2JMOA

Ibr domain of human parkin
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
80
structure length
80
Chain Sequence
GHMGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parkin
publication title Structure of the Parkin in-between-ring domain provides insights for E3-ligase dysfunction in autosomal recessive Parkinson's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 1
structure length 80
sequence length 80
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2006-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2jmoA01
2R6MA 2JMOA 2RT9A 2M48A 4DGLA 4NH1C 4MD9A 4MD7A 1QF8A 1JWHC 3EEDA 1RQFA 2M6NA 4MD8A
chains in the Genus database with same CATH superfamily
3CCL1 3CCRZ 3H3VJ 1USPA 5FLMI 2VPXA 4E2ZA 1YIT1 1KQSY 3EERA 4HH4A 3I56Z 1YI21 1RO2A 3D9XA 4DGLA 3U50C 2IV2X 3GTGI 1RLYA 1KC82 4QTTA 2LIYA 4A3GI 1QYPA 5IT9f 3GTKI 3MZLB 4E30A 1VQM1 4RS4A 1TWAI 4BBSI 1I6HI 2E9HA 1ZB8A 3CCLZ 2GTHA 3CCS1 1YITZ 2QA41 3CCJ1 3HOYI 3S1RI 2H85A 1YI2Z 1YJ91 1VQN1 1Q862 5D1OA 1YHQ1 2PMZA 3NFZA 2WAQA 1K731 1Q822 1M901 4A3JI 2JA5I 3HOVI 1Q7Y1 3S15I 2NVYI 3NDJA 4BBRI 1VQMZ 1M1K2 2HF1A 1S721 2AKLA 1KQSZ 2R93I 1K8A2 2V8IA 2QKDA 3VMGA 2JS4A 5D1PA 1N8R2 3CCSZ 3CCQ1 4NBHA 2HU9A 2QA4Z 1VQP1 3CCJZ 1YJ9Z 1VQNZ 2PM9A 3CD61 1YHQZ 1VQO1 3GTPI 3I4MI 3Q87A 3FQQA 2GTIA 4A93I 2B63I 3GKQA 3CME1 2E2JI 1S72Z 1FDIA 2OTL1 3S1QI 2RBLA 2VUMI 2QRDB 3CC71 2Q51A 3CQZI 3CCQZ 1NJI2 1VQPZ 2NVQI 4HGYA 1AA6A 2JA8I 3CD6Z 1VQOZ 4NB9A 3MZKB 2RT9A 1YJW1 1WJ2A 3S1NI 5FLXb 1VQ6Z 4A3KI 3CMEZ 1Y8CA 4XX2A 3CCM1 1X0TA 2OTLZ 1SFOI 4NBDA 4NBEA 1TWGI 1LQLA 2Q4ZA 3CC7Z 1K83I 4BY7I 2NVTI 4A3CI 1KD11 4HGZA 4MD9A 5D1OB 1WZNA 4S1TA 1NUIA 3NH8A 1P9NA 3S1MI 3ESWA 1VQK1 1VQ51 3J80f 5T6BA 1JJ2Z 3MONA 2AYDA 3D2LA 1YJWZ 2F4MA 2ZAEB 2NAPA 2YADA 3HOUI 3K7AI 3CXCY 1NP6A 1M1K1 3HOZI 2R92I 3J7A4 2I3CA 3CCMZ 2VF1A 4E2YA 2EGTA 3NH4A 2LFUA 1Z01A 3VTNA 2KPIA 1ZB9A 5CM2M 4A3LI 1QXFA 3VMIA 5A2Qb 