3HOXI

Complete rna polymerase ii elongation complex v
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hoxI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hoxI02
4XX2A 3GTJI 3S15I 3S1RI 3D6WA 3EERA 1ML8A 4A3JI 4A3FI 2DE7A 2NVXI 3S16I 2PK7A 3GTOI 3PO3I 3HOVI 2NVYI 2JA6I 2E2II 2K5RA 1X3WA 3GKQA 2E2JI 4A93I 4BBSI 3S2HI 4QTUA 1USPA 3GTPI 4NBCA 2R93I 2JA8I 1TWHI 3S1QI 1Y1VS 1K83I 4A3CI 1TWCI 4MH4A 3M3YI 4Y7NI 4X6AI 4NB9A 1I3QI 4NBAA 3HOWI 5C3EI 5C4XI 3ESWA 4A3EI 4A3II 3GTLI 5C4JI 4BY1I 1I50I 2BJOA 3GTMI 2P3YA 3GTQI 2DE6A 4NBGA 1L1OC 4BY7I 2JA7I 3S17I 3CQZI 1QYPA 3I07A 2JNYA 4A3KI 3K7AI 2R7ZI 1ZB8A 1RLYA 3FKII 2AKLA 1ZB9A 3VB9A 4QTTA 5FLMI 4NOZA 2NVQI 1VLAA 3S2DI 2F4OA 1LQLA 1NUIA 3S1MI 1X3ZA 3I4MI 1RO4A 1TFIA 3RZDI 3PO3S 3Q87A 4NBHA 3PO2I 1N2FA 4NBEA 3VMHA 3VMIA 5IP9I 4NB8A 1I6HI 2NVTI 3RZOI 1WCMI 2R92I 3GTGI 4A3DI 3M4OI 1SFOI 3H3VJ 2B63I 3S14I 4A3MI 2E2HI 2JS4A 3HOYI 2F4MA 2RBLA 4BXXI 4Y52I 1USPB 2DE5A 1TWGI 4A3GI 4NBDA 3GTMS 1PFTA 4A3LI 1R9TI 3GCFA 4A3BI 4BBRI 1Y1VI 5C44I 1TWAI 3S1NI 3LUSA 3VMGA 3HOUI 3H0GI 2J6AA 3HOZI 2JR6A 2HF1A 4NBFA 2KPIA 1WW9A 3U50C 1Y1WI 3HOXI 1DL6A 5CM2M 3I4NI 2JA5I 2VUMI 5IP7I 4NBBA 1TWFI 1YUAA 2YU9I 3GTKI
chains in the Genus database with same CATH superfamily
3BG1B 1RQFA 3EERA 1ML8A 1VQP1 2Q4ZA 3I561 3I56Z 4RVHA 1K731 3PO3I 3HOVI 4MD9A 2G2KA 4RVFA 3CMA1 1RO0A 1Q16A 1K9M1 3VTNA 4BBSI 1YJW1 3S2HI 1USPA 2JA8I 1VQMZ 1TWHI 3I551 5LL6f 3I55Z 2V8IA 3CCL1 3CCLZ 2JIRA 1I3QI 2O53A 3HOWI 3NFZA 5C4XI 2QRCB 3TE5B 3F3FC 3G71Z 1I50I 2P3YA 1VQ9Z 2P28A 4BY7I 4EWCA 1KD12 4TNUA 1ZB8A 1RLYA 1ZB9A 2NVQI 1N8R1 1M902 3S1MI 3G6EZ 1RO4A 1TFIA 3KIHA 3RZDI 1Q811 1VQ7Z 1VQ71 3Q87A 3PO2I 4RV9A 1QVGY 3JAMb 3GTGI 1NJI1 1VQL1 1VQLZ 1Q861 4A3DI 1YIT1 2M6NA 3S14I 2QLVB 1Z01A 4RVDA 2IZ4A 4E33A 1S721 4NBDA 1S72Z 1PFTA 2GU2A 2JMOA 1JJ2Y 4A3LI 2AYDA 4A3BI 1RNIA 5D1PA 3IFUA 3LUSA 3VMGA 3HOUI 1VQO1 1VQOZ 3HOZI 1M1K2 1QVFZ 1WW9A 1Q822 1S7MA 1Y1WI 1DL6A 4HH4A 5CM2M 5D1OB 1ZH1A 3MZKB 4CL1A 3I4NI 2QKDA 5IP7I 4MD8A 3D2LA 4E31A 2YU9I 3GTJI 3S1RI 2QREB 4A3FI 5T67A 2Q51A 3S16I 2PK7A 2NAPA 2VPZA 5A2Qb 2NVYI 3OW2Y 2QRDB 1X3WA 1AA6A 2E2JI 3CPWY 3GTPI 4NBCA 4E2XA 2H85A 2OZKA 