3HOXI

Complete rna polymerase ii elongation complex v
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hoxI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hoxI02
3PO2I 5IP7I 3GTMS 4A3EI 3HOVI 1DL6A 2R92I 3VMIA 3S1RI 2YU9I 1TWAI 3M3YI 3HOZI 5IP9I 3PO3I 2JS4A 2DE6A 4BBSI 4NB9A 3GTKI 2HF1A 1TFIA 4BY1I 3EERA 3GTOI 3FKII 5C4JI 3I07A 3GTQI 2P3YA 2VUMI 1X3WA 4A93I 4A3DI 1ML8A 2R93I 3RZDI 1WW9A 3S17I 4A3FI 4A3CI 3LUSA 4NBBA 3S15I 2AKLA 1SFOI 1QYPA 4A3BI 1ZB8A 2E2HI 1USPA 4A3II 4MH4A 4NBGA 1K83I 3D6WA 4NB8A 3ESWA 2J6AA 2B63I 5FLMI 3S1MI 2JA6I 3S1QI 5C3EI 4NBCA 1USPB 4BBRI 3S2HI 1LQLA 1I50I 2JA5I 1Y1VS 2NVXI 2F4OA 3I4NI 4A3GI 2R7ZI 3GTJI 3GKQA 3S2DI 2JNYA 3RZOI 2JR6A 1NUIA 2K5RA 4NBFA 3HOUI 1TWGI 1TWHI 3S16I 4A3KI 1Y1VI 4BY7I 1TWFI 4NOZA 2JA7I 3GTLI 4X6AI 1N2FA 5CM2M 2E2JI 3VB9A 4XX2A 1R9TI 3HOXI 4Y7NI 4A3MI 5C4XI 3M4OI 3GTGI 1VLAA 3U50C 2NVTI 3GTPI 3S14I 3VMHA 2KPIA 4QTUA 2NVQI 3I4MI 2RBLA 4NBHA 1WCMI 2DE7A 2DE5A 1X3ZA 3H0GI 3K7AI 4BXXI 4A3JI 1YUAA 4QTTA 4A3LI 1RLYA 3S1NI 1TWCI 4Y52I 1L1OC 2NVYI 2PK7A 1RO4A 4NBEA 4NBDA 5C44I 3HOWI 3GTMI 3HOYI 2BJOA 3VMGA 1ZB9A 4NBAA 2E2II 1I6HI 3CQZI 1Y1WI 1I3QI 2JA8I 3PO3S 3H3VJ 1PFTA 2F4MA 3GCFA 3Q87A
chains in the Genus database with same CATH superfamily
4MD7A 5IP7I 1YIJZ 1RO0A 3HOVI 3BG1B 2H85A 4RVHA 3NH4A 1DL6A 3CCRZ 4HGYA 3CCSZ 1TWAI 5IP9I 2JS4A 3D9XA 2O53A 4NB9A 2HF1A 1TFIA 1WJ2A 3EERA 2EGTA 3P5JB 5C4JI 3G4S1 3F3PC 2VUMI 1VQ61 2VPWA 3QWUA 1KQSZ 1VQN1 1K8A2 4A93I 4MD8A 5A2Qf 2JIOA 1WW9A 3LUSA 2AKLA 2AYDA 1QYPA 4A3BI 3F3FC 4A3II 1K9M1 3S1QI 4NBCA 1USPB 4E32A 1VQ5Z 3CCUZ 1S721 2G2KA 3I4NI 2VPZA 1K731 3EEDA 3GTJI 2R7ZI 1QVFZ 3T4NB 1KD12 1M1K1 2K5RA 3OW2Y 1RQFA 1TWGI 3NH8A 5D1PA 2VPXA 1TWHI 3VTNA 3CC41 2R6MA 5FLXf 4A3KI 3CD61 2IV2X 2VF1A 1QVGY 3GTLI 1VQ4Z 4RVDA 5CM2M 3IFUA 2E2JI 1NJI1 1Q821 1W2BY 1P9NA 3CME1 1VQ6Z 1VQNZ 2OOYB 3CXCZ 3JAMf 3GTGI 3CCE1 3CC21 1FDIA 3S14I 2LFUA 2KPIA 3I4MI 4MRIA 2DE5A 3H0GI 2RHBA 4A3JI 3G6EZ 2WB1A 3CMA1 2IZ3A 2OTJZ 1YIJ1 1QXFA 1X0TA 1WZNA 1Z02A 3CCS1 4NBDA 3IF8A 2V8JA 1N8R1 2BJOA 2PM9A 1ZB9A 2Q4ZA 1Y1WI 1Q7Y1 3FQQA 2JA8I 1YJW1 2F4MA 3GCFA 4AYBA 3CC4Z 3CD6Z 1Q861 4A3EI 3CCQ1 1AA6A 2R92I 2YU9I 