2K3RA 2KI7B 4RV9A 5IP7I 2JA6I 4MH4A 1TWCI 4AYBA 2JR6A 3F3FC 2G2KA 1VQKZ 1VQ5Z 4NH1C 2OOYB 2J6AA 3J81b 1Y1WI 2W04A 3I551 3VB9A 3PO3I 3GTLI 3LUSA 3S14I 3F3PC 1K9M1 4NBFA 1RQFA 3IX0A 1VQ41 3GTMS 4BXXI 2V3VA 3T4NB 1VQ91 1KRLA 2OOXB 4MONA 2DE6A 2IZ3A 3JAMb 1Y1VS 4DK1A 3I4NI 3VMHA 2DE7A 4E2XA 1QF8A 3S16I 2BJOA 3CXCZ 3OW2Y 3I55Z 2R7ZI 3CC41 1VQ61 1WCMI 3CCV1 2JIQA 5C4JI 1Q16A 1VQ4Z 1Q811 1USPB 1N2FA 1WIIA 2E7ZA 3PO2I 1TFIA 5IT9b 2VPYA 3S17I 1K732 1VQ9Z 1QVFY 1M902 2RPRA 3CCE1 1KC81 5C3EI 1FDOA 4NB8A 1Q7Y2 3CPWY 2V8KA 1ML8A 4MRIA 2JA7I 2JIRA 3CMA1 3FQMA 2P28A 4Y7NI 1QVGY 4Y52I 5T64A 2V45A 5AN9F 3CC4Z 2JUBA 3GTQI 4NBGA 1YUAA 3CCVZ 1Z02A 2OZKA 3G4S1 2QEX1 1VQ81 1RNIA 1TWHI 4NOZA 5C4XI 1R9TI 3TE5B 1Q861 3CCEZ 1L1OC 2V8JA 3OW2Z 1VQ71 4CL1A 4MD7A 2JNYA 3CMAZ 1Q821 2F4OA 1RO4A 3IR7A 3JAMf 2O4HA 3EEDA 4A3II 4A3EI 2M6NA 4A3FI 1PFTA 3KIHA 2O53A 1K8A1 3G4SZ 3CCU1 1W2BY 2YU9I 1QVFZ 4E33A 1TWFI 2P3YA 2QEXZ 1VQL1 1JWHC 1VQ8Z 1N8R1 2JMOA 2PK7A 1VLAA 3CPWZ 1S7MA 2RIQA 3D6WA 4TNUA 1QVGZ 4RVDA 2WB1A 5T67A 2DE5A 1VQ7Z 1SIWA 2QLVB 4DQYB 3HKZA 4EWCA 2E2HI 3GCFA 3M4OI 2Y0SA 2JIOA 1RO0A 2R6MA 3G6E1 2RHBA 1KD12 2QR1B 3S2HI 3CCUZ 3GTJI 3BG1B 1VQLZ 5FLXf 1I3QI 2M48A 2IZ4A 5C44I 1NJI1 3M3YI 3KIFA 3S2DI 1YIJ1 3CC21 1Z03A 3BG0B 3IF8A 2OTJ1 3G711 3IFUA 1W2BZ 3GTOI 3FKII 3J80b 2JIMA 3G6EZ 1YJN1 3QWUA 2JIPA 4MXUA 1YUKA 2LEXA 2VUGA 3TDHB 4X6AI 1ZH1A 4A3MI 4RVGA 2NVXI 4NBCA 3I07A 5IP9I 4BY1I 3P5JB 4RVHA 2VPZA 4A3BI 1YIJZ 4MD8A 3CC2Z 5A2Qf 3NDIA 1JJ2Y 1K9M2 3HOWI 2OTJZ 3G71Z 1WW9A 3CCR1 5LL6f 2GU2A 3H0GI 3HOXI 2W03A 4RVFA 3GTMI 3I561 3J81f 2K5RA 2E2II 4E2WA 1YJNZ 1X3WA 4NFRA 2QREB 2QRCB 1Y1VI 4NBBA 4QTUA 4E32A 4A3DI 3PO3S 3RZDI 4NBAA 2VPWA 1DL6A 3NH5A 1I50I 1X3ZA 4E31A 3RZOI 1Q812
chains in the Genus database with same CATH topology