4RVGA 2V8JA 3ESWA 2JIOA 1WZNA 1VQN1 1VQNZ 1YJN1 1YJNZ 1RO2A 3NH5A 1YHQZ 4NH1C 1KC82 2QEX1 2QEXZ 3K7AI 3FKII 1KD11 2AKLA 3VB9A 4NOZA 1VLAA 1VQM1 3S2DI 2F4OA 3CCEZ 3I4MI 1M901 1K8A1 5T64A 2IV2X 3VMIA 2PM9A 3G4S1 1KQSY 3G4SZ 3G711 2E9HA 5FLXb 1VQ91 1WCMI 2R92I 2IZ3A 2R6MA 3M4OI 3JAMf 1KRLA 3H3VJ 2B63I 4A3MI 1W2BY 2VPWA 3CCR1 4Y52I 3CCRZ 1Q7Y2 1WIIA 1TWGI 4A3GI 3GTMS 4DK1A 1R9TI 3HKZA 3G6E1 2RIQA 2PMZA 5IT9b 3S1NI 2LIYA 2OOXB 3H0GI 1VQ4Z 4HGZA 2JR6A 2LFUA 2HF1A 2M48A 4E30A 5T6BA 3HOXI 1M1K1 3CXCY 1Q821 3FQQA 2VUMI 1Y8CA 1VQ81 1VQ8Z 3TDHB 3BG0B 4MONA 4NBBA 1YUAA 2K3RA 2GTIA 1WJ2A 3S15I 3CCQZ 3D6WA 3CCMZ 2NVXI 2OTL1 2V8KA 3CC21 3CC2Z 2OTLZ 3GTOI 1SIWA 3CD6Z 3P5JB 1FDIA 2JA6I 2VF1A 3CCSZ 2K5RA 1YUKA 5A2Qf 2KI7B 4A93I 2VPYA 3F3PC 3NH4A 3CC4Z 3S1QI 1Y1VS 4HGYA 1TWCI 4A3CI 4MH4A 3M3YI 4Y7NI 4X6AI 4NB9A 3CME1 3CMEZ 5C3EI 1VQ6Z 4E2WA 2QA41 2QA4Z 5C4JI 2BJOA 2E7ZA 3GTQI 2DE6A 4NBGA 4E2ZA 2W04A 4DGLA 2V3VA 2JIQA 3CCUZ 1KC81 1QVGZ 1LQLA 1NUIA 1NP6A 2O4HA 1X3ZA 3PO3S 2RPRA 4NBEA 2JIPA 5IP9I 4NB8A 1I6HI 3RZOI 1JWHC 5FLXf 1JJ2Z 1SFOI 1YHQ1 3MZLB 2E2HI 4AYBA 1FDOA 3HOYI 2F4MA 5D1OA 2RBLA 3D9XA 3J7A4 2V45A 3CCE1 4MD7A 1Q7Y1 3GCFA 4RS4A 5C44I 1VQPZ 5IT9f 3IF8A 4NBFA 2KPIA 3J81b 3U50C 3CMAZ 3QWUA 3J80f 2Y0SA 1YJWZ 2RT9A 5AN9F 4MRIA 1VQ51 1TWFI 1VQ5Z 1QVFY 3OW2Z 3GTKI 4XX2A 4A3JI 1K732 2DE7A 3CPWZ 2JIMA 1VQ41 1K9M2 2E2II 3J80b 2WB1A 3GKQA 1Z03A 4QTUA 2R93I 1K8A2 1K83I 2JUBA 4NBAA 3EEDA 4A3EI 4A3II 3CCQ1 1Z02A 1P9NA 3GTLI 4BY1I 3CCM1 3GTMI 1L1OC 1YITZ 3CD61 3CCJ1 2JA7I 3CCJZ 2VPXA 3S17I 3CQZI 1QYPA 3CCS1 3I07A 2JNYA 4A3KI 2YADA 2R7ZI 1N8R2 5FLMI 4QTTA 1KQSZ 3IR7A 3CC41 1Q812 2RHBA 4E2YA 4NBHA 1VQK1 1VQ61 1VQKZ 1W2BZ 1N2FA 1X0TA 3VMHA 1NJI2 1Q862 2QR1B 2NVTI 2GTHA 3KIFA 4MXUA 2OTJ1 2OTJZ 2EGTA 2I3CA 3MONA 3CC71 3CC7Z 3FQMA 1YIJ1 3T4NB 1YIJZ 2JS4A 3CCU1 3NDJA 1USPB 2DE5A 2WAQA 2ZAEB 1YJ91 1YJ9Z 3CCV1 3CCVZ 4BBRI 3NH8A 2W03A 1QXFA 1Y1VI 2VUGA 3CXCZ 1TWAI 4E32A 2J6AA 3NDIA 2LEXA 4S1TA 4DQYB 1YI21 1YI2Z 3J81f 4NFRA 2JA5I 3IX0A 1QF8A 2OOYB 2HU9A 4BXXI
chains in the Genus database with same CATH topology