2RPRA 3CPWZ 2M6NA 1JJ2Y 4BBSI 2V8KA 2IZ4A 1VQLZ 3GTOI 3I07A 3FQMA 1VQ51 2I3CA 3NDIA 2QEXZ 1RO2A 3I55Z 1K83I 3D6WA 5FLMI 1Z03A 3S1MI 5C3EI 4BBRI 2JMOA 1YJWZ 1S7MA 1VQ41 1Y1VS 2NVXI 2RT9A 2F4OA 4A3GI 3GKQA 3I56Z 3KIHA 2JNYA 1K9M2 3CCQZ 3G71Z 2V3VA 1RNIA 2JIMA 1KC81 2LIYA 4DK1A 1YJ9Z 3VB9A 1KQSY 3G6E1 1ZH1A 4XX2A 2OTJ1 1R9TI 3HOXI 4Y7NI 4A3MI 5C4XI 3CC7Z 1M901 3MONA 1VLAA 3U50C 2OTLZ 4MONA 4E33A 4NBHA 2DE7A 4EWCA 2YADA 2W03A 1Q822 2QRCB 4QTTA 1VQMZ 2LEXA 1K8A1 1RLYA 5IT9f 1TWCI 3OW2Z 4Y52I 3J80f 1L1OC 1WIIA 1QVFY 5C44I 3HOWI 3GTMI 3CCJZ 1JWHC 1I6HI 3PO3S 2QLVB 5LL6f 1PFTA 3CCV1 1VQL1 1Y8CA 3GTMS 4DGLA 2Q51A 2QEX1 3CXCY 1Q812 1Q7Y2 3HKZA 2DE6A 3I551 3GTKI 1VQK1 1Q862 4E2ZA 1VQ7Z 3BG0B 3GTQI 2P3YA 2RIQA 2Y0SA 4RS4A 4A3DI 3RZDI 3S17I 4A3FI 3S15I 2JIQA 1SFOI 1ZB8A 3I561 1VQOZ 1USPA 4MH4A 1FDOA 4CL1A 4HGZA 1YHQZ 3G711 4NB8A 1YITZ 5A2Qb 2J6AA 2B63I 2QKDA 4TNUA 1NP6A 3S2HI 1YJ91 2JA5I 3CCVZ 1VQ9Z 1VQP1 3S2DI 3RZOI 2JR6A 3CC71 1NUIA 1KRLA 2OTL1 3IR7A 1YUKA 3HOUI 3S16I 2M48A 1Y1VI 3MZKB 1TWFI 2JA7I 1VQKZ 1VQM1 4E31A 4E2XA 2OZKA 2QR1B 5FLXb 1YI2Z 3M4OI 1VQ81 1KC82 2HU9A 3GTPI 5T64A 5D1OB 3VMHA 4QTUA 2NVQI 2GU2A 4DQYB 3CCJ1 1X3ZA 1Q16A 4MD9A 3JAMb 1YUAA 2QREB 3D2LA 4A3LI 4S1TA 3TE5B 1M902 3CCL1 2WAQA 1K732 4MXUA 2QA4Z 2V8IA 4NBEA 2E9HA 3J81b 1VQPZ 3HOYI 4NH1C 3CCM1 1M1K2 2V45A 3H3VJ 5T67A 3Q87A 2K3RA 3PO2I 1VQ71 2VUGA 3NH5A 1NJI2 5AN9F 1QF8A 4E30A 3VMIA 3NFZA 3S1RI 3M3YI 3HOZI 3PO3I 1VQ8Z 1VQO1 2JIPA 4NFRA 1YJNZ 1YHQ1 3NDJA 1YIT1 2JUBA 4BY1I 2JIRA 3FKII 1QVGZ 5T6BA 1X3WA 4RV9A 3J7A4 2P28A 1W2BZ 1ML8A 2R93I 1VQ91 4A3CI 4NBBA 3CCLZ 3IX0A 2E2HI 4RVFA 2O4HA 4NBGA 1N8R2 3ESWA 5D1OA 3CCMZ 1KD11 3G4SZ 2JA6I 2GTIA 2NAPA 1LQLA 1I50I 3MZLB 1YI21 3J81f 4NBFA 4BY7I 4NOZA 2ZAEB 1Z01A 4X6AI 1S72Z 1N2FA 4E2WA 3CCR1 2QRDB 1Q811 4E2YA 2KI7B 2QA41 2NVTI 1JJ2Z 2RBLA 1WCMI 3CPWY 3K7AI 4BXXI 3TDHB 2OOXB 2GTHA 3KIFA 3CMEZ 2VPYA 3S1NI 2PMZA 3CCEZ 4HH4A 3CC2Z 2NVYI 2PK7A 1RO4A 2W04A 3VMGA 4NBAA 5IT9b 2E2II 2E7ZA 3CQZI 1YJN1 1I3QI 1SIWA 3J80b 3CCU1 3CMAZ 4RVGA
chains in the Genus database with same CATH topology
