2JMOA

Ibr domain of human parkin
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
80
structure length
80
Chain Sequence
b'GHMGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parkin
publication title Structure of the Parkin in-between-ring domain provides insights for E3-ligase dysfunction in autosomal recessive Parkinson's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 1
structure length 80
sequence length 80
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2006-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2jmoA01
2R6MA 4DGLA 4MD9A 4MD7A 4MD8A 2RT9A 4NH1C 1RQFA 1QF8A 2M48A 2JMOA 2M6NA 1JWHC 3EEDA
chains in the Genus database with same CATH superfamily
4BXXI 1S7MA 1N8R1 3MZKB 3HOXI 1VQ8Z 1KC82 3J7A4 3IF8A 4X6AI 3CCMZ 3VMIA 1VQOZ 1NP6A 1QVFY 1RQFA 4DQYB 2F4MA 3CC21 1Y1VS 2E7ZA 3J80f 1Y8CA 3GTKI 3I561 2PMZA 1WW9A 4Y7NI 4BY7I 5T64A 3CMAZ 3GTJI 3GTQI 3S15I 4RS4A 1KRLA 1WIIA 2JIRA 2NVYI 1NJI2 4A3BI 4NBCA 1VQ4Z 2QRDB 3H0GI 2OTJ1 1Q7Y1 3NDJA 1SFOI 5T6BA 3GTMS 3KIHA 1M902 2RIQA 4XX2A 2Y0SA 2G2KA 2WAQA 2EGTA 2LEXA 1SIWA 3CCSZ 1YI21 3H3VJ 2JIOA 3J81b 3CPWZ 3D2LA 2QLVB 2JS4A 3CCU1 3GTPI 3CC2Z 1YJW1 4NBBA 1X0TA 3I4MI 3I56Z 1M901 2E2JI 3BG0B 3JAMf 3CC71 3CCQ1 2GTIA 3FKII 2PK7A 3OW2Y 5IP7I 2OTJZ 1TWHI 3GKQA 4DGLA 2QEX1 1VQK1 3S1MI 4RVHA 1Y1VI 5A2Qb 3EERA 3CCR1 3CCJ1 3VMHA 1VLAA 1VQLZ 1YI2Z 1W2BY 3Q87A 5C4XI 1K732 1K9M1 1TWAI 2VUMI 5T67A 2QREB 5FLMI 3CCUZ 4NBGA 4EWCA 2K3RA 5IP9I 1YJWZ 3GTMI 1Q811 1N2FA 2DE6A 1Z01A 2YU9I 4A3MI 3K7AI 1YIT1 1M1K2 3CXCZ 1PFTA 1JWHC 4E31A 2QA41 1YJN1 3G4SZ 3RZOI 2V3VA 2V45A 3F3FC 1RLYA 3EEDA 3CC41 1JJ2Y 3CCV1 1VQKZ 3TDHB 1FDIA 1YJ91 4MH4A 2VUGA 2YADA 3NH4A 1ZH1A 4HGYA 3CMEZ 3CCRZ 5CM2M 2VPWA 3CCJZ 1KD12 4S1TA 1Q16A 2R93I 2R92I 3G6EZ 2DE7A 5C4JI 3CQZI 1VQ51 1Q822 1Q862 4E32A 4MD9A 1Y1WI 5D1OB 3HOVI 3KIFA 5D1OA 4NBHA 3QWUA 2NVTI 4MD7A 2GTHA 3I551 4A3II 1VQ7Z 2O53A 2OOXB 4NBFA 1KD11 1YITZ 