1Y8CA

Crystal structure of a s-adenosylmethionine-dependent methyltransferase from clostridium acetobutylicum atcc 824
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
246
structure length
246
Chain Sequence
NCYNKFAHIYDKLIRADVDYKKWSDFIIEKCVENNLVFDDYLDLACGTGNLTENLCPKFKNTWAVDLSQEMLSEAENKFRSQGLKPRLACQDISNLNINRKFDLITCCLDSTNYIIDSDDLKKYFKAVSNHLKEGGVFIFDINSYYKLSQVLGNNDFNYDDDEVFYYWENQFEDDLVSMYISFFVRDGEFYKRFDEEHEERAYKEEDIEKYLKHGQLNILDKVDCYSNKKVEKFTERITYLVKLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a S-adenosylmethionine-dependent methyltransferase from Clostridium acetobutylicum ATCC 824
rcsb
source organism Clostridium acetobutylicum
molecule tags Transferase
molecule keywords S-adenosylmethionine-dependent methyltransferase
total genus 90
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2004-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.110 Mainly Beta Single Sheet N-terminal domain of TfIIb S-adenosyl-L-methionine-dependent methyltransferases 1y8cA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1y8cA01
3OCJA 3R24A 4MIKA 3JWHA 2OPBA 2FPOA 4B17A 4X1OA 5EOVA 3BXOA 4GOND 1RI1A 1QAMA 2AS0A 3EVCA 3HA7A 2AN3A 4BLUA 1M0EA 3NMUF 2QM3A 2IPXA 4FS8A 3VYWA 2R6ZA 5CVUA 1IXKA 3QOXA 1KPGA 2IIPA 1O9GA 3Q87B 2ZULA 4HGYA 3PFHA 3T7RA 3UZUA 3T0IA 4F84A 2PKWA 5LQRA 2AOUB 2ZIFA 4PCAA 5DM0A 5K05A 3PS9A 1L3BA 3LKZA 3E05A 4LWPA 3CJQA 2NYUA 1G55A 5ICFA 3UJ9A 1R18A 2ORED 2PXXA 4MQ4A 3KU1A 1TW2A 4GUAA 1X19A 3BUSA 1DCTA 4FSDA 1QANA 1H1DA 3P2KA 2PLWA 5K03A 4R6XA 1L1EA 5CD1A 4K6MA 4ER6A 4OQDA 1KPHA 2XBMA 3AJDA 5CCBA 5LR6A 5C9ZA 1JSXA 2VZ9A 3SVZA 1D2CA 1KHHA 2OB2A 3DLIA 5IH3A 4Y2HA 1NE2A 3LDUA 5DLYA 3CBGA 3KKZA 4AZSA 