1VQM1

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqm100
1VQMZ 1VQ81 1Q821 1W2BZ 1YJ9Z 1VQ9Z 1VQ61 1VQKZ 1YJNZ 3CCLZ 2QA4Z 3CC41 3CCQZ 3CCEZ 1Q822 3I55Z 1K8A1 3CC2Z 3CPWZ 3CCM1 1YIJ1 3CD61 1N8R1 1YITZ 2QEXZ 1K8A2 1YJW1 3CCUZ 1VQLZ 1N8R2 3CCV1 1YHQZ 1VQ7Z 3CXCY 1VQP1 1K731 3I56Z 1KD11 1VQ51 3CCSZ 3CC71 1S72Z 1K9M1 1VQM1 1Q861 1K732 3CXCZ 1KD12 1NJI1 1YI2Z 1YJ91 1VQ91 1VQK1 1K9M2 1YJN1 3CCL1 1Q7Y1 1Q862 2QA41 3CCQ1 3CCE1 1NJI2 3I551 3CMEZ 3CC21 3OW2Z 1VQ4Z 1Q7Y2 1VQNZ 1YIT1 2QEX1 3CCU1 1QVFZ 3G71Z 1VQOZ 3CCJZ 1VQL1 1YHQ1 1VQ71 1M1K1 1Q811 3G4SZ 1KC81 3OW2Y 1M1K2 3I561 1QVGY 3CMAZ 3CCS1 2OTLZ 1Q812 1S721 1KC82 1QVFY 1YI21 3G6EZ 1KQSZ 2OTJZ 3CME1 1QVGZ 3CCRZ 1VQ41 1VQ8Z 1VQN1 1JJ2Z 1VQ6Z 3G711 1VQO1 3CCJ1 3CC4Z 3CCMZ 1YIJZ 3CD6Z 1KQSY 3G4S1 1YJWZ 3CMA1 2OTL1 3CCVZ 1JJ2Y 1W2BY 1VQPZ 1M901 3G6E1 1VQ5Z 3CC7Z 2OTJ1 3CPWY 3CCR1 1M902
chains in the Genus database with same CATH superfamily
1VQ81 3M4OI 4QTUA 3TDHB 1W2BZ 1VQ9Z 2VPZA 5FLXf 2QA4Z 3CC41 3GTQI 1K8A1 4RVFA 1NUIA 4MONA 2E2JI 1AA6A 3GTMI 1N8R2 3CXCY 4A3MI 5CM2M 2R6MA 3HOZI 2WAQA 1VQM1 1Q861 3D2LA 2O53A 2Y0SA 3CQZI 3CXCZ 3HKZA 5D1OA 1KD12 3TE5B 2JA5I 4Y52I 4E2ZA 1VQK1 4X6AI 3S14I 5T64A 3GTMS 2LIYA 2M6NA 2GTHA 1YIT1 1QVFZ 1VQOZ 1LQLA 2V45A 1P9NA 1TWHI 2F4OA 3NDIA 2EGTA 1Q16A 3G4SZ 1KC81 2H85A 3OW2Y 3BG1B 5LL6f 2QRCB 2JNYA 3Q87A 1QVGY 4A3BI 1S721 1S7MA 5FLXb 1ZB8A 2HU9A 2YU9I 1KQSZ 1QVGZ 1FDOA 2KI7B 4Y7NI 3GTJI 2Q4ZA 1I3QI 3CCJ1 2M48A 1Z02A 2QR1B 3S16I 2NVTI 3QWUA 5A2Qf 3CD6Z 3F3FC 4A3CI 1USPA 2JIPA 2OOYB 3CMA1 3NDJA 5C4JI 4MD8A 3RZDI 1VQPZ 3G6E1 3MZLB 3GCFA 1WCMI 2P3YA 1WW9A 2JA7I 3FQQA 4A3EI 2QKDA 3J7A4 4E2XA 3T4NB 5IP9I 1Q821 3FKII 3VTNA 1YJ9Z 2AYDA 1VQ61 4NB8A 1YJNZ 3CCLZ 2YADA 2KPIA 1WJ2A 2R93I 3NFZA 3I55Z 3CC2Z 3CCM1 2QEXZ 1K8A2 3CCUZ 3S2HI 3S17I 3CCV1 2K5RA 1VQ7Z 4TNUA 2NVXI 3MONA 4RS4A 3HOVI 3GTOI 1ZH1A 1K731 2DE6A 2RIQA 1VQ51 1X0TA 3CCSZ 3CC71 2V8IA 4MRIA 2PK7A 2I3CA 1NJI1 3EERA 4A3DI 5A2Qb 1Q7Y1 1Q862 2BJOA 3CCQ1 3CCE1 3CMEZ 4HGZA 3PO2I 3KIHA 3HOUI 2JUBA 3VMHA 2V8JA 1VQL1 4A93I 1YHQ1 1Y1VI 1M1K1 5AN9F 4S1TA 5IT9f 4RVDA 