2JMOA

Ibr domain of human parkin
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
80
structure length
80
Chain Sequence
GHMGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Parkin
publication title Structure of the Parkin in-between-ring domain provides insights for E3-ligase dysfunction in autosomal recessive Parkinson's disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 1
structure length 80
sequence length 80
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2006-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2jmoA01
1RQFA 2JMOA 2M6NA 4DGLA 2R6MA 3EEDA 4NH1C 2RT9A 4MD8A 4MD7A 1JWHC 1QF8A 2M48A 4MD9A
chains in the Genus database with same CATH superfamily
3NDIA 2KPIA 1X3ZA 1WJ2A 1VQNZ 1KQSY 4E2XA 1FDIA 2V8IA 3PO2I 2NVQI 2H85A 2W03A 1RO2A 4HH4A 5IT9f 3CCJ1 4A3BI 2JS4A 3NH5A 4RVHA 2OTL1 2OOXB 2VPZA 1YI2Z 4CL1A 3T4NB 3CQZI 1VQ81 1VQ71 4RV9A 4A3CI 1SFOI 4A3II 1VQ41 1K83I 1TFIA 4S1TA 2HU9A 3CCJZ 1Y1VS 4RVFA 2OTLZ 4NBEA 2LEXA 5D1OB 1VQ8Z 1VQ7Z 5T6BA 2O4HA 5CM2M 5C3EI 1VQK1 1VQ4Z 3Q87A 3P5JB 2B63I 3MZLB 2V8KA 3VMIA 3S14I 4E2YA 3GTPI 3GTKI 1M901 1M1K2 4BXXI 3NFZA 4TNUA 3BG1B 1QXFA 1VQM1 4DGLA 4MRIA 3M3YI 2F4OA 1KD11 1VQKZ 5D1OA 3M4OI 3GCFA 4NBDA 3HOZI 2RBLA 2GU2A 2AKLA 3CCR1 4NBHA 4MXUA 3GTGI 1RO0A 4MONA 5T64A 3J81f 4AYBA 1ZB8A 3CCL1 5FLXf 2AYDA 3CCRZ 1USPA 1YIJ1 5T67A 1K9M2 2OTJ1 3S17I 1Q822 1K732 1VQO1 3CCLZ 4Y52I 3MZKB 4EWCA 1KC82 1K8A2 1QVGZ 3CCS1 4MD9A 1PFTA 1RQFA 2O53A 3S1MI 3VTNA 5C4JI 1YIJZ 4A3JI 2OTJZ 2LFUA 1VQOZ 4BY7I 1YJW1 5LL6f 3F3FC 2QRCB 3G711 2PM9A 2VPYA 2RIQA 2BJOA 3CCSZ 1Y8CA 5IP7I 1VQ51 3GTOI 2PMZA 3CCQ1 1Z02A 4A3FI 1QF8A 2E2II 1QVGY 2KI7B 4A93I 1YJWZ 3G71Z 3D6WA 3QWUA 1Q16A 2JMOA 1Q7Y1 2JA8I 3KIFA 1VQ5Z 3I4NI 2E7ZA 3CC41 3CCQZ 2E9HA 3TDHB 4NH1C 1NJI2 2RT9A 4NBAA 3S15I 4NOZA 4NB9A 3J80b 1DL6A 3G4S1 2I3CA 2DE7A 1P9NA 2GTIA 2IZ4A 3HOUI 2HF1A 3HOYI 3J81b 2VF1A 3CC4Z 4E30A 4QTUA 5AN9F 1L1OC 3S1QI 