3BG1B 1RQFA 3EERA 1ML8A 1VQP1 2Q4ZA 3I561 3I56Z 4RVHA 1K731 3PO3I 3HOVI 4MD9A 2G2KA 4RVFA 3CMA1 1RO0A 1K9M1 3VTNA 4BBSI 1YJW1 3S2HI 1USPA 2JA8I 1VQMZ 1TWHI 3I551 5LL6f 3I55Z 2V8IA 3CCL1 3CCLZ 1I3QI 2O53A 3HOWI 3NFZA 5C4XI 2QRCB 3TE5B 3F3FC 3G71Z 1I50I 2P3YA 1VQ9Z 2P28A 4BY7I 4EWCA 1KD12 4TNUA 1ZB8A 1RLYA 1ZB9A 2NVQI 1N8R1 1M902 3S1MI 3G6EZ 1RO4A 1TFIA 3KIHA 3RZDI 1Q811 1VQ7Z 1VQ71 3Q87A 3PO2I 4RV9A 1QVGY 3JAMb 3GTGI 1NJI1 1VQL1 1VQLZ 1Q861 4A3DI 1YIT1 2M6NA 3S14I 2QLVB 1Z01A 4RVDA 2IZ4A 4E33A 1S721 4NBDA 1S72Z 1PFTA 2GU2A 2JMOA 1JJ2Y 4A3LI 4A3BI 1RNIA 5D1PA 3IFUA 3LUSA 3VMGA 3HOUI 1VQO1 1VQOZ 3HOZI 1M1K2 1QVFZ 1WW9A 1Q822 1S7MA 1Y1WI 1DL6A 4HH4A 5CM2M 5D1OB 1ZH1A 3MZKB 4CL1A 3I4NI 2QKDA 5IP7I 4MD8A 4E31A 2YU9I 3GTJI 3S1RI 2QREB 4A3FI 5T67A 2Q51A 3S16I 2PK7A 5A2Qb 2NVYI 3OW2Y 2QRDB 1X3WA 2E2JI 3CPWY 3GTPI 4NBCA 4E2XA 2H85A 2OZKA 4RVGA 2V8JA 3ESWA 1VQN1 1VQNZ 1YJN1 1YJNZ 1RO2A 3NH5A 1YHQZ 4NH1C 1KC82 2QEX1 2QEXZ 3K7AI 3FKII 1KD11 2AKLA 3VB9A 4NOZA 1VLAA 1VQM1 3S2DI 2F4OA 3CCEZ 3I4MI 1M901 1K8A1 5T64A 3VMIA 2PM9A 3G4S1 1KQSY 3G4SZ 3G711 2E9HA 5FLXb 1VQ91 1WCMI 2R92I 2IZ3A 2R6MA 3M4OI 3JAMf 1KRLA 3H3VJ 2B63I 4A3MI 1W2BY 3CCR1 4Y52I 3CCRZ 1Q7Y2 1WIIA 1TWGI 4A3GI 3GTMS 4DK1A 1R9TI 3HKZA 3G6E1 2RIQA 2PMZA 5IT9b 3S1NI 2LIYA 2OOXB 3H0GI 1VQ4Z 4HGZA 2JR6A 2LFUA 2HF1A 2M48A 4E30A 5T6BA 3HOXI 1M1K1 3CXCY 1Q821 3FQQA 2VUMI 1VQ81 1VQ8Z 3TDHB 3BG0B 4MONA 4NBBA 1YUAA 2K3RA 2GTIA 3S15I 3CCQZ 3D6WA 3CCMZ 2NVXI 2OTL1 2V8KA 3CC21 3CC2Z 2OTLZ 3GTOI 3CD6Z 3P5JB 2JA6I 2VF1A 3CCSZ 2K5RA 1YUKA 5A2Qf 2KI7B 4A93I 3F3PC 3NH4A 3CC4Z 3S1QI 1Y1VS 4HGYA 1TWCI 4A3CI 4MH4A 3M3YI 4Y7NI 4X6AI 4NB9A 3CME1 3CMEZ 5C3EI 1VQ6Z 4E2WA 2QA41 2QA4Z 5C4JI 2BJOA 3GTQI 2DE6A 4NBGA 4E2ZA 2W04A 4DGLA 3CCUZ 1KC81 1QVGZ 1LQLA 1NUIA 1NP6A 2O4HA 1X3ZA 3PO3S 2RPRA 4NBEA 5IP9I 4NB8A 1I6HI 3RZOI 1JWHC 5FLXf 1JJ2Z 1SFOI 1YHQ1 3MZLB 2E2HI 4AYBA 3HOYI 2F4MA 5D1OA 2RBLA 3D9XA 3J7A4 3CCE1 4MD7A 1Q7Y1 3GCFA 4RS4A 5C44I 1VQPZ 5IT9f 3IF8A 4NBFA 2KPIA 3J81b 3U50C 3CMAZ 3QWUA 3J80f 2Y0SA 1YJWZ 2RT9A 5AN9F 4MRIA 1VQ51 1TWFI 1VQ5Z 1QVFY 3OW2Z 3GTKI 4XX2A 4A3JI 1K732 2DE7A 3CPWZ 1VQ41 1K9M2 2E2II 3J80b 2WB1A 3GKQA 1Z03A 4QTUA 2R93I 1K8A2 1K83I 2JUBA 4NBAA 3EEDA 4A3EI 4A3II 3CCQ1 1Z02A 1P9NA 3GTLI 4BY1I 