZ 1N8R2 3CC7Z 1VQMZ 1VQ41 1YIJZ 1YIT1 3I56Z 1VQPZ 1KD11 3CC21 2QEXZ 1Q811 1VQ5Z 3CME1 3CCE1 1VQ7Z 3CMA1 2OTLZ 3CCQ1 3G71Z 1M901 1VQ8Z 2QA41 1YJ91 1VQL1 1VQKZ 3CCM1 3G6E1 3CC4Z 3I55Z 1K732 1YJWZ 1YHQ1 1VQN1 2OTJZ 1M1K2 3CCJ1 1Q862 1JJ2Y 1VQ61 1YI21 1VQ9Z 1Q822 3CCLZ 1K8A2 3OW2Y 1KC82 1VQ4Z 1K9M1 1JJ2Z 1S721 1Q7Y1 3CC2Z 1YIJ1 3G4S1 1VQO1 3CCEZ 3OW2Z 3CCVZ 3CCS1 1YJN1 3CXCY 1KD12 3CCUZ 1Q812 3CCQZ 3CCRZ 1W2BY 2OTL1 1VQ81 1NJI1 3CD61 1VQLZ 3CXCZ 1M902 1N8R1 3CCMZ 1YHQZ 1VQNZ 3CC71 1YJW1 1YITZ 1YI2Z 1VQM1 1KQSY 3I561 1VQP1 3CMEZ 1VQ91 2QEX1 3CCL1 1VQ51 3CMAZ 1VQ71 1S72Z 2QA4Z 1KQSZ 3G4SZ 1YJ9Z
chains in the Genus database with same CATH superfamily
3G711 3CCSZ 3CPWY 1Q7Y2 4XX2A 1Z01A 1WJ2A 2W03A 1M1K1 1QVGY 2JA6I 2PK7A 3I551 3K7AI 3CD6Z 2OTJ1 3CCJZ 1KC81 4NBHA 3HOZI 2VF1A 1N8R2 4TNUA 3S1MI 2V3VA 5D1OA 1VQ41 3NH8A 1YIT1 3I56Z 1VQPZ 1YUAA 1KD11 4Y52I 1VQ5Z 5D1OB 3CCE1 4A3II 1VQ7Z 3CQZI 3CCQ1 3GKQA 2PM9A 2JIOA 1I3QI 3CCM1 3ESWA 3NDIA 2DE7A 1M1K2 1X3WA 3LUSA 3GTJI 2QR1B 1VQ61 2F4MA 3EERA 2M48A 4MXUA 3J80f 1VQ9Z 2AYDA 3S1NI 1KC82 5C4JI 3M3YI 2OZKA 1KRLA 3NDJA 3G4S1 1VQO1 1RO2A 1YJN1 3CXCY 1KD12 2JS4A 4S1TA 5T67A 3CCUZ 2VUGA 3CCRZ 1NP6A 3VMHA 1VQ81 2JUBA 1Z03A 3T4NB 3GTKI 4E2WA 2RBLA 3M4OI 3VMGA 2E7ZA 4X6AI 1YI2Z 3I4MI 1VQM1 3HOYI 2DE5A 3CCL1 3CMAZ 5A2Qf 4DGLA 4E30A 3F3FC 2WAQA 2O53A 1S72Z 3IX0A 2BJOA 1RO0A 1ZH1A 1TFIA 3CCV1 4DQYB 3G6EZ 2JA5I 2QREB 4RV9A 3HOXI 1W2BZ 3S2HI 3CC41 2LFUA 2IZ3A 1Q821 1K8A1 1QVFZ 3PO3S 4HGYA 2Q4ZA 3CC7Z 3IFUA 3I4NI 4NH1C 2NVTI 1P9NA 4AYBA 3S16I 4E2YA 1RO4A 2JA8I 3CC21 2QEXZ 1Q811 3TE5B 3VB9A 1ZB8A 4CL1A 2R93I 1N2FA 4MD7A 5D1PA 4MD9A 5IP9I 2LEXA 1ZB9A 3G71Z 1M901 3FQMA 4NOZA 5FLXf 3S1QI 3I07A 1YJ91 2JIQA 5C44I 1VLAA 1Z02A 4E2XA 2KI7B 3I55Z 1USPA 2NVYI 3VMIA 3J81b 1VQN1 2OTJZ 3GTOI 3TDHB 4NBDA 1USPB 3CCJ1 1AA6A 1Q822 1RLYA 1K8A2 3OW2Y 2K5RA 3PO2I 4NBGA 1VQ4Z 1JJ2Z 4NBBA 1X3ZA 3CCEZ 2OOYB 5LL6f 1QYPA 3RZOI 1Q812 4A3BI 4BXXI 3EEDA 3CCQZ 4A93I 5IT9b 1W2BY 2GTIA 1NJI1 2JR6A 1M902 3S2DI 3CCMZ 4MH4A 4NB9A 1Y1VI 3GTLI 2DE6A 4E2ZA 1ML8A 2K3RA 