3PO3I 2J6AA 3IX0A 4E2WA 5FLXb 3HOVI 3G4SZ 3MONA 5A2Qb 1R9TI 3K7AI 1VQ91 1WW9A 3I07A 1ZH1A 1S7MA 1VLAA 1Q861 3FKII 2M6NA 3KIHA 4X6AI 2V45A 3S16I 4MH4A 1Q811 1TWHI 4E2ZA 4XX2A 1JJ2Z 3S2DI 2OOYB 3RZOI 1WIIA 2NAPA 3VMHA 1N2FA 1VQ9Z 3BG0B 2R93I 4MD8A 1Z03A 3CCU1 1SIWA 2Q51A 3FQMA 3CXCZ 3J7A4 2W04A 1N8R2 3HOWI 3CCE1 3NH8A 2R92I 2NVTI 3CD61 2QEX1 3IR7A 4HGYA 4A3LI 3D9XA 1JJ2Y 3CCUZ 4Y7NI 3GTLI 1AA6A 4RVDA 1I6HI 3IF8A 3CCEZ 3CD6Z 2QEXZ 1YUKA 3CC71 1YJN1 3CXCY 3S2HI 4A3KI 1TWCI 2WAQA 3HKZA 5IT9b 3G6E1 2VPWA 1YJ91 1Y1WI 3CPWY 3CC7Z 1QYPA 1YJNZ 3I4MI 2JIMA 3G6EZ 1YJ9Z 2R6MA 1VQP1 2QLVB 2M48A 1RNIA 1TWFI 2QR1B 2QKDA 4NBBA 2E2HI 2EGTA 4DQYB 1M902 3CC21 1TWAI 1JWHC 1M1K1 3CME1 2QA41 2V8JA 1VQPZ 1TWGI 2VUGA 3GTMI 2NVXI 1WCMI 2G2KA 2K3RA 1W2BZ 1KD12 1RO4A 1I3QI 2JR6A 2Y0SA 3VMGA 5D1PA 2IV2X 2R7ZI 3CC2Z 1Z01A 3I551 1VQL1 2ZAEB 2JIOA 2GTHA 2Q4ZA 3CMEZ 2QA4Z 3CCM1 3FQQA 2DE6A 5C4XI 2V3VA 3JAMf 4NBCA 3GTQI 3TE5B 1YIT1 5IP9I 4A3EI 3H3VJ 1X3WA 4NBFA 4NFRA 4QTTA 4A3MI 1W2BY 2VUMI 2JUBA 3HOXI 1NP6A 2PK7A 3I55Z 1VQLZ 2P28A 3CCMZ 4HGZA 2JIRA 3ESWA 4NB8A 2VPXA 1K9M1 1Q821 1K731 1NUIA 1YITZ 1S721 1KC81 1K8A1 1ZB9A 2DE5A 2JIQA 3IFUA 4RS4A 3I561 1RLYA 2JNYA 4E33A 2WB1A 1S72Z 3S1RI 4BBSI 3H0GI 1Y1VI 4A3GI 4RVGA 1QVFZ 3I56Z 1I50I 3CPWZ 1WZNA 2JA7I 1LQLA 1Q7Y2 2K5RA 4A3DI 1KRLA 3D2LA 1X0TA 2OZKA 3LUSA 4E32A 1YHQ1 4E31A 3GTJI 1USPB 3F3PC 1NJI1 3J80f 3OW2Z 2IZ3A 1ML8A 2QRDB 1FDOA 1VQMZ 1QVFY 2QREB 3JAMb 1YHQZ 4BY1I 4MD7A 4BBRI 2JA5I 5A2Qf 3EERA 2E2JI 1Q862 3OW2Y 2F4MA 1Q812 3EEDA 1VQ61 2NVYI 5C44I 2JA6I 1YUAA 3GTMS 2RHBA 3CMA1 2YADA 3NDJA 2LIYA 3VB9A 2JIPA 3NH4A 5FLMI 2RPRA 3GKQA 3U50C 1KQSZ 1VQ6Z 3CCV1 4DK1A 3CMAZ 1VQN1 1N8R1 3S1NI 3PO3S 2P3YA 4NBGA 2YU9I 3RZDI 3CCVZ 1YI21
chains in the Genus database with same CATH topology