3CCM1 3GTMI 1L1OC 1YITZ 3CD61 3CCJ1 2JA7I 3CCJZ 3S17I 3CQZI 1QYPA 3CCS1 3I07A 2JNYA 4A3KI 2YADA 2R7ZI 1N8R2 5FLMI 4QTTA 1KQSZ 3CC41 1Q812 2RHBA 4E2YA 4NBHA 1VQK1 1VQ61 1VQKZ 1W2BZ 1N2FA 1X0TA 3VMHA 1NJI2 1Q862 2QR1B 2NVTI 2GTHA 3KIFA 4MXUA 2OTJ1 2OTJZ 2EGTA 2I3CA 3MONA 3CC71 3CC7Z 3FQMA 1YIJ1 3T4NB 1YIJZ 2JS4A 3CCU1 3NDJA 1USPB 2DE5A 2WAQA 2ZAEB 1YJ91 1YJ9Z 3CCV1 3CCVZ 4BBRI 3NH8A 2W03A 1Y1VI 2VUGA 3CXCZ 1TWAI 4E32A 2J6AA 3NDIA 4S1TA 4DQYB 1YI21 1YI2Z 3J81f 4NFRA 2JA5I 3IX0A 1QF8A 2OOYB 2HU9A 4BXXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XX2 A;  3GTJ I;  3S15 I;  3S1R I;  3D6W A;  3EER A;  1ML8 A;  4A3J I;  4A3F I;  2DE7 A;  2NVX I;  3S16 I;  2PK7 A;  3GTO I;  3PO3 I;  3HOV I;  2NVY I;  2JA6 I;  2E2I I;  2K5R A;  1X3W A;  3GKQ A;  2E2J I;  4A93 I;  4BBS I;  3S2H I;  4QTU A;  1USP A;  3GTP I;  4NBC A;  2R93 I;  2JA8 I;  1TWH I;  3S1Q I;  1Y1V S;  1K83 I;  4A3C I;  1TWC I;  4MH4 A;  3M3Y I;  4Y7N I;  4X6A I;  4NB9 A;  1I3Q I;  4NBA A;  3HOW I;  5C3E I;  5C4X I;  3ESW A;  4A3E I;  4A3I I;  3GTL I;  5C4J I;  4BY1 I;  1I50 I;  2BJO A;  3GTM I;  2P3Y A;  3GTQ I;  2DE6 A;  4NBG A;  1L1O C;  4BY7 I;  2JA7 I;  3S17 I;  3CQZ I;  1QYP A;  3I07 A;  2JNY A;  4A3K I;  3K7A I;  2R7Z I;  1ZB8 A;  1RLY A;  3FKI I;  2AKL A;  1ZB9 A;  3VB9 A;  4QTT A;  5FLM I;  4NOZ A;  2NVQ I;  1VLA A;  3S2D I;  2F4O A;  1LQL A;  1NUI A;  3S1M I;  1X3Z A;  3I4M I;  1RO4 A;  1TFI A;  3RZD I;  3PO3 S;  3Q87 A;  4NBH A;  3PO2 I;  1N2F A;  4NBE A;  3VMH A;  3VMI A;  5IP9 I;  4NB8 A;  1I6H I;  2NVT I;  3RZO I;  1WCM I;  2R92 I;  3GTG I;  4A3D I;  3M4O I;  1SFO I;  3H3V J;  2B63 I;  3S14 I;  4A3M I;  2E2H I;  2JS4 A;  3HOY I;  2F4M A;  2RBL A;  4BXX I;  4Y52 I;  1USP B;  2DE5 A;  1TWG I;  4A3G I;  4NBD A;  3GTM S;  1PFT A;  4A3L I;  1R9T I;  3GCF A;  4A3B I;  4BBR I;  1Y1V I;  5C44 I;  1TWA I;  3S1N I;  3LUS A;  3VMG A;  3HOU I;  3H0G I;  2J6A A;  3HOZ I;  2JR6 A;  2HF1 A;  4NBF A;  2KPI A;  1WW9 A;  3U50 C;  1Y1W I;  3HOX I;  1DL6 A;  5CM2 M;  3I4N I;  2JA5 I;  2VUM I;  5IP7 I;  4NBB A;  1TWF I;  1YUA A;  2YU9 I;  3GTK I; 
#chains in the Genus database with same CATH topology
