1Y8CA

Crystal structure of a s-adenosylmethionine-dependent methyltransferase from clostridium acetobutylicum atcc 824
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
246
structure length
246
Chain Sequence
NCYNKFAHIYDKLIRADVDYKKWSDFIIEKCVENNLVFDDYLDLACGTGNLTENLCPKFKNTWAVDLSQEMLSEAENKFRSQGLKPRLACQDISNLNINRKFDLITCCLDSTNYIIDSDDLKKYFKAVSNHLKEGGVFIFDINSYYKLSQVLGNNDFNYDDDEVFYYWENQFEDDLVSMYISFFVRDGEFYKRFDEEHEERAYKEEDIEKYLKHGQLNILDKVDCYSNKKVEKFTERITYLVKLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a S-adenosylmethionine-dependent methyltransferase from Clostridium acetobutylicum ATCC 824
rcsb
source organism Clostridium acetobutylicum
molecule tags Transferase
molecule keywords S-adenosylmethionine-dependent methyltransferase
total genus 90
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2004-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.110 Mainly Beta Single Sheet N-terminal domain of TfIIb S-adenosyl-L-methionine-dependent methyltransferases 1y8cA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1y8cA01
5DSXA 2I6GA 4BP1A 3MCTA 3UA4A 4X1OA 3UJ9A 1QAOA 2Z6UA 2O0LA 4AZTA 1KHHA 1FJXA 2IDKA 4P7GA 4XUDA 5DX0A 3FRHA 2PBFA 5E2AA 4Z2YA 1RJFA 3KPYA 3UZUA 4P7JA 3KPJA 3NWBA 3HA3A 2G71A 4M7RA 2YXLA 2OO3A 2PJDA 3KQTA 4RTRA 3GWZA 3R9XB 3T7SA 3SSMA 3THRA 4DCGA 1L3IA 3QOWA 2JH9A 3CCFA 5LQKA 2ZW9A 3LCCA 3E05A 3ID6C 5IKMA 3GU3A 3NMUF 1L1EA 3CVOA 2BM8A 2OKCA 2B2CA 2P8JA 3KPUA 3NTVA 2YVLA 3PS9A 4OBWA 4RTPA 3DOUA 2FRXA 3BWCA 3LCUA 2JH8A 3EEOA 1V39A 1RI5A 1YZHA 3G2OA 3JWGA 4FSDA 5EG5A 5KS2A 5K0GA 3AXSA 3FUVA 4GOLD 5EZSA 3TLJA 1WZNA 2B3TA 2YXDA 3FPHA 3LBFA 1NT2A 4E30A 5K0NA 1R00A 1VBFA 4X60A 1BHJA 3MGGA 1QYRA 2PGXA 4U7TB 3ER8A 4F85A 4M37A 5EQJB 3NVMB 5EEHA 5ERGB 4GF5A 3EVCA 1DCTA 2XYRA 5K0EA 4RTSA 4CKEA 1VLMA 3IHTA 3LHDA 4CWAA 3GDHA 5KQRA 3BWMA 2FK7A 3P9NA 2PX8A 3BXOA 5LQAA 3ELWA 4G56A 3B3FA 3EVDA 1BOOA 1N7IA 1L9KA 3P71T 1R74A 1VL5A 2CMHA 4OA8A 5FQNA 2P7HA 3TPZA 1RJDA 3ME5A 4MTLA 3RW9A 5GP1A 5CVJA 4JXJA 1G38A 3G2PA 3LDFA 3CJRA 2GH1A 4AX8A 3EGEA 2ZCJA 4BY9E 2Q41A 3BKWA 1G6Q1 1QZZA 3EVAA 4QQKA 5EKXA 3R0QA 5BXYA 4AUKA 2ZWVA 5DSTA 5EGSA 1SQFA 4PGGA 3HA7A 1EJ0A 4GC9A 3LKZA 3I9FA 4FS8A 5E1BA 3TMAA 4E2WA 3MQ2A 5GM2A 3AY0A 2NXNA 1ORIA 4FSXA 4IV0A 2N47A 5GM1A 3OE4A 4YMGA 2GLUA 5BW5A 5EMMA 3HVHA 2IFTA 3UJ6A 3REOA 1HNNA 2GAFA 3OE5A 1JTEA 4RVFA 1NW5A 1VP9A 3B3JA 4XUEA 1I1NA 2AVDA 2QRVB 10MHA 1RI1A 2PX4A 4C4AA 1N2XA 2B25A 1QANA 3KKZA 3BZBA 2ZIFA 3JWIA 5CVVA 4C04A 1KYWA 1F3LA 4YUWA 3BGIA 1UIRA 2OB2A 3P9CA 1RJEA 2JHPA 3GIWA 3Q87B 5EEGA 2P3LA 2IGTA 3C6KA 4NECA 3RIEA 3CC8A 2UYQA 5BP7A 3G2MA 3IV6A 4BP3A 3H2BA 3KQMA 2ONZA 1QAQA 3EVZA 2NXCA 2Y1XA 5E9JA 3MTIA 3MB5A 3K6RA 3OU2A 5HEKA 5DM0A 2Y1WA 3DMHA 3NDJA 2AOXA 5DM1A 3HCCA 4HG2A 3SGLA 4OA5A 4YV2A 2I9KA 5K0CA 3UJ7A 2NXJA 2JHAA 2P40A 3M33A 1DL5A 4OQEA 4PYJA 2NXEA 4UOEA 3CJTA 4DMGA 3DXXA 3GRVA 2G72A 5FCDA 3KR9A 1VP3A 5EHGA 3PTAA 4PWYA 4ATNA 3UA3A 4IKPA 3UJCA 3IEIA 1XXLA 1BC5A 1O9HA 3PX3A 4PYKA 3VC1A 1Q0SA 5LR6A 1PRYA 2GS9A 2YXEA 1XCLA 3TM5A 5E1OA 3TQSA 5HIKA 4ER3A 2H1RA 2ZZKA 5CVUA 2ZULA 5DLYA 5DWQA 4QDJA 4RV9A 4YV1A 4FR0A 4YV0A 4HGYA 1P91A 4YUXA 4PYNA 4MQ4A 3M6WA 2YQZA 4R05A 1SG9A 3ER9A 1X1CA 3C3YA 4GBED 4PINA 2JJQA 4R6XA 4PYLA 5EVJA 2PWPA 4PCAA 1JQEA 3FYDA 2R6ZA 2WK1A 4RTQA 3M6VA 4EVIA 3HTXA 1P1CA 3UWPA 3EVFA 5K0LA 3EGVA 3A7EA 1I9GA 1RI3A 1AF7A 4ZTBA 3A27A 3DXYA 3FRIA 2ESRA 2R3SA 4PONA 4DM3A 1IXKA 1JSXA 4K6MA 5KVAA 3PFHA 3THSA 2O07A 4RTMA 3S68A 4QVGA 5E1DA 4HRAA 1H1DA 3DH0A 2VDVE 3ELYA 1HMYA 2BR5A 2CL5A 3I64A 4R8RA 1X1DA 4HTFB 5D1HA 5E2BA 4RVGA 3JWJA 3OU7A 5T6BA 1BKYA 4E31A 2ZZMA 5DX8A 3JWHA 4X63A 5K0FA 3RODA 1TPYA 3EVBA 1SUSA 2ZIEA 1ORHA 2PVCA 1X1AA 5K09A 1XJ5A 2PXAA 2EFJA 3PFGA 1L3CA 5DX1A 2O05A 2PX5A 4HTFA 4FP9A 3Q7EA 3SVZA 1WY7A 1T43A 5EMLA 3P97A 3UJ8A 1JQDA 3MAGA 3G8AA 2IIPA 4CTKA 2ADMA 2ZWAA 3OZTA 3BGVA 4KDCA 4EKGA 2P35A 3HCEA 5LQRA 2PLWA 3F4KA 5LQNA 2G1PA 2H11A 3BKXA 2PV0A 3P2KA 3PT9A 4PCLA 4PGHA 4CKCA 3ERCA 3SM3A 1R8YA 4HH4A 4KVZA 4L7VA 3HVKA 5ICGA 1KYZA 1XTPA 3EPPA 3FPJA 4OBXA 3M6XA 3KQVA 2KW5A 7MHTA 5FHQA 2PXCA 3LCVB 2UYOA 5T64A 2IDJA 2PT6A 2FHPA 3C6MA 2PXXA 1ZKDA 3QOXA 3HEMA 4M36A 3OZRA 1ZQ9A 4RSRA 3DXZA 1YFJA 5FUBA 4U7PB 3G5TA 4P7FA 1U2ZA 2I7CA 2CMGA 3GO4A 5DTRA 4R8SA 1JG3A 5K8VA 3E7PA 1SQGA 1XDZA 2AVNA 4IV8A 4QPPA 3FTCA 3R24A 3V8VA 4B17A 2UZ4A 4E32A 9MHTA 5KQSA 3HCDA 5DRYA 1SUIA 4E70A 2XVAA 4YUVA 2AOVA 4KW7A 1G8SA 3TFWA 3G5LA 1XVAA 3OFKA 1JG4A 1WS6A 2QE6A 4X61A 4AZVA 3NJRA 3HA5A 4MIKA 2GB4A 2OYRA 2OZVA 5K0JA 5CCBA 1NV8A 4V0RA 5DRTA 5EOVA 4C07A 4QVKA 1FP2A 1INLA 1YB2A 5EPEA 2K4MA 3X0DA 5D1NA 3T7TA 2VS1A 4OQDA 3HNRA 3TM4A 2XYQA 4CXMA 2IH4A 2HV9A 3MCZA 2ZSUA 2C7RA 3PVCA 5E8JA 2ZLBA 3DLCA 2OBFA 3TKAA 3LGAA 4EQZA 1YZ3A 3FUTA 3TRKA 4O29A 5FTWA 5HILA 2DPMA 5GINE 2AOWA 2UYHA 4KWCA 2A14A 3G2QA 4C08A 3GRRA 5E8RA 5K01A 4RWZA 2HMYB 1VIDA 2YR0A 5LQJA 3K0BA 1AQIA 3P2EA 2CKDA 3P9IA 1KPHA 4RX1A 2V7EA 1G8AA 2AN4A 3B7PA 3FPFA 4RTOA 3FTFA 2NP6A 5EHIA 1D2CA 2WA2A 4QTTB 3UBTA 4FT4A 2LD4A 4MWZA 5U4XA 3D2LA 1RI4A 2OPBA 1FPQA 1NV9A 3WSTA 3UJBA 2BR4A 3I5UA 2ZIGA 5F2OA 