3KIFA 5FLMI 3I561 4A3KI 1TWCI 2OTLZ 1KC82 1ZB9A 1QVFY 3NH5A 1PFTA 1YI21 1RQFA 4A3II 2OZKA 1VQ41 1VQ8Z 1VQN1 4NBCA 1TWAI 4E2YA 4E33A 1JJ2Z 3G711 3CC4Z 2R7ZI 3FQMA 3I4MI 2E9HA 4E32A 4NOZA 4MD7A 4NBEA 1KQSY 3S15I 3GTPI 3GTLI 1RO2A 2W04A 4NBDA 1Y1WI 2JIQA 2HF1A 2PM9A 3HOXI 3RZOI 4RVGA 3S1QI 1ML8A 1M901 2V8KA 2R92I 5IP7I 1TWFI 2OTJ1 3CPWY 3CCR1 1VQMZ 5D1OB 1X3WA 4DQYB 1VQKZ 2JS4A 5IT9b 1FDIA 3EEDA 4XX2A 1Q822 3CPWZ 1YIJ1 2NVYI 4E31A 1YITZ 1YJW1 2JIOA 2NVQI 1QYPA 4BBSI 1WZNA 2F4MA 3PO3I 2WB1A 5T6BA 1S72Z 4NBFA 1K9M1 1K732 2K3RA 2IV2X 1QF8A 2JA8I 1VQ91 3D9XA 2QA41 4NBGA 3NH8A 1NJI2 2E2II 1Q7Y2 3M3YI 4AYBA 4HH4A 1YUAA 3ESWA 3CCJZ 3BG0B 1Q811 1M1K2 4BY7I 3CMAZ 3VMGA 3J80f 4EWCA 1RO4A 4BY1I 3K7AI 4QTTA 2QLVB 2OOXB 3G6EZ 2E2HI 3HOWI 1VQ6Z 1VQO1 2E7ZA 3J81f 3JAMf 2B63I 1DL6A 2ZAEB 3CCMZ 2Q51A 2AKLA 1R9TI 3G4S1 2VPXA 1RO0A 3VMIA 3I07A 2P28A 4NH1C 4E2WA 3CCVZ 1JJ2Y 3D6WA 2LEXA 2VF1A 2GU2A 1Z01A 1YUKA 2DE5A 1NP6A 2JIRA 1VQ5Z 3CC7Z 1SFOI 3IR7A 1Y1VS 4A3JI 1M902 4DGLA 1WIIA 3F3PC 3H0GI 4HGYA 2RT9A 4MD9A 1RLYA 1SIWA 2JMOA 3CCEZ 3CCQZ 3S1NI 2IZ3A 2RBLA 3VB9A 1N2FA 3CD61 1N8R1 4A3FI 3J80b 2V3VA 1VQLZ 1YHQZ 3H3VJ 1K83I 2IZ4A 4NBBA 2GTIA 1RNIA 4NBHA 1QXFA 1VQP1 2LFUA 3U50C 2PMZA 4RVHA 2W03A 2JR6A 3I56Z 1KD11 1I6HI 4A3GI 3J81b 2O4HA 3JAMb 1YI2Z 1YJ91 1K9M2 1YJN1 3CCL1 4RV9A 2RPRA 4MXUA 5C44I 3I551 3CC21 3OW2Z 1VQ4Z 2VPWA 1Z03A 1VQNZ 3S2DI 4MH4A 4NBAA 2QEX1 2JA6I 2DE7A 3CCU1 1Y8CA 3G71Z 5C3EI 2VUGA 1VQ71 1TFIA 3LUSA 3IX0A 4BXXI 3S1RI 4NFRA 2G2KA 3CCS1 2JIMA 3IF8A 3NH4A 1Q812 1VLAA 5D1PA 2VUMI 3S1MI 2QRDB 2OTJZ 3CME1 3CCRZ 1TWGI 4CL1A 3P5JB 3PO3S 4NB9A 3MZKB 1I50I 1JWHC 4DK1A 1USPB 2VPYA 1YIJZ 2RHBA 1YJWZ 3IFUA 3GTKI 1X3ZA 1L1OC 2QREB 4E30A 1KRLA 4BBRI 2OTL1 5C4XI 3GKQA 5T67A 1W2BY 3HOYI 3I4NI 2J6AA 4A3LI 3GTGI 2NAPA
chains in the Genus database with same CATH topology