4MD7A 5IP7I 1YIJZ 1RO0A 3HOVI 3BG1B 2H85A 4RVHA 3NH4A 1DL6A 3CCRZ 4HGYA 3CCSZ 1TWAI 5IP9I 2JS4A 3D9XA 2O53A 4NB9A 2HF1A 1TFIA 3EERA 2EGTA 3P5JB 5C4JI 3G4S1 3F3PC 2VUMI 1VQ61 1KQSZ 3QWUA 1VQN1 4A93I 1K8A2 4MD8A 5A2Qf 1WW9A 3LUSA 2AKLA 1QYPA 4A3BI 3F3FC 4A3II 1K9M1 3S1QI 4NBCA 1USPB 4E32A 1VQ5Z 3CCUZ 1S721 2G2KA 3I4NI 1K731 3EEDA 3GTJI 2R7ZI 1QVFZ 3T4NB 1KD12 1M1K1 2K5RA 3OW2Y 1RQFA 1TWGI 3NH8A 5D1PA 1TWHI 3VTNA 3CC41 2R6MA 5FLXf 4A3KI 3CD61 2VF1A 1QVGY 3GTLI 1VQ4Z 4RVDA 5CM2M 3IFUA 2E2JI 1NJI1 1Q821 1W2BY 1P9NA 3CME1 1VQ6Z 1VQNZ 2OOYB 3CXCZ 3JAMf 3GTGI 3CCE1 3CC21 3S14I 2LFUA 2KPIA 3I4MI 4MRIA 2DE5A 3H0GI 2RHBA 4A3JI 3G6EZ 2WB1A 3CMA1 2IZ3A 2OTJZ 1YIJ1 1X0TA 1Z02A 3CCS1 4NBDA 3IF8A 2V8JA 1N8R1 2BJOA 2PM9A 1ZB9A 2Q4ZA 1Y1WI 1Q7Y1 3FQQA 2JA8I 1YJW1 2F4MA 3GCFA 4AYBA 3CC4Z 3CD6Z 1Q861 4A3EI 3CCQ1 2R92I 2YU9I 2RPRA 3CPWZ 2M6NA 1JJ2Y 4BBSI 2V8KA 2IZ4A 1VQLZ 3GTOI 3I07A 3FQMA 1VQ51 2I3CA 3NDIA 2QEXZ 1RO2A 3I55Z 1K83I 3D6WA 5FLMI 1Z03A 3S1MI 5C3EI 4BBRI 2JMOA 1YJWZ 1S7MA 1VQ41 1Y1VS 2NVXI 2RT9A 2F4OA 4A3GI 3GKQA 3I56Z 3KIHA 2JNYA 1K9M2 3CCQZ 3G71Z 1RNIA 1KC81 2LIYA 4DK1A 1YJ9Z 3VB9A 1KQSY 3G6E1 1ZH1A 4XX2A 2OTJ1 1R9TI 3HOXI 4Y7NI 4A3MI 5C4XI 3CC7Z 1M901 3MONA 1VLAA 3U50C 2OTLZ 4MONA 4E33A 4NBHA 2DE7A 4EWCA 2YADA 2W03A 1Q822 2QRCB 4QTTA 1VQMZ 1K8A1 1RLYA 5IT9f 1TWCI 3OW2Z 4Y52I 3J80f 1L1OC 1WIIA 1QVFY 5C44I 3HOWI 3GTMI 3CCJZ 1JWHC 1I6HI 3PO3S 2QLVB 5LL6f 1PFTA 3CCV1 1VQL1 3GTMS 4DGLA 2Q51A 2QEX1 3CXCY 1Q812 1Q7Y2 3HKZA 2DE6A 3I551 3GTKI 1VQK1 1Q862 4E2ZA 1VQ7Z 3BG0B 3GTQI 2P3YA 2RIQA 2Y0SA 4RS4A 4A3DI 3RZDI 3S17I 4A3FI 3S15I 1SFOI 1ZB8A 3I561 1VQOZ 1USPA 4MH4A 4CL1A 4HGZA 1YHQZ 3G711 4NB8A 1YITZ 5A2Qb 2J6AA 2B63I 2QKDA 4TNUA 1NP6A 3S2HI 1YJ91 2JA5I 3CCVZ 1VQ9Z 1VQP1 3S2DI 3RZOI 2JR6A 3CC71 1NUIA 1KRLA 2OTL1 1YUKA 3HOUI 3S16I 2M48A 1Y1VI 3MZKB 1TWFI 2JA7I 1VQKZ 1VQM1 4E31A 4E2XA 2OZKA 2QR1B 5FLXb 1YI2Z 3M4OI 1VQ81 1KC82 2HU9A 3GTPI 5T64A 5D1OB 3VMHA 4QTUA 2NVQI 2GU2A 4DQYB 3CCJ1 1X3ZA 4MD9A 3JAMb 1YUAA 2QREB 4A3LI 4S1TA 3TE5B 1M902 3CCL1 2WAQA 1K732 4MXUA 2QA4Z 2V8IA 4NBEA 2E9HA 3J81b 1VQPZ 3HOYI 4NH1C 3CCM1 1M1K2 3H3VJ 5T67A 3Q87A 2K3RA 3PO2I 1VQ71 2VUGA 3NH5A 1NJI2 5AN9F 1QF8A 4E30A 3VMIA 3NFZA 3S1RI 3M3YI 3HOZI 3PO3I 1VQ8Z 1VQO1 4NFRA 1YJNZ 