3CCL1 3CCRZ 3H3VJ 1USPA 5FLMI 4E2ZA 1YIT1 1KQSY 3EERA 4HH4A 3I56Z 1YI21 1RO2A 3D9XA 4DGLA 3U50C 3GTGI 1RLYA 1KC82 4QTTA 2LIYA 4A3GI 1QYPA 5IT9f 3GTKI 3MZLB 4E30A 1VQM1 4RS4A 1TWAI 4BBSI 1I6HI 2E9HA 1ZB8A 3CCLZ 2GTHA 3CCS1 1YITZ 2QA41 3CCJ1 3HOYI 3S1RI 2H85A 1YI2Z 1YJ91 1VQN1 1Q862 5D1OA 1YHQ1 2PMZA 3NFZA 2WAQA 1K731 1Q822 1M901 4A3JI 2JA5I 3HOVI 1Q7Y1 3S15I 2NVYI 3NDJA 4BBRI 1VQMZ 1M1K2 2HF1A 1S721 2AKLA 1KQSZ 2R93I 1K8A2 2V8IA 2QKDA 3VMGA 2JS4A 5D1PA 1N8R2 3CCSZ 3CCQ1 4NBHA 2HU9A 2QA4Z 1VQP1 3CCJZ 1YJ9Z 1VQNZ 2PM9A 3CD61 1YHQZ 1VQO1 3GTPI 3I4MI 3Q87A 3FQQA 2GTIA 4A93I 2B63I 3GKQA 3CME1 2E2JI 1S72Z 3S1QI 2OTL1 2RBLA 2VUMI 2QRDB 3CC71 2Q51A 3CQZI 3CCQZ 1NJI2 1VQPZ 2NVQI 4HGYA 2JA8I 3CD6Z 1VQOZ 4NB9A 3MZKB 2RT9A 1YJW1 3S1NI 5FLXb 1VQ6Z 4A3KI 3CMEZ 4XX2A 3CCM1 1X0TA 2OTLZ 1SFOI 4NBDA 4NBEA 1TWGI 1LQLA 2Q4ZA 3CC7Z 1K83I 4BY7I 2NVTI 4A3CI 1KD11 4HGZA 4MD9A 5D1OB 4S1TA 1NUIA 3NH8A 1P9NA 3S1MI 3ESWA 1VQK1 1VQ51 3J80f 5T6BA 1JJ2Z 3MONA 1YJWZ 2F4MA 2ZAEB 2YADA 3HOUI 3K7AI 3CXCY 1NP6A 1M1K1 3HOZI 2R92I 3J7A4 2I3CA 3CCMZ 2VF1A 4E2YA 2EGTA 3NH4A 2LFUA 1Z01A 3VTNA 2KPIA 1ZB9A 5CM2M 4A3LI 3VMIA 5A2Qb 2K3RA 2KI7B 4RV9A 5IP7I 2JA6I 4MH4A 1TWCI 4AYBA 2JR6A 3F3FC 2G2KA 1VQKZ 1VQ5Z 4NH1C 2OOYB 2J6AA 3J81b 1Y1WI 2W04A 3I551 3VB9A 3PO3I 3GTLI 3LUSA 3S14I 3F3PC 1K9M1 4NBFA 1RQFA 3IX0A 1VQ41 3GTMS 4BXXI 3T4NB 1VQ91 1KRLA 2OOXB 4MONA 2DE6A 2IZ3A 3JAMb 1Y1VS 4DK1A 3I4NI 3VMHA 2DE7A 4E2XA 1QF8A 3S16I 2BJOA 3CXCZ 3OW2Y 3I55Z 2R7ZI 3CC41 1VQ61 1WCMI 3CCV1 5C4JI 1VQ4Z 1Q811 1USPB 1N2FA 1WIIA 3PO2I 1TFIA 5IT9b 3S17I 1K732 1VQ9Z 1QVFY 1M902 2RPRA 3CCE1 1KC81 5C3EI 4NB8A 1Q7Y2 3CPWY 2V8KA 1ML8A 4MRIA 2JA7I 3CMA1 3FQMA 2P28A 4Y7NI 1QVGY 4Y52I 5T64A 5AN9F 3CC4Z 2JUBA 3GTQI 4NBGA 1YUAA 3CCVZ 1Z02A 2OZKA 3G4S1 2QEX1 1VQ81 1RNIA 1TWHI 4NOZA 5C4XI 1R9TI 3TE5B 1Q861 3CCEZ 1L1OC 2V8JA 3OW2Z 1VQ71 4CL1A 4MD7A 2JNYA 3CMAZ 1Q821 2F4OA 1RO4A 3JAMf 2O4HA 3EEDA 4A3II 4A3EI 2M6NA 4A3FI 1PFTA 3KIHA 2O53A 1K8A1 3G4SZ 3CCU1 1W2BY 2YU9I 1QVFZ 4E33A 1TWFI 2P3YA 2QEXZ 1VQL1 1JWHC 1VQ8Z 1N8R1 2JMOA 2PK7A 1VLAA 3CPWZ 