1VQ81 3M4OI 4QTUA 3TDHB 1W2BZ 1VQ9Z 5FLXf 2QA4Z 3CC41 3GTQI 1K8A1 4RVFA 1NUIA 4MONA 2E2JI 3GTMI 1N8R2 3CXCY 4A3MI 5CM2M 2R6MA 3HOZI 2WAQA 1VQM1 1Q861 2O53A 2Y0SA 3CQZI 3CXCZ 3HKZA 5D1OA 1KD12 3TE5B 2JA5I 4Y52I 4E2ZA 1VQK1 4X6AI 3S14I 5T64A 3GTMS 2LIYA 2M6NA 2GTHA 1YIT1 1QVFZ 1VQOZ 1LQLA 1P9NA 1TWHI 2F4OA 3NDIA 2EGTA 3G4SZ 1KC81 2H85A 3OW2Y 3BG1B 5LL6f 2QRCB 2JNYA 3Q87A 1QVGY 4A3BI 1S721 1S7MA 5FLXb 1ZB8A 2HU9A 2YU9I 1KQSZ 1QVGZ 2KI7B 4Y7NI 3GTJI 2Q4ZA 1I3QI 3CCJ1 2M48A 1Z02A 2QR1B 3S16I 2NVTI 3QWUA 5A2Qf 3CD6Z 3F3FC 4A3CI 1USPA 2OOYB 3CMA1 3NDJA 5C4JI 4MD8A 3RZDI 1VQPZ 3G6E1 3MZLB 3GCFA 1WCMI 2P3YA 1WW9A 2JA7I 3FQQA 4A3EI 2QKDA 3J7A4 4E2XA 3T4NB 5IP9I 1Q821 3FKII 3VTNA 1YJ9Z 1VQ61 4NB8A 1YJNZ 3CCLZ 2YADA 2KPIA 2R93I 3NFZA 3I55Z 3CC2Z 3CCM1 2QEXZ 1K8A2 3CCUZ 3S2HI 3S17I 3CCV1 2K5RA 1VQ7Z 4TNUA 2NVXI 3MONA 4RS4A 3HOVI 3GTOI 1ZH1A 1K731 2DE6A 2RIQA 1VQ51 1X0TA 3CCSZ 3CC71 2V8IA 4MRIA 2PK7A 2I3CA 1NJI1 3EERA 4A3DI 5A2Qb 1Q7Y1 1Q862 2BJOA 3CCQ1 3CCE1 3CMEZ 4HGZA 3PO2I 3KIHA 3HOUI 2JUBA 3VMHA 2V8JA 1VQL1 4A93I 1YHQ1 1Y1VI 1M1K1 5AN9F 4S1TA 5IT9f 4RVDA 3KIFA 5FLMI 3I561 4A3KI 1TWCI 2OTLZ 1KC82 1ZB9A 1QVFY 3NH5A 1PFTA 1YI21 1RQFA 4A3II 2OZKA 1VQ41 1VQ8Z 1VQN1 4NBCA 1TWAI 4E2YA 4E33A 1JJ2Z 3G711 3CC4Z 2R7ZI 3FQMA 3I4MI 2E9HA 4E32A 4NOZA 4MD7A 4NBEA 1KQSY 3S15I 3GTPI 3GTLI 1RO2A 2W04A 4NBDA 1Y1WI 2HF1A 2PM9A 3HOXI 3RZOI 4RVGA 3S1QI 1ML8A 1M901 2V8KA 2R92I 5IP7I 1TWFI 2OTJ1 3CPWY 3CCR1 1VQMZ 5D1OB 1X3WA 4DQYB 1VQKZ 2JS4A 5IT9b 3EEDA 4XX2A 1Q822 3CPWZ 1YIJ1 2NVYI 4E31A 1YITZ 1YJW1 2NVQI 1QYPA 4BBSI 2F4MA 3PO3I 2WB1A 5T6BA 1S72Z 4NBFA 1K9M1 1K732 2K3RA 1QF8A 2JA8I 1VQ91 3D9XA 2QA41 4NBGA 3NH8A 1NJI2 2E2II 1Q7Y2 3M3YI 4AYBA 4HH4A 1YUAA 3ESWA 3CCJZ 3BG0B 1Q811 1M1K2 4BY7I 3CMAZ 3VMGA 3J80f 4EWCA 1RO4A 4BY1I 3K7AI 4QTTA 2QLVB 2OOXB 3G6EZ 2E2HI 3HOWI 1VQ6Z 1VQO1 3J81f 3JAMf 2B63I 1DL6A 2ZAEB 3CCMZ 2Q51A 2AKLA 1R9TI 3G4S1 1RO0A 3VMIA 3I07A 2P28A 4NH1C 4E2WA 3CCVZ 1JJ2Y 3D6WA 2VF1A 2GU2A 1Z01A 1YUKA 2DE5A 1NP6A 1VQ5Z 3CC7Z 1SFOI 1Y1VS 4A3JI 1M902 4DGLA 1WIIA 3F3PC 3H0GI 4HGYA 2RT9A 4MD9A 1RLYA 2JMOA 3CCEZ 3CCQZ 3S1NI 2IZ3A 2RBLA 3VB9A 1N2FA 3CD61 1N8R1 4A3FI 3J80b 1VQLZ 1YHQZ 3H3VJ 1K83I 2IZ4A 4NBBA 2GTIA 1RNIA 4NBHA 1VQP1 2LFUA 3U50C 2PMZA 4RVHA 2W03A 2JR6A 3I56Z 1KD11 1I6HI 4A3GI 3J81b 2O4HA 3JAMb 1YI2Z 1YJ91 1K9M2 1YJN1 3CCL1 