3G71Z 1KC81 2IZ3A 4MD8A 3GTOI 3CD61 1NUIA 1VQN1 1YUKA 3S2HI 1VQPZ 1Q861 4BY1I 2M48A 3CPWY 3CCVZ 2AKLA 1YJ9Z 3J81f 2F4OA 3MONA 4E2YA 1NJI1 1Z02A 2VF1A 3M4OI 2IZ4A 1TWGI 1TWFI 4NB9A 5AN9F 1YIJ1 1TWCI 4E30A 4QTTA 2OOYB 2W04A 1RO2A 3FQMA 3I07A 3HKZA 2JUBA 4AYBA 3CCE1 1QXFA 2NVQI 4RVDA 1YHQ1 2RPRA 2O4HA 5C44I 4CL1A 3PO3S 1ZB8A 2V8IA 3NFZA 1S721 2KPIA 2LFUA 4A3JI 2JNYA 1KQSZ 5A2Qf 2JA8I 1X3ZA 2HU9A 3HOZI 4E2XA 4NBDA 3VMGA 3HOWI 2R6MA 1K8A2 1VQ91 1QYPA 4HH4A 2E2HI 4NB8A 3ESWA 3CCL1 2VPXA 2NVXI 1TFIA 3CXCY 2RT9A 2JA5I 3CCEZ 3F3PC 2JIQA 4TNUA 1ZB9A 1WJ2A 3CC7Z 3CCQZ 1VQ81 3U50C 3IX0A 2B63I 3CCM1 4NOZA 2JMOA 1AA6A 2PM9A 1P9NA 1K731 2JA6I 5IT9b 1RO0A 4MONA 1R9TI 1DL6A 3S17I 2QRCB 2W03A 2QEXZ 3CMA1 1QF8A 1X3WA 3NH8A 3S16I 4A3FI 3S1QI 4A3CI 4E2WA 1VQ41 3FQQA 1USPB 1M1K1 2Q4ZA 1USPA 1VQ9Z 1VQ61 2V8JA 1QVGZ 3PO3I 3HOYI 2JR6A 5FLXb 4E2ZA 1RNIA 2K5RA 3D6WA 1FDOA 2E9HA 1Z03A 1ML8A 3CCS1 3HOUI 4HGZA 4Y52I 1Q7Y2 3IFUA 2RBLA 1JJ2Z 3BG1B 4RV9A 2QA4Z 1YJNZ 1Q821 1K83I 2LIYA 3NH5A 4MXUA 3PO2I 2P3YA 3CC4Z 2Q51A 4A3LI 3J80b 2J6AA 1VQM1 4DK1A 2OZKA 1QVFZ 1WCMI 2GU2A 4MRIA 2QR1B 4A3EI 3GTGI 2R7ZI 1LQLA 3TE5B 1VQ6Z 1VQ5Z 4BBSI 2OTL1 3MZLB 3S1NI 3S1RI 2M6NA 1KQSY 2H85A 3T4NB 3I55Z 1VQL1 4NBAA 4A3GI 4A93I 4NH1C 3CD6Z 1VQNZ 3IR7A 2E2II 2AYDA 4A3DI 2P28A 4QTUA 3NDIA 1VQMZ 3GTLI 2KI7B 3M3YI 3JAMb 3D9XA 1K9M2 3VTNA 4RVGA 3G4S1 2VPYA 1YIJZ 2JIMA 2OTLZ 2QKDA 1Q812 3S2DI 3I4NI 2BJOA 2DE5A 5LL6f 3CME1 3OW2Z 1YHQZ 3GCFA 2VPZA 1I3QI 1VQO1 5IT9f 3G6E1 5C3EI 2V8KA 2JIPA 1K8A1 3VB9A 1S72Z 3RZDI 1RO4A 4E33A 4NBEA 2HF1A 2IV2X 2NAPA 1L1OC 3LUSA 1W2BZ 1WZNA 1QVGY 1YUAA 2ZAEB 1N8R2 1VQ71 4NFRA 5D1PA 1I6HI 2JA7I 2RHBA 3G711 5FLXf 3P5JB 4RVFA 1I50I 4BBRI 1VQP1 3CCLZ 4A3KI 2I3CA 3S14I 2WB1A
chains in the Genus database with same CATH topology