3BWBA 5E9WA 5EHGA 4F86A 2CL5A 1NT2A 1T43A 2PXAA 4HG2A 4V0QA 3OZSA 3R6TA 3A27A 5K0BA 3LCCA 1KYWA 4HTFB 4A6EA 1YUBA 4OQEA 2H1RA 4QVGA 5CVVA 5EGSA 4CWAA 5JUWA 2PWPA 3GCZA 5CUQA 3NWBA 5DX0A 5KQSA 3OPNA 3KQWA 4QPPA 5M5BA 2UYCA 2NXNA 3T7SA 3HVHA 4BY9E 2PT9A 1L3CA 3SSOA 1B42A 2JJQA 3AWIA 4RVHA 2XVMA 2CKDA 1NV9A 3ELUA 1RI3A 2FHPA 4U7PB 2ZSUA 4PYKA 5DTMA 3FPFA 4DF3A 1R00A 1L9KA 1XDZA 3F4KA 4QDJA 3NTVA 3ME5A 4EQZA 3IYLW 4M7RA 2G70A 5JR3A 3LCVB 1JSZA 4E70A 2AOXA 2IDJA 2YX1A 1FPQA 1I9GA 3UJ6A 4RTMA 3G2MA 1XXLA 3TOSA 4P7FA 4YV2A 1WS6A 3ORHA 4PONA 1JG4A 1MHTA 1YZ3A 4KVZA 3EGVA 4YV1A 2Z6AA 4DKJA 2BH2A 3PTAA 2UZ4A 1SQFA 3HNRA 3C6MA 5EIFA 4GBED 2DPMA 3PFGA 5E8JA 4CKCA 5LQNA 4HSGA 5U4XA 3P9KA 2B3TA 2PX4A 4X63A 3NVKI 4OBWA 1F3LA 3EVZA 4RTPA 4PYMA 2IBTA 3O31A 4E2ZA 1OR8A 5E1OA 2GPYA 5B1SA 3FPEA 3DXZA 5E1MA 3ER8A 3GIWA 1TPYA 1UFKA 1JQ3A 4E30A 2V7EA 2A14A 3FUVA 3MTIA 4DCGA 4RSRA 3T7TA 2GA9A 5EG5A 5FA8A 4PINA 1RJFA 2E5WA 5DRYA 5BW5A 3LX6A 5KYGA 1N7JA 1N7IA 2P3OA 1XJ5A 1YF3A 3HCAA 3EMDA 1SVUA 3DH0A 1R74A 5H02A 5EMJA 5FHQA 3R0QA 1RJEA 2G1PA 3GXOA 3V8VA 4MTLA 3SX0A 3M70A 4RTOA 3HCCA 3NW9A 3OU6A 3OFKA 3P2EA 3A26A 2YR0A 5DM2A 1V39A 2BZGA 3DULA 3P9IA 5CVEA 3IHTA 3M4XA 2GAFA 2O06A 2VP3A 5KQRA 1KYZA 3P2IA 1KR5A 4RTQA 3EVAA 3G8AA 2BM9A 1X1CA 4CKBA 4E32A 2BM8A 4PYJA 1O9HA 5DTQA 1RJGA 3GNLA 4Z2YA 1X1AA 2AN4A 2AVDA 1X1DA 2Y1XA 3MTEA 5LQKA 3AXSA 5HILA 5C0OE 2NXJA 3E23A 2Z6QA 2LD4A 5EMMA 3GO4A 4MWZA 2JH8A 4F85A 5DT2A 3TR6A 5HEKA 5EKXA 3B3GA 1XTPA 1YB2A 3LL7A 4AX8A 3KHKA 2NXCA 3KR0A 1VE3A 1NV8A 4KW7A 5HIKA 4KIFA 4WXHA 2YTZA 4PGHA 5GM1A 3B89A 4BLWA 1RJDA 3GRZA 3U81A 4CTKA 1WXWA 2EJTA 1M6EX 3E8SA 5F2OA 5ICEA 3PX2A 1NW8A 3HCDA 4FZVA 5HIIA 3LCUA 1QAQA 4C4AA 