 3BG1 B;  1RQF A;  3EER A;  1ML8 A;  1VQP 1;  2Q4Z A;  3I56 1;  3I56 Z;  4RVH A;  1K73 1;  3PO3 I;  3HOV I;  4MD9 A;  2G2K A;  4RVF A;  3CMA 1;  1RO0 A;  1Q16 A;  1K9M 1;  3VTN A;  4BBS I;  1YJW 1;  3S2H I;  1USP A;  2JA8 I;  1VQM Z;  1TWH I;  3I55 1;  5LL6 f;  3I55 Z;  2V8I A;  3CCL 1;  3CCL Z;  2JIR A;  1I3Q I;  2O53 A;  3HOW I;  3NFZ A;  5C4X I;  2QRC B;  3TE5 B;  3F3F C;  3G71 Z;  1I50 I;  2P3Y A;  1VQ9 Z;  2P28 A;  4BY7 I;  4EWC A;  1KD1 2;  4TNU A;  1ZB8 A;  1RLY A;  1ZB9 A;  2NVQ I;  1N8R 1;  1M90 2;  3S1M I;  3G6E Z;  1RO4 A;  1TFI A;  3KIH A;  3RZD I;  1Q81 1;  1VQ7 Z;  1VQ7 1;  3Q87 A;  3PO2 I;  4RV9 A;  1QVG Y;  3JAM b;  3GTG I;  1NJI 1;  1VQL 1;  1VQL Z;  1Q86 1;  4A3D I;  1YIT 1;  2M6N A;  3S14 I;  2QLV B;  1Z01 A;  4RVD A;  2IZ4 A;  4E33 A;  1S72 1;  4NBD A;  1S72 Z;  1PFT A;  2GU2 A;  2JMO A;  1JJ2 Y;  4A3L I;  2AYD A;  4A3B I;  1RNI A;  5D1P A;  3IFU A;  3LUS A;  3VMG A;  3HOU I;  1VQO 1;  1VQO Z;  3HOZ I;  1M1K 2;  1QVF Z;  1WW9 A;  1Q82 2;  1S7M A;  1Y1W I;  1DL6 A;  4HH4 A;  5CM2 M;  5D1O B;  1ZH1 A;  3MZK B;  4CL1 A;  3I4N I;  2QKD A;  5IP7 I;  4MD8 A;  3D2L A;  4E31 A;  2YU9 I;  3GTJ I;  3S1R I;  2QRE B;  4A3F I;  5T67 A;  2Q51 A;  3S16 I;  2PK7 A;  2NAP A;  2VPZ A;  5A2Q b;  2NVY I;  3OW2 Y;  2QRD B;  1X3W A;  1AA6 A;  2E2J I;  3CPW Y;  3GTP I;  4NBC A;  4E2X A;  2H85 A;  2OZK A;  4RVG A;  2V8J A;  3ESW A;  2JIO A;  1WZN A;  1VQN 1;  1VQN Z;  1YJN 1;  1YJN Z;  1RO2 A;  3NH5 A;  1YHQ Z;  4NH1 C;  1KC8 2;  2QEX 1;  2QEX Z;  3K7A I;  3FKI I;  1KD1 1;  2AKL A;  3VB9 A;  4NOZ A;  1VLA A;  1VQM 1;  3S2D I;  2F4O A;  3CCE Z;  3I4M I;  1M90 1;  1K8A 1;  5T64 A;  2IV2 X;  3VMI A;  2PM9 A;  3G4S 1;  1KQS Y;  3G4S Z;  3G71 1;  2E9H A;  5FLX b;  1VQ9 1;  1WCM I;  2R92 I;  2IZ3 A;  2R6M A;  3M4O I;  3JAM f;  1KRL A;  3H3V J;  2B63 I;  4A3M I;  1W2B Y;  2VPW A;  3CCR 1;  4Y52 I;  3CCR Z;  1Q7Y 2;  1WII A;  1TWG I;  4A3G I;  3GTM S;  4DK1 A;  1R9T I;  3HKZ A;  3G6E 1;  2RIQ A;  2PMZ A;  5IT9 b;  3S1N I;  2LIY A;  2OOX B;  3H0G I;  1VQ4 Z;  4HGZ A;  2JR6 A;  2LFU A;  2HF1 A;  2M48 A;  4E30 A;  5T6B A;  3HOX I;  1M1K 1;  3CXC Y;  1Q82 1;  3FQQ A;  2VUM I;  1Y8C