4BXXI 1S7MA 1N8R1 3MZKB 3HOXI 1VQ8Z 1KC82 3J7A4 3IF8A 4X6AI 3CCMZ 3VMIA 1VQOZ 1NP6A 1QVFY 1RQFA 4DQYB 2F4MA 3CC21 1Y1VS 3J80f 3GTKI 3I561 2PMZA 1WW9A 4Y7NI 4BY7I 5T64A 3CMAZ 3GTJI 3GTQI 3S15I 4RS4A 1KRLA 1WIIA 2NVYI 1NJI2 4A3BI 4NBCA 1VQ4Z 2QRDB 3H0GI 2OTJ1 1Q7Y1 3NDJA 1SFOI 5T6BA 3GTMS 3KIHA 1M902 2RIQA 4XX2A 2Y0SA 2G2KA 2WAQA 2EGTA 3CCSZ 1YI21 3H3VJ 3J81b 3CPWZ 2QLVB 2JS4A 3CCU1 3GTPI 3CC2Z 1YJW1 4NBBA 1X0TA 3I4MI 3I56Z 1M901 2E2JI 3BG0B 3JAMf 3CC71 3CCQ1 2GTIA 3FKII 2PK7A 3OW2Y 5IP7I 2OTJZ 1TWHI 3GKQA 4DGLA 2QEX1 1VQK1 3S1MI 4RVHA 1Y1VI 5A2Qb 3EERA 3CCR1 3CCJ1 3VMHA 1VLAA 1VQLZ 1YI2Z 1W2BY 3Q87A 5C4XI 1K732 1K9M1 1TWAI 2VUMI 5T67A 2QREB 5FLMI 3CCUZ 4NBGA 4EWCA 2K3RA 5IP9I 1YJWZ 3GTMI 1Q811 1N2FA 2DE6A 1Z01A 2YU9I 4A3MI 3K7AI 1YIT1 1M1K2 3CXCZ 1PFTA 1JWHC 4E31A 2QA41 1YJN1 3G4SZ 3RZOI 3F3FC 1RLYA 3EEDA 3CC41 1JJ2Y 3CCV1 1VQKZ 3TDHB 1YJ91 4MH4A 2VUGA 2YADA 3NH4A 1ZH1A 4HGYA 3CMEZ 3CCRZ 5CM2M 3CCJZ 1KD12 4S1TA 2R93I 2R92I 3G6EZ 2DE7A 5C4JI 3CQZI 1VQ51 1Q822 1Q862 4E32A 4MD9A 1Y1WI 5D1OB 3HOVI 3KIFA 5D1OA 4NBHA 3QWUA 2NVTI 4MD7A 2GTHA 3I551 4A3II 1VQ7Z 2O53A 2OOXB 4NBFA 1KD11 1YITZ 3G71Z 1KC81 2IZ3A 4MD8A 3GTOI 3CD61 1NUIA 1VQN1 1YUKA 3S2HI 1VQPZ 1Q861 4BY1I 2M48A 3CPWY 3CCVZ 2AKLA 1YJ9Z 3J81f 2F4OA 3MONA 4E2YA 1NJI1 1Z02A 2VF1A 3M4OI 2IZ4A 1TWGI 1TWFI 4NB9A 5AN9F 1YIJ1 1TWCI 4E30A 4QTTA 2OOYB 2W04A 1RO2A 3FQMA 3I07A 3HKZA 2JUBA 4AYBA 3CCE1 2NVQI 4RVDA 1YHQ1 2RPRA 2O4HA 5C44I 4CL1A 3PO3S 1ZB8A 2V8IA 3NFZA 1S721 2KPIA 2LFUA 4A3JI 2JNYA 1KQSZ 5A2Qf 2JA8I 1X3ZA 2HU9A 3HOZI 4NBDA 3VMGA 4E2XA 3HOWI 2R6MA 1K8A2 1VQ91 1QYPA 4HH4A 2E2HI 4NB8A 3ESWA 3CCL1 2NVXI 1TFIA 3CXCY 2RT9A 2JA5I 3CCEZ 3F3PC 4TNUA 1ZB9A 3CC7Z 3CCQZ 1VQ81 3U50C 3IX0A 2B63I 3CCM1 4NOZA 2JMOA 2PM9A 1P9NA 1K731 2JA6I 5IT9b 1RO0A 4MONA 1R9TI 1DL6A 3S17I 2QRCB 2W03A 2QEXZ 3CMA1 1QF8A 1X3WA 3NH8A 3S16I 4A3FI 3S1QI 4A3CI 4E2WA 1VQ41 3FQQA 1USPB 1M1K1 2Q4ZA 1USPA 1VQ9Z 1VQ61 2V8JA 1QVGZ 3PO3I 3HOYI 2JR6A 5FLXb 4E2ZA 1RNIA 2K5RA 3D6WA 2E9HA 1Z03A 1ML8A 3CCS1 3HOUI 4HGZA 4Y52I 1Q7Y2 3IFUA 2RBLA 1JJ2Z 3BG1B 