1YHQ1 3NDJA 1YIT1 2JUBA 4BY1I 3FKII 1QVGZ 5T6BA 1X3WA 4RV9A 3J7A4 2P28A 1W2BZ 1ML8A 2R93I 1VQ91 4A3CI 4NBBA 3CCLZ 3IX0A 2E2HI 4RVFA 2O4HA 4NBGA 1N8R2 3ESWA 5D1OA 3CCMZ 1KD11 3G4SZ 2JA6I 2GTIA 1LQLA 1I50I 3MZLB 1YI21 3J81f 4NBFA 4BY7I 4NOZA 2ZAEB 1Z01A 4X6AI 1S72Z 1N2FA 4E2WA 3CCR1 2QRDB 1Q811 4E2YA 2KI7B 2QA41 2NVTI 1JJ2Z 2RBLA 1WCMI 3CPWY 3K7AI 4BXXI 3TDHB 2OOXB 2GTHA 3KIFA 3CMEZ 3S1NI 2PMZA 3CCEZ 3CC2Z 2NVYI 4HH4A 2PK7A 1RO4A 2W04A 3VMGA 4NBAA 5IT9b 2E2II 3CQZI 1YJN1 1I3QI 3J80b 3CCU1 3CMAZ 4RVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO2 I;  5IP7 I;  3GTM S;  4A3E I;  3HOV I;  1DL6 A;  2R92 I;  3VMI A;  3S1R I;  2YU9 I;  1TWA I;  3M3Y I;  3HOZ I;  5IP9 I;  3PO3 I;  2JS4 A;  2DE6 A;  4BBS I;  4NB9 A;  3GTK I;  2HF1 A;  1TFI A;  4BY1 I;  3EER A;  3GTO I;  3FKI I;  5C4J I;  3I07 A;  3GTQ I;  2P3Y A;  2VUM I;  1X3W A;  4A93 I;  4A3D I;  1ML8 A;  2R93 I;  3RZD I;  1WW9 A;  3S17 I;  4A3F I;  4A3C I;  3LUS A;  4NBB A;  3S15 I;  2AKL A;  1SFO I;  1QYP A;  4A3B I;  1ZB8 A;  2E2H I;  1USP A;  4A3I I;  4MH4 A;  4NBG A;  1K83 I;  3D6W A;  4NB8 A;  3ESW A;  2J6A A;  2B63 I;  5FLM I;  3S1M I;  2JA6 I;  3S1Q I;  5C3E I;  4NBC A;  1USP B;  4BBR I;  3S2H I;  1LQL A;  1I50 I;  2JA5 I;  1Y1V S;  2NVX I;  2F4O A;  3I4N I;  4A3G I;  2R7Z I;  3GTJ I;  3GKQ A;  3S2D I;  2JNY A;  3RZO I;  2JR6 A;  1NUI A;  2K5R A;  4NBF A;  3HOU I;  1TWG I;  1TWH I;  3S16 I;  4A3K I;  1Y1V I;  4BY7 I;  1TWF I;  4NOZ A;  2JA7 I;  3GTL I;  4X6A I;  1N2F A;  5CM2 M;  2E2J I;  3VB9 A;  4XX2 A;  1R9T I;  3HOX I;  4Y7N I;  4A3M I;  5C4X I;  3M4O I;  3GTG I;  1VLA A;  3U50 C;  2NVT I;  3GTP I;  3S14 I;  3VMH A;  2KPI A;  4QTU A;  2NVQ I;  3I4M I;  2RBL A;  4NBH A;  1WCM I;  2DE7 A;  2DE5 A;  1X3Z A;  3H0G I;  3K7A I;  4BXX I;  4A3J I;  1YUA A;  4QTT A;  4A3L I;  1RLY A;  3S1N I;  1TWC I;  4Y52 I;  1L1O C;  2NVY I;  2PK7 A;  1RO4 A;  4NBE A;  4NBD A;  5C44 I;  3HOW I;  3GTM I;  3HOY I;  2BJO A;  3VMG A;  1ZB9 A;  4NBA A;  2E2I I;  1I6H I;  3CQZ I;  1Y1W I;  1I3Q I;  2JA8 I;  3PO3 S;  3H3V J;  1PFT A;  2F4M A;  3GCF A;  3Q87 A; 
#chains in the Genus database with same CATH topology