A;  1VQ8 1;  1VQ8 Z;  3TDH B;  3BG0 B;  4MON A;  4NBB A;  1YUA A;  2K3R A;  2GTI A;  1WJ2 A;  3S15 I;  3CCQ Z;  3D6W A;  3CCM Z;  2NVX I;  2OTL 1;  2V8K A;  3CC2 1;  3CC2 Z;  2OTL Z;  3GTO I;  1SIW A;  3CD6 Z;  3P5J B;  1FDI A;  2JA6 I;  2VF1 A;  3CCS Z;  2K5R A;  1YUK A;  5A2Q f;  2KI7 B;  4A93 I;  2VPY A;  3F3P C;  3NH4 A;  3CC4 Z;  3S1Q I;  1Y1V S;  4HGY A;  1TWC I;  4A3C I;  4MH4 A;  3M3Y I;  4Y7N I;  4X6A I;  4NB9 A;  3CME 1;  3CME Z;  5C3E I;  1VQ6 Z;  4E2W A;  2QA4 1;  2QA4 Z;  5C4J I;  2BJO A;  2E7Z A;  3GTQ I;  2DE6 A;  4NBG A;  4E2Z A;  2W04 A;  4DGL A;  2V3V A;  2JIQ A;  3CCU Z;  1KC8 1;  1QVG Z;  1LQL A;  1NUI A;  1NP6 A;  2O4H A;  1X3Z A;  3PO3 S;  2RPR A;  4NBE A;  2JIP A;  5IP9 I;  4NB8 A;  1I6H I;  3RZO I;  1JWH C;  5FLX f;  1JJ2 Z;  1SFO I;  1YHQ 1;  3MZL B;  2E2H I;  4AYB A;  1FDO A;  3HOY I;  2F4M A;  5D1O A;  2RBL A;  3D9X A;  3J7A 4;  2V45 A;  3CCE 1;  4MD7 A;  1Q7Y 1;  3GCF A;  4RS4 A;  5C44 I;  1VQP Z;  5IT9 f;  3IF8 A;  4NBF A;  2KPI A;  3J81 b;  3U50 C;  3CMA Z;  3QWU A;  3J80 f;  2Y0S A;  1YJW Z;  2RT9 A;  5AN9 F;  4MRI A;  1VQ5 1;  1TWF I;  1VQ5 Z;  1QVF Y;  3OW2 Z;  3GTK I;  4XX2 A;  4A3J I;  1K73 2;  2DE7 A;  3CPW Z;  2JIM A;  1VQ4 1;  1K9M 2;  2E2I I;  3J80 b;  2WB1 A;  3GKQ A;  1Z03 A;  4QTU A;  2R93 I;  1K8A 2;  1K83 I;  2JUB A;  4NBA A;  3EED A;  4A3E I;  4A3I I;  3CCQ 1;  1Z02 A;  1P9N A;  3GTL I;  4BY1 I;  3CCM 1;  3GTM I;  1L1O C;  1YIT Z;  3CD6 1;  3CCJ 1;  2JA7 I;  3CCJ Z;  2VPX A;  3S17 I;  3CQZ I;  1QYP A;  3CCS 1;  3I07 A;  2JNY A;  4A3K I;  2YAD A;  2R7Z I;  1N8R 2;  5FLM I;  4QTT A;  1KQS Z;  3IR7 A;  3CC4 1;  1Q81 2;  2RHB A;  4E2Y A;  4NBH A;  1VQK 1;  1VQ6 1;  1VQK Z;  1W2B Z;  1N2F A;  1X0T A;  3VMH A;  1NJI 2;  1Q86 2;  2QR1 B;  2NVT I;  2GTH A;  3KIF A;  4MXU A;  2OTJ 1;  2OTJ Z;  2EGT A;  2I3C A;  3MON A;  3CC7 1;  3CC7 Z;  3FQM A;  1YIJ 1;  3T4N B;  1YIJ Z;  2JS4 A;  3CCU 1;  3NDJ A;  1USP B;  2DE5 A;  2WAQ A;  2ZAE B;  1YJ9 1;  1YJ9 Z;  3CCV 1;  3CCV Z;  4BBR I;  3NH8 A;  2W03 A;  1QXF A;  1Y1V I;  2VUG A;  3CXC Z;  1TWA I;  4E32 A;  2J6A A;  3NDI A;  2LEX A;  4S1T A;  4DQY B;  1YI2 1;  1YI2 Z;  3J81 f;  4NFR A;  2JA5 I;  3IX0 A;  1QF8 A;  2OOY B;  2HU9 A;  4BXX I; 