2PMZA 1I6HI 2YU9I 3D6WA 3HOVI 1KQSY 4E31A 4A3KI 4NBEA 3CMEZ 1VQ91 3U50C 3NH5A 2QA4Z 4QTUA 3G4SZ 2P28A 1VQOZ 3QWUA 2V45A 1YJNZ 1SIWA 3H3VJ 2JIMA 2GTHA 3CCU1 1RQFA 2QKDA 1VQK1 1QXFA 2RT9A 3CCR1 2R7ZI 2NVQI 5IP7I 3CPWZ 1TWAI 1FDOA 3JAMb 2I3CA 2VUMI 1NJI2 5C3EI 2QRCB 1QVGZ 3GCFA 2VPXA 1I50I 1TWFI 5A2Qb 3GTQI 3HKZA 3HOUI 1VQMZ 1YIJZ 5AN9F 2WB1A 5T6BA 2LIYA 2ZAEB 4MONA 1RNIA 2E2II 3D9XA 1JWHC 3CMA1 2JA7I 3GTGI 2OTLZ 5CM2M 3S14I 2G2KA 3S17I 4DK1A 1WW9A 4Y7NI 3BG1B 4NFRA 1VQL1 1TWGI 4A3MI 3G6E1 4RVHA 2EGTA 3CC4Z 3RZDI 4NBFA 1YHQ1 1YJWZ 4RS4A 4RVFA 2H85A 4A3LI 2HF1A 2GU2A 2HU9A 3FKII 1WCMI 1K9M1 4A3GI 3NH4A 2IZ4A 2Y0SA 4QTTA 3CC2Z 2J6AA 3CCS1 4A3JI 4HGZA 2P3YA 2R92I 3KIFA 2VPYA 4E32A 1Q16A 3PO3I 3GTMI 1YUKA 2OOXB 2JIPA 2VPWA 3H0GI 3S15I 3CD61 3CXCZ 2AKLA 1K83I 2R6MA 4EWCA 2NVXI 3VTNA 2RHBA 1VQNZ 3IF8A 3MONA 1YITZ 4A3EI 4HH4A 3I561 1NUIA 1VQP1 4NBCA 1VQ51 3J81f 4BY7I 2O4HA 1DL6A 1VQ71 3GTPI 1S7MA 2NAPA 1Y1VS 2E9HA 2V8KA 2JNYA 2B63I 1K9M2 4BBSI 1SFOI 2V8IA 1K731 1QVFY 4RVDA 2KPIA 3NFZA 3J80b 1Q861 1VQ6Z 1TWHI 4NB8A 1QF8A 2JMOA 4MD8A 5IT9f 3D2LA 1FDIA 4BBRI 1WZNA 5C4XI 4A3DI 2V8JA 4NBAA 3S1RI 1Y1WI 3HOWI 2E2HI 4A3FI 3CME1 3FQQA 3MZLB 2RIQA 1VQ8Z 1L1OC 2QA41 1VQKZ 1LQLA 1PFTA 1K732 4RVGA 1R9TI 5FLMI 1JJ2Y 1Q862 1YI21 3CCLZ 2RPRA 3Q87A 5T64A 2QRDB 3JAMf 3P5JB 1S721 1Q7Y1 1YIJ1 2YADA 2JIRA 3OW2Z 3CCVZ 1X0TA 3J7A4 2QLVB 2IV2X 2VPZA 2OTL1 3MZKB 1WIIA 3BG0B 4BY1I 3KIHA 1VQLZ 1N8R1 4E33A 2F4OA 1YHQZ 2M6NA 3IR7A 2E2JI 3CC71 1YJW1 2Q51A 3F3PC 1TWCI 3GTMS 5FLXb 2QEX1 4A3CI 4MRIA 1Y8CA 1KQSZ 2W04A 1YJ9Z
chains in the Genus database with same CATH topology
3G711 3CCSZ 3CPWY 1Q7Y2 4XX2A 1Z01A 2W03A 1M1K1 1QVGY 2JA6I 2PK7A 3I551 3K7AI 3CD6Z 2OTJ1 3CCJZ 1KC81 4NBHA 3HOZI 2VF1A 1N8R2 4TNUA 3S1MI 5D1OA 1VQ41 3NH8A 1YIT1 3I56Z 1VQPZ 1YUAA 1KD11 4Y52I 1VQ5Z 5D1OB 3CCE1 4A3II 1VQ7Z 3CQZI 3CCQ1 3GKQA 2PM9A 1I3QI 3CCM1 3ESWA 3NDIA 2DE7A 1M1K2 1X3WA 3LUSA 3GTJI 2QR1B 1VQ61 2F4MA 3EERA 2M48A 4MXUA 3J80f 1VQ9Z 3S1NI 1KC82 5C4JI 3M3YI 2OZKA 1KRLA 3NDJA 3G4S1 1VQO1 1RO2A 1YJN1 3CXCY 1KD12 