3MHTA 3NVKI 2ZBPA 1G55A 1VE3A 2ZTHA 5EKUA 2YTZA 3OPNA 5DT2A 2UYCA 1XCJA 5GWXA 2QYOA 4E2XA 5JUWA 5CM2Z 2CWWA 3AXTA 2V74B 5GIOE 2AOUB 3G7UA 5K05A 3LSTA 1EIZA 3M6UA 1SVUA 1ZGAA 5HIIA 1NW7A 4Y2HA 3A26A 2HNKA 2O57A 1JSZA 3NW9A 2EX4A 4PIPA 5LSAA 3KQYA 4FZVA 3FTDA 4C05A 1NW6A 2C7PA 3SXJA 1ZHFA 3GRUA 3AJDA 4ER0A 3KPWA 3ORHA 3E8SA 3EVGA 3HVIA 2FCAA 3A4TA 3SX0A 4E2YA 4E2ZA 3UJDA 4GUAA 1SKMA 3PB3A 4V0QA 3GRYA 5DTMA 4RTNA 2BM9A 1ZGJA 1NE2A 1D2HA 1M6YA 3LPMA 5HOQA 2EJUA 3KQSA 5FWDA 5HZMA 3E23A 5M5BA 2AN3A 1NBIA 1EQAA 2HTEA 3DUWA 3FYCA 4QTUB 4DKJA 4POOA 5FWAA 4RVHA 1X19A 3OU6A 4BLUA 4EKIA 5KYGA 4KRGA 4QPNA 5HIJA 4C03A 5F2NA 1O54A 4CTJA 4E33A 5DM2A 3HCFA 4QDKA 5E1MA 3FPGA 4YUZA 3LX6A 5ICFA 2AN5A 3KPVA 4WVLA 3PX2A 4LWPA 4X41A 1TW2A 1Z3CA 2VP3A 4CKBA 3MTEA 2XYVA 2ZBRA 3DULA 1KPIA 3ELDA 4KDRA 1YF3A 2OB1A 1AQJA 1XDSA 2JHCA 2YUIA 3ELUA 3SSOA 1NBHA 3UJAA 2JG3A 4AZWA 1IM8A 1KXZA 2VDUE 2IH2A 1B42A 2AS0A 3GCZA 1G60A 3KR2A 1RJGA 3LBYA 4A6EA 4RTKA 2BH2A 3EEYA 4KIGA 3KR1A 2EJTA 3GXOA 3ANXA 5P8WA 4FT2A 1R8XA 3DLIA 1P39A 3OZSA 4RYLA 4BLVA 5IH3A 5FA5A 3BT7A 5EIFA 5CD1A 4PIMA 2ZFUA 4KIFA 3EVEA 1X1BA 3G8BA 2ERCA 3AWIA 1D2GA 1EAMA 1QAMA 5JR3A 4GOOD 5E9WA 4P7KA 3A25A 1JG1A 2H00A 5DTQA 3PLAE 2PWYA 3HM2A 3MERA 1ZG3A 2Z6QA 1WG8A 2QY6A 1NKVA 3DTNA 1L3BA 1DUSA 3KQOA 5T67A 4ISCA 5K0BA 3TR6A 3CJQA 2BZGA 2PY6A 3G88A 2YX1A 4RTJA 1VQ1A 2P3OA 1UWVA 1F38A 1P1BA 1PJZA 1Y8CA 5ICCA 5EMKA 5MHTA 5ICEA 2DULA 2I62A 4DCMA 3DMFA 2VDWA 4PYQA 5CCXA 3NWEA 3GRZA 3G89A 3M70A 3R6TA 2C7QA 1WXXA 2O06A 4DF3A 1XDUA 3DP7A 4DQ0A 2GPYA 3I58A 4EK9A 4H0NA 3EGIA 4MHTA 2ZZNA 2IBSA 5C0OE 4ER5A 3GJYA 4RVDA 2IP2A 3GGDA 4AZSA 2ZVJA 2GA9A 3EMBA 3FUXA 3P2IA 5FHRA 3TOSA 5FADA 2WA1A 1MJFA 4GOND 1KIAA 2FK8A 2PKWA 2PT9A 5EZQA 5G02A 4C06A 2OXTA 5BW4A 2B78A 3U81A 1I4WA 3FZGA 4XUCA 5GOZA 4BLWA 4LECA 3B3GA 5C1IA 3LECA 1FBNA 3M4XA 3DMGA 1M0EA 5K03A 2NYUA 4DA4A 3O7WA 4M38A 5LQUA 1EG2A 4QQNA 5CUQA 2FPOA 2ZBQA 4F84A 4PYMA 8MHTA 3KHKA 3V97A 2B9EA 1WXWA 3VYWA 2AOUA 3C0KA 3OCJA 2G70A 2FYTA 1IY9A 3LDUA 3LKDA 4GOMD 5EIWA 2C7OA 5GIPE 3IYLW 5DXAA 5CIYA 3FTEA 4PYOA 3BWYA 1MHTA 3C3PA 1EJ6A 3NDIA 2P3QA 3OFJA 4P58A 1TW3A 2IPXA 4DZRA 3HCBA 5C9ZA 3B89A 2BR3A 3DR5A 3SR4A 3UFBA 2ORED 1UFKA 3FUWA 3CKKA 5E9QA 5EMJA 5HFJA 4FGZA 5HIMA 4PNEA 3EMDA 1R18A 3KQQA 2AZTA 3SSNA 3CGGA 2ONYA 3HCAA 4Y30A 5EC8A 1FP1D 4YMHA 4GC5A 2PX2A 3T7RA 4YUYA 3KR0A 3O31A 2AOTB 1Q0TA 2F8LA 2QRVA 2P7IA 3KU1A 2P1DA 3HP7A 1NW3A 3FPEA 5DXJA 2G8NA 4LWOA 4R6WA 1R6AA 1YUBA 3QV2A 1JQ3A 2HWKA 4LG1A 5DPMA 5FULA 1YFLA 2XVMA 1VPTA 3P9KA 4GEKA 4WXHA 3R3HA 2AOTA 4EMSA 3GNLA 2XBMA 1RI2A 2EG5A 3KQWA 3P8ZA 1KR5A 4RTLA 1KP9A 2IH5A 1JR4A 4ER6A 3VSEA 2QM3A 2VZ9A 4A6DA 3TKYA 3BUSA 4HC4A 2P41A 5CVEA 2IBTA 5LQCA 1JTFA 1N7JA 2OY0A 2NNWB 4ER7A 4HGZA 1M6EX 4XCXA 3O4FA 1OR8A 1JG2A 2AR0A 3CBGA 4OX9Y 5FQOA 3SMQA 2E5WA 3BWBA 3A7DA 5F2KA 2HR1A 4GQBA 3LL7A 3HVJA 4IWNA 5CVDA 5FA8A 5H02A 5B1SA 1AV6A 2NP7A 3BGDA 5DM4A 3I53A 4F86A 3L8DA 2Z6AA 1O9GA 3VC2A 2PSSA 4HSGA 4PYIA 3B5IA 1KPGA 3LDGA 3T0IA 1NW8A 3FUUA 3KQPA
chains in the Genus database with same CATH superfamily
1DEAA 3BMQA 1MHPA 4LN1A 1NXVA 4YMSA 4BP1A 5C7YA 1HO3A 3AQIA 3FYTA 1VM6A 2DKNA 2XGGA 1QGED 1N5DA 1WEHA 2H8GA 4DJFC 3G1UA 4TZKA 3BXHA 3Q87A 3B70A 4NNOA 4P32A 2FA9A 2YXLA 1TD9A 3KQTA 1R27A 2GF9A 2QTNA 3TGWA 1CR2A 3R9XB 3LA8A 4X92A 1H1LB 3KOUA 5L53A 4NE2A 2RBLA 4YJDA 4A4DA 5AVVA 1U8AA 4MUJA 2A2ZA 3KT3A 4F2GA 3R5HA 3KKLA 5BNZA 3NIFB 1LJ8A 2OBBA 5I7UA 4MR9A 2FY8A 4BNMA 5M34A 2O3UA 2FN3A 1FNNA 1Z5OA 2CB0A 4RCVA 1OWLA 3DD5A 4M0FA 1GZ4A 3UOGA 4DCJA 1DWOA 4KLCA 4F1WA 2BGLA 3AM5A 1YZHA 4GR4A 4MVJE 4RLHA 1KK3A 1UMDA 2GBFA 3F6RA 3ITEA 4Q93A 1TU3A 4CETA 2YXDA 5BNWA 2H1LA 4CM8B 1EUQA 2ZUCA 3I30X 1N2ZA 3H8WA 4IZHA 4QGSA 4TXJA 3M6LA 1GZUA 4V3BA 3TLGB 4U9IS 2QZJA 2ZB7A 3NC4A 1D1PA 4B7UA 2OECA 3QSYA 2QR2A 4DLBA 4LJRA 4GXQA 1CZKA 6CHYA 1GKIA 3ICOA 4N0DA 3Q0TA 1UPAA 1GQQA 4FOPA 3RKSA 3KEQA 2AG0A 4RTSA 2QMZA 2IYSA 3EXFB 2UAGA 2C0PA 2P5SA 1IRIA 1UEIA 1DRKA 4P31A 2CV0A 3P71T 5JADA 3IJEB 2VRNA 3HYRA 1WAMA 1JVNA 2A0UA 4LVNA 2QN6A 3PT5A 4HBGA 3FE2A 3NLLA 4KMRA 4MV3A 4PZLA 1T9AA 1CFJA 4M3NA 4UVDA 4JP2A 4E2FA 4KTTE 1VB3A 4LZNA 1YJBA 4NBEA 1EWVA 2H7CA 1MO5A 5JC1A 3ZWAA 4HVLA 5H4GA 4C30A 1VQM1 2BMWA 3QFSA 3TCXB 4QUGA 1QCZA 4JZKA 2D1TA 2YIVX 4PAOA 5TF0A 2VAMA 1ORIA 4ILKA 4BO9A 4KYUA 1W48A 5BW5A 3QX3A 4YQZA 5A5GA 4HYYA 3E6AA 4HQOA 3DL4A 3KJNA 5IYZB 1MIOA 3LCRA 1IM2A 3LHFA 4MUNA 1XJ0A 5B53A 4CG1A 4DR2B 1CJBA 5IKOA 1X77A 1MP0A 4G23A 4HX5A 1XZGA 5ESXA 5EJMA 3R23A 1K5HA 2OB2A 1M33A 2P3SA 4ZPXA 5A2GA 3HOZI 1SXJA 3QPUA 1PWEA 3VR3D 1I01A 3FOWA 4LGVA 1HTTA 1PJ3A 2WWVD 3QF4A 4UM7A 3TAHA 5C8ZA 1E2DA 1PQUA 8GPBA 4DLZA 5E7MA 1UIMA 1C1DA 1IZ7A 5DM1A 4H18A 1T13A 2IYXA 5L3ZA 3UMSA 2ZYWX 4FGJA 3SGLA 1FRFS 3DYBA 3R44A 3ISVA 3FGPA 1ZH4A 2NQ8A 2AXQA 3DOJA 4Q4HA 4TMTA 5BWMA 2X19A 1ORDA 1DI0A 1EDZA 1I0LA 1UDBA 3OPYA 3DW3X 4AQDA 1P4JA 4ZOBA 1PLJA 2HRCA 3C48A 1H2ZA 2HIMA 2XADA 4HDSA 4PWYA 5HX7A 3PTAA 2H1OA 1ESMA 1O9HA 1YGPA 1JB1A 3ADKA 4KLRA 1ZK2A 4PO9A 3WOVA 1GPNA 1ZN8A 1QIFA 1GT91 1OT3A 1T26A 2QEX1 1U9IA 4X8LA 1U3TA 2FSPA 4UU0A 2X42A 3AGPA 4NCXA 