 4MD7 A;  5IP7 I;  1YIJ Z;  1RO0 A;  3HOV I;  3BG1 B;  2H85 A;  4RVH A;  3NH4 A;  1DL6 A;  3CCR Z;  4HGY A;  3CCS Z;  1TWA I;  5IP9 I;  2JS4 A;  3D9X A;  2O53 A;  4NB9 A;  2HF1 A;  1TFI A;  1WJ2 A;  3EER A;  2EGT A;  3P5J B;  5C4J I;  3G4S 1;  3F3P C;  2VUM I;  1VQ6 1;  2VPW A;  3QWU A;  1KQS Z;  1VQN 1;  1K8A 2;  4A93 I;  4MD8 A;  5A2Q f;  2JIO A;  1WW9 A;  3LUS A;  2AKL A;  2AYD A;  1QYP A;  4A3B I;  3F3F C;  4A3I I;  1K9M 1;  3S1Q I;  4NBC A;  1USP B;  4E32 A;  1VQ5 Z;  3CCU Z;  1S72 1;  2G2K A;  3I4N I;  2VPZ A;  1K73 1;  3EED A;  3GTJ I;  2R7Z I;  1QVF Z;  3T4N B;  1KD1 2;  1M1K 1;  2K5R A;  3OW2 Y;  1RQF A;  1TWG I;  3NH8 A;  5D1P A;  2VPX A;  1TWH I;  3VTN A;  3CC4 1;  2R6M A;  5FLX f;  4A3K I;  3CD6 1;  2IV2 X;  2VF1 A;  1QVG Y;  3GTL I;  1VQ4 Z;  4RVD A;  5CM2 M;  3IFU A;  2E2J I;  1NJI 1;  1Q82 1;  1W2B Y;  1P9N A;  3CME 1;  1VQ6 Z;  1VQN Z;  2OOY B;  3CXC Z;  3JAM f;  3GTG I;  3CCE 1;  3CC2 1;  1FDI A;  3S14 I;  2LFU A;  2KPI A;  3I4M I;  4MRI A;  2DE5 A;  3H0G I;  2RHB A;  4A3J I;  3G6E Z;  2WB1 A;  3CMA 1;  2IZ3 A;  2OTJ Z;  1YIJ 1;  1QXF A;  1X0T A;  1WZN A;  1Z02 A;  3CCS 1;  4NBD A;  3IF8 A;  2V8J A;  1N8R 1;  2BJO A;  2PM9 A;  1ZB9 A;  2Q4Z A;  1Y1W I;  1Q7Y 1;  3FQQ A;  2JA8 I;  1YJW 1;  2F4M A;  3GCF A;  4AYB A;  3CC4 Z;  3CD6 Z;  1Q86 1;  4A3E I;  3CCQ 1;  1AA6 A;  2R92 I;  2YU9 I;  2RPR A;  3CPW Z;  2M6N A;  1JJ2 Y;  4BBS I;  2V8K A;  2IZ4 A;  1VQL Z;  3GTO I;  3I07 A;  3FQM A;  1VQ5 1;  2I3C A;  3NDI A;  2QEX Z;  1RO2 A;  3I55 Z;  1K83 I;  3D6W A;  5FLM I;  1Z03 A;  3S1M I;  5C3E I;  4BBR I;  2JMO A;  1YJW Z;  1S7M A;  1VQ4 1;  1Y1V S;  2NVX I;  2RT9 A;  2F4O A;  4A3G I;  3GKQ A;  3I56 Z;  3KIH A;  2JNY A;  1K9M 2;  3CCQ Z;  3G71 Z;  2V3V A;  1RNI A;  2JIM A;  1KC8 1;  2LIY A;  4DK1 A;  1YJ9 Z;  3VB9 A;  1KQS Y;  3G6E 1;  1ZH1 A;  4XX2 A;  2OTJ 1;  1R9T I;  3HOX I;  4Y7N I;  4A3M I;  5C4X I;  3CC7 Z;  1M90 1;  3MON A;  1VLA A;  3U50 C;  2OTL Z;  4MON A;  4E33 A;  4NBH A;  2DE7 A;  4EWC A;  2YAD A;  2W03 A;  1Q82 2;  2QRC B;  4QTT A;  1VQM Z;  2LEX A;  1K8A 1;  1RLY A;  5IT9 f;  1TWC I;  3OW2 Z;  4Y52 I;  3J80 f;  1L1O C;  1WII A;  1QVF Y;  5C44 