2JS4A 4S1TA 5T67A 3CCUZ 2VUGA 3CCRZ 1NP6A 3VMHA 1VQ81 2JUBA 1Z03A 3T4NB 3GTKI 4E2WA 2RBLA 3M4OI 3VMGA 4X6AI 1YI2Z 3I4MI 1VQM1 3HOYI 2DE5A 3CCL1 3CMAZ 5A2Qf 4DGLA 4E30A 3F3FC 2WAQA 2O53A 1S72Z 3IX0A 2BJOA 1RO0A 1ZH1A 1TFIA 3CCV1 4DQYB 3G6EZ 2JA5I 2QREB 4RV9A 3HOXI 1W2BZ 3S2HI 3CC41 2LFUA 2IZ3A 1Q821 1K8A1 1QVFZ 3PO3S 4HGYA 2Q4ZA 3CC7Z 3IFUA 3I4NI 4NH1C 2NVTI 1P9NA 4AYBA 3S16I 4E2YA 1RO4A 2JA8I 3CC21 2QEXZ 1Q811 3TE5B 3VB9A 1ZB8A 4CL1A 2R93I 1N2FA 4MD7A 5D1PA 4MD9A 5IP9I 1ZB9A 3G71Z 1M901 3FQMA 4NOZA 5FLXf 3S1QI 3I07A 1YJ91 5C44I 1VLAA 1Z02A 4E2XA 2KI7B 3I55Z 1USPA 2NVYI 3VMIA 3J81b 1VQN1 2OTJZ 3GTOI 3TDHB 4NBDA 1USPB 3CCJ1 1Q822 1RLYA 1K8A2 3OW2Y 2K5RA 3PO2I 4NBGA 1VQ4Z 1JJ2Z 4NBBA 1X3ZA 3CCEZ 2OOYB 5LL6f 1QYPA 3RZOI 1Q812 4A3BI 4BXXI 3EEDA 3CCQZ 4A93I 5IT9b 1W2BY 2GTIA 1NJI1 2JR6A 1M902 3S2DI 3CCMZ 4MH4A 4NB9A 1Y1VI 3GTLI 2DE6A 4E2ZA 1ML8A 2K3RA 2PMZA 1I6HI 2YU9I 3D6WA 3HOVI 1KQSY 4E31A 4A3KI 4NBEA 3CMEZ 1VQ91 3U50C 3NH5A 2QA4Z 4QTUA 3G4SZ 2P28A 1VQOZ 3QWUA 1YJNZ 3H3VJ 2GTHA 3CCU1 1RQFA 2QKDA 1VQK1 2RT9A 3CCR1 2R7ZI 2NVQI 5IP7I 3CPWZ 1TWAI 3JAMb 2I3CA 2VUMI 1NJI2 5C3EI 2QRCB 1QVGZ 3GCFA 1I50I 1TWFI 5A2Qb 3GTQI 3HKZA 3HOUI 1VQMZ 1YIJZ 5AN9F 2WB1A 5T6BA 2LIYA 2ZAEB 4MONA 1RNIA 2E2II 3D9XA 1JWHC 3CMA1 2JA7I 3GTGI 2OTLZ 5CM2M 3S14I 2G2KA 3S17I 4DK1A 1WW9A 4Y7NI 3BG1B 4NFRA 1VQL1 1TWGI 4A3MI 3G6E1 4RVHA 2EGTA 3CC4Z 3RZDI 4NBFA 1YHQ1 1YJWZ 4RS4A 4RVFA 2H85A 4A3LI 2HF1A 2GU2A 2HU9A 3FKII 1WCMI 1K9M1 4A3GI 3NH4A 2IZ4A 2Y0SA 4QTTA 3CC2Z 2J6AA 3CCS1 4A3JI 4HGZA 2P3YA 2R92I 3KIFA 4E32A 3PO3I 3GTMI 1YUKA 2OOXB 3H0GI 3S15I 3CD61 3CXCZ 2AKLA 1K83I 2R6MA 4EWCA 2NVXI 3VTNA 2RHBA 1VQNZ 3IF8A 3MONA 1YITZ 4A3EI 4HH4A 3I561 1NUIA 1VQP1 4NBCA 1VQ51 3J81f 4BY7I 2O4HA 1DL6A 1VQ71 3GTPI 1S7MA 1Y1VS 2E9HA 2V8KA 2JNYA 2B63I 1K9M2 4BBSI 1SFOI 2V8IA 1K731 1QVFY 4RVDA 2KPIA 3NFZA 3J80b 1Q861 1VQ6Z 1TWHI 4NB8A 2JMOA 1QF8A 4MD8A 5IT9f 4BBRI 5C4XI 4A3DI 2V8JA 4NBAA 3S1RI 1Y1WI 3HOWI 2E2HI 4A3FI 3CME1 3FQQA 3MZLB 2RIQA 1VQ8Z 1L1OC 2QA41 1VQKZ 1LQLA 1PFTA 1K732 4RVGA 1R9TI 5FLMI 