4RV9A 2QA4Z 1YJNZ 1Q821 1K83I 2LIYA 3NH5A 4MXUA 3PO2I 2P3YA 3CC4Z 2Q51A 4A3LI 3J80b 1VQM1 2J6AA 4DK1A 2OZKA 1QVFZ 1WCMI 2GU2A 4MRIA 2QR1B 4A3EI 3GTGI 2R7ZI 1LQLA 3TE5B 1VQ6Z 1VQ5Z 4BBSI 2OTL1 3MZLB 3S1NI 3S1RI 2M6NA 1KQSY 2H85A 3T4NB 3I55Z 1VQL1 4NBAA 4A3GI 4A93I 4NH1C 3CD6Z 1VQNZ 2E2II 4A3DI 2P28A 4QTUA 3NDIA 1VQMZ 3GTLI 2KI7B 3M3YI 3JAMb 3D9XA 1K9M2 3VTNA 4RVGA 3G4S1 1YIJZ 2OTLZ 2QKDA 1Q812 3S2DI 3I4NI 2BJOA 2DE5A 5LL6f 3CME1 3OW2Z 1YHQZ 3GCFA 1I3QI 1VQO1 5IT9f 3G6E1 5C3EI 2V8KA 1K8A1 3VB9A 1S72Z 3RZDI 1RO4A 4E33A 4NBEA 2HF1A 1L1OC 3LUSA 1W2BZ 1QVGY 1YUAA 2ZAEB 1N8R2 1VQ71 4NFRA 5D1PA 1I6HI 2JA7I 2RHBA 3G711 5FLXf 3P5JB 4RVFA 1I50I 4BBRI 1VQP1 3CCLZ 4A3KI 2I3CA 3S14I 2WB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R6M A;  4DGL A;  4MD9 A;  4MD7 A;  4MD8 A;  2RT9 A;  4NH1 C;  1RQF A;  1QF8 A;  2M48 A;  2JMO A;  2M6N A;  1JWH C;  3EED A; 
#chains in the Genus database with same CATH topology
 4BXX I;  1S7M A;  1N8R 1;  3MZK B;  3HOX I;  1VQ8 Z;  1KC8 2;  3J7A 4;  3IF8 A;  4X6A I;  3CCM Z;  3VMI A;  1VQO Z;  1NP6 A;  1QVF Y;  1RQF A;  4DQY B;  2F4M A;  3CC2 1;  1Y1V S;  2E7Z A;  3J80 f;  1Y8C A;  3GTK I;  3I56 1;  2PMZ A;  1WW9 A;  4Y7N I;  4BY7 I;  5T64 A;  3CMA Z;  3GTJ I;  3GTQ I;  3S15 I;  4RS4 A;  1KRL A;  1WII A;  2JIR A;  2NVY I;  1NJI 2;  4A3B I;  4NBC A;  1VQ4 Z;  2QRD B;  3H0G I;  2OTJ 1;  1Q7Y 1;  3NDJ A;  1SFO I;  5T6B A;  3GTM S;  3KIH A;  1M90 2;  2RIQ A;  4XX2 A;  2Y0S A;  2G2K A;  2WAQ A;  2EGT A;  2LEX A;  1SIW A;  3CCS Z;  1YI2 1;  3H3V J;  2JIO A;  3J81 b;  3CPW Z;  3D2L A;  2QLV B;  2JS4 A;  3CCU 1;  3GTP I;  3CC2 Z;  1YJW 1;  4NBB A;  1X0T A;  3I4M I;  3I56 Z;  1M90 1;  2E2J I;  3BG0 B;  3JAM f;  3CC7 1;  3CCQ 1;  2GTI A;  3FKI I;  2PK7 A;  3OW2 Y;  5IP7 I;  2OTJ Z;  1TWH I;  3GKQ A;  4DGL A;  2QEX 1;  1VQK 1;  3S1M I;  4RVH A;  1Y1V I;  5A2Q b;  3EER A;  3CCR 1;  3CCJ 1;  3VMH A;  1VLA A;  1VQL Z;  