3NDIA 2KPIA 1X3ZA 1VQNZ 1KQSY 4E2XA 2V8IA 3PO2I 2NVQI 2H85A 2W03A 1RO2A 4HH4A 5IT9f 3CCJ1 4A3BI 2JS4A 3NH5A 4RVHA 2OTL1 2OOXB 1YI2Z 4CL1A 3T4NB 3CQZI 1VQ81 1VQ71 4RV9A 4A3CI 1SFOI 4A3II 1VQ41 1K83I 1TFIA 4S1TA 2HU9A 3CCJZ 1Y1VS 4RVFA 2OTLZ 4NBEA 5D1OB 1VQ8Z 1VQ7Z 5T6BA 2O4HA 5CM2M 5C3EI 1VQK1 1VQ4Z 3Q87A 3P5JB 2B63I 3MZLB 2V8KA 3VMIA 3S14I 4E2YA 3GTPI 3GTKI 1M901 1M1K2 4BXXI 3NFZA 4TNUA 3BG1B 1VQM1 4DGLA 4MRIA 3M3YI 2F4OA 1KD11 1VQKZ 5D1OA 3M4OI 3GCFA 4NBDA 3HOZI 2RBLA 2GU2A 2AKLA 3CCR1 4NBHA 4MXUA 3GTGI 1RO0A 4MONA 5T64A 3J81f 4AYBA 1ZB8A 3CCL1 5FLXf 3CCRZ 1USPA 1YIJ1 5T67A 1K9M2 2OTJ1 3S17I 1Q822 1K732 1VQO1 3CCLZ 4Y52I 3MZKB 4EWCA 1KC82 1K8A2 1QVGZ 3CCS1 4MD9A 1PFTA 1RQFA 2O53A 3S1MI 3VTNA 5C4JI 1YIJZ 4A3JI 2OTJZ 2LFUA 1VQOZ 4BY7I 1YJW1 5LL6f 3F3FC 2QRCB 3G711 2PM9A 2RIQA 2BJOA 3CCSZ 5IP7I 1VQ51 3GTOI 2PMZA 3CCQ1 1Z02A 4A3FI 1QF8A 2E2II 1QVGY 2KI7B 4A93I 1YJWZ 3G71Z 3D6WA 3QWUA 2JMOA 1Q7Y1 2JA8I 3KIFA 1VQ5Z 3I4NI 3CC41 3CCQZ 2E9HA 3TDHB 4NH1C 1NJI2 2RT9A 4NBAA 3S15I 4NOZA 4NB9A 3J80b 1DL6A 3G4S1 2I3CA 2DE7A 1P9NA 2GTIA 2IZ4A 3HOUI 2HF1A 3HOYI 3J81b 2VF1A 3CC4Z 4E30A 4QTUA 5AN9F 1L1OC 3S1QI 3PO3I 2J6AA 3IX0A 4E2WA 5FLXb 3HOVI 3G4SZ 3MONA 5A2Qb 1R9TI 3K7AI 1VQ91 1WW9A 3I07A 1ZH1A 1S7MA 1VLAA 1Q861 3FKII 2M6NA 3KIHA 4X6AI 3S16I 4MH4A 1Q811 1TWHI 4E2ZA 4XX2A 1JJ2Z 3S2DI 2OOYB 3RZOI 1WIIA 3VMHA 1N2FA 1VQ9Z 3BG0B 2R93I 4MD8A 1Z03A 3CCU1 2Q51A 3FQMA 3CXCZ 3J7A4 2W04A 1N8R2 3HOWI 3CCE1 3NH8A 2R92I 2NVTI 3CD61 2QEX1 4HGYA 4A3LI 3D9XA 1JJ2Y 3CCUZ 4Y7NI 3GTLI 4RVDA 1I6HI 3IF8A 3CCEZ 3CD6Z 2QEXZ 1YUKA 3CC71 1YJN1 3CXCY 3S2HI 4A3KI 1TWCI 2WAQA 3HKZA 5IT9b 3G6E1 1YJ91 1Y1WI 3CPWY 3CC7Z 1QYPA 1YJNZ 3I4MI 3G6EZ 1YJ9Z 2R6MA 1VQP1 2QLVB 2M48A 1RNIA 1TWFI 2QR1B 2QKDA 4NBBA 2E2HI 2EGTA 4DQYB 1M902 3CC21 1TWAI 1JWHC 1M1K1 3CME1 2QA41 2V8JA 1VQPZ 1TWGI 2VUGA 3GTMI 2NVXI 1WCMI 2G2KA 2K3RA 1W2BZ 1KD12 1RO4A 1I3QI 2JR6A 2Y0SA 3VMGA 5D1PA 2R7ZI 3CC2Z 1Z01A 3I551 1VQL1 2ZAEB 2GTHA 2Q4ZA 3CMEZ 2QA4Z 3FQQA 3CCM1 2DE6A 5C4XI 3JAMf 4NBCA 3GTQI 3TE5B 1YIT1 5IP9I 4A3EI 3H3VJ 1X3WA 4NBFA 