3RVKA 3VMMA 5TMPA 4B84A 1B2LA 1RPNA 1KQOA 2BRUA 1SH7A 1ENYA 1U9ZA 2PQMA 2QNRA 3AY3A 3MT0A 4M7PA 5ALFA 3GFPA 3DE0X 2IX3A 1GKYA 2AWNA 4M9SA 1MO6A 3JR3A 4OQLA 1C9MA 3ADPA 1KZYC 1PR5A 3QFHA 3UWKA 5KQLA 2IZ6A 4DLPA 2A5GA 3EVFA 4FMCB 4B6JA 4BNUA 3KLPX 3MPOA 1JKXA 3FBWA 1AF7A 2G76A 3OJOA 4GGPA 4FR2A 4I50A 4YMIA 1V2GA 3P94A 2K5RA 4DLVA 1I4EB 3TXAA 3QTBA 2HSEA 4N9QA 5MDHA 4NU5A 5IXYA 1OLXA 2O07A 1ULAA 2FOIA 2OV6A 1F2UB 3H4IA 3PCTA 4FHZA 4MPJA 3VAYA 2K5UA 2XRYA 3ELYA 1I51A 3K4PA 2CL5A 4B33A 1V5IA 1QHXA 5E2BA 4O08A 4E31A 4BYMA 5ECYA 5B6JA 2ZU0C 1QVGZ 1BKYA 3DEKA 5KWSA 5KNLA 1NFFA 3L7YA 4MQ6A 3O74A 3HDTA 3C70A 3U3OA 3DVAA 5IJZA 1VFPA 2VK1A 4HX9A 4Q5IA 4X95A 2ZIXB 4KR0A 3SDZA 1NLYA 2QUKA 1M72A 2XH8A 2B4QA 3QE3A 1Z7YA 3C3KA 1VECA 1Y89A 2EWWA 3MWEB 3HJNA 3X3HA 4BO8A 4JUIA 4ZDWA 2VC2B 5EKDA 1GLVA 3IEMA 1YHYA 3OMXA 2P35A 5CDFE 4B7ZA 5BUQA 3IV9A 1DG1G 1LCIA 2Y2VA 5T3UA 3PT9A 5DM70 3CV3A 4L7VA 4G0WA 2OORC 4YT4A 1ZR4A 2JFFA 5CX1A 4HB2A 1Q91A 1JR2A 3ESYA 2BW0A 1U0HC 3S27A 4BZWA 3ZE2B 4JMPA 5KO2A 4DRXA 3P26A 3QUCA 1UXJA 3DEHA 4MWEA 4PCUA 5CR9A 2J3EA 3B1VA 1RQXA 5ALJA 2GDZA 2NN3C 3N5KA 2XUDA 3GLGA 2QTWB 3ILSA 3WDSA 5KOYA 4KR6A 3JY6A 4HJXA 3A05A 3GO4A 4DLTA 1YZKA 1E9FA 3L9XA 4Y2GA 4O4LF 3A6EA 2HSGA 3UYLA 1PFGA 3Q98A 3HO1A 3VZDA 3BMNA 4IJWA 4EYEA 1NBAA 5E7JA 5SZJA 2PXHA 3SR0A 3JQPA 1F60A 4HUQA 4NTZA 1G20A 2VT7A 5CB6A 3DNMA 3RT9A 3ORQA 2JA1A 1V95A 1XAJA 4NBSA 4WZBE 1JWAB 2QE6A 3TL2A 4AZVA 3HB4X 3MIZA 1EXNA 1NV8A 2KBEA 4ZVVA 5HFNA 4YPVA 4HDKB 4PC3A 4CKWB 1NN0A 3WMXA 3RVBA 4UW9A 1E9BA 1L4BA 4CFYA 1JIQA 3KT6A 1A04A 4XDZA 1R4AA 4LDJA 4MVXA 2Q7DA 1I2AA 3D4BA 5CA0B 2YDXA 1T9ZA 1E8DA 3OFND 3QWHA 1RXYA 2ZR0A 5E8JA 3D0RA 1BEUB 2Y1DA 3T4UA 1J49A 4QYSA 5HE8A 5JCOC 2PSJA 2BKUA 4JDPA 4R1OA 3Q41A 1U2PA 3MBOA 1Q1QA 2AKEA 1U2TA 3WA7A 1K8QA 2ILVA 3FPFA 2AN4A 5E38A 4A3CI 5JS8A 2GI4A 5IUJC 4PTYA 4D80A 2IU0A 4G5OA 1RVDA 2JIZA 3HJCA 2HDNB 3PIDA 1Y5MA 2YVUA 4MQFA 5HMLA 5L3RA 1ADGA 1G0NA 1LX7A 1YQGA 2XTAA 3MOSA 3UN1A 3ZCRA 2COUA 4WBXC 1W1WA 3TJMA 3CF0A 2HWXA 3Q0IA 2VLBA 2GPNA 2YBDA 2HX1A 3MHTA 3ITDA 1CJUC 1YL5A 2UYCA 5I5EA 2C4WA 3P0JA 1CF9A 3GJZA 2ZRIA 3VNAA 4C4YA 4WPGA 4GYWA 3ZJ4A 1ELOA 1QPGA 4B3FX 1G5TA 1X8LA 5EIEA 2X3YA 1T36A 4RZ3A 5FWYA 3T5BA 3CR3C 4AIRA 4HLQB 1RFGE 4I66A 4UAUA 2QPAA 2EX4A 1BXRB 2DG2A 2IXGA 2WR8A 3PKZA 2RAFA 3NQ41 3L6CA 2E5FA 3FN4A 1Q15A 4JEIA 4RD3A 3EA5A 1QE3A 1YS4A 4FOSA 4P9NA 1XZQA 2CVQA 3BJIC 3GLGB 3VA7A 3H0GI 4TQGA 4EAAA 1YOVB 2C20A 4P83A 1XZ8A 3HFGA 3L93A 3M1LA 2PUAA 3ZGOA 3OBBA 1F1JA 3KHTA 4Q7KA 3GLIE 1JN0A 5CIWA 5A9TA 4P5EA 2Z8YA 3ZWOA 5B58C 1CIPA 1X1RA 1D2HA 2JFHA 4I6GA 2JLUA 3LPMA 2VYCA 4NULA 3MZLB 1NQTA 1SY7A 3HY4A 2WIFA 3FYCA 3WLOA 2HH9A 2XXBA 4Q03A 2W2KA 4M9QA 4U7DA 2WQ7A 3ZVNA 3OLCX 3ZH9B 2FMKA 4W1RA 4IMJB 4FQ5A 2P2ZA 3DDHA 1XPOA 5P21A 2WWXA 2ZI7A 2KWIA 3CUYA 1UF9A 1QVWA 3CUKA 1CE8A 5EIBC 3HA2A 4B3XA 5IRCD 1AIPA 4P08A 1HSOA 2VVTA 4WNCA 3IB3A 4K05A 3NV7A 1CT9A 1E2IA 4X7BA 4DEVA 5JD4A 1II8B 3ELDA 2OUKA 3HZRA 4O0MA 3ENWA 3KLOA 5G1NA 2PUJA 4GPIB 4OHUA 5TQ0A 4M1TA 1OH7A 4DQLA 1AQJA 4MICA 2QQFA 2JHCA 1ESCA 1X8JA 2G25A 4GEGA 2PBLA 4PPYA 4YJHB 1E6KA 2QZ9A 4FE3A 1KZHA 1RQGA 4MUEA 3LBYA 4YAWA 2NZ2A 1O58A 4O4HB 4L5JA 4BLPA 1M902 5DIZA 3COPA 1OH5A 3DFMA 2UUOA 2FWAA 1IOWA 1V8ZA 1WMBA 2QXTA 3BE8A 3R3SA 3L4BA 3ZLUA 4D98A 5IKXA 3ZLBA 5J4KA 1LD3A 1JR3D 3UAZA 4MUGA 2V0GA 3AEQA 4JJ7A 4QT0A 1EUYA 1VQ6Z 2ATXA 2VDPB 2XE4A 1TM7E 5DHTA 1CNMA 4LJ8A 3OFNA 5J23A 3EB9A 2QY6A 5F1YA 2HMWA 3CEHA 3H11B 4UFNA 3HDVA 3KQOA 5T67A 3PO3S 1EZ4A 2J30A 3PTLA 2RGUA 3ND8A 3O3NB 1GO2A 2XIJA 3D3WA 2RPRA 1HKHA 2NPIA 5AXBA 3C8UA 2XT9A 2R86A 1WMDA 3SD7A 4R8MA 2ZM6B 1RJ9B 3KBBA 2ZJAA 3A1VA 4UHBA 5IARA 1ZCAA 2IY7A 3EXEB 2V9PA 4L27A 1S2DA 2C83A 2C2BA 1LLQA 5BO5A 2Y66A 3DP7A 3R0XA 5TEWA 3UAOA 1T9BA 1PR3A 4M1EA 1BW9B 3OX2A 2EFDB 3E2PA 5AI6A 2DHQA 3RF7A 4MRIA 4N0PA 3TOSA 3EMBA 3NONA 3WFJA 4DR7B 2F8MA 1V3VA 2XJ4A 4BMXA 1L4NA 2WTMA 3AB8A 3PNKA 1PW7A 1U1IA 2REOA 2XNKA 1P60A 4DUPA 2FTKE 3FNGA 3A32A 5FPTA 3D8NA 5IAGA 3STVA 4D9IA 5GOZA 3UVEA 1SMKA 2JA2A 5KCMA 3TTWA 4U8GA 3AZQA 4GRAA 1OREA 4DA0A 4TM7A 2EIHA 3B36A 2VDRB 2DR0A 3WZ2A 5C53B 1M1YB 3O7WA 3QWAA 4HLUA 1TYAE 1LU9A 1TEXA 4ZO7A 3V2UA 3HGQA 3PI6A 2BHRA 4NBBA 4S1OA 1IHXA 3RSFA 3WO0A 4AZ3B 4Z4GA 4MYSA 3G59A 3DEIA 4Y9TA 3NP9A 3FOCA 4DLUA 5EJ8A 1G1AA 4OK6A 2HIHA 2Y1OA 1PUXA 5ALLA 3UMBA 2A33A 2FWNA 2CJWB 3DBRA 4C6RA 1NUPA 3LT0A 3CRW1 4EA6A 3THYA 4MJXA 3ECAA 4JYZA 1SKYE 3HCBA 3ZJTA 2OTCA 2HSWA 4YMHA 1Y1TA 221PA 4JOCA 1N33B 4Z0HO 3P9QA 3TD2A 1N2HA 3GTMI 1A3CA 2QSYA 3DL7A 3RK4A 1PYGA 1HDGO 2I8CA 4DL9A 4IDBA 5FUMA 2XZOA 2ONYA 1GXSB 3HOXI 4IJQA 4PWZA 1CYDA 4IOMA 4XASA 5ECDA 3EPKA 3N2GB 3PEUA 4GC5A 4YUYA 3GTMS 3R7DA 2P1DA 5MF6A 5ELXA 1GPH1 2HXYA 2PUTA 3TF5A 1K7YA 3FJOA 1UFOA 1J00A 1NVTA 2F48A 3I45A 4EA8A 3BXEA 4QAQA 3PE3A 2HWKA 4ROTA 2UDPA 1QH0A 4EJFA 1T5IA 1JT2A 4KPGA 3TRJA 5LP6F 2W93A 2GTHA 1X7GA 3R3HA 4EMSA 2OZKA 1CP2A 4HAIA 2OBNA 1KS9A 1W94A 1C30B 1CHDA 4QDZA 3TLYA 3L92A 3T5PA 1KP9A 3EWNA 2GVZC 3RRXA 1GTZA 2G8LA 4JLKA 2JFOA 3CY6A 3GARA 4OXIA 4URHA 3QYAA 1YITZ 3GTLI 3U3RA 4A6DA 4UTXA 1KWKA 3AJRA 2TRSB 1N7JA 4IZ6A 3UXYA 