1YI2 Z;  1W2B Y;  3Q87 A;  5C4X I;  1K73 2;  1K9M 1;  1TWA I;  2VUM I;  5T67 A;  2QRE B;  5FLM I;  3CCU Z;  4NBG A;  4EWC A;  2K3R A;  5IP9 I;  1YJW Z;  3GTM I;  1Q81 1;  1N2F A;  2DE6 A;  1Z01 A;  2YU9 I;  4A3M I;  3K7A I;  1YIT 1;  1M1K 2;  3CXC Z;  1PFT A;  1JWH C;  4E31 A;  2QA4 1;  1YJN 1;  3G4S Z;  3RZO I;  2V3V A;  2V45 A;  3F3F C;  1RLY A;  3EED A;  3CC4 1;  1JJ2 Y;  3CCV 1;  1VQK Z;  3TDH B;  1FDI A;  1YJ9 1;  4MH4 A;  2VUG A;  2YAD A;  3NH4 A;  1ZH1 A;  4HGY A;  3CME Z;  3CCR Z;  5CM2 M;  2VPW A;  3CCJ Z;  1KD1 2;  4S1T A;  1Q16 A;  2R93 I;  2R92 I;  3G6E Z;  2DE7 A;  5C4J I;  3CQZ I;  1VQ5 1;  1Q82 2;  1Q86 2;  4E32 A;  4MD9 A;  1Y1W I;  5D1O B;  3HOV I;  3KIF A;  5D1O A;  4NBH A;  3QWU A;  2NVT I;  4MD7 A;  2GTH A;  3I55 1;  4A3I I;  1VQ7 Z;  2O53 A;  2OOX B;  4NBF A;  1KD1 1;  1YIT Z;  3G71 Z;  1KC8 1;  2IZ3 A;  4MD8 A;  3GTO I;  3CD6 1;  1NUI A;  1VQN 1;  1YUK A;  3S2H I;  1VQP Z;  1Q86 1;  4BY1 I;  2M48 A;  3CPW Y;  3CCV Z;  2AKL A;  1YJ9 Z;  3J81 f;  2F4O A;  3MON A;  4E2Y A;  1NJI 1;  1Z02 A;  2VF1 A;  3M4O I;  2IZ4 A;  1TWG I;  1TWF I;  4NB9 A;  5AN9 F;  1YIJ 1;  1TWC I;  4E30 A;  4QTT A;  2OOY B;  2W04 A;  1RO2 A;  3FQM A;  3I07 A;  3HKZ A;  2JUB A;  4AYB A;  3CCE 1;  1QXF A;  2NVQ I;  4RVD A;  1YHQ 1;  2RPR A;  2O4H A;  5C44 I;  4CL1 A;  3PO3 S;  1ZB8 A;  2V8I A;  3NFZ A;  1S72 1;  2KPI A;  2LFU A;  4A3J I;  2JNY A;  1KQS Z;  5A2Q f;  2JA8 I;  1X3Z A;  2HU9 A;  3HOZ I;  4E2X A;  4NBD A;  3VMG A;  3HOW I;  2R6M A;  1K8A 2;  1VQ9 1;  1QYP A;  4HH4 A;  2E2H I;  4NB8 A;  3ESW A;  3CCL 1;  2VPX A;  2NVX I;  1TFI A;  3CXC Y;  2RT9 A;  2JA5 I;  3CCE Z;  3F3P C;  2JIQ A;  4TNU A;  1ZB9 A;  1WJ2 A;  3CC7 Z;  3CCQ Z;  1VQ8 1;  3U50 C;  3IX0 A;  2B63 I;  3CCM 1;  4NOZ A;  2JMO A;  1AA6 A;  2PM9 A;  1P9N A;  1K73 1;  2JA6 I;  5IT9 b;  1RO0 A;  4MON A;  1R9T I;  1DL6 A;  3S17 I;  2QRC B;  2W03 A;  2QEX Z;  3CMA 1;  1QF8 