4RV9A 2RPRA 4MXUA 5C44I 3I551 3CC21 3OW2Z 1VQ4Z 1Z03A 1VQNZ 3S2DI 4MH4A 4NBAA 2QEX1 2JA6I 2DE7A 3CCU1 3G71Z 5C3EI 2VUGA 1VQ71 1TFIA 3LUSA 3IX0A 4BXXI 3S1RI 4NFRA 2G2KA 3CCS1 3NH4A 3IF8A 1Q812 1VLAA 5D1PA 2VUMI 3S1MI 2QRDB 2OTJZ 3CME1 3CCRZ 1TWGI 4CL1A 3P5JB 3PO3S 4NB9A 3MZKB 1I50I 1JWHC 4DK1A 1USPB 1YIJZ 2RHBA 1YJWZ 3IFUA 3GTKI 1X3ZA 1L1OC 2QREB 4E30A 1KRLA 4BBRI 2OTL1 5C4XI 3GKQA 5T67A 1W2BY 3HOYI 3I4NI 2J6AA 4A3LI 3GTGI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM Z;  1VQ8 1;  1Q82 1;  1W2B Z;  1YJ9 Z;  1VQ9 Z;  1VQ6 1;  1VQK Z;  1YJN Z;  3CCL Z;  2QA4 Z;  3CC4 1;  3CCQ Z;  3CCE Z;  1Q82 2;  3I55 Z;  1K8A 1;  3CC2 Z;  3CPW Z;  3CCM 1;  1YIJ 1;  3CD6 1;  1N8R 1;  1YIT Z;  2QEX Z;  1K8A 2;  1YJW 1;  3CCU Z;  1VQL Z;  1N8R 2;  3CCV 1;  1YHQ Z;  1VQ7 Z;  3CXC Y;  1VQP 1;  1K73 1;  3I56 Z;  1KD1 1;  1VQ5 1;  3CCS Z;  3CC7 1;  1S72 Z;  1K9M 1;  1VQM 1;  1Q86 1;  1K73 2;  3CXC Z;  1KD1 2;  1NJI 1;  1YI2 Z;  1YJ9 1;  1VQ9 1;  1VQK 1;  1K9M 2;  1YJN 1;  3CCL 1;  1Q7Y 1;  1Q86 2;  2QA4 1;  3CCQ 1;  3CCE 1;  1NJI 2;  3I55 1;  3CME Z;  3CC2 1;  3OW2 Z;  1VQ4 Z;  1Q7Y 2;  1VQN Z;  1YIT 1;  2QEX 1;  3CCU 1;  1QVF Z;  3G71 Z;  1VQO Z;  3CCJ Z;  1VQL 1;  1YHQ 1;  1VQ7 1;  1M1K 1;  1Q81 1;  3G4S Z;  1KC8 1;  3OW2 Y;  1M1K 2;  3I56 1;  1QVG Y;  3CMA Z;  3CCS 1;  2OTL Z;  1Q81 2;  1S72 1;  1KC8 2;  1QVF Y;  1YI2 1;  3G6E Z;  1KQS Z;  2OTJ Z;  3CME 1;  1QVG Z;  3CCR Z;  1VQ4 1;  1VQ8 Z;  1VQN 1;  1JJ2 Z;  1VQ6 Z;  3G71 1;  1VQO 1;  3CCJ 1;  3CC4 Z;  3CCM Z;  1YIJ Z;  3CD6 Z;  1KQS Y;  3G4S 1;  1YJW Z;  3CMA 1;  2OTL 1;  3CCV Z;  1JJ2 Y;  1W2B Y;  1VQP Z;  1M90 1;  3G6E 1;  1VQ5 Z;  3CC7 Z;  2OTJ 1;  3CPW Y;  3CCR 1;  1M90 2; 
#chains in the Genus database with same CATH topology
 1VQ8 1;  3M4O I;  4QTU A;  3TDH B;  1W2B Z;  1VQ9 Z;  2VPZ A;  5FLX f;  2QA4 Z;  3CC4 1;  3GTQ I;  1K8A 1;  4RVF A;  1NUI A;  4MON A;  2E2J I;  1AA6 A;  3GTM I;  1N8R 2;  3CXC Y;  4A3M I;  5CM2 M;  2R6M A;  3HOZ I;  2WAQ A;  1VQM 1;  1Q86 1;  3D2L A;  2O53 A;  2Y0S A;  3CQZ I;  3CXC Z;  3HKZ A;  5D1O A;  1KD1 2;  3TE5 