1JJ2Y 1Q862 1YI21 3CCLZ 2RPRA 3Q87A 5T64A 2QRDB 3JAMf 3P5JB 1S721 1Q7Y1 1YIJ1 2YADA 3OW2Z 3CCVZ 1X0TA 3J7A4 2QLVB 2OTL1 3MZKB 1WIIA 3BG0B 4BY1I 3KIHA 1VQLZ 1N8R1 4E33A 2F4OA 1YHQZ 2M6NA 2E2JI 3CC71 1YJW1 2Q51A 3F3PC 1TWCI 3GTMS 5FLXb 2QEX1 4A3CI 4MRIA 1KQSZ 2W04A 1YJ9Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO Z;  3G71 1;  1K9M 2;  3CCS Z;  1YJN Z;  3CPW Y;  1Q7Y 2;  3CCV 1;  1K73 1;  3G6E Z;  1QVF Y;  3CCU 1;  1W2B Z;  1VQK 1;  1M1K 1;  3CCR 1;  1QVG Y;  3CC4 1;  3I55 1;  3CD6 Z;  3CPW Z;  1Q86 1;  2OTJ 1;  1Q82 1;  3CCJ Z;  1VQ6 Z;  1K8A 1;  1QVF Z;  1NJI 2;  1KC8 1;  1QVG Z;  1N8R 2;  3CC7 Z;  1VQM Z;  1VQ4 1;  1YIJ Z;  1YIT 1;  3I56 Z;  1VQP Z;  1KD1 1;  3CC2 1;  2QEX Z;  1Q81 1;  1VQ5 Z;  3CME 1;  3CCE 1;  1VQ7 Z;  3CMA 1;  2OTL Z;  3CCQ 1;  3G71 Z;  1M90 1;  1VQ8 Z;  2QA4 1;  1YJ9 1;  1VQL 1;  1VQK Z;  3CCM 1;  3G6E 1;  3CC4 Z;  3I55 Z;  1K73 2;  1YJW Z;  1YHQ 1;  1VQN 1;  2OTJ Z;  1M1K 2;  3CCJ 1;  1Q86 2;  1JJ2 Y;  1VQ6 1;  1YI2 1;  1VQ9 Z;  1Q82 2;  3CCL Z;  1K8A 2;  3OW2 Y;  1KC8 2;  1VQ4 Z;  1K9M 1;  1JJ2 Z;  1S72 1;  1Q7Y 1;  3CC2 Z;  1YIJ 1;  3G4S 1;  1VQO 1;  3CCE Z;  3OW2 Z;  3CCV Z;  3CCS 1;  1YJN 1;  3CXC Y;  1KD1 2;  3CCU Z;  1Q81 2;  3CCQ Z;  3CCR Z;  1W2B Y;  2OTL 1;  1VQ8 1;  1NJI 1;  3CD6 1;  1VQL Z;  3CXC Z;  1M90 2;  1N8R 1;  3CCM Z;  1YHQ Z;  1VQN Z;  3CC7 1;  1YJW 1;  1YIT Z;  1YI2 Z;  1VQM 1;  1KQS Y;  3I56 1;  1VQP 1;  3CME Z;  1VQ9 1;  2QEX 1;  3CCL 1;  1VQ5 1;  3CMA Z;  1VQ7 1;  1S72 Z;  2QA4 Z;  1KQS Z;  3G4S Z;  1YJ9 Z; 
#chains in the Genus database with same CATH topology
 3G71 1;  3CCS Z;  3CPW Y;  1Q7Y 2;  4XX2 A;  1Z01 A;  1WJ2 A;  2W03 A;  1M1K 1;  1QVG Y;  2JA6 I;  2PK7 A;  3I55 1;  3K7A I;  3CD6 Z;  2OTJ 1;  3CCJ Z;  1KC8 1;  4NBH A;  3HOZ I;  2VF1 A;  1N8R 2;  4TNU A;  3S1M I;  2V3V A;  5D1O A;  1VQ4 1;  3NH8 A;  1YIT 1;  3I56 Z;  1VQP Z;  1YUA A;  1KD1 1;  4Y52 I;  1VQ5 Z;  5D1O B;  3CCE 1;  4A3I I;  1VQ7 Z;  3CQZ I;  3CCQ 1;  3GKQ A;  2PM9 A;  2JIO A;  1I3Q I;  3CCM 1;  3ESW A;  3NDI A;  2DE7 A;  