I;  3HOW I;  3GTM I;  3CCJ Z;  1JWH C;  1I6H I;  3PO3 S;  2QLV B;  5LL6 f;  1PFT A;  3CCV 1;  1VQL 1;  1Y8C A;  3GTM S;  4DGL A;  2Q51 A;  2QEX 1;  3CXC Y;  1Q81 2;  1Q7Y 2;  3HKZ A;  2DE6 A;  3I55 1;  3GTK I;  1VQK 1;  1Q86 2;  4E2Z A;  1VQ7 Z;  3BG0 B;  3GTQ I;  2P3Y A;  2RIQ A;  2Y0S A;  4RS4 A;  4A3D I;  3RZD I;  3S17 I;  4A3F I;  3S15 I;  2JIQ A;  1SFO I;  1ZB8 A;  3I56 1;  1VQO Z;  1USP A;  4MH4 A;  1FDO A;  4CL1 A;  4HGZ A;  1YHQ Z;  3G71 1;  4NB8 A;  1YIT Z;  5A2Q b;  2J6A A;  2B63 I;  2QKD A;  4TNU A;  1NP6 A;  3S2H I;  1YJ9 1;  2JA5 I;  3CCV Z;  1VQ9 Z;  1VQP 1;  3S2D I;  3RZO I;  2JR6 A;  3CC7 1;  1NUI A;  1KRL A;  2OTL 1;  3IR7 A;  1YUK A;  3HOU I;  3S16 I;  2M48 A;  1Y1V I;  3MZK B;  1TWF I;  2JA7 I;  1VQK Z;  1VQM 1;  4E31 A;  4E2X A;  2OZK A;  2QR1 B;  5FLX b;  1YI2 Z;  3M4O I;  1VQ8 1;  1KC8 2;  2HU9 A;  3GTP I;  5T64 A;  5D1O B;  3VMH A;  4QTU A;  2NVQ I;  2GU2 A;  4DQY B;  3CCJ 1;  1X3Z A;  1Q16 A;  4MD9 A;  3JAM b;  1YUA A;  2QRE B;  3D2L A;  4A3L I;  4S1T A;  3TE5 B;  1M90 2;  3CCL 1;  2WAQ A;  1K73 2;  4MXU A;  2QA4 Z;  2V8I A;  4NBE A;  2E9H A;  3J81 b;  1VQP Z;  3HOY I;  4NH1 C;  3CCM 1;  1M1K 2;  2V45 A;  3H3V J;  5T67 A;  3Q87 A;  2K3R A;  3PO2 I;  1VQ7 1;  2VUG A;  3NH5 A;  1NJI 2;  5AN9 F;  1QF8 A;  4E30 A;  3VMI A;  3NFZ A;  3S1R I;  3M3Y I;  3HOZ I;  3PO3 I;  1VQ8 Z;  1VQO 1;  2JIP A;  4NFR A;  1YJN Z;  1YHQ 1;  3NDJ A;  1YIT 1;  2JUB A;  4BY1 I;  2JIR A;  3FKI I;  1QVG Z;  5T6B A;  1X3W A;  4RV9 A;  3J7A 4;  2P28 A;  1W2B Z;  1ML8 A;  2R93 I;  1VQ9 1;  4A3C I;  4NBB A;  3CCL Z;  3IX0 A;  2E2H I;  4RVF A;  2O4H A;  4NBG A;  1N8R 2;  3ESW A;  5D1O A;  3CCM Z;  1KD1 1;  3G4S Z;  2JA6 I;  2GTI A;  2NAP A;  1LQL A;  1I50 I;  3MZL B;  1YI2 1;  3J81 f;  4NBF A;  4BY7 I;  4NOZ A;  2ZAE B;  1Z01 A;  4X6A I;  1S72 Z;  1N2F A;  4E2W A;  3CCR 1;  2QRD B;  1Q81 1;  4E2Y A;  2KI7 B;  2QA4 1;  2NVT I;  1JJ2 Z;  2RBL A;  1WCM I;  3CPW Y;  3K7A I;  4BXX I;  3TDH B;  2OOX B;  2GTH A;  3KIF A;  3CME Z;  2VPY A;  3S1N I;  2PMZ A;  3CCE Z;  4HH4 A;  3CC2 Z;  2NVY I;  2PK7 A;  1RO4 A;  2W04 A;  3VMG A;  4NBA A;  5IT9 b;  2E2I I;  2E7Z A;  3CQZ I;  1YJN 1;  1I3Q I;  1SIW A;  3J80 b;  3CCU 1;  3CMA Z;  4RVG A; 