#chains in the Genus database with same CATH homology
 3BG1 B;  1RQF A;  3EER A;  1ML8 A;  1VQP 1;  2Q4Z A;  3I56 1;  3I56 Z;  4RVH A;  1K73 1;  3PO3 I;  3HOV I;  4MD9 A;  2G2K A;  4RVF A;  3CMA 1;  1RO0 A;  1K9M 1;  3VTN A;  4BBS I;  1YJW 1;  3S2H I;  1USP A;  2JA8 I;  1VQM Z;  1TWH I;  3I55 1;  5LL6 f;  3I55 Z;  2V8I A;  3CCL 1;  3CCL Z;  1I3Q I;  2O53 A;  3HOW I;  3NFZ A;  5C4X I;  2QRC B;  3TE5 B;  3F3F C;  3G71 Z;  1I50 I;  2P3Y A;  1VQ9 Z;  2P28 A;  4BY7 I;  4EWC A;  1KD1 2;  4TNU A;  1ZB8 A;  1RLY A;  1ZB9 A;  2NVQ I;  1N8R 1;  1M90 2;  3S1M I;  3G6E Z;  1RO4 A;  1TFI A;  3KIH A;  3RZD I;  1Q81 1;  1VQ7 Z;  1VQ7 1;  3Q87 A;  3PO2 I;  4RV9 A;  1QVG Y;  3JAM b;  3GTG I;  1NJI 1;  1VQL 1;  1VQL Z;  1Q86 1;  4A3D I;  1YIT 1;  2M6N A;  3S14 I;  2QLV B;  1Z01 A;  4RVD A;  2IZ4 A;  4E33 A;  1S72 1;  4NBD A;  1S72 Z;  1PFT A;  2GU2 A;  2JMO A;  1JJ2 Y;  4A3L I;  4A3B I;  1RNI A;  5D1P A;  3IFU A;  3LUS A;  3VMG A;  3HOU I;  1VQO 1;  1VQO Z;  3HOZ I;  1M1K 2;  1QVF Z;  1WW9 A;  1Q82 2;  1S7M A;  1Y1W I;  1DL6 A;  4HH4 A;  5CM2 M;  5D1O B;  1ZH1 A;  3MZK B;  4CL1 A;  3I4N I;  2QKD A;  5IP7 I;  4MD8 A;  4E31 A;  2YU9 I;  3GTJ I;  3S1R I;  2QRE B;  4A3F I;  5T67 A;  2Q51 A;  3S16 I;  2PK7 A;  5A2Q b;  2NVY I;  3OW2 Y;  2QRD B;  1X3W A;  2E2J I;  3CPW Y;  3GTP I;  4NBC A;  4E2X A;  2H85 A;  2OZK A;  4RVG A;  2V8J A;  3ESW A;  1VQN 1;  1VQN Z;  1YJN 1;  1YJN Z;  1RO2 A;  3NH5 A;  1YHQ Z;  4NH1 C;  1KC8 2;  2QEX 1;  2QEX Z;  3K7A I;  3FKI I;  1KD1 1;  2AKL A;  3VB9 A;  4NOZ A;  1VLA A;  1VQM 1;  3S2D I;  2F4O A;  3CCE Z;  3I4M I;  1M90 1;  1K8A 1;  5T64 A;  3VMI A;  2PM9 A;  3G4S 1;  1KQS Y;  3G4S Z;  3G71 1;  2E9H A;  5FLX b;  1VQ9 1;  1WCM I;  2R92 I;  2IZ3 A;  2R6M A;  3M4O I;  3JAM f;  1KRL A;  3H3V J;  2B63 I;  4A3M I;  1W2B Y;  3CCR 1;  4Y52 I;  3CCR Z;  1Q7Y 2;  1WII A;  1TWG I;  4A3G I;  3GTM S;  4DK1 A;  1R9T I;  3HKZ A;  3G6E 1;  2RIQ A;  2PMZ A;  5IT9 b;  3S1N I;  2LIY A;  2OOX B;  3H0G I;  1VQ4 Z;  4HGZ A;  2JR6 A;  2LFU A;  2HF1 A;  2M48 A;  4E30 A;  5T6B A;  3HOX I;  1M1K 1;  3CXC Y;  