5ICCA 5FQOA 1EIZA 3Q7EA 4QQNA 4HGZA 5CVDA 3LKDA 5LQAA 1XCLA 1XDSA 1JQDA 3HA5A 2PV0A 3DMFA 5FWDA 1JG1A 4RTSA 1BC5A 3O7WA 5E8RA 3P9NA 3M6WA 5FCDA 2ZCJA 2ADMA 2Y1WA 3FUUA 3OU2A 4PYQA 4UOEA 3GRYA 3G88A 4RVGA 2I7CA 2ZBQA 4R05A 5F2KA 4POOA 3EPPA 2AOWA 3VSEA 4DMGA 2FRXA 2K4MA 4EVIA 4L7VA 5DM4A 2ZIGA 5K0EA 3KQTA 3P9CA 1BOOA 4E2WA 2C7PA 2VDWA 3OZRA 5GOZA 1YFJA 4BP3A 3JWGA 1WY7A 2AVNA 2HMYB 3SXJA 3REOA 3P97A 4GEKA 3MQ2A 2OBFA 4XUDA 5FWAA 3DMHA 1AQIA 2G8NA 4M36A 1G8SA 3CVOA 3FRIA 3NJRA 4QQKA 2P41A 4QTTB 4AZTA 5F2NA 1SKMA 3HTXA 1NBHA 1NW7A 4M37A 4YMHA 4IKPA 2OKCA 3ELYA 4WVLA 4DM3A 1VLMA 4ATNA 3FUXA 2JHAA 3UJAA 3UA4A 2NP7A 3BGDA 3C3YA 3OE4A 2P7IA 1Q0TA 3K6RA 3KR9A 2CWWA 1P91A 3A7DA 5K0JA 1YZHA 3PB3A 3OE5A 4PYIA 2GH1A 5CCXA 3FTFA 2ESRA 5CVJA 3EVFA 2ZFUA 3G8BA 3EGIA 4IV8A 4P7JA 5E2BA 3UBTA 1RI4A 4X61A 5FTWA 3KQVA 3MCZA 5LQCA 2ZTHA 3KPUA 3FPJA 4XCXA 2FYTA 3G89A 3PLAE 1VQ1A 4FSXA 5FUBA 8MHTA 2QYOA 2BR3A 3TFWA 3TM4A 3DMGA 1D2HA 2XYRA 4ER5A 5EMKA 4E31A 5K0GA 2VDVE 2ONYA 4FP9A 3EMBA 5E9JA 3CKKA 4IV0A 4CKEA 3D2LA 3M6VA 3PVCA 3G2QA 3VC1A 1TW3A 3P71T 4BLVA 5K01A 3FUTA 2ZZMA 4XUCA 2ZBPA 3OZTA 1I1NA 1UIRA 3KQQA 3NVMB 4LWOA 5GP1A 4YUYA 5HIJA 4PNEA 5E2AA 4GOMD 2IDKA 3L8DA 3M6UA 2P3LA 4RTNA 1JG3A 3LHDA 2JG3A 5DSXA 2B25A 4OBXA 5E1BA 3NDIA 3FPGA 1Q0SA 3CC8A 3FZGA 1G60A 5DRTA 2EX4A 2IFTA 2NNWB 5LSAA 4DZRA 2C7QA 1IY9A 1JQEA 1JG2A 1IM8A 3BZBA 1HNNA 4HTFA 3TMAA 5DXJA 2Z6UA 4EKGA 2DULA 3NWEA 2PJDA 1RI5A 5HFJA 4PYOA 2B9EA 3C0KA 4PWYA 3THRA 3FTCA 2IH2A 2P7HA 4ER3A 3KQYA 4RV9A 4X60A 2YVLA 3G5TA 3KQMA 4IWNA 2O57A 4U7TB 3V97A 2H11A 3A25A 3I64A 3KQOA 1JTFA 2I62A 1INLA 5EQJB 3TLJA 2ZZNA 2PY6A 2HTEA 2UYHA 3HEMA 2IH4A 1VBFA 2IP2A 1ZKDA 4EK9A 2WA1A 2QY6A 