A;  1X3W A;  3NH8 A;  3S16 I;  4A3F I;  3S1Q I;  4A3C I;  4E2W A;  1VQ4 1;  3FQQ A;  1USP B;  1M1K 1;  2Q4Z A;  1USP A;  1VQ9 Z;  1VQ6 1;  2V8J A;  1QVG Z;  3PO3 I;  3HOY I;  2JR6 A;  5FLX b;  4E2Z A;  1RNI A;  2K5R A;  3D6W A;  1FDO A;  2E9H A;  1Z03 A;  1ML8 A;  3CCS 1;  3HOU I;  4HGZ A;  4Y52 I;  1Q7Y 2;  3IFU A;  2RBL A;  1JJ2 Z;  3BG1 B;  4RV9 A;  2QA4 Z;  1YJN Z;  1Q82 1;  1K83 I;  2LIY A;  3NH5 A;  4MXU A;  3PO2 I;  2P3Y A;  3CC4 Z;  2Q51 A;  4A3L I;  3J80 b;  2J6A A;  1VQM 1;  4DK1 A;  2OZK A;  1QVF Z;  1WCM I;  2GU2 A;  4MRI A;  2QR1 B;  4A3E I;  3GTG I;  2R7Z I;  1LQL A;  3TE5 B;  1VQ6 Z;  1VQ5 Z;  4BBS I;  2OTL 1;  3MZL B;  3S1N I;  3S1R I;  2M6N A;  1KQS Y;  2H85 A;  3T4N B;  3I55 Z;  1VQL 1;  4NBA A;  4A3G I;  4A93 I;  4NH1 C;  3CD6 Z;  1VQN Z;  3IR7 A;  2E2I I;  2AYD A;  4A3D I;  2P28 A;  4QTU A;  3NDI A;  1VQM Z;  3GTL I;  2KI7 B;  3M3Y I;  3JAM b;  3D9X A;  1K9M 2;  3VTN A;  4RVG A;  3G4S 1;  2VPY A;  1YIJ Z;  2JIM A;  2OTL Z;  2QKD A;  1Q81 2;  3S2D I;  3I4N I;  2BJO A;  2DE5 A;  5LL6 f;  3CME 1;  3OW2 Z;  1YHQ Z;  3GCF A;  2VPZ A;  1I3Q I;  1VQO 1;  5IT9 f;  3G6E 1;  5C3E I;  2V8K A;  2JIP A;  1K8A 1;  3VB9 A;  1S72 Z;  3RZD I;  1RO4 A;  4E33 A;  4NBE A;  2HF1 A;  2IV2 X;  2NAP A;  1L1O C;  3LUS A;  1W2B Z;  1WZN A;  1QVG Y;  1YUA A;  2ZAE B;  1N8R 2;  1VQ7 1;  4NFR A;  5D1P A;  1I6H I;  2JA7 I;  2RHB A;  3G71 1;  5FLX f;  3P5J B;  4RVF A;  1I50 I;  4BBR I;  1VQP 1;  3CCL Z;  4A3K I;  2I3C A;  3S14 I;  2WB1 A; 
#chains in the Genus database with same CATH homology
 4BXX I;  1S7M A;  1N8R 1;  3MZK B;  3HOX I;  1VQ8 Z;  1KC8 2;  3J7A 4;  3IF8 A;  4X6A I;  3CCM Z;  3VMI A;  1VQO Z;  1NP6 A;  1QVF Y;  1RQF A;  4DQY B;  2F4M A;  3CC2 1;  1Y1V S;  3J80 f;  3GTK I;  3I56 1;  2PMZ A;  1WW9 A;  4Y7N I;  4BY7 I;  5T64 A;  3CMA Z;  3GTJ I;  3GTQ I;  3S15 I;  4RS4 A;  1KRL A;  1WII A;  2NVY I;  1NJI 2;  4A3B I;  4NBC