B;  2JA5 I;  4Y52 I;  4E2Z A;  1VQK 1;  4X6A I;  3S14 I;  5T64 A;  3GTM S;  2LIY A;  2M6N A;  2GTH A;  1YIT 1;  1QVF Z;  1VQO Z;  1LQL A;  2V45 A;  1P9N A;  1TWH I;  2F4O A;  3NDI A;  2EGT A;  1Q16 A;  3G4S Z;  1KC8 1;  2H85 A;  3OW2 Y;  3BG1 B;  5LL6 f;  2QRC B;  2JNY A;  3Q87 A;  1QVG Y;  4A3B I;  1S72 1;  1S7M A;  5FLX b;  1ZB8 A;  2HU9 A;  2YU9 I;  1KQS Z;  1QVG Z;  1FDO A;  2KI7 B;  4Y7N I;  3GTJ I;  2Q4Z A;  1I3Q I;  3CCJ 1;  2M48 A;  1Z02 A;  2QR1 B;  3S16 I;  2NVT I;  3QWU A;  5A2Q f;  3CD6 Z;  3F3F C;  4A3C I;  1USP A;  2JIP A;  2OOY B;  3CMA 1;  3NDJ A;  5C4J I;  4MD8 A;  3RZD I;  1VQP Z;  3G6E 1;  3MZL B;  3GCF A;  1WCM I;  2P3Y A;  1WW9 A;  2JA7 I;  3FQQ A;  4A3E I;  2QKD A;  3J7A 4;  4E2X A;  3T4N B;  5IP9 I;  1Q82 1;  3FKI I;  3VTN A;  1YJ9 Z;  2AYD A;  1VQ6 1;  4NB8 A;  1YJN Z;  3CCL Z;  2YAD A;  2KPI A;  1WJ2 A;  2R93 I;  3NFZ A;  3I55 Z;  3CC2 Z;  3CCM 1;  2QEX Z;  1K8A 2;  3CCU Z;  3S2H I;  3S17 I;  3CCV 1;  2K5R A;  1VQ7 Z;  4TNU A;  2NVX I;  3MON A;  4RS4 A;  3HOV I;  3GTO I;  1ZH1 A;  1K73 1;  2DE6 A;  2RIQ A;  1VQ5 1;  1X0T A;  3CCS Z;  3CC7 1;  2V8I A;  4MRI A;  2PK7 A;  2I3C A;  1NJI 1;  3EER A;  4A3D I;  5A2Q b;  1Q7Y 1;  1Q86 2;  2BJO A;  3CCQ 1;  3CCE 1;  3CME Z;  4HGZ A;  3PO2 I;  3KIH A;  3HOU I;  2JUB A;  3VMH A;  2V8J A;  1VQL 1;  4A93 I;  1YHQ 1;  1Y1V I;  1M1K 1;  5AN9 F;  4S1T A;  5IT9 f;  4RVD A;  3KIF A;  5FLM I;  3I56 1;  4A3K I;  1TWC I;  2OTL Z;  1KC8 2;  1ZB9 A;  1QVF Y;  3NH5 A;  1PFT A;  1YI2 1;  1RQF A;  4A3I I;  2OZK A;  1VQ4 1;  1VQ8 Z;  1VQN 1;  4NBC A;  1TWA I;  4E2Y A;  4E33 A;  1JJ2 Z;  3G71 1;  3CC4 Z;  2R7Z I;  3FQM A;  3I4M I;  2E9H A;  4E32 A;  4NOZ A;  4MD7 A;  4NBE A;  1KQS Y;  3S15 I;  3GTP I;  3GTL I;  1RO2 A;  2W04 A;  4NBD A;  1Y1W I;  2JIQ A;  2HF1 A;  2PM9 A;  3HOX I;  3RZO I;  4RVG A;  3S1Q I;  1ML8 A;  1M90 1;  2V8K A;  2R92 I;  5IP7 I;  1TWF I;  2OTJ 1;  3CPW Y;  3CCR 1;  1VQM Z;  5D1O B;  1X3W A;  4DQY B;  1VQK Z;  2JS4 A;  5IT9 b;  1FDI A;  3EED A;  4XX2 A;  1Q82 2;  3CPW Z;  1YIJ 1;  2NVY I;  4E31 A;  1YIT Z;  