4NFRA 4QTTA 4A3MI 1W2BY 2VUMI 2JUBA 3HOXI 1NP6A 2PK7A 3I55Z 1VQLZ 2P28A 3CCMZ 4HGZA 3ESWA 4NB8A 1K9M1 1Q821 1K731 1NUIA 1YITZ 1S721 1KC81 1K8A1 1ZB9A 2DE5A 3IFUA 4RS4A 3I561 1RLYA 2JNYA 4E33A 2WB1A 1S72Z 3S1RI 4BBSI 3H0GI 1Y1VI 4A3GI 4RVGA 1QVFZ 3I56Z 1I50I 3CPWZ 2JA7I 1LQLA 1Q7Y2 2K5RA 4A3DI 1KRLA 1X0TA 2OZKA 3LUSA 4E32A 1YHQ1 4E31A 3GTJI 1USPB 3F3PC 1NJI1 3J80f 3OW2Z 2IZ3A 1ML8A 2QRDB 1VQMZ 1QVFY 2QREB 3JAMb 1YHQZ 4BY1I 4MD7A 4BBRI 2JA5I 5A2Qf 3EERA 2E2JI 1Q862 3OW2Y 2F4MA 1Q812 3EEDA 1VQ61 2NVYI 5C44I 2JA6I 1YUAA 3GTMS 2RHBA 3CMA1 2YADA 3NDJA 2LIYA 3VB9A 3NH4A 5FLMI 2RPRA 3GKQA 3U50C 1KQSZ 1VQ6Z 3CCV1 4DK1A 3CMAZ 1VQN1 1N8R1 3S1NI 3PO3S 2P3YA 4NBGA 2YU9I 3RZDI 3CCVZ 1YI21
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RQF A;  2JMO A;  2M6N A;  4DGL A;  2R6M A;  3EED A;  4NH1 C;  2RT9 A;  4MD8 A;  4MD7 A;  1JWH C;  1QF8 A;  2M48 A;  4MD9 A; 
#chains in the Genus database with same CATH topology
 3NDI A;  2KPI A;  1X3Z A;  1WJ2 A;  1VQN Z;  1KQS Y;  4E2X A;  1FDI A;  2V8I A;  3PO2 I;  2NVQ I;  2H85 A;  2W03 A;  1RO2 A;  4HH4 A;  5IT9 f;  3CCJ 1;  4A3B I;  2JS4 A;  3NH5 A;  4RVH A;  2OTL 1;  2OOX B;  2VPZ A;  1YI2 Z;  4CL1 A;  3T4N B;  3CQZ I;  1VQ8 1;  1VQ7 1;  4RV9 A;  4A3C I;  1SFO I;  4A3I I;  1VQ4 1;  1K83 I;  1TFI A;  4S1T A;  2HU9 A;  3CCJ Z;  1Y1V S;  4RVF A;  2OTL Z;  4NBE A;  2LEX A;  5D1O B;  1VQ8 Z;  1VQ7 Z;  5T6B A;  2O4H A;  5CM2 M;  5C3E I;  1VQK 1;  1VQ4 Z;  3Q87 A;  3P5J B;  2B63 I;  3MZL B;  2V8K A;  3VMI A;  3S14 I;  4E2Y A;  3GTP I;  3GTK I;  1M90 1;  1M1K 2;  4BXX I;  3NFZ A;  4TNU A;  3BG1 B;  1QXF A;  1VQM 1;  4DGL A;  4MRI A;  3M3Y I;  2F4O A;  1KD1 1;  1VQK Z;  5D1O A;  3M4O I;  3GCF A;  4NBD A;  3HOZ I;  2RBL A;  2GU2 A;  2AKL A;  3CCR 1;  4NBH A;  4MXU A;  3GTG I;  1RO0 A;  4MON A;  5T64 A;  3J81 f;  4AYB A;  1ZB8 A;  3CCL 1;  5FLX f;  2AYD A;  3CCR Z;  1USP A;  1YIJ 1;  5T67 A;  1K9M 2;  2OTJ 1;  