1Z8HA 4EUNA 2QD2A 1Z4JA 5JJ5A 3RG2A 2NV0A 3CH6A 3GVXA 1RE0A 2DH6A 1OFUX 4BBJA 4E6EA 4DV1B 1ZGZA 4ZVQA 2DUUA 1C9NA 3K31A 3WB9A 2PPVA 2WJJA 3I52A 2ZDQA 5B1SA 5TS2A 3IEVA 4JENA 2GWHA 1IZ8A 1DEXA 4WW0A 3ILVA 1NI5A 3VC2A 5CDYA 4HSGA 1F6BA 3ZJYA 3OTHA 1IEQA 4HZUB 2H59A 2E9HA 1XZLA 2H2FA 3VNBA 3IVAA 4N5DA 3VZPA 2ECQA 5EIHA 3VI4B 3QV1A 2JA5I 3SWWA 4H0FA 4PTLA 4IY1A 4U7HA 4Q9KA 4TL9A 4EEZA 1RQPA 1U8YA 1YE3A 2B5OA 1USIA 4LNHA 3S2HI 4P4TA 5FPYA 1RAFA 1NVVQ 1WDMA 2WMNB 3LD9A 1D2NA 2I22A 3N6XA 5CGZA 3ZNOA 4X6LA 4Y9DA 2EAUA 2AFIE 1EFCA 3NWBA 2I6FA 4RVNA 4ZAGA 3KSRA 3ZK7A 1UJNA 2PJDA 4H7EA 5FBRB 3S2UA 4CV0A 1UJBA 3OZBA 4ZT6A 1L3IA 3USES 1E2PA 3DBRB 4R1TA 2GZ2A 1T5BA 4TM8A 1QZ3A 5C46F 3STYA 4LRQA 4MUFA 1QORA 3CVOA 1DHRA 4RHXA 1UBCA 5IWAB 4OJMX 4BQFA 1U1FA 4IXNA 1FW6A 2ZYGA 3KRTA 4V39A 1R6TA 5K8IA 1A71A 1RBMA 4PZCA 4ZK2A 3RVQA 3TLJA 4X6AI 3KE8A 4Q01A 4URFA 2CF5A 2X86A 1W4ZA 4RSMA 1P5ZB 2WJ3A 2YIDA 4LX8A 5THXA 5K6TA 1PE0A 3BICA 3A10A 4DYHA 3LQQA 1NXSA 1JLRA 3LFHA 4K9LA 1EFAA 3PEVA 1OHHD 2E2JI 1MO3A 4IGIA 4MKZA 4AT1A 4F4HA 3FOAA 4JVNA 2B98A 3MA0A 1DKUA 1K63A 2FMXA 1MB3A 3LHDA 1JF8A 2NUPA 2BUAA 3GDHA 5LQAA 4H1VA 4GIBA 3QEAZ 2HT6A 3V34A 2HPVA 2HK9A 1BRTA 5KJEA 3TLEA 4BL5A 4F6RA 4Z4QA 1PF7E 5LBIA 2QTRA 2P2LA 1CU1A 4G84A 2R6GA 3GVHA 3W34A 2IHKA 3IMKA 4INOA 3I6BA 5G1OA 3EGEA 2JLRA 3GEPA 2V5UA 2WF5A 4BNKA 1WD7A 4MV4A 3LXUX 4AUKA 2X9LA 4US2R 1PL6A 4JHLA 5E1BA 4GL4A 4PZPA 1QU3A 4FXPA 3JALB 1ZVVA 2QTCA 3RO7A 1FS6A 1M3SA 4ZVMA 3E3OA 3ZE7A 3T5DA 1HL7A 3RGWS 4CQLA 2VDNB 3BCHA 2C2GA 4UZSA 1DFGA 3FAZA 4L7QA 1I4LD 2GA8A 2HA5A 3DT6A 2LIPA 3V8RA 4EJMA 7AT1A 1W76A 3HB9A 5AJYA 4QYWA 1K66A 4Y0NA 1MH1A 2OOSA 2VYFA 4D9FA 2REXB 2Z8XA 1JDVA 1HYGA 2Y1KA 3AIOA 3B8HA 1NBEA 1TAGA 1TJ4A 2NUBA 3LT1A 2JCSA 3LW7A 4LNUA 3TL6A 4C5BA 4ARCA 3K9FC 3FDZB 3OE1A 3WP1B 1UFRA 2ZJFA 4C4ZA 3MINB 4RPIA 1XWFA 2X9VA 3DHVA 4QNRA 5IK2A 3Q12A 2Z9DA 2RGEA 1AGPA 2WIAA 1BSVA 1MFPA 1WUKS 3KEFA 3WGJA 4AYTA 2YL2A 4I14A 1K9M1 3B1XA 5D3MB 3KQMA 2ONZA 2C31A 1QAQA 4Q12A 3RD5A 3RFTA 5E9JA 1ZOLA 4LV8B 3B3AA 3MJEA 5HEKA 3OOJA 4LGYA 1TVKA 4EIWA 4JL8A 1BGXT 2VP6A 3VB9A 3BXXA 1NJGA 1Y9AA 2GM3A 3L8HA 1QYDA 2I9KA 3ESBA 1EIWA 3R8XA 4LJKA 3GTPI 1CUIA 2ZQ5A 1XEWX 1GSOA 3M33A 3RFXA 2NXEA 4BO6A 4CKBB 1KSHA 2HHLA 1FP4B 2QW8A 3GQVA 3PPIA 1NVEA 5KOHA 1QYVA 3AG5A 3RS3A 1OFHA 1LS1A 4PFJA 3GRKA 5KHLB 3UA3A 2O1WA 1E5LA 1QYWA 2VRWA 3EHEA 4R84A 5KTNA 3ZBUA 3JVVA 3KWJA 4G25A 2KLBA 4KRFA 4L2IB 2VDQB 3HEBA 3FOZA 3W6UA 1IL0A 1ZUWA 3TIGA 3GP5A 3FFXA 3G68A 4FBLA 3EYWA 3FVRA 1QFYA 2GCOA 4Y6SA 1LSJA 1W5FA 4JKYA 3S0JA 5LFAA 1E6MA 5JAHA 3DEAA 1QGZA 4Z2AA 3NAQA 3M6WA 1TWAI 2VSXA 4IP0A 4Q1DA 4O33A 5DGDA 5GGXA 5I8PA 2V97A 5BSWA 1ADFA 3I04A 3VR2D 1KI8A 3AM1A 1F2UA 2D2XA 1OWMA 1R5NA 1NXTA 2BGKA 2PMZA 4RK0A 1MCZA 5J1TB 2WY2D 3SHQA 1X94A 1ULTA 3OTOB 2F4VB 4XVQA 1PR2A 1N5RA 4B43A 3BGOS 1N8R2 3RASA 4RJIA 1X86B 4IIFA 3DVAB 3GOQA 3PFHA 1XL1A 4KFRA 4YN3A 4NCBA 3HDHA 3CC2Z 3KYCA 4ILEA 2QLVB 3IIJA 3PQFA 2CHQA 3N05A 1R0XA 3OU7A 1YQEA 1DPFA 4NICA 3EXEA 5T4HA 4BTVA 3LK6A 1DBIA 2C54A 3MT8A 2BFOA 4HDMB 3OP1A 4S1WA 5KBYA 3Q3HA 3FCYA 4D99A 5CHEA 2VUTA 2YJ5A 4ODIA 1HFJA 3PZBA 3I6MA 3SVZA 2DP4E 3OP4A 1C3XA 3VUFA 4F5WA 1SUDA 3N75A 4YQEA 3RSLA 4JUDX 2HPZA 5LM3A 2VJMB 3JQRA 3F5FA 4B3JA 2OP0A 3FZYA 3GQBB 4DNPA 4RACA 5D1OB 2ZUSA 4CKCA 2DJIA 5CFLA 3PENA 5IAJA 4BMYA 4J2TA 3UV7A 4AYBA 1M1YA 2B6HA 3SS9X 2V3WA 2MYNA 2ICAA 4HRYA 3ICEA 3TLCA 3CMEZ 3VHXB 3MG9A 2D2VA 4DCNA 3MWGA 3LHIA 3N0XA 4FMDB 1G5PA 4YCJA 5E6RB 2CZCA 3C4JA 1Z9BA 1YUMA 2QGNA 1FP4A 5I7HA 4BV3A 1YVUA 2JNWA 2O54A 3OPVA 3AEKB 2I76A 4IV8A 1K3TA 3AHCA 3CWQA 3THYB 3DW1X 4QC2A 5BWOA 2MHCA 1LDBA 1PNTA 2OK7A 2D2EA 4G0XA 2PL9A 4XGNA 1AGRA 3C4VA 3AT1A 1VBNA 1X0VA 3C3EA 1LDNA 3EBPA 4GI2A 1GRVA 5KYTA 2QLLA 1E89A 2ORYA 4JLJA 5DNCA 4QBTA 1F6WA 3KBOA 2GCOB 2VBGA 1WDLA 2YH2A 3ES9A 2QOEA 4MQUA 4Q4DA 1XKLA 3ZGVA 1Z0SA 2FPSA 4P38A 1Y6RA 4LVUA 4HY3A 3TB4A 1SKAA 3VZQA 1D4ZA 3NASA 4L0QA 2VS1A 5HG0A 1ODCA 4ACBA 1T0IA 3JQGB 1FCJA 1AT1A 1PFKA 3P32A 3W2HA 4UE2A 3COWA 4P0QB 1XP5A 4H08A 3FUTA 5IULC 3TE5B 3Q85A 1K6JA 1N2OA 2W6ID 4H35A 2HREA 5D5QA 4MEJA 3CC4Z 5J2TA 4UXIA 4R7TA 4XR4A 4MQFB 1Z2EA 1FNCA 4JEHA 4C4TA 4YLYA 1A9OA 4PSKA 3P2EA 3LC7O 5J4VA 1U1EA 4BBSI 5GAJA 4DR6B 2Y4NA 3VU3A 1N3IA 1XEXA 5EHIA 1DAGA 1YS7A 4XVUA 2BFWA 2VPPA 3QLEA 2DU8A 4G5RA 3UBTA 1XNHA 1Z25A 3M34A 1WF6A 1SC1A 1KARA 1G5HA 1SVKA 3DUFB 2NU7A 4L8FA 1FPQA 4WFJA 1WV1A 5IVIA 2BGMA 4A1FA 2HUNA 3C6BA 2W6IA 1SQ0A 3ZWBA 5LLDA 3SIWA 2FMFA 4JJKA 4MO9A 3CE9A 5BNIA 4NCJA 2SKDA 3QKSB 4YGYA 4YCSA 2YTZA 5ESWA 4PZYA 1XCJA 5EYPA 4J0QA 1TUIA 1G66A 4B8YA 5JUWA 1TX4B 3M2PA 1CVIA 3FSEA 3PL1A 3JQFA 5K51A 3AVOA 5K05A 1DE0A 1RE1A 2G83A 2R751 1MAVA 2MMCA 2VQ3A 3E5HA 3PFBA 4JJIA 4UVHA 4ZALA 3MNFA 4G6ZA 5IJXA 3WV5A 2HNKA 2YCLA 4DNOA 5A4AA 1GUDA 1RMTA 1PBTA 2IQ5A 3HBNA 3RUDA 5AVRA 5KJ1A 4MRAA 5M2QA 4A10A 4PFSA 4C0KA 1OT5A 2OCKA 1JHXA 4G8DA 1MZPA 3MOIA 3UT0A 1OTXA 1Q0LA 5TVKA 1ND5A 4ER0A 1X15A 3AHFA 1T9GS 1XTUA 3CR7A 2CUNA 3E8SA 3A4TA 2X0KA 3NHPA 4L72A 3CRNA 4BRWA 2PSFA 2VZLA 1MVLA 5DTJA 3PVZA 1JFLA 2YN4A 5KSOA 3ENZA 3WMEA 3WAJA 1CTQA 3DE1X 1YZFA 4UZFA 4ZC8A 