2YXDA 3S68A 2V74B 4A6DA 1G38A 4RVFA 3BT7A 4ISCA 4HH4A 3ANXA 3LSTA 1ORIA 3FTDA 3UFBA 3PX3A 1UWVA 2OY0A 2BR5A 3OU7A 2O07A 4BP1A 3SSNA 4M38A 3P8ZA 3KPWA 3UA3A 3UWPA 3FUWA 5GM2A 1Y8CA 3GGDA 5BXYA 3ERCA 5FQNA 3BGVA 2WK1A 3FTEA 2ZBRA 3MERA 3BWYA 4RTJA 1G8AA 3C3PA 1R6AA 3HCBA 5EKUA 1XVAA 3HP7A 2JHCA 3UJCA 1ZG3A 3HVJA 1ZHFA 2Q41A 4QPNA 1I4WA 2YXEA 3HM2A 3MHTA 2AZTA 2P3QA 3ELWA 1KIAA 2ZVJA 5FULA 4MHTA 3ER9A 5E9QA 1FP1D 2AR0A 3DUWA 3NDJA 4GF5A 4PYNA 2VS1A 4RTKA 3R9XB 2NP6A 3GJYA 1KPIA 5K0FA 4OA8A 1SG9A 4PYLA 1VPTA 2P8JA 4OA5A 1VIDA 5EEGA 2ZW9A 2EFJA 3MGGA 5FHRA 5BW4A 2HR1A 5T64A 1XCJA 5LQJA 3ELDA 4EMSA 2P40A 2PGXA 3TKAA 5BP7A 1M6YA 4R6WA 1P1CA 1WZNA 2AN5A 1X1BA 5LQUA 2GLUA 2PT6A 4LECA 3KR1A 1D2GA 5FA5A 4ER0A 4QDKA 5DSTA 4DCMA 2F8LA 5DM1A 3B5IA 2YXLA 1DUSA 2IGTA 5K0CA 3FYDA 2KW5A 9MHTA 1SQGA 1EAMA 1BKYA 1L3IA 3KQPA 2I9KA 3HVIA 3LBYA 1AV6A 2PX2A 3SM3A 4P58A 5K0LA 2R3SA 3BWMA 5CIYA 5DPMA 2PXCA 4LG1A 5G02A 1FJXA 2C7RA 3RODA 4C06A 3IV6A 3OFJA 3DTNA 3KPVA 2ZWAA 2HNKA 5EZSA 1F38A 3CCFA 4JXJA 5EHIA 3TQSA 3G7UA 3SSMA 3FRHA 4HRAA 4C05A 2I6GA 5K0NA 4DQ0A 1N2XA 2QRVA 4KIGA 4Y30A 1Z3CA 4AZWA 3TPZA 4YUWA 5T6BA 5GIOE 3BWCA 4AUKA 4YUVA 3EEOA 3GRRA 2FK7A 4QVKA 3SGLA 4ZTBA 4PCLA 4FR0A 3EVEA 3A7EA 1ZGJA 3EVDA 5IKMA 3KR2A 3I58A 3HCEA 5P8WA 3SR4A 3GRUA 3LBFA 4G56A 3UJ8A 4E2YA 4YMGA 2EJUA 5D1HA 1P39A 3R3HA 4QTUB 2G72A 2O0LA 1VP9A 2G71A 2OB1A 3GWZA 4GC9A 2OZVA 3THSA 4CTJA 1AQJA 4RTLA 5K8VA 2IBSA 3DLCA 5C1IA 2N47A 3O4FA 4E33A 2P35A 5EIWA 2UYQA 3JWJA 3FPHA 2FCAA 5EZQA 3WSTA 5DXAA 2OYRA 2ERCA 4C08A 5MHTA 1PJZA 2XYQA 3HCFA 4PIMA 4V0RA 3DR5A 4RWZA 1YFLA 2FK8A 4EKIA 3CJRA 4P7KA 3M33A 3MCTA 4FT2A 4GOLD 2WA2A 5ICGA 4YV0A 2AOTA 5EVJA 4AZVA 5K09A 2QRVB 3RIEA 