1YJW 1;  2JIO A;  2NVQ I;  1QYP A;  4BBS I;  1WZN A;  2F4M A;  3PO3 I;  2WB1 A;  5T6B A;  1S72 Z;  4NBF A;  1K9M 1;  1K73 2;  2K3R A;  2IV2 X;  1QF8 A;  2JA8 I;  1VQ9 1;  3D9X A;  2QA4 1;  4NBG A;  3NH8 A;  1NJI 2;  2E2I I;  1Q7Y 2;  3M3Y I;  4AYB A;  4HH4 A;  1YUA A;  3ESW A;  3CCJ Z;  3BG0 B;  1Q81 1;  1M1K 2;  4BY7 I;  3CMA Z;  3VMG A;  3J80 f;  4EWC A;  1RO4 A;  4BY1 I;  3K7A I;  4QTT A;  2QLV B;  2OOX B;  3G6E Z;  2E2H I;  3HOW I;  1VQ6 Z;  1VQO 1;  2E7Z A;  3J81 f;  3JAM f;  2B63 I;  1DL6 A;  2ZAE B;  3CCM Z;  2Q51 A;  2AKL A;  1R9T I;  3G4S 1;  2VPX A;  1RO0 A;  3VMI A;  3I07 A;  2P28 A;  4NH1 C;  4E2W A;  3CCV Z;  1JJ2 Y;  3D6W A;  2LEX A;  2VF1 A;  2GU2 A;  1Z01 A;  1YUK A;  2DE5 A;  1NP6 A;  2JIR A;  1VQ5 Z;  3CC7 Z;  1SFO I;  3IR7 A;  1Y1V S;  4A3J I;  1M90 2;  4DGL A;  1WII A;  3F3P C;  3H0G I;  4HGY A;  2RT9 A;  4MD9 A;  1RLY A;  1SIW A;  2JMO A;  3CCE Z;  3CCQ Z;  3S1N I;  2IZ3 A;  2RBL A;  3VB9 A;  1N2F A;  3CD6 1;  1N8R 1;  4A3F I;  3J80 b;  2V3V A;  1VQL Z;  1YHQ Z;  3H3V J;  1K83 I;  2IZ4 A;  4NBB A;  2GTI A;  1RNI A;  4NBH A;  1QXF A;  1VQP 1;  2LFU A;  3U50 C;  2PMZ A;  4RVH A;  2W03 A;  2JR6 A;  3I56 Z;  1KD1 1;  1I6H I;  4A3G I;  3J81 b;  2O4H A;  3JAM b;  1YI2 Z;  1YJ9 1;  1K9M 2;  1YJN 1;  3CCL 1;  4RV9 A;  2RPR A;  4MXU A;  5C44 I;  3I55 1;  3CC2 1;  3OW2 Z;  1VQ4 Z;  2VPW A;  1Z03 A;  1VQN Z;  3S2D I;  4MH4 A;  4NBA A;  2QEX 1;  2JA6 I;  2DE7 A;  3CCU 1;  1Y8C A;  3G71 Z;  5C3E I;  2VUG A;  1VQ7 1;  1TFI A;  3LUS A;  3IX0 A;  4BXX I;  3S1R I;  4NFR A;  2G2K A;  3CCS 1;  2JIM A;  3IF8 A;  3NH4 A;  1Q81 2;  1VLA A;  5D1P A;  2VUM I;  3S1M I;  2QRD B;  2OTJ Z;  3CME 1;  3CCR Z;  1TWG I;  4CL1 A;  3P5J B;  3PO3 S;  4NB9 A;  3MZK B;  1I50 I;  1JWH C;  4DK1 A;  1USP B;  2VPY A;  1YIJ Z;  2RHB A;  1YJW Z;  3IFU A;  3GTK I;  1X3Z A;  1L1O C;  2QRE B;  4E30 A;  1KRL A;  4BBR I;  2OTL 1;  5C4X I;  3GKQ A;  5T67 A;  1W2B Y;  3HOY I;  3I4N I;  2J6A A;  4A3L I;  3GTG I;  2NAP A; 
#chains in the Genus database with same CATH homology