3S17 I;  1Q82 2;  1K73 2;  1VQO 1;  3CCL Z;  4Y52 I;  3MZK B;  4EWC A;  1KC8 2;  1K8A 2;  1QVG Z;  3CCS 1;  4MD9 A;  1PFT A;  1RQF A;  2O53 A;  3S1M I;  3VTN A;  5C4J I;  1YIJ Z;  4A3J I;  2OTJ Z;  2LFU A;  1VQO Z;  4BY7 I;  1YJW 1;  5LL6 f;  3F3F C;  2QRC B;  3G71 1;  2PM9 A;  2VPY A;  2RIQ A;  2BJO A;  3CCS Z;  1Y8C A;  5IP7 I;  1VQ5 1;  3GTO I;  2PMZ A;  3CCQ 1;  1Z02 A;  4A3F I;  1QF8 A;  2E2I I;  1QVG Y;  2KI7 B;  4A93 I;  1YJW Z;  3G71 Z;  3D6W A;  3QWU A;  1Q16 A;  2JMO A;  1Q7Y 1;  2JA8 I;  3KIF A;  1VQ5 Z;  3I4N I;  2E7Z A;  3CC4 1;  3CCQ Z;  2E9H A;  3TDH B;  4NH1 C;  1NJI 2;  2RT9 A;  4NBA A;  3S15 I;  4NOZ A;  4NB9 A;  3J80 b;  1DL6 A;  3G4S 1;  2I3C A;  2DE7 A;  1P9N A;  2GTI A;  2IZ4 A;  3HOU I;  2HF1 A;  3HOY I;  3J81 b;  2VF1 A;  3CC4 Z;  4E30 A;  4QTU A;  5AN9 F;  1L1O C;  3S1Q I;  3PO3 I;  2J6A A;  3IX0 A;  4E2W A;  5FLX b;  3HOV I;  3G4S Z;  3MON A;  5A2Q b;  1R9T I;  3K7A I;  1VQ9 1;  1WW9 A;  3I07 A;  1ZH1 A;  1S7M A;  1VLA A;  1Q86 1;  3FKI I;  2M6N A;  3KIH A;  4X6A I;  2V45 A;  3S16 I;  4MH4 A;  1Q81 1;  1TWH I;  4E2Z A;  4XX2 A;  1JJ2 Z;  3S2D I;  2OOY B;  3RZO I;  1WII A;  2NAP A;  3VMH A;  1N2F A;  1VQ9 Z;  3BG0 B;  2R93 I;  4MD8 A;  1Z03 A;  3CCU 1;  1SIW A;  2Q51 A;  3FQM A;  3CXC Z;  3J7A 4;  2W04 A;  1N8R 2;  3HOW I;  3CCE 1;  3NH8 A;  2R92 I;  2NVT I;  3CD6 1;  2QEX 1;  3IR7 A;  4HGY A;  4A3L I;  3D9X A;  1JJ2 Y;  3CCU Z;  4Y7N I;  3GTL I;  1AA6 A;  4RVD A;  1I6H I;  3IF8 A;  3CCE Z;  3CD6 Z;  2QEX Z;  1YUK A;  3CC7 1;  1YJN 1;  3CXC Y;  3S2H I;  4A3K I;  1TWC I;  2WAQ A;  3HKZ A;  5IT9 b;  3G6E 1;  2VPW A;  1YJ9 1;  1Y1W I;  3CPW Y;  3CC7 Z;  1QYP A;  1YJN Z;  3I4M I;  2JIM A;  3G6E Z;  1YJ9 Z;  2R6M A;  1VQP 1;  2QLV B;  2M48 A;  1RNI A;  1TWF I;  2QR1 B;  2QKD A;  4NBB A;  2E2H I;  2EGT A;  4DQY B;  1M90 2;  3CC2 1;  1TWA I;  1JWH C;  1M1K 1;  3CME 1;  2QA4 1;  2V8J A;  1VQP Z;  1TWG I;  2VUG