#chains in the Genus database with same CATH homology
 4MD7 A;  5IP7 I;  1YIJ Z;  1RO0 A;  3HOV I;  3BG1 B;  2H85 A;  4RVH A;  3NH4 A;  1DL6 A;  3CCR Z;  4HGY A;  3CCS Z;  1TWA I;  5IP9 I;  2JS4 A;  3D9X A;  2O53 A;  4NB9 A;  2HF1 A;  1TFI A;  3EER A;  2EGT A;  3P5J B;  5C4J I;  3G4S 1;  3F3P C;  2VUM I;  1VQ6 1;  1KQS Z;  3QWU A;  1VQN 1;  4A93 I;  1K8A 2;  4MD8 A;  5A2Q f;  1WW9 A;  3LUS A;  2AKL A;  1QYP A;  4A3B I;  3F3F C;  4A3I I;  1K9M 1;  3S1Q I;  4NBC A;  1USP B;  4E32 A;  1VQ5 Z;  3CCU Z;  1S72 1;  2G2K A;  3I4N I;  1K73 1;  3EED A;  3GTJ I;  2R7Z I;  1QVF Z;  3T4N B;  1KD1 2;  1M1K 1;  2K5R A;  3OW2 Y;  1RQF A;  1TWG I;  3NH8 A;  5D1P A;  1TWH I;  3VTN A;  3CC4 1;  2R6M A;  5FLX f;  4A3K I;  3CD6 1;  2VF1 A;  1QVG Y;  3GTL I;  1VQ4 Z;  4RVD A;  5CM2 M;  3IFU A;  2E2J I;  1NJI 1;  1Q82 1;  1W2B Y;  1P9N A;  3CME 1;  1VQ6 Z;  1VQN Z;  2OOY B;  3CXC Z;  3JAM f;  3GTG I;  3CCE 1;  3CC2 1;  3S14 I;  2LFU A;  2KPI A;  3I4M I;  4MRI A;  2DE5 A;  3H0G I;  2RHB A;  4A3J I;  3G6E Z;  2WB1 A;  3CMA 1;  2IZ3 A;  2OTJ Z;  1YIJ 1;  1X0T A;  1Z02 A;  3CCS 1;  4NBD A;  3IF8 A;  2V8J A;  1N8R 1;  2BJO A;  2PM9 A;  1ZB9 A;  2Q4Z A;  1Y1W I;  1Q7Y 1;  3FQQ A;  2JA8 I;  1YJW 1;  2F4M A;  3GCF A;  4AYB A;  3CC4 Z;  3CD6 Z;  1Q86 1;  4A3E I;  3CCQ 1;  2R92 I;  2YU9 I;  2RPR A;  3CPW Z;  2M6N A;  1JJ2 Y;  4BBS I;  2V8K A;  2IZ4 A;  1VQL Z;  3GTO I;  3I07 A;  3FQM A;  1VQ5 1;  2I3C A;  3NDI A;  2QEX Z;  1RO2 A;  3I55 Z;  1K83 I;  3D6W A;  5FLM I;  1Z03 A;  3S1M I;  5C3E I;  4BBR I;  2JMO A;  1YJW Z;  1S7M A;  1VQ4 1;  1Y1V S;  2NVX I;  2RT9 A;  2F4O A;  4A3G I;  3GKQ A;  3I56 Z;  3KIH A;  2JNY A;  1K9M 2;  3CCQ Z;  3G71 Z;  1RNI A;  1KC8 1;  2LIY A;  4DK1 A;  1YJ9 Z;  3VB9 A;  1KQS Y;  3G6E 1;  1ZH1 A;  4XX2 A;  2OTJ 1;  1R9T I;  3HOX I;  4Y7N I;  4A3M I;  5C4X I;  3CC7 Z;  1M90 1;  3MON A;  1VLA A;  3U50 C;  2OTL Z;  4MON A;  4E33 A;  4NBH A;  2DE7 A;  4EWC A;  2YAD A;  2W03 A;  1Q82 2;  2QRC B;  4QTT A;  1VQM Z;  1K8A 1;  1RLY A;  5IT9 f;  1TWC I;  3OW2 Z;  4Y52 I;  3J80 f;  1L1O C;  1WII A;  1QVF Y;  