 1VQ8 1;  3M4O I;  4QTU A;  3TDH B;  1W2B Z;  1VQ9 Z;  5FLX f;  2QA4 Z;  3CC4 1;  3GTQ I;  1K8A 1;  4RVF A;  1NUI A;  4MON A;  2E2J I;  3GTM I;  1N8R 2;  3CXC Y;  4A3M I;  5CM2 M;  2R6M A;  3HOZ I;  2WAQ A;  1VQM 1;  1Q86 1;  2O53 A;  2Y0S A;  3CQZ I;  3CXC Z;  3HKZ A;  5D1O A;  1KD1 2;  3TE5 B;  2JA5 I;  4Y52 I;  4E2Z A;  1VQK 1;  4X6A I;  3S14 I;  5T64 A;  3GTM S;  2LIY A;  2M6N A;  2GTH A;  1YIT 1;  1QVF Z;  1VQO Z;  1LQL A;  1P9N A;  1TWH I;  2F4O A;  3NDI A;  2EGT A;  3G4S Z;  1KC8 1;  2H85 A;  3OW2 Y;  3BG1 B;  5LL6 f;  2QRC B;  2JNY A;  3Q87 A;  1QVG Y;  4A3B I;  1S72 1;  1S7M A;  5FLX b;  1ZB8 A;  2HU9 A;  2YU9 I;  1KQS Z;  1QVG Z;  2KI7 B;  4Y7N I;  3GTJ I;  2Q4Z A;  1I3Q I;  3CCJ 1;  2M48 A;  1Z02 A;  2QR1 B;  3S16 I;  2NVT I;  3QWU A;  5A2Q f;  3CD6 Z;  3F3F C;  4A3C I;  1USP A;  2OOY B;  3CMA 1;  3NDJ A;  5C4J I;  4MD8 A;  3RZD I;  1VQP Z;  3G6E 1;  3MZL B;  3GCF A;  1WCM I;  2P3Y A;  1WW9 A;  2JA7 I;  3FQQ A;  4A3E I;  2QKD A;  3J7A 4;  4E2X A;  3T4N B;  5IP9 I;  1Q82 1;  3FKI I;  3VTN A;  1YJ9 Z;  1VQ6 1;  4NB8 A;  1YJN Z;  3CCL Z;  2YAD A;  2KPI A;  2R93 I;  3NFZ A;  3I55 Z;  3CC2 Z;  3CCM 1;  2QEX Z;  1K8A 2;  3CCU Z;  3S2H I;  3S17 I;  3CCV 1;  2K5R A;  1VQ7 Z;  4TNU A;  2NVX I;  3MON A;  4RS4 A;  3HOV I;  3GTO I;  1ZH1 A;  1K73 1;  2DE6 A;  2RIQ A;  1VQ5 1;  1X0T A;  3CCS Z;  3CC7 1;  2V8I A;  4MRI A;  2PK7 A;  2I3C A;  1NJI 1;  3EER A;  4A3D I;  5A2Q b;  1Q7Y 1;  1Q86 2;  2BJO A;  3CCQ 1;  3CCE 1;  3CME Z;  4HGZ A;  3PO2 I;  3KIH A;  3HOU I;  2JUB A;  3VMH A;  2V8J A;  1VQL 1;  4A93 I;  1YHQ 1;  1Y1V I;  1M1K 1;  5AN9 F;  4S1T A;  5IT9 f;  4RVD A;  3KIF A;  5FLM I;  3I56 1;  4A3K I;  1TWC I;  2OTL Z;  1KC8 2;  1ZB9 A;  1QVF Y;  3NH5 A;  1PFT A;  1YI2 1;  1RQF A;  4A3I I;  2OZK A;  1VQ4 1;  1VQ8 Z;  1VQN 1;  4NBC A;  1TWA I;  4E2Y A;  4E33 A;  1JJ2 Z;  3G71 1;  3CC4 Z;  2R7Z I;  3FQM A;  3I4M I;  2E9H A;  4E32 A;  4NOZ A;  4MD7 A;  4NBE A;  1KQS Y;  3S15 I;  3GTP I;  3GTL I;  1RO2 A;  2W04 A;  4NBD A;  1Y1W I;  2HF1 A;  2PM9 A;  3HOX I;  3RZO I;  4RVG A;  3S1Q I;  1ML8 A;  1M90 1;  2V8K A;  2R92 I;  