A;  3GTM I;  2NVX I;  1WCM I;  2G2K A;  2K3R A;  1W2B Z;  1KD1 2;  1RO4 A;  1I3Q I;  2JR6 A;  2Y0S A;  3VMG A;  5D1P A;  2IV2 X;  2R7Z I;  3CC2 Z;  1Z01 A;  3I55 1;  1VQL 1;  2ZAE B;  2JIO A;  2GTH A;  2Q4Z A;  3CME Z;  2QA4 Z;  3CCM 1;  3FQQ A;  2DE6 A;  5C4X I;  2V3V A;  3JAM f;  4NBC A;  3GTQ I;  3TE5 B;  1YIT 1;  5IP9 I;  4A3E I;  3H3V J;  1X3W A;  4NBF A;  4NFR A;  4QTT A;  4A3M I;  1W2B Y;  2VUM I;  2JUB A;  3HOX I;  1NP6 A;  2PK7 A;  3I55 Z;  1VQL Z;  2P28 A;  3CCM Z;  4HGZ A;  2JIR A;  3ESW A;  4NB8 A;  2VPX A;  1K9M 1;  1Q82 1;  1K73 1;  1NUI A;  1YIT Z;  1S72 1;  1KC8 1;  1K8A 1;  1ZB9 A;  2DE5 A;  2JIQ A;  3IFU A;  4RS4 A;  3I56 1;  1RLY A;  2JNY A;  4E33 A;  2WB1 A;  1S72 Z;  3S1R I;  4BBS I;  3H0G I;  1Y1V I;  4A3G I;  4RVG A;  1QVF Z;  3I56 Z;  1I50 I;  3CPW Z;  1WZN A;  2JA7 I;  1LQL A;  1Q7Y 2;  2K5R A;  4A3D I;  1KRL A;  3D2L A;  1X0T A;  2OZK A;  3LUS A;  4E32 A;  1YHQ 1;  4E31 A;  3GTJ I;  1USP B;  3F3P C;  1NJI 1;  3J80 f;  3OW2 Z;  2IZ3 A;  1ML8 A;  2QRD B;  1FDO A;  1VQM Z;  1QVF Y;  2QRE B;  3JAM b;  1YHQ Z;  4BY1 I;  4MD7 A;  4BBR I;  2JA5 I;  5A2Q f;  3EER A;  2E2J I;  1Q86 2;  3OW2 Y;  2F4M A;  1Q81 2;  3EED A;  1VQ6 1;  2NVY I;  5C44 I;  2JA6 I;  1YUA A;  3GTM S;  2RHB A;  3CMA 1;  2YAD A;  3NDJ A;  2LIY A;  3VB9 A;  2JIP A;  3NH4 A;  5FLM I;  2RPR A;  3GKQ A;  3U50 C;  1KQS Z;  1VQ6 Z;  3CCV 1;  4DK1 A;  3CMA Z;  1VQN 1;  1N8R 1;  3S1N I;  3PO3 S;  2P3Y A;  4NBG A;  2YU9 I;  3RZD I;  3CCV Z;  1YI2 1; 
#chains in the Genus database with same CATH homology
 3NDI A;  2KPI A;  1X3Z A;  1VQN Z;  1KQS Y;  4E2X A;  2V8I A;  3PO2 I;  2NVQ I;  2H85 A;  2W03 A;  1RO2 A;  4HH4 A;  5IT9 f;  3CCJ 1;  4A3B I;  2JS4 A;  3NH5 A;  4RVH A;  2OTL 1;  2OOX B;  1YI2 Z;  4CL1 A;  3T4N B;  3CQZ I;  1VQ8 1;  1VQ7 1;  4RV9 A;  4A3C I;  1SFO I;  4A3I I;  1VQ4 1;  1K83 I;  1TFI A;  4S1T A;  2HU9 A;  3CCJ Z;  1Y1V S;  4RVF