1M1K 2;  1X3W A;  3LUS A;  3GTJ I;  2QR1 B;  1VQ6 1;  2F4M A;  3EER A;  2M48 A;  4MXU A;  3J80 f;  1VQ9 Z;  2AYD A;  3S1N I;  1KC8 2;  5C4J I;  3M3Y I;  2OZK A;  1KRL A;  3NDJ A;  3G4S 1;  1VQO 1;  1RO2 A;  1YJN 1;  3CXC Y;  1KD1 2;  2JS4 A;  4S1T A;  5T67 A;  3CCU Z;  2VUG A;  3CCR Z;  1NP6 A;  3VMH A;  1VQ8 1;  2JUB A;  1Z03 A;  3T4N B;  3GTK I;  4E2W A;  2RBL A;  3M4O I;  3VMG A;  2E7Z A;  4X6A I;  1YI2 Z;  3I4M I;  1VQM 1;  3HOY I;  2DE5 A;  3CCL 1;  3CMA Z;  5A2Q f;  4DGL A;  4E30 A;  3F3F C;  2WAQ A;  2O53 A;  1S72 Z;  3IX0 A;  2BJO A;  1RO0 A;  1ZH1 A;  1TFI A;  3CCV 1;  4DQY B;  3G6E Z;  2JA5 I;  2QRE B;  4RV9 A;  3HOX I;  1W2B Z;  3S2H I;  3CC4 1;  2LFU A;  2IZ3 A;  1Q82 1;  1K8A 1;  1QVF Z;  3PO3 S;  4HGY A;  2Q4Z A;  3CC7 Z;  3IFU A;  3I4N I;  4NH1 C;  2NVT I;  1P9N A;  4AYB A;  3S16 I;  4E2Y A;  1RO4 A;  2JA8 I;  3CC2 1;  2QEX Z;  1Q81 1;  3TE5 B;  3VB9 A;  1ZB8 A;  4CL1 A;  2R93 I;  1N2F A;  4MD7 A;  5D1P A;  4MD9 A;  5IP9 I;  2LEX A;  1ZB9 A;  3G71 Z;  1M90 1;  3FQM A;  4NOZ A;  5FLX f;  3S1Q I;  3I07 A;  1YJ9 1;  2JIQ A;  5C44 I;  1VLA A;  1Z02 A;  4E2X A;  2KI7 B;  3I55 Z;  1USP A;  2NVY I;  3VMI A;  3J81 b;  1VQN 1;  2OTJ Z;  3GTO I;  3TDH B;  4NBD A;  1USP B;  3CCJ 1;  1AA6 A;  1Q82 2;  1RLY A;  1K8A 2;  3OW2 Y;  2K5R A;  3PO2 I;  4NBG A;  1VQ4 Z;  1JJ2 Z;  4NBB A;  1X3Z A;  3CCE Z;  2OOY B;  5LL6 f;  1QYP A;  3RZO I;  1Q81 2;  4A3B I;  4BXX I;  3EED A;  3CCQ Z;  4A93 I;  5IT9 b;  1W2B Y;  2GTI A;  1NJI 1;  2JR6 A;  1M90 2;  3S2D I;  3CCM Z;  4MH4 A;  4NB9 A;  1Y1V I;  3GTL I;  2DE6 A;  4E2Z A;  1ML8 A;  2K3R A;  2PMZ A;  1I6H I;  2YU9 I;  3D6W A;  3HOV I;  1KQS Y;  4E31 A;  4A3K I;  4NBE A;  3CME Z;  1VQ9 1;  3U50 C;  3NH5 A;  2QA4 Z;  4QTU A;  3G4S Z;  2P28 A;  1VQO Z;  3QWU A;  2V45 A;  1YJN Z;  1SIW A;  3H3V J;  2JIM A;  2GTH A;  3CCU 1;  1RQF A;  2QKD A;  1VQK 1;  1QXF A;  2RT9 A;  3CCR 1;  2R7Z I;  2NVQ I;  5IP7 I;  3CPW Z;  1TWA I;  1FDO A;  3JAM b;  2I3C A;  2VUM I;  1NJI 2;  5C3E I;  2QRC B;  1QVG Z;  3GCF A;  2VPX A;  1I50 