A;  1VQ4 Z;  2QRD B;  3H0G I;  2OTJ 1;  1Q7Y 1;  3NDJ A;  1SFO I;  5T6B A;  3GTM S;  3KIH A;  1M90 2;  2RIQ A;  4XX2 A;  2Y0S A;  2G2K A;  2WAQ A;  2EGT A;  3CCS Z;  1YI2 1;  3H3V J;  3J81 b;  3CPW Z;  2QLV B;  2JS4 A;  3CCU 1;  3GTP I;  3CC2 Z;  1YJW 1;  4NBB A;  1X0T A;  3I4M I;  3I56 Z;  1M90 1;  2E2J I;  3BG0 B;  3JAM f;  3CC7 1;  3CCQ 1;  2GTI A;  3FKI I;  2PK7 A;  3OW2 Y;  5IP7 I;  2OTJ Z;  1TWH I;  3GKQ A;  4DGL A;  2QEX 1;  1VQK 1;  3S1M I;  4RVH A;  1Y1V I;  5A2Q b;  3EER A;  3CCR 1;  3CCJ 1;  3VMH A;  1VLA A;  1VQL Z;  1YI2 Z;  1W2B Y;  3Q87 A;  5C4X I;  1K73 2;  1K9M 1;  1TWA I;  2VUM I;  5T67 A;  2QRE B;  5FLM I;  3CCU Z;  4NBG A;  4EWC A;  2K3R A;  5IP9 I;  1YJW Z;  3GTM I;  1Q81 1;  1N2F A;  2DE6 A;  1Z01 A;  2YU9 I;  4A3M I;  3K7A I;  1YIT 1;  1M1K 2;  3CXC Z;  1PFT A;  1JWH C;  4E31 A;  2QA4 1;  1YJN 1;  3G4S Z;  3RZO I;  3F3F C;  1RLY A;  3EED A;  3CC4 1;  1JJ2 Y;  3CCV 1;  1VQK Z;  3TDH B;  1YJ9 1;  4MH4 A;  2VUG A;  2YAD A;  3NH4 A;  1ZH1 A;  4HGY A;  3CME Z;  3CCR Z;  5CM2 M;  3CCJ Z;  1KD1 2;  4S1T A;  2R93 I;  2R92 I;  3G6E Z;  2DE7 A;  5C4J I;  3CQZ I;  1VQ5 1;  1Q82 2;  1Q86 2;  4E32 A;  4MD9 A;  1Y1W I;  5D1O B;  3HOV I;  3KIF A;  5D1O A;  4NBH A;  3QWU A;  2NVT I;  4MD7 A;  2GTH A;  3I55 1;  4A3I I;  1VQ7 Z;  2O53 A;  2OOX B;  4NBF A;  1KD1 1;  1YIT Z;  3G71 Z;  1KC8 1;  2IZ3 A;  4MD8 A;  3GTO I;  3CD6 1;  1NUI A;  1VQN 1;  1YUK A;  3S2H I;  1VQP Z;  1Q86 1;  4BY1 I;  2M48 A;  3CPW Y;  3CCV Z;  2AKL A;  1YJ9 Z;  3J81 f;  2F4O A;  3MON A;  4E2Y A;  1NJI 1;  1Z02 A;  2VF1 A;  3M4O I;  2IZ4 A;  1TWG I;  1TWF I;  4NB9 A;  5AN9 F;  1YIJ 1;  1TWC I;  4E30 A;  4QTT A;  2OOY B;  2W04 A;  1RO2 A;  3FQM A;  3I07 A;  3HKZ A;  2JUB A;  4AYB A;  3CCE 1;  2NVQ I;  4RVD A;  1YHQ 1;  2RPR A;  2O4H A;  5C44 I;  4CL1 A;  3PO3 S;  1ZB8 A;  2V8I A;  3NFZ A;  1S72 1;  2KPI A;  2LFU A;  4A3J I;  2JNY A;  1KQS Z;  5A2Q f;  