1S7MA 2RIQA 3D6WA 4TNUA 1QVGZ 4RVDA 2WB1A 5T67A 2DE5A 1VQ7Z 2QLVB 4DQYB 3HKZA 4EWCA 2E2HI 3GCFA 3M4OI 2Y0SA 1RO0A 2R6MA 3G6E1 2RHBA 1KD12 2QR1B 3S2HI 3CCUZ 3GTJI 3BG1B 1VQLZ 5FLXf 1I3QI 2M48A 2IZ4A 5C44I 1NJI1 3M3YI 3KIFA 3S2DI 1YIJ1 3CC21 1Z03A 3BG0B 3IF8A 2OTJ1 3G711 3IFUA 1W2BZ 3GTOI 3FKII 3J80b 3G6EZ 1YJN1 3QWUA 4MXUA 1YUKA 2VUGA 3TDHB 4X6AI 1ZH1A 4A3MI 4RVGA 2NVXI 4NBCA 3I07A 5IP9I 4BY1I 3P5JB 4RVHA 4A3BI 1YIJZ 4MD8A 3CC2Z 5A2Qf 3NDIA 1JJ2Y 1K9M2 3HOWI 2OTJZ 3G71Z 1WW9A 3CCR1 5LL6f 2GU2A 3H0GI 3HOXI 2W03A 4RVFA 3GTMI 3I561 3J81f 2K5RA 2E2II 4E2WA 1YJNZ 1X3WA 4NFRA 2QREB 2QRCB 1Y1VI 4NBBA 4QTUA 4E32A 4A3DI 3PO3S 3RZDI 4NBAA 1DL6A 3NH5A 1I50I 1X3ZA 4E31A 3RZOI 1Q812
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R6M A;  2JMO A;  2RT9 A;  2M48 A;  4DGL A;  4NH1 C;  4MD9 A;  4MD7 A;  1QF8 A;  1JWH C;  3EED A;  1RQF A;  2M6N A;  4MD8 A; 
#chains in the Genus database with same CATH topology
 3CCL 1;  3CCR Z;  3H3V J;  1USP A;  5FLM I;  2VPX A;  4E2Z A;  1YIT 1;  1KQS Y;  3EER A;  4HH4 A;  3I56 Z;  1YI2 1;  1RO2 A;  3D9X A;  4DGL A;  3U50 C;  2IV2 X;  3GTG I;  1RLY A;  1KC8 2;  4QTT A;  2LIY A;  4A3G I;  1QYP A;  5IT9 f;  3GTK I;  3MZL B;  4E30 A;  1VQM 1;  4RS4 A;  1TWA I;  4BBS I;  1I6H I;  2E9H A;  1ZB8 A;  3CCL Z;  2GTH A;  3CCS 1;  1YIT Z;  2QA4 1;  3CCJ 1;  3HOY I;  3S1R I;  2H85 A;  1YI2 Z;  1YJ9 1;  1VQN 1;  1Q86 2;  5D1O A;  1YHQ 1;  2PMZ A;  3NFZ A;  2WAQ A;  1K73 1;  1Q82 2;  1M90 1;  4A3J I;  2JA5 I;  3HOV I;  1Q7Y 1;  3S15 I;  2NVY I;  3NDJ A;  4BBR I;  1VQM Z;  1M1K 2;  2HF1 A;  1S72 1;  2AKL A;  1KQS Z;  2R93 I;  1K8A 2;  2V8I A;  2QKD A;  3VMG A;  2JS4 A;  5D1P A;  1N8R 2;  3CCS Z;  3CCQ 1;  4NBH A;  2HU9 A;  2QA4 Z;  1VQP 1;  3CCJ Z;  1YJ9 Z;  1VQN Z;  2PM9 A;  3CD6 1;  1YHQ Z;  1VQO 1;  3GTP I;  3I4M I;  3Q87 A;  3FQQ A;  2GTI A;  4A93 I;  2B63 I;  3GKQ A;  3CME 1;  2E2J I;  1S72 Z;  1FDI A;  2OTL 1;  