I;  1TWF I;  5A2Q b;  3GTQ I;  3HKZ A;  3HOU I;  1VQM Z;  1YIJ Z;  5AN9 F;  2WB1 A;  5T6B A;  2LIY A;  2ZAE B;  4MON A;  1RNI A;  2E2I I;  3D9X A;  1JWH C;  3CMA 1;  2JA7 I;  3GTG I;  2OTL Z;  5CM2 M;  3S14 I;  2G2K A;  3S17 I;  4DK1 A;  1WW9 A;  4Y7N I;  3BG1 B;  4NFR A;  1VQL 1;  1TWG I;  4A3M I;  3G6E 1;  4RVH A;  2EGT A;  3CC4 Z;  3RZD I;  4NBF A;  1YHQ 1;  1YJW Z;  4RS4 A;  4RVF A;  2H85 A;  4A3L I;  2HF1 A;  2GU2 A;  2HU9 A;  3FKI I;  1WCM I;  1K9M 1;  4A3G I;  3NH4 A;  2IZ4 A;  2Y0S A;  4QTT A;  3CC2 Z;  2J6A A;  3CCS 1;  4A3J I;  4HGZ A;  2P3Y A;  2R92 I;  3KIF A;  2VPY A;  4E32 A;  1Q16 A;  3PO3 I;  3GTM I;  1YUK A;  2OOX B;  2JIP A;  2VPW A;  3H0G I;  3S15 I;  3CD6 1;  3CXC Z;  2AKL A;  1K83 I;  2R6M A;  4EWC A;  2NVX I;  3VTN A;  2RHB A;  1VQN Z;  3IF8 A;  3MON A;  1YIT Z;  4A3E I;  4HH4 A;  3I56 1;  1NUI A;  1VQP 1;  4NBC A;  1VQ5 1;  3J81 f;  4BY7 I;  2O4H A;  1DL6 A;  1VQ7 1;  3GTP I;  1S7M A;  2NAP A;  1Y1V S;  2E9H A;  2V8K A;  2JNY A;  2B63 I;  1K9M 2;  4BBS I;  1SFO I;  2V8I A;  1K73 1;  1QVF Y;  4RVD A;  2KPI A;  3NFZ A;  3J80 b;  1Q86 1;  1VQ6 Z;  1TWH I;  4NB8 A;  1QF8 A;  2JMO A;  4MD8 A;  5IT9 f;  3D2L A;  1FDI A;  4BBR I;  1WZN A;  5C4X I;  4A3D I;  2V8J A;  4NBA A;  3S1R I;  1Y1W I;  3HOW I;  2E2H I;  4A3F I;  3CME 1;  3FQQ A;  3MZL B;  2RIQ A;  1VQ8 Z;  1L1O C;  2QA4 1;  1VQK Z;  1LQL A;  1PFT A;  1K73 2;  4RVG A;  1R9T I;  5FLM I;  1JJ2 Y;  1Q86 2;  1YI2 1;  3CCL Z;  2RPR A;  3Q87 A;  5T64 A;  2QRD B;  3JAM f;  3P5J B;  1S72 1;  1Q7Y 1;  1YIJ 1;  2YAD A;  2JIR A;  3OW2 Z;  3CCV Z;  1X0T A;  3J7A 4;  2QLV B;  2IV2 X;  2VPZ A;  2OTL 1;  3MZK B;  1WII A;  3BG0 B;  4BY1 I;  3KIH A;  1VQL Z;  1N8R 1;  4E33 A;  2F4O A;  1YHQ Z;  2M6N A;  3IR7 A;  2E2J I;  3CC7 1;  1YJW 1;  2Q51 A;  3F3P C;  1TWC I;  3GTM S;  5FLX b;  2QEX 1;  4A3C I;  4MRI A;  1Y8C A;  1KQS Z;  2W04 A;  1YJ9 Z; 
#chains in the Genus database with same CATH homology