5IP7 I;  1TWF I;  2OTJ 1;  3CPW Y;  3CCR 1;  1VQM Z;  5D1O B;  1X3W A;  4DQY B;  1VQK Z;  2JS4 A;  5IT9 b;  3EED A;  4XX2 A;  1Q82 2;  3CPW Z;  1YIJ 1;  2NVY I;  4E31 A;  1YIT Z;  1YJW 1;  2NVQ I;  1QYP A;  4BBS I;  2F4M A;  3PO3 I;  2WB1 A;  5T6B A;  1S72 Z;  4NBF A;  1K9M 1;  1K73 2;  2K3R A;  1QF8 A;  2JA8 I;  1VQ9 1;  3D9X A;  2QA4 1;  4NBG A;  3NH8 A;  1NJI 2;  2E2I I;  1Q7Y 2;  3M3Y I;  4AYB A;  4HH4 A;  1YUA A;  3ESW A;  3CCJ Z;  3BG0 B;  1Q81 1;  1M1K 2;  4BY7 I;  3CMA Z;  3VMG A;  3J80 f;  4EWC A;  1RO4 A;  4BY1 I;  3K7A I;  4QTT A;  2QLV B;  2OOX B;  3G6E Z;  2E2H I;  3HOW I;  1VQ6 Z;  1VQO 1;  3J81 f;  3JAM f;  2B63 I;  1DL6 A;  2ZAE B;  3CCM Z;  2Q51 A;  2AKL A;  1R9T I;  3G4S 1;  1RO0 A;  3VMI A;  3I07 A;  2P28 A;  4NH1 C;  4E2W A;  3CCV Z;  1JJ2 Y;  3D6W A;  2VF1 A;  2GU2 A;  1Z01 A;  1YUK A;  2DE5 A;  1NP6 A;  1VQ5 Z;  3CC7 Z;  1SFO I;  1Y1V S;  4A3J I;  1M90 2;  4DGL A;  1WII A;  3F3P C;  3H0G I;  4HGY A;  2RT9 A;  4MD9 A;  1RLY A;  2JMO A;  3CCE Z;  3CCQ Z;  3S1N I;  2IZ3 A;  2RBL A;  3VB9 A;  1N2F A;  3CD6 1;  1N8R 1;  4A3F I;  3J80 b;  1VQL Z;  1YHQ Z;  3H3V J;  1K83 I;  2IZ4 A;  4NBB A;  2GTI A;  1RNI A;  4NBH A;  1VQP 1;  2LFU A;  3U50 C;  2PMZ A;  4RVH A;  2W03 A;  2JR6 A;  3I56 Z;  1KD1 1;  1I6H I;  4A3G I;  3J81 b;  2O4H A;  3JAM b;  1YI2 Z;  1YJ9 1;  1K9M 2;  1YJN 1;  3CCL 1;  4RV9 A;  2RPR A;  4MXU A;  5C44 I;  3I55 1;  3CC2 1;  3OW2 Z;  1VQ4 Z;  1Z03 A;  1VQN Z;  3S2D I;  4MH4 A;  4NBA A;  2QEX 1;  2JA6 I;  2DE7 A;  3CCU 1;  3G71 Z;  5C3E I;  2VUG A;  1VQ7 1;  1TFI A;  3LUS A;  3IX0 A;  4BXX I;  3S1R I;  4NFR A;  2G2K A;  3CCS 1;  3NH4 A;  3IF8 A;  1Q81 2;  1VLA A;  5D1P A;  2VUM I;  3S1M I;  2QRD B;  2OTJ Z;  3CME 1;  3CCR Z;  1TWG I;  4CL1 A;  3P5J B;  3PO3 S;  4NB9 A;  3MZK B;  1I50 I;  1JWH C;  4DK1 A;  1USP B;  1YIJ Z;  2RHB A;  1YJW Z;  3IFU A;  3GTK I;  1X3Z A;  1L1O C;  2QRE B;  4E30 A;  1KRL A;  4BBR I;  2OTL 1;  5C4X I;  3GKQ A;  5T67 A;  1W2B Y;  3HOY I;  3I4N I;  2J6A A;  4A3L I;  3GTG I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...