2JA8 I;  1X3Z A;  2HU9 A;  3HOZ I;  4NBD A;  3VMG A;  4E2X A;  3HOW I;  2R6M A;  1K8A 2;  1VQ9 1;  1QYP A;  4HH4 A;  2E2H I;  4NB8 A;  3ESW A;  3CCL 1;  2NVX I;  1TFI A;  3CXC Y;  2RT9 A;  2JA5 I;  3CCE Z;  3F3P C;  4TNU A;  1ZB9 A;  3CC7 Z;  3CCQ Z;  1VQ8 1;  3U50 C;  3IX0 A;  2B63 I;  3CCM 1;  4NOZ A;  2JMO A;  2PM9 A;  1P9N A;  1K73 1;  2JA6 I;  5IT9 b;  1RO0 A;  4MON A;  1R9T I;  1DL6 A;  3S17 I;  2QRC B;  2W03 A;  2QEX Z;  3CMA 1;  1QF8 A;  1X3W A;  3NH8 A;  3S16 I;  4A3F I;  3S1Q I;  4A3C I;  4E2W A;  1VQ4 1;  3FQQ A;  1USP B;  1M1K 1;  2Q4Z A;  1USP A;  1VQ9 Z;  1VQ6 1;  2V8J A;  1QVG Z;  3PO3 I;  3HOY I;  2JR6 A;  5FLX b;  4E2Z A;  1RNI A;  2K5R A;  3D6W A;  2E9H A;  1Z03 A;  1ML8 A;  3CCS 1;  3HOU I;  4HGZ A;  4Y52 I;  1Q7Y 2;  3IFU A;  2RBL A;  1JJ2 Z;  3BG1 B;  4RV9 A;  2QA4 Z;  1YJN Z;  1Q82 1;  1K83 I;  2LIY A;  3NH5 A;  4MXU A;  3PO2 I;  2P3Y A;  3CC4 Z;  2Q51 A;  4A3L I;  3J80 b;  1VQM 1;  2J6A A;  4DK1 A;  2OZK A;  1QVF Z;  1WCM I;  2GU2 A;  4MRI A;  2QR1 B;  4A3E I;  3GTG I;  2R7Z I;  1LQL A;  3TE5 B;  1VQ6 Z;  1VQ5 Z;  4BBS I;  2OTL 1;  3MZL B;  3S1N I;  3S1R I;  2M6N A;  1KQS Y;  2H85 A;  3T4N B;  3I55 Z;  1VQL 1;  4NBA A;  4A3G I;  4A93 I;  4NH1 C;  3CD6 Z;  1VQN Z;  2E2I I;  4A3D I;  2P28 A;  4QTU A;  3NDI A;  1VQM Z;  3GTL I;  2KI7 B;  3M3Y I;  3JAM b;  3D9X A;  1K9M 2;  3VTN A;  4RVG A;  3G4S 1;  1YIJ Z;  2OTL Z;  2QKD A;  1Q81 2;  3S2D I;  3I4N I;  2BJO A;  2DE5 A;  5LL6 f;  3CME 1;  3OW2 Z;  1YHQ Z;  3GCF A;  1I3Q I;  1VQO 1;  5IT9 f;  3G6E 1;  5C3E I;  2V8K A;  1K8A 1;  3VB9 A;  1S72 Z;  3RZD I;  1RO4 A;  4E33 A;  4NBE A;  2HF1 A;  1L1O C;  3LUS A;  1W2B Z;  1QVG Y;  1YUA A;  2ZAE B;  1N8R 2;  1VQ7 1;  4NFR A;  5D1P A;  1I6H I;  2JA7 I;  2RHB A;  3G71 1;  5FLX f;  3P5J B;  4RVF A;  1I50 I;  4BBR I;  1VQP 1;  3CCL Z;  4A3K I;  2I3C A;  3S14 I;  2WB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...