 3G71 1;  3CCS Z;  3CPW Y;  1Q7Y 2;  4XX2 A;  1Z01 A;  2W03 A;  1M1K 1;  1QVG Y;  2JA6 I;  2PK7 A;  3I55 1;  3K7A I;  3CD6 Z;  2OTJ 1;  3CCJ Z;  1KC8 1;  4NBH A;  3HOZ I;  2VF1 A;  1N8R 2;  4TNU A;  3S1M I;  5D1O A;  1VQ4 1;  3NH8 A;  1YIT 1;  3I56 Z;  1VQP Z;  1YUA A;  1KD1 1;  4Y52 I;  1VQ5 Z;  5D1O B;  3CCE 1;  4A3I I;  1VQ7 Z;  3CQZ I;  3CCQ 1;  3GKQ A;  2PM9 A;  1I3Q I;  3CCM 1;  3ESW A;  3NDI A;  2DE7 A;  1M1K 2;  1X3W A;  3LUS A;  3GTJ I;  2QR1 B;  1VQ6 1;  2F4M A;  3EER A;  2M48 A;  4MXU A;  3J80 f;  1VQ9 Z;  3S1N I;  1KC8 2;  5C4J I;  3M3Y I;  2OZK A;  1KRL A;  3NDJ A;  3G4S 1;  1VQO 1;  1RO2 A;  1YJN 1;  3CXC Y;  1KD1 2;  2JS4 A;  4S1T A;  5T67 A;  3CCU Z;  2VUG A;  3CCR Z;  1NP6 A;  3VMH A;  1VQ8 1;  2JUB A;  1Z03 A;  3T4N B;  3GTK I;  4E2W A;  2RBL A;  3M4O I;  3VMG A;  4X6A I;  1YI2 Z;  3I4M I;  1VQM 1;  3HOY I;  2DE5 A;  3CCL 1;  3CMA Z;  5A2Q f;  4DGL A;  4E30 A;  3F3F C;  2WAQ A;  2O53 A;  1S72 Z;  3IX0 A;  2BJO A;  1RO0 A;  1ZH1 A;  1TFI A;  3CCV 1;  4DQY B;  3G6E Z;  2JA5 I;  2QRE B;  4RV9 A;  3HOX I;  1W2B Z;  3S2H I;  3CC4 1;  2LFU A;  2IZ3 A;  1Q82 1;  1K8A 1;  1QVF Z;  3PO3 S;  4HGY A;  2Q4Z A;  3CC7 Z;  3IFU A;  3I4N I;  4NH1 C;  2NVT I;  1P9N A;  4AYB A;  3S16 I;  4E2Y A;  1RO4 A;  2JA8 I;  3CC2 1;  2QEX Z;  1Q81 1;  3TE5 B;  3VB9 A;  1ZB8 A;  4CL1 A;  2R93 I;  1N2F A;  4MD7 A;  5D1P A;  4MD9 A;  5IP9 I;  1ZB9 A;  3G71 Z;  1M90 1;  3FQM A;  4NOZ A;  5FLX f;  3S1Q I;  3I07 A;  1YJ9 1;  5C44 I;  1VLA A;  1Z02 A;  4E2X A;  2KI7 B;  3I55 Z;  1USP A;  2NVY I;  3VMI A;  3J81 b;  1VQN 1;  2OTJ Z;  3GTO I;  3TDH B;  4NBD A;  1USP B;  3CCJ 1;  1Q82 2;  1RLY A;  1K8A 2;  3OW2 Y;  2K5R A;  3PO2 I;  4NBG A;  1VQ4 Z;  1JJ2 Z;  4NBB A;  1X3Z A;  3CCE Z;  2OOY B;  5LL6 f;  1QYP A;  3RZO I;  1Q81 2;  4A3B I;  4BXX I;  3EED A;  3CCQ Z;  4A93 I;  5IT9 b;  1W2B Y;  2GTI A;  1NJI 1;  2JR6 A;  1M90 2;  3S2D I;  3CCM Z;  4MH4 A;  4NB9 A;  1Y1V I;  3GTL I;  2DE6 A;  4E2Z A;  1ML8 A;  2K3R A;  2PMZ A;  1I6H I;  2YU9 I;  3D6W A;  3HOV I;  1KQS Y;  4E31 A;  4A3K I;  4NBE A;  3CME Z;  1VQ9 1;  3U50 C;  3NH5 A;  2QA4 Z;  4QTU A;  3G4S Z;  2P28 A;  1VQO