4A2WA 4GDFA 1LJUA 3ZWXA 1WOMA 2YZNA 4JSYA 1O6BA 1U02A 3VPSA 1P73A 4NPHA 2P28A 3NFYA 1P4AA 3G2JA 6AT1A 3G2KA 1QP4A 1S9HA 1JE1A 1TUBA 4OH7A 1TADA 1CQJB 5HZKA 1VGQA 3QFCA 4F2HA 1IOZA 1JHUA 4R1LA 2XUOA 2XYHA 2YWXA 2VAXA 4L02A 5DM2A 5TQ0B 5REQB 3UENA 4EA7A 3RAJA 2FLWA 4E5DA 2AN5A 3I8SA 4CR6A 4Z4HA 3PNQA 1FUEA 1Z3CA 2BDEA 2O6LA 2WMOB 3DKKA 3GUVA 2R85A 3DHNA 2A9PA 3LQRA 4I7EA 4MS3B 5A02A 5FO1A 2H1SA 1W7AA 3E48A 3NJ4A 3R5FA 1OIVA 5CX4A 3THWA 3JRNA 1FFXA 2IYLD 3GWGA 3PXDA 4QU5A 3NTXA 3SSOA 4GKJB 4DPLA 3HXQA 1YZYA 4QWMA 4WQMA 3LP8A 3V7FA 4JVOA 1B42A 1D2AA 3I1FA 3B9QA 3BD9A 4RTKA 4PX5A 2QAJA 4V2UA 2XHEA 3IT0A 3LLUA 4G9BA 3FRJA 5DO9A 3J81A 2JUBA 3DWFA 3GBSA 4DC0A 1R8XA 3S2DI 3AFOA 3L40A 5DW0A 5A6SA 4GP9A 1AS3A 1EB8A 3U13A 4AF7A 1DTWA 4KJXA 2Q4EA 2I66A 1T1IA 3GCGA 4ZAWA 4FYYA 1GCGA 1TYDE 4W9NA 1OYYA 1EAMA 1QLWA 1FFHA 2OLEA 2UYYA 3BMCB 3NZEA 4HH1A 2VHUA 4IHJF 5E9WA 2H00A 2PIAA 4D3FA 4OSOA 2NV2B 2PWYA 3GB9A 4QICA 4D1YA 4D42A 1NSFA 4JR1A 4KRYA 4C87A 4ENWA 1SHLA 1T5HX 1J70A 4TXHA 5SYAA 4NBGA 1QKKA 1SHTX 3WLHA 1T8UA 3U19A 4QRHA 4E09A 4ARAA 1IUPA 1IG0A 3K0AA 2WV9A 2YHUA 5A4MS 4YAJA 1Z0FA 2IPAB 2PZAA 1B15A 1KMCA 4C4SA 1Y5RA 2CUKA 2WUGA 5JQGA 4MTCA 2ZR7A 2O06A 4EK9A 2J5KA 5D3MA 4DQ0A 1D6MA 2HD4A 4XYMA 5E7IA 5HKLA 1X0XA 5H8WA 4FXOA 3WB1A 4NCAA 1N1MA 2E3JA 4IDQA 1K2VN 2JJ2D 4NJOA 2GXAA 2IS1A 5ILOA 3ORFA 5BVGA 3S1MI 2QF7A 2CMDA 3J81f 2PX3A 1FLVA 1UDCA 1ZNXA 2R1ZA 4MUXA 5TPWB 5TB5A 4KE6A 2QRHA 1QG6A 2YNMA 1C3LA 3B48A 2OWEA 1PJCA 2V4UA 4AJ1A 3AR5A 1ZOIA 3MW8A 3WGQA 1O4VA 1JVSA 4WNAA 1U7DA 2V7WA 4JIGA 5DHFA 4D8VA 5CFMA 3E5MA 3D8SA 1Z0AA 3KK0A 3OWXA 2H5EA 2QTZA 1S2NA 3JQFC 1YHQ1 1J8QA 3OEEA 3V97A 2NSLA 2YYZA 4NP6A 3JYNA 2XI4A 2AOUA 3C0KA 4IYRA 1RYHA 4XEHA 3U0BA 2X4LA 1FYVA 4B9AA 2QRLA 3UQZA 4IDDA 4LFBB 3I6ZA 2VWGA 3N2YA 1FFXB 2ID7A 1FUYB 1Y4ZA 3L8ZA 2G80A 3NDIA 1V9SA 2NSDA 2P3QA 2Z30A 4GWKA 2BI8A 2DJ5A 2JKVA 3OD1A 2C3PA 1W52X 3DR5A 5JXJA 1P2FA 1QXFA 1KOFA 1B74A 1IULA 4AYXA 1KDRA 2C8LA 3OICA 4YRDA 2WWYA 1OFVA 4C7VA 2FZLA 1KMNA 1PAUA 1R6XA 3CGGA 3R3YA 3ZH2A 4DT1B 1I14A 2XJ9A 4XJTA 5CP8A 5JTTA 3CC71 2VQ6A 1TRKA 4II7A 4QODA 4Y30A 6NULA 1VJ1A 1WMFA 2Q5OA 3NC0C 2IYPA 2YFKA 3KKMA 4HO1X 1E2GA 3CVVA 1AC5A 1O8CA 2AOTB 2EX1A 5CXUA 1Y7TA 3O03A 1YIT1 5BUSA 3T1VA 1ABBA 2ZIAA 3CTMA 1JU3A 5DMXA 1WZCA 4GI5A 4U02A 3U09A 4MEAA 5DPMA 3O4JA 4MRMA 3D6MA 1VPTA 3P9SA 1YD7A 3C41J 4MOWA 1XV5A 1GLGA 1BU8A 3P8ZA 3FJYA 1DL6A 4MHSA 3ZEIA 1WCMI 1L5YA 4B76A 3CNNA 4TTRA 2Y0BA 3QJGA 1MXFA 1TIKA 4NBRA 4NMHA 4R5MA 5C7LO 1TM4E 2B61A 2NVXI 5LZ7A 3UM9A 2XA9A 2A9QA 2A57A 4NCNA 2NNWB 3TW8A 3OM8A 4MVJH 3I8XA 2QMQA 5BW6B 5EWJB 4XCXA 3WBKA 1JLLB 4HAOA 2E4XA 5ENZA 4A2QA 2VRCD 5JWHA 2P6PA 4DQDA 3C7KA 2YHAA 3A7DA 3M6AA 1GFSA 1N57A 1WOYA 2RG1A 3FCSB 3E82A 4GQBA 4MW5A 3IOBA 1CNFA 2XDYA 5KWIA 1ILEA 1TZBA 4LHYA 2C1ZA 1I13A 1Z39A 1VQ8Z 1FPMA 1DAOA 2QYHA 4LJ6A 3LF1A 3NCTA 4NFYA 5TPWA 4DSAA 2HK6A 2XGJA 2VYQA 2V9ZA 1UK6A 3O1HB 1H2BA 1WXHA 1WLYA 2GMWA 2WWIA 1CUZA 3AEKA 3I72A 3KT0A 3MCTA 3OSZA 3WGKA 4EPYA 1P4SA 5CMLA 1G8YA 3QEOA 4BNDA 5BUCA 2BSAA 4Z2YA 3FRHA 2PBFA 4X54A 3KPYA 2GN6A 4XR9A 1I5EA 3AUXA 2FPRA 4AJHA 4WOKA 1RPZA 4RUKA 1RW4A 1KK1A 3T7SA 1XKXA 2VO1A 4KQEA 1FFSA 2YWHA 1N5LA 3FCOA 3B2QA 1T6BY 1P1RA 1F8XA 1JSLA 4RDIA 4WKGA 4PV7A 2JA6I 2ATIA 3RSGA 3VMFA 1Z4IA 1H4TA 4W82A 3ZNPA 3WLSA 3LF2A 4PX3A 1ND6A 2ODEA 2OFWA 5KCZA 1RXVA 4MW9A 1OKKA 3JQGA 3OUTA 4Z7OB 4AK9A 1E2UA 3CFYA 2YZ7A 3AJAA 4BO1A 4D97A 3UHFA 4FSDA 2IZ7A 1V8BA 2H18A 3M6FA 1WZNA 4F4IA 3PYMA 5BT9A 3UAWA 1NT2A 1RYYA 3HKCA 3MQ4A 5AJVB 4J7AA 5LUBA 4Q9NA 4CE6A 1DCTA 2ZBFA 2XYRA 3FWPA 4JI1B 1XRQA 3HXOA 3HR7A 3RIMA 1P3Y1 5IT4A 1ZJ4A 1ETHA 3QKUA 4XTRA 5DJ5A 2BFDB 3WADA 2Q9CA 3ZHSA 2XNHA 2DUWA 1HF3A 5E3IA 5D5HA 1RJWA 1ESZA 1W5SA 3QKWA 1DELA 5EJ6A 1RRMA 1U0TA 2GM4A 2F2TA 4Q18A 3U60B 2P0YA 3DVSX 4HPWA 5DLPA 1CEEA 3CT4A 1G8FA 3BKWA 3UT6A 4EATA 3ZKWB 3NPAA 3I8OA 4QQKA 3ST7A 4EKDA 5BWLA 1WMAA 1COZA 1FMJA 3IQFA 2OP1A 3O9MA 2MWMA 3VO8A 2W04A 4PGGA 1E3QA 3JR7A 5ICCA 2QA4Z 3SCZA 2FUCA 4RXTA 2NXNA 2JCXA 4JBYA 4MUIA 4ZQGA 3HSYA 4FSXA 4UE3S 1M34E 1QYIA 3QEJA 4DABA 4FIZA 3SHVA 1T4MA 3RSHA 1JECA 3UT5A 3OE4A 4GOKA 4WL0A 4UEWA 4RF3A 4GZ3A 4QEZA 4TL7A 4O2RA 2P1RA 5B6PA 3U7HB 2JAHA 2XE6A 4ME6A 4UCQA 2VTBA 1HZJA 1E58A 3BAZA 1XP8A 3OF3A 4MWDA 4RHTA 3T61A 4EF5A 2WD7A 2ISQA 2BGUA 2XUFA 3RVMA 2PX4A 1DTEA 2ZAIA 2DFVA 3WLQA 5KNBA 3OA2A 5C4MA 3Q6NA 2FVYA 3HSKA 3RYTC 3BRSA 4INJA 2ZUUA 4I1VA 1ZC3A 4PR3A 5IANA 5ICGA 3GIWA 3M5CA 2UU9B 2B6NA 2OV4A 3DG9A 3SLRA 1GA6A 1X9IA 3ESCA 2E4ZA 1PU2A 5IBCA 1ZJZA 2J9RA 4QFMA 2YV3A 4K6CA 1GNVA 2Y1XA 3LH5A 1Z0DA 4NVRA 4X1KB 2BMEA 3MB5A 3LP6A 3RKRA 2YWBA 4OI0A 1VQ61 4X7RA 3AFNA 2OG2A 1EX1A 5G1PA 4C6SA 2W70A 5AW1A 4QXOA 1AGNA 3EFOA 3GC6A 3WL7A 3DFKA 4GSYA 1WQ3A 3OT1A 2AFVA 3VU9A 1S1MA 4G0UA 1KERA 3KR9A 2IHZA 3ENQA 3UGTA 4KQ1A 3NI2A 1T15A 4JHXA 4QWWA 5CT6A 1DX6A 1OTHA 2WQZA 4OPMA 5IM4F 5KU1A 2Z95A 3DTVD 2O4UX 4IDPA 4C3VA 5C4IA 1DQSA 4DDUA 2KI7B 4Q6WA 4XWGA 3E18A 5J9FA 2FW7A 4FE4A 1J23A 1M2WA 2V8IA 2QN8A 4MW6A 4XM0A 1L5HB 5BQ5A 1Z0ZA 3G13A 3MIIA 3ABOB 4FHEA 3V42A 4RZQA 4BFZA 4BP9A 5C18A 2BN4A 3RADC 1ILWA 1I3CA 3AKEA 