1KP9A 3C6KA 3QOWA 1G6Q1 4KWCA 4YUXA 3KPYA 4FGZA 1QAOA 4O29A 3HA3A 5EPEA 4ER7A 2PX8A 5KVAA 5GWXA 3KQSA 3MAGA 1FBNA 2JH9A 1RI2A 2ZIEA 4R8SA 1R8YA 1SUSA 3A4TA 3SMQA 1O54A 2XVAA 3EVGA 5HIMA 4GQBA 2O05A 3FYCA 1U2ZA 1NKVA 4DA4A 5GIPE 1XDUA 4KDRA 3CJTA 3I5UA 3K0BA 4GOOD 4NECA 4FT4A 4RX1A 1QZZA 2B2CA 3H2BA 3UJBA 3I9FA 2YQZA 1VP3A 4C07A 3EEYA 3G2OA 5DX8A 3GRVA 7MHTA 5D1NA 2PX5A 4GC5A 2PVCA 2HV9A 1PRYA 2ZZKA 4PIPA 3BGIA 3LDFA 5FADA 2AOTB 3LDGA 2ONZA 3LPMA 4R8RA 1ZQ9A 3I53A 3RW9A 3TKYA 3G5LA 4P7GA 3LECA 2GB4A 5DTRA 3CGGA 4RTRA 5CM2Z 3BKXA 1KXZA 3ID6C 3M6XA 5DWQA 3MB5A 3JWIA 2PSSA 5GINE 3KPJA 2CMGA 1FP2A 3AY0A 3DP7A 4HC4A 4C03A 1NW5A 3X0DA 5HZMA 1EJ0A 3DXXA 2CMHA 2UYOA 3HVKA 1HMYA 4KDCA 3E7PA 2HWKA 3IEIA 1MJFA 3LGAA 2C7OA 1QYRA 4YUZA 1NBIA 1DL5A 2ZLBA 3G2PA 5T67A 1NW3A 5E1DA 3TRKA 4C04A 1ZGAA 1JR4A 3GU3A 1JTEA 3B3JA 3UJDA 5EMLA 3VC2A 1P1BA 2GS9A 1R8XA 3DXYA 3PT9A 2ZWVA 3B3FA 3GDHA 1WXXA 3AXTA 2NXEA 5EEHA 5HOQA 5KS2A 2XYVA 3QV2A 2IH5A 2OXTA 4PGGA 1VL5A 2VDUE 3DOUA 1BHJA 4E2XA 2OO3A 4OX9Y 2AOUA 4CXMA 1AF7A 2YUIA 3EVBA 1NW6A 2AOVA 3BKWA 1EQAA 2JHPA 3B7PA 4KRGA 5ERGB 2P1DA 1EG2A 5EC8A 4XUEA 3TM5A 10MHA 3UJ7A 4H0NA 2PWYA 4X41A 1WG8A 2BR4A 1ORHA 2QE6A 4RYLA 2H00A 1SUIA 4RVDA 5DX1A 1EJ6A 3EGEA 2EG5A 2B78A 2PBFA
chains in the Genus database with same CATH superfamily
1V8DA 2NVOA 5JU6A 1YR2A 3NASA 5F5XA 3NTXA 3MSCA 4CF7A 5KVCA 5JMWA 3DBLB 4JGIA 1NRIA 4UAGA 3RADC 5CLIA 4WHMA 4RZXA 5H4HA 1QGYA 2PGJA 2JJ2A 2WIJA 1GPDG 1N8TA 3GMDA 1P7PA 4IDCA 4IR7A 3KBBA 3AVYA 1BMTA 1H1TA 3QOXA 4L7QA 5JHGB 3BA6A 4HDRB 4ZAYA 4ZK6A 4RLSA 1U7XA 3ROPA 3S4YA 1U8AA 3AR5A 2F4NA 1R0WA 5T4EA 2Y1FA 3SYNA 1J90A 2VSOA 3HEAA 3IUNA 1CUWA 3E27A 4IGKA 1ORVA 4IJKA 3R7WA 