1Q82 1;  3FQQ A;  2VUM I;  1VQ8 1;  1VQ8 Z;  3TDH B;  3BG0 B;  4MON A;  4NBB A;  1YUA A;  2K3R A;  2GTI A;  3S15 I;  3CCQ Z;  3D6W A;  3CCM Z;  2NVX I;  2OTL 1;  2V8K A;  3CC2 1;  3CC2 Z;  2OTL Z;  3GTO I;  3CD6 Z;  3P5J B;  2JA6 I;  2VF1 A;  3CCS Z;  2K5R A;  1YUK A;  5A2Q f;  2KI7 B;  4A93 I;  3F3P C;  3NH4 A;  3CC4 Z;  3S1Q I;  1Y1V S;  4HGY A;  1TWC I;  4A3C I;  4MH4 A;  3M3Y I;  4Y7N I;  4X6A I;  4NB9 A;  3CME 1;  3CME Z;  5C3E I;  1VQ6 Z;  4E2W A;  2QA4 1;  2QA4 Z;  5C4J I;  2BJO A;  3GTQ I;  2DE6 A;  4NBG A;  4E2Z A;  2W04 A;  4DGL A;  3CCU Z;  1KC8 1;  1QVG Z;  1LQL A;  1NUI A;  1NP6 A;  2O4H A;  1X3Z A;  3PO3 S;  2RPR A;  4NBE A;  5IP9 I;  4NB8 A;  1I6H I;  3RZO I;  1JWH C;  5FLX f;  1JJ2 Z;  1SFO I;  1YHQ 1;  3MZL B;  2E2H I;  4AYB A;  3HOY I;  2F4M A;  5D1O A;  2RBL A;  3D9X A;  3J7A 4;  3CCE 1;  4MD7 A;  1Q7Y 1;  3GCF A;  4RS4 A;  5C44 I;  1VQP Z;  5IT9 f;  3IF8 A;  4NBF A;  2KPI A;  3J81 b;  3U50 C;  3CMA Z;  3QWU A;  3J80 f;  2Y0S A;  1YJW Z;  2RT9 A;  5AN9 F;  4MRI A;  1VQ5 1;  1TWF I;  1VQ5 Z;  1QVF Y;  3OW2 Z;  3GTK I;  4XX2 A;  4A3J I;  1K73 2;  2DE7 A;  3CPW Z;  1VQ4 1;  1K9M 2;  2E2I I;  3J80 b;  2WB1 A;  3GKQ A;  1Z03 A;  4QTU A;  2R93 I;  1K8A 2;  1K83 I;  2JUB A;  4NBA A;  3EED A;  4A3E I;  4A3I I;  3CCQ 1;  1Z02 A;  1P9N A;  3GTL I;  4BY1 I;  3CCM 1;  3GTM I;  1L1O C;  1YIT Z;  3CD6 1;  3CCJ 1;  2JA7 I;  3CCJ Z;  3S17 I;  3CQZ I;  1QYP A;  3CCS 1;  3I07 A;  2JNY A;  4A3K I;  2YAD A;  2R7Z I;  1N8R 2;  5FLM I;  4QTT A;  1KQS Z;  3CC4 1;  1Q81 2;  2RHB A;  4E2Y A;  4NBH A;  1VQK 1;  1VQ6 1;  1VQK Z;  1W2B Z;  1N2F A;  1X0T A;  3VMH A;  1NJI 2;  1Q86 2;  2QR1 B;  2NVT I;  2GTH A;  3KIF A;  4MXU A;  2OTJ 1;  2OTJ Z;  2EGT A;  2I3C A;  3MON A;  3CC7 1;  3CC7 Z;  3FQM A;  1YIJ 1;  3T4N B;  1YIJ Z;  2JS4 A;  3CCU 1;  3NDJ A;  1USP B;  2DE5 A;  2WAQ A;  2ZAE B;  1YJ9 1;  1YJ9 Z;  3CCV 1;  3CCV Z;  4BBR I;  3NH8 A;  2W03 A;  1Y1V I;  2VUG A;  3CXC Z;  1TWA I;  4E32 A;  2J6A A;  3NDI A;  4S1T A;  4DQY B;  1YI2 1;  1YI2 Z;  3J81 f;  4NFR A;  2JA5 I;  3IX0 A;  1QF8 A;  2OOY B;  2HU9 A;  4BXX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...