3AHJA 1W2BZ 1C7IA 4HMQA 5BSGA 1QNFA 3PRHA 4DCSA 4Y0AA 1RXUA 1BZYA 3A3PA 3BWDD 4KQ2A 4Z5XA 4X1YA 3SX4A 2PWPA 1ZLYA 4RTQA 4C0AC 5ADWA 3L49A 3IMFA 2WNIA 1VQ5Z 1MQSA 4DUGA 3SZMA 5A9SA 3S1RI 1IMOA 2OHIA 1U9IC 3K1AA 3RUPA 4D4HA 1PQYA 4HTAA 4O3FA 3P0HA 5AK4A 5JARA 1WPXA 4XIYA 2HJSA 5JTUA 4UU8A 2NGRA 3JZMA 1N9GA 3GD5A 5BWBA 2VWPA 5F7OA 3W5SA 4AU1A 4KFTA 4S04A 2VPZA 5T6BA 1D7OA 1PD1A 4HTFB 2MJLA 3KQLA 3BZWA 1KGSA 1BE8A 2EBFX 1Z8NA 2HJGA 3NRJA 3G9QA 1VPLA 4ENPA 3FMGA 3HVRA 5HUQA 4ZYTA 9ABPA 1YHZA 2VJMA 5FBLB 2XIQA 1P1IA 3LWNA 3Q0EA 1J24A 5H83A 3HWWA 2OHGA 1GZSA 4EPXA 3TMKA 1I6MA 3PEEA 4NYMQ 5LP1A 2FF7A 2FPPA 5DX1A 4YRJA 1XIVA 3FCUB 2FZVA 5SZIA 1JQDA 3UH0A 4I3GA 1PGOA 1H22A 5B58T 4EYGA 4EG0A 5JYDA 2QLNA 2WJVA 2WSIA 4WUTA 3D6AA 3VR0A 3ANNA 3F4KA 3WHKA 4C3ZA 1LGYA 1QZTA 5LBTA 4EMBA 2O2HA 1TWFI 4EVSA 4EL5A 2A5YB 2ZRCA 4B6OA 3R6GA 2B4KA 1NI4A 3SM3A 4CM4B 5AFSA 3H87A 1QH8A 1VLLA 2VI5A 2AMJA 3G9ZA 4PSCA 3VM6A 2Q49A 1DC8A 4LRWA 1T3ZA 2PXCA 5IABA 2UYOA 3OW2Y 2IDJA 3NP7A 1K0FA 4I4LA 4O8CA 3KKQA 5ABPA 1R8SA 4LMAA 1TKAA 1QP0A 1VCMA 3FNRA 2WU4A 2V7BA 2DFKB 4R01A 3WJAA 4Z7JA 1ZQ9A 3FB4A 2HGSA 4I4CA 1LLDA 4BMDA 1NMYA 1AHNA 1KAHA 4EFLA 1FUKA 2BFPA 5TT0A 1OXMA 2RHOA 4ALLA 3D6VA 4R2HA 5CB4B 3C6XA 3DTTA 3HDJA 4JLMA 5EHNA 4E32A 3WXBA 1A82A 1VG9B 3BB1A 3E22A 3B12A 3EQ6A 3FSGA 3I9MA 1M6WA 4DIEA 1ZK3A 4LKOA 2Q6IA 5DNUA 2RT9A 2ZCUA 1RZ3A 3TFWA 5TNXA 3V4SA 2JH3A 1B0UA 4DJJA 4LJ7A 2IYRA 3HRKA 2AMFA 2AYYA 4M22A 4ZKDA 3ZCVA 3HA5A 1FQKA 2A4MA 3KJEA 1DAKA 2DT8A 3IP6A 1E6LA 4CJXA 1DRJA 1VHWA 2F1HA 1RAAA 3U50C 2P11A 5AOAA 4YMTA 1JG6A 2WJAA 3RU3A 3TK1A 4C7OB 1JHPA 2O8DB 1UKZA 3LZCA 2ZSUA 3BIXA 2BWJA 2A1IA 3LHKA 4B0OA 2CNWA 2ZLBA 3GGOA 1SVMA 2UKDA 4HT3B 1RC0A 4BS9A 1XEXB 1R4MB 2I2WA 2W2LA 4LZPA 4O29A 3TRKA 3UV6A 4KUEA 3UPTA 3LZ6A 1N9GB 1PVVA 4KWCA 3HE3A 3IDAA 1TE2A 3P9ZA 4PO1A 3T7KA 3A3YA 3GRRA 4AAYA 4ZCTA 5CRIA 4CN9A 1I9CA 3WWYA 1LDMA 2QU8A 3P9IA 2WVHA 2YZ2A 4HPJB 3F8WA 2V7EA 3ASVA 1VQNZ 4JC8A 2LZ0A 2PAAA 4DE5A 3MZKB 3NWOA 2ZRDA 3ZVRA 6REQA 4KN5A 3NT5A 1U28A 1Z15A 3H84A 3N2IA 1C0IA 1R2QA 1YB4A 1JQJC 2GPTA 1G98A 1Z07A 3Q9LA 3T4XA 1DMRA 2WWFA 5MGNA 4C0XA 3N07A 2PJUA 2CHEA 4TMWA 3SHOA 3T38A 4E2XA 1LZLA 3IAXA 3OIYA 2V7TA 4MB6A 3NOOA 5HIAA 2AFHB 1A8QA 3OCYA 5FTJA 4URXR 1WW8A 1R0RE 1D8TA 3K1TA 1HEYA 5T41A 3AUAA 3U4DA 3IKJA 5EZYB 3BA6A 3REQA 3R9KA 3WHLA 1KL7A 4IKEA 3CBQA 1IAVA 4XJSA 5BQOA 3MMNA 2GU2A 2FJ0A 4XB6B 1QTQA 2I1VB 3S2SA 2KE5A 1MLDA 3AFGA 3G6WA 4NBWA 3WRXC 3CX3A 1PX0A 1ZHFA 3EZLA 1HDZA 3A9CA 2X1VA 5G0VA 4N8EA 4HQ6A 4XOUA 4DDTA 4EMUA 1NAHA 3FDIA 1T2FA 3CZCA 4JR0A 3THXA 4E2YA 3R0IA 4H6WA 3OKCA 1G6HA 1SXIA 4MH4A 2A92A 2FP3A 4CL1A 5KOIA 2BLNA 5BPHA 3HP1A 3UK2A 4JX8A 2CVPA 4L8VA 2C4VA 4DIBA 3I07A 4HFJA 5A7FA 1EESA 1BS1A 4OLJA 4QULA 3EOZA 4LRTB 1EU1A 2VOJA 4CEJA 1F1BA 1W47A 1B8PA 3Q5DA 5K3CA 3ZCXA 2VK2A 3E9EA 3TQTA 5DLEA 1ISHA 4F4DA 3IUEA 1M6VA 2WNSA 5HIJA 4R7GA 2QK4A 1A5ZA 4Y2RA 5CT8A 5A71A 2ZBUA 2EZUA 2EKDA 1MDFA 1U3VA 4LWPA 5BSMA 1O5IA 5KNBD 2RKWA 3TTTA 1LV8A 1ULHA 5I7EA 1EK6A 4DSNA 4Z53A 2I80A 5EXTA 2NW6A 1GRCA 2IZZA 3N5CA 4LI0A 4WXPA 1HZZC 1EFRD 2DKOA 3CF4G 4XARA 4Y1FA 3J7AC 1SFOI 4LRYA 3TG8A 1ZA1A 3H5RA 2FJPA 2QT0A 2ZSBA 2GPSA 3ISJA 3MMSA 4QOGA 3ZQ4A 1BDJA 1JQLB 4N65A 2VDUE 4I6EA 4TTQA 5DN6D 2BEJA 2XUAA 3OSUA 5KB3A 2H2WA 4Q6BA 1ST3A 5BV0A 3U4QA 1Q811 3ANXA 4FI3F 3BMNB 4YLEA 5JEDA 3H8SA 4O2AA 4WCFC 1IHUA 1NGSA 2H1CA 5BOVA 3TZQA 2XHZA 1IJFA 3AF5A 2RE8A 5JZOA 1G7TA 4LTDA 5ITZA 4IBOA 4DLAA 2X2OA 4EDFA 4XPIA 4NFSA 3PLAE 5KPJA 4UM9D 4XIFA 4U2EA 1NKVA 3DTNA 5DH9A 3V2IA 3ZCQA 1DUSA 5K3DA 1H5QA 1KNXA 3EISA 1AZTA 1GAQA 2I4RA 2IHVA 2MSNA 4DG5A 1WB4A 1RD4A 2WZDA 2XE7A 4JI6B 4YRNA 5JISA 5HJ2A 5EPEA 3MUEA 2A9VA 2DULA 3MCWA 4CQMD 1UMBB 3GEBA 3PEFA 2K2WA 4MI6A 4DRYA 3QFRA 5CCXA 5C8VA 3IPCA 1OBFO 2EQ5A 3M70A 3RH0A 2YJNA 5HMMA 4S1TA 3ZCPA 1WKBA 4RFVA 3QBJA 2VNIA 2GJKA 3BWVA 1Q7EA 4KR2A 2FW0A 7REQB 1L6RA 1VQKZ 3UF0A 1NVAA 2FWRA 2O0KA 1JFVA 4AJ4A 3AI3A 3L7DA 3U7QB 3INTA 2L42A 2PT9A 3ROGA 2D06A 1XB2A 3V4ZA 3X1JA 2HO5A 1IPFA 1E7YA 3QVXA 5HCUA 4G85A 3BQ9A 3T1TA 5BRAA 2O0MA 4EW2A 1EYZA 1VYHA 2HBQA 3PQ2A 4O2BF 3A1TA 3K35A 2QDKA 5DNVA 4AC9A 1V1RA 2BP7A 3E35A 3I1IA 4ZODA 4KEAA 3L4SO 1BX1A 1Z6PA 5KNCA 3IO3A 2MSWA 1V16A 4D0SA 5AXAA 3EUEA 3EF1A 4FBGA 2EW2A 1FUUA 4GQAA 2UXBB 1CUAA 4AMGA 1O03A 3AKZA 4P7BA 4R5HA 1OFIA 3IRUA 4F3YA 4I8DA 5DXAA 1TJNA 1DTSA 2L0XA 3CCCA 4FYKA 4RULA 1PL7A 3IPYA 2P77A 3C3PA 3DD1A 3K8ZA 4IWYA 2BFBA 3D4OA 1P5FA 4XDGA 5TRTA 4OG2A 4XWWA 4BNZA 2HL6A 2PEZA 3B1FA 4HLUC 1EFUA 1MABB 1YJ8A 1ZJ6A 4MS1B 4BOYA 1OIWA 1RNIA 2YADA 3HN6A 1H2AS 3I6IA 2OQVA 2W83A 2DHDA 3IDOA 1DFHA 3VBCA 2OQ2A 2V6GA 2PWBA 3EWSA 1D2MA 3SBEA 3X2EA 4FFVA 2WIKA 1XALA 5IT5A 3HB1A 4P5PA 3PF9A 4DMHA 2HJRA 2VSYA 4DDKA 1UK7A 3CPSA 3CXUA 5BYKA 2ZROA 2NTYC 3ODGA 4G01B 3H1TA 4QGGA 5CNMA 1Q0TA 5ITZB 1F3OA 1YA8A 3Q1LA 1TJYA 3OQIA 3TTUA 2Q0SA 5TLSA 3K09A 1PSWA 3E9QA 4KN9S 4OMCA 3B6JA 3HYNA 3TDNA 3C5HA 3LPAA 4QNNA 3IAM6 3VR6H 2NUTA 3CPEA 5IKPA 2BKLA 1RI2A 3PTZA 3ZV7A 1QE5A 3LGSA 3VH3A 1JLLA 4Z0PA 1ACJA 4CVNA 3FYUB 3VSEA 2CLMB 1W0KD 3G2NA 4H7KA 1YI1A 4TTAA 1K8A2 4DV0B 1JTFA 3T52A 3WIUA 4A0GA 