3UF0A 1FFGA 1X0TA 3CJQA 4TXMA 2XXJA 3K0EA 2ORED 4PR0A 1J8DA 1ZD5A 4KFSA 2XYPA 1FCJA 1UC8A 1G5QA 1HYQA 2ACVA 3KU1A 2XOXA 4BV8A 1G98A 1EZ4A 1X19A 1ZM2A 4C4XA 2XGOA 1V11B 4HNTA 1O4VA 3H6GA 3KZ1E 3B53X 1CDZA 3IP8A 4Y2XA 4XWKA 4OL9A 1WBDA 1XN4A 4DK1A 2W00A 4MXUA 2FTKE 3PL1A 4LV8B 4B75A 2NV0A 2PUVA 5ESRA 1D2CA 4KE6A 3T4XA 2BFDA 3G0CA 3PEFA 1QONA 3CUSA 4BAUA 3A9SA 3WLNA 5BWCA 6LDHA 4DNXA 5ECDA 3VYTB 1JP7A 3AL0C 4YRGA 3N2IA 2IHUA 5EHGA 1VLQA 1D1QA 4BCDA 5BUZA 4R2KA 4TTPA 2W58A 1T43A 4CQLA 3DCIA 3R6TA 4IJVA 5H1YA 3FNFA 3H0EA 3DBOB 4PVDA 3P4XA 4KQ2A 4OQEA 4MI3A 2Z08A 4C5CA 4XPIA 5JUWA 5DU2A 1XDDA 3HCWA 3MC1A 3U60B 4G1FA 4CG0A 2J5QA 4OHFA 4NABA 3DB2A 1YDMA 1KQOA 3BXZA 3DHYA 2QTLA 3OZDA 4HGQA 5AKGA 1G8KA 3AWIA 3PL5A 4MS3A 3W34A 4PO1A 3AVXA 4NYIR 5CLQA 2IPLA 3A0RB 3A6EA 4EHLA 3F90A 4GXQA 3TIGA 1ZR4A 3A05A 1YVPA 1QIMA 1W5FA 1XNHA 1KK0A 4WZBE 5I8WA 2G5GX 5KREA 4A6PA 2JFBA 3EZLA 4GSLA 3WTCA 4HEA6 1V6AA 2AOXA 3U7HB 2WWGA 1WKVA 1SPXA 1UANA 4G1VA 4U7FA 3JTEA 1T2UA 4DVGA 3G2MA 3CWCA 1NYTA 3TH5A 5C8VA 3GUVA 1ZMRA 1O08A 1SOVA 1WS6A 1AUPA 3IBSA 3FDXA 4YV1A 2IIVA 2VPPA 4GBMA 1TF2A 2FW1A 4QC2A 3GJ5A 1QQAA 1AQLA 4OUDB 2DTXA 4Q4AA 3ZVMA 1A71A 4CKCA 2J4FA 5HF5A 4BRZA 4MWGA 4HSGA 5KKNB 2WFLB 5LQNA 4A3FI 3LS2A 4JVSB 4QLBA 4NFSA 5AKEA 1JLSA 1PYDA 3GAZA 3C8MA 1DO0A 1YA6A 1E1LA 2JFNA 3HDTA 3FPEA 2FP4B 2P79A 2E87A 2QUBA 3HXKA 2Z8YM 4IIYA 2YRFA 3WQRA 2GBLC 4DCGA 5DOZA 4BX3A 4J0QA 4FCCA 2QRKA 4IEFB 3AH8A 1OFGA 5DIZA 3F3FC 1RJFA 2R8XA 5G3ZA 1WP4A 3TLZA 1JPNA 3ZNQA 2QJRA 3B20A 2H4YA 3KOZA 2A5FA 3VH2A 2P3OA 1RPAA 4JBHA 3H4MA 3IVCA 2G0AA 3EMDA 1YF3A 2UUAB 1SK8A 4RKRA 2R87A 4PZCA 4RJKA 5L6LB 3G1UA 1SKQA 1L5QA 1YZQA 3R0QA 1TIPA 4AU1A 4O0MA 3RS9A 2NTNA 1TMYA 