5C44 I;  3HOW I;  3GTM I;  3CCJ Z;  1JWH C;  1I6H I;  3PO3 S;  2QLV B;  5LL6 f;  1PFT A;  3CCV 1;  1VQL 1;  3GTM S;  4DGL A;  2Q51 A;  2QEX 1;  3CXC Y;  1Q81 2;  1Q7Y 2;  3HKZ A;  2DE6 A;  3I55 1;  3GTK I;  1VQK 1;  1Q86 2;  4E2Z A;  1VQ7 Z;  3BG0 B;  3GTQ I;  2P3Y A;  2RIQ A;  2Y0S A;  4RS4 A;  4A3D I;  3RZD I;  3S17 I;  4A3F I;  3S15 I;  1SFO I;  1ZB8 A;  3I56 1;  1VQO Z;  1USP A;  4MH4 A;  4CL1 A;  4HGZ A;  1YHQ Z;  3G71 1;  4NB8 A;  1YIT Z;  5A2Q b;  2J6A A;  2B63 I;  2QKD A;  4TNU A;  1NP6 A;  3S2H I;  1YJ9 1;  2JA5 I;  3CCV Z;  1VQ9 Z;  1VQP 1;  3S2D I;  3RZO I;  2JR6 A;  3CC7 1;  1NUI A;  1KRL A;  2OTL 1;  1YUK A;  3HOU I;  3S16 I;  2M48 A;  1Y1V I;  3MZK B;  1TWF I;  2JA7 I;  1VQK Z;  1VQM 1;  4E31 A;  4E2X A;  2OZK A;  2QR1 B;  5FLX b;  1YI2 Z;  3M4O I;  1VQ8 1;  1KC8 2;  2HU9 A;  3GTP I;  5T64 A;  5D1O B;  3VMH A;  4QTU A;  2NVQ I;  2GU2 A;  4DQY B;  3CCJ 1;  1X3Z A;  4MD9 A;  3JAM b;  1YUA A;  2QRE B;  4A3L I;  4S1T A;  3TE5 B;  1M90 2;  3CCL 1;  2WAQ A;  1K73 2;  4MXU A;  2QA4 Z;  2V8I A;  4NBE A;  2E9H A;  3J81 b;  1VQP Z;  3HOY I;  4NH1 C;  3CCM 1;  1M1K 2;  3H3V J;  5T67 A;  3Q87 A;  2K3R A;  3PO2 I;  1VQ7 1;  2VUG A;  3NH5 A;  1NJI 2;  5AN9 F;  1QF8 A;  4E30 A;  3VMI A;  3NFZ A;  3S1R I;  3M3Y I;  3HOZ I;  3PO3 I;  1VQ8 Z;  1VQO 1;  4NFR A;  1YJN Z;  1YHQ 1;  3NDJ A;  1YIT 1;  2JUB A;  4BY1 I;  3FKI I;  1QVG Z;  5T6B A;  1X3W A;  4RV9 A;  3J7A 4;  2P28 A;  1W2B Z;  1ML8 A;  2R93 I;  1VQ9 1;  4A3C I;  4NBB A;  3CCL Z;  3IX0 A;  2E2H I;  4RVF A;  2O4H A;  4NBG A;  1N8R 2;  3ESW A;  5D1O A;  3CCM Z;  1KD1 1;  3G4S Z;  2JA6 I;  2GTI A;  1LQL A;  1I50 I;  3MZL B;  1YI2 1;  3J81 f;  4NBF A;  4BY7 I;  4NOZ A;  2ZAE B;  1Z01 A;  4X6A I;  1S72 Z;  1N2F A;  4E2W A;  3CCR 1;  2QRD B;  1Q81 1;  4E2Y A;  2KI7 B;  2QA4 1;  2NVT I;  1JJ2 Z;  2RBL A;  1WCM I;  3CPW Y;  3K7A I;  4BXX I;  3TDH B;  2OOX B;  2GTH A;  3KIF A;  3CME Z;  3S1N I;  2PMZ A;  3CCE Z;  3CC2 Z;  2NVY I;  4HH4 A;  2PK7 A;  1RO4 A;  2W04 A;  3VMG A;  4NBA A;  5IT9 b;  2E2I I;  3CQZ I;  1YJN 1;  1I3Q I;  3J80 b;  3CCU 1;  3CMA Z;  4RVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...