3S1Q I;  2RBL A;  2VUM I;  2QRD B;  3CC7 1;  2Q51 A;  3CQZ I;  3CCQ Z;  1NJI 2;  1VQP Z;  2NVQ I;  4HGY A;  1AA6 A;  2JA8 I;  3CD6 Z;  1VQO Z;  4NB9 A;  3MZK B;  2RT9 A;  1YJW 1;  1WJ2 A;  3S1N I;  5FLX b;  1VQ6 Z;  4A3K I;  3CME Z;  1Y8C A;  4XX2 A;  3CCM 1;  1X0T A;  2OTL Z;  1SFO I;  4NBD A;  4NBE A;  1TWG I;  1LQL A;  2Q4Z A;  3CC7 Z;  1K83 I;  4BY7 I;  2NVT I;  4A3C I;  1KD1 1;  4HGZ A;  4MD9 A;  5D1O B;  1WZN A;  4S1T A;  1NUI A;  3NH8 A;  1P9N A;  3S1M I;  3ESW A;  1VQK 1;  1VQ5 1;  3J80 f;  5T6B A;  1JJ2 Z;  3MON A;  2AYD A;  3D2L A;  1YJW Z;  2F4M A;  2ZAE B;  2NAP A;  2YAD A;  3HOU I;  3K7A I;  3CXC Y;  1NP6 A;  1M1K 1;  3HOZ I;  2R92 I;  3J7A 4;  2I3C A;  3CCM Z;  2VF1 A;  4E2Y A;  2EGT A;  3NH4 A;  2LFU A;  1Z01 A;  3VTN A;  2KPI A;  1ZB9 A;  5CM2 M;  4A3L I;  1QXF A;  3VMI A;  5A2Q b;  2K3R A;  2KI7 B;  4RV9 A;  5IP7 I;  2JA6 I;  4MH4 A;  1TWC I;  4AYB A;  2JR6 A;  3F3F C;  2G2K A;  1VQK Z;  1VQ5 Z;  4NH1 C;  2OOY B;  2J6A A;  3J81 b;  1Y1W I;  2W04 A;  3I55 1;  3VB9 A;  3PO3 I;  3GTL I;  3LUS A;  3S14 I;  3F3P C;  1K9M 1;  4NBF A;  1RQF A;  3IX0 A;  1VQ4 1;  3GTM S;  4BXX I;  2V3V A;  3T4N B;  1VQ9 1;  1KRL A;  2OOX B;  4MON A;  2DE6 A;  2IZ3 A;  3JAM b;  1Y1V S;  4DK1 A;  3I4N I;  3VMH A;  2DE7 A;  4E2X A;  1QF8 A;  3S16 I;  2BJO A;  3CXC Z;  3OW2 Y;  3I55 Z;  2R7Z I;  3CC4 1;  1VQ6 1;  1WCM I;  3CCV 1;  2JIQ A;  5C4J I;  1Q16 A;  1VQ4 Z;  1Q81 1;  1USP B;  1N2F A;  1WII A;  2E7Z A;  3PO2 I;  1TFI A;  5IT9 b;  2VPY A;  3S17 I;  1K73 2;  1VQ9 Z;  1QVF Y;  1M90 2;  2RPR A;  3CCE 1;  1KC8 1;  5C3E I;  1FDO A;  4NB8 A;  1Q7Y 2;  3CPW Y;  2V8K A;  1ML8 A;  4MRI A;  2JA7 I;  2JIR A;  3CMA 1;  3FQM A;  2P28 A;  4Y7N I;  1QVG Y;  4Y52 I;  5T64 A;  2V45 A;  5AN9 F;  3CC4 Z;  2JUB A;  3GTQ I;  4NBG A;  1YUA A;  3CCV Z;  1Z02 A;  2OZK A;  3G4S 1;  2QEX 1;  1VQ8 1;  1RNI A;  1TWH I;  4NOZ A;  5C4X I;  1R9T I;  3TE5 B;  1Q86 