1R66A 3U31A 1RZVA 4RK1A 3SG0A 1E9SA 3GLHE 4UC0A 2GD6A 1Q20A 2XDQB 3HMQA 4JOSA 3IXQA 3QEKA 1DXYA 1MXHA 4Z0NA 5FTNA 5HKOA 4JITA 2MDTA 3IR6A 4EHFA 1J1ZA 1N0WA 4S3MA 1KC3A 3R74A 1KKMA 3I53A 1PS9A 5G0TA 1RHUA 2OAQ1 3AK4A 3O4VA 3QPWA 4RQBA 1XU9A 4WJZA 5K3FB 4YX9A 3TLKA 4N6OA 1PL0A 1P0IA 4P5DA 1WZUA 5FJIA 5LMCA 1VIAA 4AI6A 1O6FA 1GTG1 1Y6ZA 4L3VA 4KACA 4CMHA 3U9SA 1M2NA 1XRNA 4R8VA 4RF2A 2C5BA 3HRHA 4HRXA 4IHQA 2C4TA 1ZMRA 1X80B 4P7GA 4E1AA 4ZAZA 3QE9Y 3RBZA 1GAWA 1OH6A 1PJRA 2FRVA 3W1VA 5C8YA 3DBHA 4CMEA 3K0FB 3WRYA 2ET6A 3BMQB 5LP6B 1E8NA 1NJ8A 2I2FA 2XGMA 3ZNQA 1AO0A 3GUCA 2JBWA 3I2JA 5AK6A 1M1K2 5A7GA 3E27A 4DYDA 3KV3O 3NFZA 2Q1UA 2C07A 3LG2A 3MMPA 4KGXA 2F8SA 3FTNA 1EBBA 3G2OA 2R79A 1BVHA 4D02A 2WHPA 1E96A 3I2KA 4GYJA 1UUFA 1S3IA 4PSVA 3AIMA 4GZLA 4K40A 2B2NA 2EXXA 4WACA 2Z3WA 1MD9A 1KFKB 2IZ5A 4M53A 3CNHA 5DIFA 1A1VA 4M37A 1SVLA 3NVMB 4NCKA 1KQPA 1LNZA 2JCGA 1G5RA 4YYZA 3ZBPA 4G8JA 1KGDA 2BY4A 1P9LA 4FILA 2NACA 4A27A 2XX3A 5INTA 5BWCA 4RH1A 1FVOA 1XTIA 2BISA 3I2FA 4MEBA 1KI4A 3ZDAA 2ODPA 2E7ZA 5TDHA 4Q4JA 2Y77A 1VL5A 2PUHA 2P7HA 3CZPA 3C7DB 4QJ5A 3RW9A 3OLVA 3OF2A 4N49A 4YP7A 5GP1A 4D3DA 3BCSA 2PEYA 3AVYA 3Q10A 4L1KA 2GH1A 2VPQA 2RIRA 4PCVA 2DOKA 4I81A 3AVVA 1FK8A 4KFUA 1JGTA 4NF2A 4Y2PA 2PL5A 7ADHA 3T3OA 2XDQA 3DAHA 4I5DA 1L4FA 2V7VA 3TMAA 5AIAA 3M5WA 3H9CA 3NO4A 5DMHA 1XRJA 4PANA 2BE7A 3STWA 3SY8A 4CTOA 4FEYA 2JPDA 5AJZA 1YE8A 1PJLA 4TLAA 4A23A 3WLAA 2GEFA 4H77A 3S2FA 2IFTA 3UJ6A 2B3DA 2Q4TA 4YQFA 4HEJA 4MWSA 1MB4A 1DWPA 1I33A 1VI6A 2OSBA 4PC1A 2WB2A 2QL9A 1XA4A 1ZD8A 3PRYA 4QJ3A 3X2SA 5CFZA 5KTPA 1WCIB 3WR5A 1ODFA 5A0FA 2VXCA 3MELA 4YUWA 3KTDA 3V3KA 1E2JA 3GN1A 1BWSA 3C3MA 3C6KA 1QYXA 2TECE 3FCXA 4JC5A 5C52B 2NVUA 5DBOA 1B26A 2H0AA 1DJPA 2P9CA 1X1TA 2WD8A 1YBFA 3L6DA 3V6MA 1H9BA 1ISJA 3LRXA 3N74A 4M0LA 5FFMA 3IVXA 5JPIA 1YRHA 3DB2A 2BGGA 3CMMA 4O2AF 4YGXB 3G6KA 4NY1A 3RWOA 4D2IA 5A4DA 1HEUA 5JATA 3OCZA 4NMXB 3JCZA 1BRMA 2J6AA 3KB8A 4OLAA 4D3YA 5K8CA 3BBPA 3VGJA 2EBUA 1DAMA 3PC3A 2XMGA 2IYVA 4H6XA 1GZ3A 4Q37A 2ISSD 4YNBA 3VC1A 5GZ1A 4LQCA 3ZJ5A 2NO4A 2PH7A 3Q2IA 3HB0A 2WILA 2RONA 4GMKA 1QRDA 3A0RB 2GHQA 4HJRA 1WV0A 1Q22A 1QJ4A 3ZGNA 3HBAA 4FYMA 1QXSA 4BDSA 4CDGA 4CQMA 1ZMXA 4ZEVA 3CCLZ 1KZ4A 1YL7A 4QDJA 4WESB 4B47A 3NHBA 3DKIA 1QFXA 4FR0A 4JLWA 4TWAA 1J0EA 1P91A 2EVWX 3KUUA 1SIWA 3CCQ1 2GZRA 4MQ4A 4JBGA 3B53X 5F23A 1L2TA 4C2UA 4CIXA 2YQ5A 4ENSA 4BQNA 3QLTA 4DG8A 5CW2A 1P1CA 4DWVA 2P6RA 2CJYA 4UATA 1YZUA 1XD9A 2XB8A 3LE8A 3KSDO 1Z38A 5A2Qb 1DO2A 4IWXA 4AL4A 2QM8A 1SKUA 4X9XA 1NKSA 4XD2A 4R1UA 1G3RA 3KXDA 4YO7A 3ZN2A 2VDVE 1ONNA 3EIOA 4QUDA 5DBIA 2BELA 2W7TA 3QK7A 4LOIA 2ANCA 2QVLA 3CF2A 2IC5A 3DP9A 3IAEA 2JZCA 2QR5A 3H3FA 5AI0A 4NBHA 4KG7A 3CX8A 3PFGA 2HRDA 3DOCA 3GPCA 1CEXA 2CXRA 5TMEA 4WTOA 3WWZA 4CI9A 4EHLA 1YAHA 3QHAA 3OURA 3INRA 1KIMA 4CKYA 3F6PA 3A4NA 4ALNA 1GYRA 2YOHA 4CLXA 2WFLA 3AKYA 2NUPB 4Q7MB 3ECSA 3VVMA 2FMTA 3OH8A 3V1YA 5LKRA 3CUWA 1ZD1A 3GLUA 4BFVA 1D0IA 2HLNA 2QORA 2PSHA 4GBGA 3ADOA 3AQ4A 3M4JA 3PZRA 1JYEA 4UVIA 1P1JA 3THWB 2CFCA 4YJGA 3GFBA 1FRQA 2HRZA 3NBKA 1KP2A 3PGMA 3CRZA 4EG4A 2B92A 2ATEA 1AQNA 1R4NB 1LQLA 1AG9A 2I7CA 3JSAA 5EWLA 1FTQA 3HXMA 2W2VA 1VE5A 1ZA2A 2ADOA 5KINB 1SQGA 1WW9A 4MCJA 1MQ9A 3O73A 4NEQA 4Q00A 4REOA 3CVWA 2XTZA 1CB0A 3OCCA 4LUCA 1UWLA 3UB2A 4K0RA 1KI2A 2HADA 2WM3A 4LYEA 1G5QA 3QVVA 3D5TA 3ADCA 2B8JA 1EX9A 2I33A 1N0HA 1ZMBA 2YYSA 4KW7A 4QG7A 4CW7A 1ADYA 4YT2A 1IY2A 3ONFA 5AVYA 3IVGA 4ZEXA 2FR8A 2RARA 1PD0A 4HUQB 4MNTA 4ARUA 1HR0B 4K0KB 4UUBA 5JBNA 1Y4SA 1FXWF 4ZAYA 4XDYA 3PGJA 1O08A 2PG3A 2QV0A 2AC2A 1WNFA 5LUAA 4M60A 2DB3A 1VA5A 4ZGBA 3F67A 2IH4A 4Q1BA 1T0UA 5A4JA 4BLQA 3K8YA 1QIEA 1CV2A 5JC8A 3PC7A 4H7JA 5GINE 1DAIA 4CMKA 1IHPA 5A9RA 1TLTA 1E98A 3DGFC 3KXKA 4M54A 4ZI7F 2P9HA 1PHRA 4AP5A 4RWZA 3DOFA 1P9WA 4I9UA 4MI1A 1G8AA 2HFJA 3IPXA 4HQKA 1LTKA 1XYYA 3FTFA 3ZHUA 4ZJUA 4H4EA 4QNMA 5KYUA 3W5CA 1KFCB 2XKKA 2ZXUA 2CVOA 1BX0A 4X84A 1IBRA 1VQN1 2MIIA 1AK1A 4PLWA 4A36A 3F3MA 2GBGA 4AJKA 5IVHA 1R5OA 3BA1A 5FOVA 2B1IA 3OZCA 1T3TA 1XMQB 4HDRA 4PE5B 1Y5IA 3X43A 2P2SA 2BRUC 2JRLA 1UJ2A 2DQZA 1G3MA 2VJPA 4JELA 4DPMA 1KJNA 1U9YA 5BN5A 2FG7C 1V6SA 2JFGA 3CCV1 4GR5A 2QYOA 1YRQA 2N75A 1GCOA 5T57A 1WW3A 2VATA 1QIMA 1N9KA 2QHXA 3I9V1 1A8PA 2JGRA 1CQPA 7MDHA 4MR8B 3RS2A 3TJRA 4YP5A 3BJZA 1VDMA 1NU6A 5B4UA 2O53A 2C2WA 4PIPA 4TRRA 3VJKA 3BB4A 1CUYA 3U56A 2PT7A 3DBLB 4HMOA 2P3YA 1GVHA 4MW4A 1MENA 4GZ5A 3SXJA 2XUZA 1R4NA 1T2NA 2H06A 3AJDA 4URUR 3IS3A 1U9JA 4I4NA 4XQ0A 1KVSA 3TCNA 1I7LA 4B4KA 1H4SA 4I5EA 2XOKA 3PCXA 4GUAA 4LJAA 4Z1OA 1BYIA 2BFAA 4BAUA 4MPTA 3QIAA 4RTNA 2Y99A 5I7FA 1ZGJA 3OFVA 2VNAA 3CVJA 1KEWA 5FWXA 5BY2A 5HOQA 2ZJ1A 1IDN1 4WJKB 2P0EA 2PLRA 4ALMA 2HTEA 3AU9A 3IKLA 4CUJA 2N0SA 1XWIA 1IVYA 1R0KA 1KYVA 1NMQA 5LLSA 1Z33A 3DHYA 1B0ZA 4A93I 2M6LA 3PJRA 3PHIA 1TC1A 1UPTA 3N87A 4MJ7A 4TMYA 5IDXA 2DTEA 3DZBA 1RM0A 2OWDA 3WYDA 4F8JA 4KR3A 1GKKA 1NVDA 3EHDA 4KHPB 1UXIA 1DBPA 1L5VA 3GFRA 4C4XA 5ER6A 4YUZA 5G0UA 4LKRA 2FW1A 3AR4A 2GYWA 1DLIA 5AKZA 1EVLA 2ZRNA 3N6RA 5FV4A 3ZV3A 4W9MC 1MJGA 1HH4A 3ZE9A 4D46A 1ZNZA 4LY3A 1IEVA 3COJA 4WINA 4LMRA 1WUJS 3PJDA 1XDSA 5T7BA 