Z;  3QWU A;  1YJN Z;  3H3V J;  2GTH A;  3CCU 1;  1RQF A;  2QKD A;  1VQK 1;  2RT9 A;  3CCR 1;  2R7Z I;  2NVQ I;  5IP7 I;  3CPW Z;  1TWA I;  3JAM b;  2I3C A;  2VUM I;  1NJI 2;  5C3E I;  2QRC B;  1QVG Z;  3GCF A;  1I50 I;  1TWF I;  5A2Q b;  3GTQ I;  3HKZ A;  3HOU I;  1VQM Z;  1YIJ Z;  5AN9 F;  2WB1 A;  5T6B A;  2LIY A;  2ZAE B;  4MON A;  1RNI A;  2E2I I;  3D9X A;  1JWH C;  3CMA 1;  2JA7 I;  3GTG I;  2OTL Z;  5CM2 M;  3S14 I;  2G2K A;  3S17 I;  4DK1 A;  1WW9 A;  4Y7N I;  3BG1 B;  4NFR A;  1VQL 1;  1TWG I;  4A3M I;  3G6E 1;  4RVH A;  2EGT A;  3CC4 Z;  3RZD I;  4NBF A;  1YHQ 1;  1YJW Z;  4RS4 A;  4RVF A;  2H85 A;  4A3L I;  2HF1 A;  2GU2 A;  2HU9 A;  3FKI I;  1WCM I;  1K9M 1;  4A3G I;  3NH4 A;  2IZ4 A;  2Y0S A;  4QTT A;  3CC2 Z;  2J6A A;  3CCS 1;  4A3J I;  4HGZ A;  2P3Y A;  2R92 I;  3KIF A;  4E32 A;  3PO3 I;  3GTM I;  1YUK A;  2OOX B;  3H0G I;  3S15 I;  3CD6 1;  3CXC Z;  2AKL A;  1K83 I;  2R6M A;  4EWC A;  2NVX I;  3VTN A;  2RHB A;  1VQN Z;  3IF8 A;  3MON A;  1YIT Z;  4A3E I;  4HH4 A;  3I56 1;  1NUI A;  1VQP 1;  4NBC A;  1VQ5 1;  3J81 f;  4BY7 I;  2O4H A;  1DL6 A;  1VQ7 1;  3GTP I;  1S7M A;  1Y1V S;  2E9H A;  2V8K A;  2JNY A;  2B63 I;  1K9M 2;  4BBS I;  1SFO I;  2V8I A;  1K73 1;  1QVF Y;  4RVD A;  2KPI A;  3NFZ A;  3J80 b;  1Q86 1;  1VQ6 Z;  1TWH I;  4NB8 A;  2JMO A;  1QF8 A;  4MD8 A;  5IT9 f;  4BBR I;  5C4X I;  4A3D I;  2V8J A;  4NBA A;  3S1R I;  1Y1W I;  3HOW I;  2E2H I;  4A3F I;  3CME 1;  3FQQ A;  3MZL B;  2RIQ A;  1VQ8 Z;  1L1O C;  2QA4 1;  1VQK Z;  1LQL A;  1PFT A;  1K73 2;  4RVG A;  1R9T I;  5FLM I;  1JJ2 Y;  1Q86 2;  1YI2 1;  3CCL Z;  2RPR A;  3Q87 A;  5T64 A;  2QRD B;  3JAM f;  3P5J B;  1S72 1;  1Q7Y 1;  1YIJ 1;  2YAD A;  3OW2 Z;  3CCV Z;  1X0T A;  3J7A 4;  2QLV B;  2OTL 1;  3MZK B;  1WII A;  3BG0 B;  4BY1 I;  3KIH A;  1VQL Z;  1N8R 1;  4E33 A;  2F4O A;  1YHQ Z;  2M6N A;  2E2J I;  3CC7 1;  1YJW 1;  2Q51 A;  3F3P C;  1TWC I;  3GTM S;  5FLX b;  2QEX 1;  4A3C I;  4MRI A;  1KQS Z;  2W04 A;  1YJ9 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...