1;  3CCE Z;  1L1O C;  2V8J A;  3OW2 Z;  1VQ7 1;  4CL1 A;  4MD7 A;  2JNY A;  3CMA Z;  1Q82 1;  2F4O A;  1RO4 A;  3IR7 A;  3JAM f;  2O4H A;  3EED A;  4A3I I;  4A3E I;  2M6N A;  4A3F I;  1PFT A;  3KIH A;  2O53 A;  1K8A 1;  3G4S Z;  3CCU 1;  1W2B Y;  2YU9 I;  1QVF Z;  4E33 A;  1TWF I;  2P3Y A;  2QEX Z;  1VQL 1;  1JWH C;  1VQ8 Z;  1N8R 1;  2JMO A;  2PK7 A;  1VLA A;  3CPW Z;  1S7M A;  2RIQ A;  3D6W A;  4TNU A;  1QVG Z;  4RVD A;  2WB1 A;  5T67 A;  2DE5 A;  1VQ7 Z;  1SIW A;  2QLV B;  4DQY B;  3HKZ A;  4EWC A;  2E2H I;  3GCF A;  3M4O I;  2Y0S A;  2JIO A;  1RO0 A;  2R6M A;  3G6E 1;  2RHB A;  1KD1 2;  2QR1 B;  3S2H I;  3CCU Z;  3GTJ I;  3BG1 B;  1VQL Z;  5FLX f;  1I3Q I;  2M48 A;  2IZ4 A;  5C44 I;  1NJI 1;  3M3Y I;  3KIF A;  3S2D I;  1YIJ 1;  3CC2 1;  1Z03 A;  3BG0 B;  3IF8 A;  2OTJ 1;  3G71 1;  3IFU A;  1W2B Z;  3GTO I;  3FKI I;  3J80 b;  2JIM A;  3G6E Z;  1YJN 1;  3QWU A;  2JIP A;  4MXU A;  1YUK A;  2LEX A;  2VUG A;  3TDH B;  4X6A I;  1ZH1 A;  4A3M I;  4RVG A;  2NVX I;  4NBC A;  3I07 A;  5IP9 I;  4BY1 I;  3P5J B;  4RVH A;  2VPZ A;  4A3B I;  1YIJ Z;  4MD8 A;  3CC2 Z;  5A2Q f;  3NDI A;  1JJ2 Y;  1K9M 2;  3HOW I;  2OTJ Z;  3G71 Z;  1WW9 A;  3CCR 1;  5LL6 f;  2GU2 A;  3H0G I;  3HOX I;  2W03 A;  4RVF A;  3GTM I;  3I56 1;  3J81 f;  2K5R A;  2E2I I;  4E2W A;  1YJN Z;  1X3W A;  4NFR A;  2QRE B;  2QRC B;  1Y1V I;  4NBB A;  4QTU A;  4E32 A;  4A3D I;  3PO3 S;  3RZD I;  4NBA A;  2VPW A;  1DL6 A;  3NH5 A;  1I50 I;  1X3Z A;  4E31 A;  3RZO I;  1Q81 2; 
#chains in the Genus database with same CATH homology
 3CCL 1;  3CCR Z;  3H3V J;  1USP A;  5FLM I;  4E2Z A;  1YIT 1;  1KQS Y;  3EER A;  4HH4 A;  3I56 Z;  1YI2 1;  1RO2 A;  3D9X A;  4DGL A;  3U50 C;  3GTG I;  1RLY A;  1KC8 2;  4QTT A;  2LIY A;  4A3G I;  1QYP A;  5IT9 f;  3GTK I;  3MZL B;  4E30 A;  1VQM 1;  4RS4 A;  1TWA I;  4BBS I;  1I6H I;  2E9H A;  1ZB8 A;  3CCL Z;  2GTH A;  3CCS 1;  1YIT Z;  2QA4 1;  