4LOKA 2JLWA 4RQUA 2JG3A 2QENA 1IM8A 1HNXB 4EVRA 3GCZA 1FFGA 3KHSA 4OJKA 3EDRA 1QGDA 3HXTA 4R3UC 4EAQA 3AWDA 4YXFA 1PJAA 3B8EA 3RF6A 2MYTA 4G2NA 4MV5A 3TEFA 2HV8A 3N2EA 2FX2A 2DZDA 2RDMA 1OAOA 5P8WA 3WVNA 1O2DA 3ONDA 1WPQA 2YQ4A 5DI9A 1YJQA 3JQ9A 4K26A 5CFRA 3RAEC 4H9GA 2I4OA 3BWXA 4MUYA 1UXHA 1Z73A 5KSPA 3SSAA 3PNOA 1T5SA 1ZB8A 1LWOA 3LM8A 3JQ7A 4OFBA 5DCLA 1SCQA 1YFZA 1VSVA 1VJ0A 1WTAA 3A25A 2YRXA 3CLUD 1T9GR 1E1YA 3LUDA 1XKTA 3FF1A 5AD1A 1V8FA 4B9EA 1ZBDA 1NDQA 1EWKA 4MDHA 1IN6A 5IT9A 3O93A 3WMWA 5C1PA 2W90A 1GGEA 4NK5A 2O7QA 4YROA 2QRGA 3WYEA 4X3OA 5BURA 4HWOA 1N6KA 4XGQA 5DU2A 3FR8A 2XF2A 4O5OA 1Y81A 4PYQA 3CO5A 4XIGS 5LPNA 1BJRE 2PKQO 3NUZA 3NXSA 1U81A 2G88A 6ADHA 3E1KA 2R97A 1ZJWA 4K9SA 3MPUA 1NURA 3TTVA 4Q34A 3L1UA 1CUGA 4OXNA 3OZVA 4TT3A 2GX6A 3GGDA 3WGZA 4AZSA 2IOFK 4ER5A 4N82A 4PC7A 5F64A 1PR9A 3B38A 2C7BA 4M0UA 5C8YF 4F71A 3S1QI 1B76A 3QF7A 4GD3Q 9GPBA 4B3CA 1JWLA 3DFZA 1Q44A 2TS1A 3W8RA 4UUMA 3S14I 3QLVC 4EGQA 4OKSA 3U81A 1WQ1R 1RXEA 4IYJA 1OWNA 2OTLZ 4PF1A 1G7RA 3HO6A 2BF7A 1CQIA 1M8JA 3M4XA 3O9VA 4N1AA 3MBKA 4MVJG 4OAOA 1ST2A 2HBRA 3AW9A 2QZ4A 3LO8A 4GKVA 4KMMA 5H0IA 2FJUA 3TL3A 1J9EA 1KR2A 1UP4A 3PDHA 1E5TA 3SC2A 2LRHA 3BEDA 1DEKA 3G79A 2VOEA 1P29A 4IHJB 4CKXA 3R4CA 4JI8B 1P80A 3HDGA 3LDUA 4EZBA 4LE0A 2RGCA 3EZ9A 4KZKA 4OMFG 4XGKA 3NUGA 4ZAVA 5HF9A 3TIFA 1V6AA 1H23A 2YNMC 2Q1YA 3BWYA 4DQKA 5JY6A 3SZOA 1MT0A 2Q45A 2V1XA 4CMCA 4QAJA 2J9ZB 3AX6A 4G4SP 4OK3A 5FI5A 5AK3A 1MOSA 2WE8A 1TFIA 1B6RA 2QREB 3KZXA 2IZ3A 3PWZA 4N8SA 5HFJA 1E2NA 4RGYA 3KQQA 2Q6OA 1LUAA 2P4UA 3DAYA 2IUEA 2ZB4A 1U3DA 1X74A 3NHKA 2OCYC 3SXPA 3NEPX 4DPKA 4X6YA 1J20A 1T0JB 1ZU5A 1YL6A 2NVWA 4DR4B 3RS9A 4ZI7A 3T9EA 3GFSA 1SHKA 2DE0X 3O31A 3P5SA 4GFDA 2UUBB 1PIWA 3RRBA 1XKQA 3VKWA 1CZOA 2H57A 3LBIA 2WAAA 5DASA 1NLZA 5DZSA 4R6WA 3VH1A 3WBFA 1CR1A 3K05A 5H81A 3W1WA 2GXQA 3WLFA 2DR2A 2W6NA 2XVMA 3N2GA 2ON6A 1Y1RA 4RA9B 3P9KA 4RK6A 3EC1A 2ZBVA 5J5CA 4EB0A 3GNLA 3IT2A 2FHSA 3HCOA 4PAGA 5B57C 1KR5A 5GADl 1NAIA 1C9YA 3B13B 2RGGA 4KE8A 2P41A 4GQIA 4LC0A 4Z8XA 4KXMA 3ANYB 4RHCA 1YKFA 4FKZA 4N8DA 3AF1A 3D7LA 3DTVB 3GFQA 4BZPA 4I0WB 5D8DA 4HNUA 1E0SA 3KOWA 3KZ1E 3SMQA 4DJ5X 2XGSA 3ORRA 4S05A 3EPHA 1PG2A 1LVUA 1TU0A 3U44B 4IWNA 2PNJA 2CBXA 4PS0A 4QZVA 3M3PA 3LBHA 5KJCA 1LI4A 4POAA 4Q05A 4RORA 5JAQA 1UPXA 1D3AA 4G0VA 1JLHA 4IIBA 4K9PA 2QM0A 1NG1A 2AE1A 1C4KA 5C8YB 2I4MA 2OZPA 1K4KA 1CQIB 2DH5A 2PK7A 1YIJZ 4J0EA 5DSXA 3IUQA 4Y2VA 3WYFA 1IIBA 4TKUB 5FBKA 5UKDA 4AMZA 5AQ1A 4HF7A 1KAEA 2WF6A 3JYQA 4HXEB 1VSQA 3KSAC 4PPNA 1R9JA 5DNAA 2QRKA 2GBLA 3IT1A 4IHJA 2VUGA 2XZTA 3UCXA 8OHMA 1N78A 2CFRA 4M7RA 5F9HA 4II2A 2A3RA 2Z9BA 4CU5A 2X13A 4J0CA 5C7IO 5EIXA 5FD8A 4KXYA 1JR6A 3THRA 4HFMA 1LPAB 4TWZA 4JI0B 1VJ5A 4TL8A 1Q6ZA 3CCFA 3U9TA 3D6UA 1DT5A 5CB8A 4ZICA 1MNAA 4E7OA 3TZLA 3Q7SA 3Q9SA 3YASA 1LRLA 1P0MA 3SBXA 2NWQA 1AMUA 5BV2P 1O96B 4FX2A 3QX7A 5ALNA 1LBHA 4RL6A 1I50I 1EB9A 1Y1QA 4K8RB 3BGSA 4ONEA 4KXFB 3UAYA 4YYEA 1UZMA 4FYHA 5KS2A 4MD8A 1QK3A 2VRCA 2RIPA 2FPGB 1R00A 2VK4A 2WD9A 4MYHA 4YJKA 4ZHQA 1VHDA 4F85A 2GT1A 4NB9A 3HYSA 4MQBA 3QYFA 4HS4A 4RVSA 4GLBA 2VYND 1RP1A 3R8FA 3U3JA 4EUKA 2F8TA 4RETA 2NVQI 3IHTA 1V47A 2ASEA 2Y9MB 4U8HA 1CIJA 1CNEA 3RIYA 1GPWB 3HWRA 4PRZA 1T2DA 2ZETA 3A37A 5FORA 5E6UB 3VAAA 1P3DA 3GCFA 1LK0A 1U0RA 2CN1A 2X8AA 1BOOA 3EVDA 1L9KA 3PI7A 4G26A 4CM4A 4RE6A 1EVZA 1KVTA 5AKXA 2X5OA 6YASA 3O95A 4WJLA 2NO9A 2J3DA 3HU5A 2IU3A 3TD9A 1U80A 2OYCA 3GH1A 3NIDB 4ZCMA 1N77A 3RYCB 2GPJA 1ORVA 1FOEB 3KKNA 4KREA 4MZDA 3HA7A 2GFIA 1CQXA 2CXQA 3R4VA 4OLHA 1YT5A 2VZ8A 2ZB3A 5WRFA 3P9YA 2X2PA 2XYPA 1Z36A 3N7AA 5JLAA 4FYWA 3T6KA 1P2DA 1DGQA 3ZDCA 4NQRA 2ZE7A 1W6RA 1QFMA 1CJKC 3CRVA 4G81A 2W2LD 3NBFA 4CTMA 3LIPA 3CPJB 3OPYI 2G9VA 5JSHA 5FLXf 3E5NA 1AXGA 1ZJ5A 1N2XA 3D43A 4M1WA 4NB8A 2ZIFA 2Q50A 4HEHA 1DG3A 3IQDB 4KDEA 3SU8A 4L9SA 1BN7A 5IDQA 2XMDA 4CCSA 2XECA 1RJEA 3F8TA 4QGHA 3TQQA 4CM9A 1G0OA 3O8LA 3VVCA 4QTUA 3IURA 5BP7A 3WISA 4D26A 2H3EA 1E1QA 2YCBA 4DW8A 3GJ7A 1NULA 1KE1A 4AMUA 2AQHA 1JQKA 2FSVC 3LDAA 3EW9A 3NDJA 1QGUB 1U1DA 2PUWA 3GUUA 3EGXB 4L78A 4YV2A 2AF3C 1LTQA 4G4JA 5FLMI 1T0BA 1ULUA 1T9CA 1WABA 2DPXA 4TLDA 1I3NA 3KOZA 4TXNA 4CFSA 5FLXA 1UMDB 1P2VA 5C3EI 1IQRA 1E7MA 4NBFA 1ZNYA 4CMEC 4DYVA 4OGGA 1VP3A 2BDTA 1W4RA 4ATNA 3IUBA 3JYHA 5A1TA 1MC1A 2JFVA 2YKGA 3WKCA 3M3YI 2L82A 2BBWA 1L4YA 1TCUA 2A5FA 2NTJA 4G3XA 3VTFA 4CBVA 5K99A 1AKMA 2LDBA 3OJEA 5JG7A 1LPNA 4CEHA 4LOAA 5CT4A 3ZY4A 3CE6A 5DWQA 1ORTA 1EUCB 3LQYA 5EFOA 4YWJA 4Q4AA 3WG9A 2QL5A 3DAPA 3GJ4A 2GZHA 4R05A 4RXUA 2QA5A 1R1DA 5EVJA 4R6XA 3FLBA 4PLGA 4DNXA 4HI0E 1N5IA 3GJ5A 4LXQA 1BFDA 4K3UA 1G8JA 3TLAA 2JI9A 3NKLA 4PXYA 4OB6A 4MINA 2ZWPA 3KQNA 1Q821 1YCFA 4JJ8A 4MUKA 4DREA 4B3DA 4G5FA 3FETA 1BNCA 3F90A 3ZLTA 4MSUA 3U4CA 1GSAA 2OTJ1 1W59A 3CURA 3T3MB 5GV8A 5FLXb 1WD5A 1EE2A 4YMUA 5KYWB 4DM3A 2UXDB 4Y98A 3TNYA 2QT1A 4D6PA 1V5EA 2DY1A 4W1SA 1ONBA 1ZM2A 1L4EA 2NO6A 5LA6F 2ZB2A 1DC5A 4D8UA 3H3XA 3LFUA 2FMIA 2DWOA 2PXAA 2ZXEA 4KXVA 2EFJA 4IFEA 4CMIB 1A2QA 4ZN6A 1YU9A 5EJIA 1IWBB 4N54A 2WJPA 3P97A 2RI6A 2DE6A 1H2HA 1X7XA 2B2XA 1OYOA 2QM7A 4KBFA 1S0UA 2F1OA 3BF8A 5LQNA 3F5SA 1G18A