A;  2OTL Z;  4NBE A;  5D1O B;  1VQ8 Z;  1VQ7 Z;  5T6B A;  2O4H A;  5CM2 M;  5C3E I;  1VQK 1;  1VQ4 Z;  3Q87 A;  3P5J B;  2B63 I;  3MZL B;  2V8K A;  3VMI A;  3S14 I;  4E2Y A;  3GTP I;  3GTK I;  1M90 1;  1M1K 2;  4BXX I;  3NFZ A;  4TNU A;  3BG1 B;  1VQM 1;  4DGL A;  4MRI A;  3M3Y I;  2F4O A;  1KD1 1;  1VQK Z;  5D1O A;  3M4O I;  3GCF A;  4NBD A;  3HOZ I;  2RBL A;  2GU2 A;  2AKL A;  3CCR 1;  4NBH A;  4MXU A;  3GTG I;  1RO0 A;  4MON A;  5T64 A;  3J81 f;  4AYB A;  1ZB8 A;  3CCL 1;  5FLX f;  3CCR Z;  1USP A;  1YIJ 1;  5T67 A;  1K9M 2;  2OTJ 1;  3S17 I;  1Q82 2;  1K73 2;  1VQO 1;  3CCL Z;  4Y52 I;  3MZK B;  4EWC A;  1KC8 2;  1K8A 2;  1QVG Z;  3CCS 1;  4MD9 A;  1PFT A;  1RQF A;  2O53 A;  3S1M I;  3VTN A;  5C4J I;  1YIJ Z;  4A3J I;  2OTJ Z;  2LFU A;  1VQO Z;  4BY7 I;  1YJW 1;  5LL6 f;  3F3F C;  2QRC B;  3G71 1;  2PM9 A;  2RIQ A;  2BJO A;  3CCS Z;  5IP7 I;  1VQ5 1;  3GTO I;  2PMZ A;  3CCQ 1;  1Z02 A;  4A3F I;  1QF8 A;  2E2I I;  1QVG Y;  2KI7 B;  4A93 I;  1YJW Z;  3G71 Z;  3D6W A;  3QWU A;  2JMO A;  1Q7Y 1;  2JA8 I;  3KIF A;  1VQ5 Z;  3I4N I;  3CC4 1;  3CCQ Z;  2E9H A;  3TDH B;  4NH1 C;  1NJI 2;  2RT9 A;  4NBA A;  3S15 I;  4NOZ A;  4NB9 A;  3J80 b;  1DL6 A;  3G4S 1;  2I3C A;  2DE7 A;  1P9N A;  2GTI A;  2IZ4 A;  3HOU I;  2HF1 A;  3HOY I;  3J81 b;  2VF1 A;  3CC4 Z;  4E30 A;  4QTU A;  5AN9 F;  1L1O C;  3S1Q I;  3PO3 I;  2J6A A;  3IX0 A;  4E2W A;  5FLX b;  3HOV I;  3G4S Z;  3MON A;  5A2Q b;  1R9T I;  3K7A I;  1VQ9 1;  1WW9 A;  3I07 A;  1ZH1 A;  1S7M A;  1VLA A;  1Q86 1;  3FKI I;  2M6N A;  3KIH A;  4X6A I;  3S16 I;  4MH4 A;  1Q81 1;  1TWH I;  4E2Z A;  4XX2 A;  1JJ2 Z;  3S2D I;  2OOY B;  3RZO I;  1WII A;  3VMH A;  1N2F A;  1VQ9 Z;  3BG0 B;  2R93 I;  4MD8 A;  1Z03 A;  3CCU 1;  2Q51 A;  3FQM A;  3CXC Z;  3J7A 4;  2W04 A;  1N8R 2;  3HOW I;  3CCE 1;  3NH8 A;  2R92 I;  2NVT I;  3CD6 1;  2QEX 1;  4HGY A;  4A3L I;  3D9X A;  1JJ2 Y;  3CCU Z;  4Y7N I;  