3CCJ 1;  3HOY I;  3S1R I;  2H85 A;  1YI2 Z;  1YJ9 1;  1VQN 1;  1Q86 2;  5D1O A;  1YHQ 1;  2PMZ A;  3NFZ A;  2WAQ A;  1K73 1;  1Q82 2;  1M90 1;  4A3J I;  2JA5 I;  3HOV I;  1Q7Y 1;  3S15 I;  2NVY I;  3NDJ A;  4BBR I;  1VQM Z;  1M1K 2;  2HF1 A;  1S72 1;  2AKL A;  1KQS Z;  2R93 I;  1K8A 2;  2V8I A;  2QKD A;  3VMG A;  2JS4 A;  5D1P A;  1N8R 2;  3CCS Z;  3CCQ 1;  4NBH A;  2HU9 A;  2QA4 Z;  1VQP 1;  3CCJ Z;  1YJ9 Z;  1VQN Z;  2PM9 A;  3CD6 1;  1YHQ Z;  1VQO 1;  3GTP I;  3I4M I;  3Q87 A;  3FQQ A;  2GTI A;  4A93 I;  2B63 I;  3GKQ A;  3CME 1;  2E2J I;  1S72 Z;  3S1Q I;  2OTL 1;  2RBL A;  2VUM I;  2QRD B;  3CC7 1;  2Q51 A;  3CQZ I;  3CCQ Z;  1NJI 2;  1VQP Z;  2NVQ I;  4HGY A;  2JA8 I;  3CD6 Z;  1VQO Z;  4NB9 A;  3MZK B;  2RT9 A;  1YJW 1;  3S1N I;  5FLX b;  1VQ6 Z;  4A3K I;  3CME Z;  4XX2 A;  3CCM 1;  1X0T A;  2OTL Z;  1SFO I;  4NBD A;  4NBE A;  1TWG I;  1LQL A;  2Q4Z A;  3CC7 Z;  1K83 I;  4BY7 I;  2NVT I;  4A3C I;  1KD1 1;  4HGZ A;  4MD9 A;  5D1O B;  4S1T A;  1NUI A;  3NH8 A;  1P9N A;  3S1M I;  3ESW A;  1VQK 1;  1VQ5 1;  3J80 f;  5T6B A;  1JJ2 Z;  3MON A;  1YJW Z;  2F4M A;  2ZAE B;  2YAD A;  3HOU I;  3K7A I;  3CXC Y;  1NP6 A;  1M1K 1;  3HOZ I;  2R92 I;  3J7A 4;  2I3C A;  3CCM Z;  2VF1 A;  4E2Y A;  2EGT A;  3NH4 A;  2LFU A;  1Z01 A;  3VTN A;  2KPI A;  1ZB9 A;  5CM2 M;  4A3L I;  3VMI A;  5A2Q b;  2K3R A;  2KI7 B;  4RV9 A;  5IP7 I;  2JA6 I;  4MH4 A;  1TWC I;  4AYB A;  2JR6 A;  3F3F C;  2G2K A;  1VQK Z;  1VQ5 Z;  4NH1 C;  2OOY B;  2J6A A;  3J81 b;  1Y1W I;  2W04 A;  3I55 1;  3VB9 A;  3PO3 I;  3GTL I;  3LUS A;  3S14 I;  3F3P C;  1K9M 1;  4NBF A;  1RQF A;  3IX0 A;  1VQ4 1;  3GTM S;  4BXX I;  3T4N B;  1VQ9 1;  1KRL A;  2OOX B;  4MON A;  2DE6 A;  2IZ3 A;  3JAM b;  1Y1V S;  4DK1 A;  3I4N I;  3VMH A;  2DE7 A;  4E2X A;  1QF8 A;  3S16 I;  2BJO A;  3CXC Z;  3OW2 Y;  3I55 Z;  2R7Z I;  3CC4 1;  1VQ6 1;  1WCM I;  3CCV 1;  5C4J I;  1VQ4 Z;  1Q81 1;  1USP