3GTL I;  4RVD A;  1I6H I;  3IF8 A;  3CCE Z;  3CD6 Z;  2QEX Z;  1YUK A;  3CC7 1;  1YJN 1;  3CXC Y;  3S2H I;  4A3K I;  1TWC I;  2WAQ A;  3HKZ A;  5IT9 b;  3G6E 1;  1YJ9 1;  1Y1W I;  3CPW Y;  3CC7 Z;  1QYP A;  1YJN Z;  3I4M I;  3G6E Z;  1YJ9 Z;  2R6M A;  1VQP 1;  2QLV B;  2M48 A;  1RNI A;  1TWF I;  2QR1 B;  2QKD A;  4NBB A;  2E2H I;  2EGT A;  4DQY B;  1M90 2;  3CC2 1;  1TWA I;  1JWH C;  1M1K 1;  3CME 1;  2QA4 1;  2V8J A;  1VQP Z;  1TWG I;  2VUG A;  3GTM I;  2NVX I;  1WCM I;  2G2K A;  2K3R A;  1W2B Z;  1KD1 2;  1RO4 A;  1I3Q I;  2JR6 A;  2Y0S A;  3VMG A;  5D1P A;  2R7Z I;  3CC2 Z;  1Z01 A;  3I55 1;  1VQL 1;  2ZAE B;  2GTH A;  2Q4Z A;  3CME Z;  2QA4 Z;  3FQQ A;  3CCM 1;  2DE6 A;  5C4X I;  3JAM f;  4NBC A;  3GTQ I;  3TE5 B;  1YIT 1;  5IP9 I;  4A3E I;  3H3V J;  1X3W A;  4NBF A;  4NFR A;  4QTT A;  4A3M I;  1W2B Y;  2VUM I;  2JUB A;  3HOX I;  1NP6 A;  2PK7 A;  3I55 Z;  1VQL Z;  2P28 A;  3CCM Z;  4HGZ A;  3ESW A;  4NB8 A;  1K9M 1;  1Q82 1;  1K73 1;  1NUI A;  1YIT Z;  1S72 1;  1KC8 1;  1K8A 1;  1ZB9 A;  2DE5 A;  3IFU A;  4RS4 A;  3I56 1;  1RLY A;  2JNY A;  4E33 A;  2WB1 A;  1S72 Z;  3S1R I;  4BBS I;  3H0G I;  1Y1V I;  4A3G I;  4RVG A;  1QVF Z;  3I56 Z;  1I50 I;  3CPW Z;  2JA7 I;  1LQL A;  1Q7Y 2;  2K5R A;  4A3D I;  1KRL A;  1X0T A;  2OZK A;  3LUS A;  4E32 A;  1YHQ 1;  4E31 A;  3GTJ I;  1USP B;  3F3P C;  1NJI 1;  3J80 f;  3OW2 Z;  2IZ3 A;  1ML8 A;  2QRD B;  1VQM Z;  1QVF Y;  2QRE B;  3JAM b;  1YHQ Z;  4BY1 I;  4MD7 A;  4BBR I;  2JA5 I;  5A2Q f;  3EER A;  2E2J I;  1Q86 2;  3OW2 Y;  2F4M A;  1Q81 2;  3EED A;  1VQ6 1;  2NVY I;  5C44 I;  2JA6 I;  1YUA A;  3GTM S;  2RHB A;  3CMA 1;  2YAD A;  3NDJ A;  2LIY A;  3VB9 A;  3NH4 A;  5FLM I;  2RPR A;  3GKQ A;  3U50 C;  1KQS Z;  1VQ6 Z;  3CCV 1;  4DK1 A;  3CMA Z;  1VQN 1;  1N8R 1;  3S1N I;  3PO3 S;  2P3Y A;  4NBG A;  2YU9 I;  3RZD I;  3CCV Z;  1YI2 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...