B;  1N2F A;  1WII A;  3PO2 I;  1TFI A;  5IT9 b;  3S17 I;  1K73 2;  1VQ9 Z;  1QVF Y;  1M90 2;  2RPR A;  3CCE 1;  1KC8 1;  5C3E I;  4NB8 A;  1Q7Y 2;  3CPW Y;  2V8K A;  1ML8 A;  4MRI A;  2JA7 I;  3CMA 1;  3FQM A;  2P28 A;  4Y7N I;  1QVG Y;  4Y52 I;  5T64 A;  5AN9 F;  3CC4 Z;  2JUB A;  3GTQ I;  4NBG A;  1YUA A;  3CCV Z;  1Z02 A;  2OZK A;  3G4S 1;  2QEX 1;  1VQ8 1;  1RNI A;  1TWH I;  4NOZ A;  5C4X I;  1R9T I;  3TE5 B;  1Q86 1;  3CCE Z;  1L1O C;  2V8J A;  3OW2 Z;  1VQ7 1;  4CL1 A;  4MD7 A;  2JNY A;  3CMA Z;  1Q82 1;  2F4O A;  1RO4 A;  3JAM f;  2O4H A;  3EED A;  4A3I I;  4A3E I;  2M6N A;  4A3F I;  1PFT A;  3KIH A;  2O53 A;  1K8A 1;  3G4S Z;  3CCU 1;  1W2B Y;  2YU9 I;  1QVF Z;  4E33 A;  1TWF I;  2P3Y A;  2QEX Z;  1VQL 1;  1JWH C;  1VQ8 Z;  1N8R 1;  2JMO A;  2PK7 A;  1VLA A;  3CPW Z;  1S7M A;  2RIQ A;  3D6W A;  4TNU A;  1QVG Z;  4RVD A;  2WB1 A;  5T67 A;  2DE5 A;  1VQ7 Z;  2QLV B;  4DQY B;  3HKZ A;  4EWC A;  2E2H I;  3GCF A;  3M4O I;  2Y0S A;  1RO0 A;  2R6M A;  3G6E 1;  2RHB A;  1KD1 2;  2QR1 B;  3S2H I;  3CCU Z;  3GTJ I;  3BG1 B;  1VQL Z;  5FLX f;  1I3Q I;  2M48 A;  2IZ4 A;  5C44 I;  1NJI 1;  3M3Y I;  3KIF A;  3S2D I;  1YIJ 1;  3CC2 1;  1Z03 A;  3BG0 B;  3IF8 A;  2OTJ 1;  3G71 1;  3IFU A;  1W2B Z;  3GTO I;  3FKI I;  3J80 b;  3G6E Z;  1YJN 1;  3QWU A;  4MXU A;  1YUK A;  2VUG A;  3TDH B;  4X6A I;  1ZH1 A;  4A3M I;  4RVG A;  2NVX I;  4NBC A;  3I07 A;  5IP9 I;  4BY1 I;  3P5J B;  4RVH A;  4A3B I;  1YIJ Z;  4MD8 A;  3CC2 Z;  5A2Q f;  3NDI A;  1JJ2 Y;  1K9M 2;  3HOW I;  2OTJ Z;  3G71 Z;  1WW9 A;  3CCR 1;  5LL6 f;  2GU2 A;  3H0G I;  3HOX I;  2W03 A;  4RVF A;  3GTM I;  3I56 1;  3J81 f;  2K5R A;  2E2I I;  4E2W A;  1YJN Z;  1X3W A;  4NFR A;  2QRE B;  2QRC B;  1Y1V I;  4NBB A;  4QTU A;  4E32 A;  4A3D I;  3PO3 S;  3RZD I;  4NBA A;  1DL6 A;  3NH5 A;  1I50 I;  1X3Z A;  4E31 A;  3RZO I;  1Q81 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...