3S2IA 4GRDA 4KIUA 3C15C 4DDMA 2YKGA 1U2RA 3LPCA 2H1SA 5JJBA 2JFVA 2R6FA 3NYQA 4EG3A 3UJPA 1NLUA 1KY5A 3M4XA 1SBTA 3V32A 4YHBA 4CV3A 4WN9A 3FLMA 2PKCA 2R5NA 3SP1A 5GTDA 3AEKA 5CH8A 4NE9A 3P20A 2YNMC 3TSCA 4Z51A 2XCIA 3D3NA 1ZIOA 4LJAA 3MMXA 4S1OA 3GUYA 5HILA 3GCFA 1AXEA 2QORA 3K0FB 3LPAA 4PS1A 3EULA 3W7VA 5F2EA 3RTGA 5CEFA 2D0OB 3PNLA 1OFUX 1US8A 2QTAA 3I6MA 4LNHA 1P9RA 3GRCA 3KSRA 3I28A 3PF9A 3DB1A 5EKXA 2C3PA 4ZO7A 1NIJA 3QGMA 4DA7A 3HXPA 3V4LA 4DIOA 4P31A 3BXHA 4HUQA 3SEAA 3O1HB 5B3LA 1XWIA 2FVXA 3IQIX 4AD8A 1TRHA 5DO9A 3U81A 2LUOA 2CLEB 2IP1A 4MD7A 2WLTA 2NACA 3VHRA 1OA0A 5CAEB 3IOEA 5E7IA 4E5YA 5ICCA 2WOJA 3QFCA 3DMRA 2PS1A 2ODAA 1E8MA 3JQ6A 1HDZA 2VQ3A 1DRWA 1KK3A 1R0XA 2YYAA 1U3CA 3QWUA 2XT6A 3BG5A 3E3NA 3Q15C 4XVRA 5FPHA 4YQEA 2L69A 1GUZA 3IIIA 3ENKA 3G8CA 3R7WB 1Q20A 2Q8PA 2ORVA 2MINA 4H35A 2MYPA 1WEKA 4R1LA 1C7EA 3A9WA 4ILKA 1Q811 1N8R1 2V0NA 4UM8B 1P9OA 3BIJA 2Y1WA 3PBKA 2KBEA 1W52X 4EF4A 4G0YA 4UJ5A 5F5NA 3ROGA 3SDBA 3W7BA 4EHJA 3WGQA 5IM4A 1JU9A 2FVYA 1ND6A 1RYYA 3HJBA 1P4JA 5K0EA 2WJHA 1S1MA 4V0OA 3FZYA 3WYAA 1N6HA 1BOFA 1BVYF 1T2NA 2NADA 1X15A 3MCUA 1DQSA 4IJUA 4E3WA 2OPHA 3RAJA 2IPNA 3K0HA 2TECE 4URHA 3FPAA 1OXKB 3PR1A 3U44A 1XKTA 3WO0A 4DQLA 4IQFA 4RQBA 1C3XA 2AMLA 3HCPA 4NENA 4J16C 1GKUB 3W8FA 4D0GA 1WZUA 2GWRA 3GLRA 4XSHA 4CM9D 3KAPA 2X9GA 3OZUA 5M34A 2XT9A 3VC3A 3QPWA 1T35A 4MR7A 3I55Z 1CG6A 1J0DA 1ZI6A 4JC4A 4KGXA 3BGDA 4WCFB 4WZAA 1I0IA 4AKSA 2P7IA 1LNSA 3KR9A 4MS4A 1WZCA 1VA5A 3C6BA 1H5QA 2SKEA 5IANA 5FO0A 3RJMA 3HV0A 5KYGA 2JLZA 4QJ5A 1QU2A 3CLUD 1GYQA 1V35A 4EO9A 2UVPA 2W04A 2GEDA 1PBNA 3M4ZA 3O82A 2OQIA 1N5RA 5DP1A 2GPBA 1RI4A 1HEUA 3PFCA 3QY0A 4X1IB 3CQ9A 1DAOA 1CE8A 3PC6A 1YR7A 4FSXA 3ZXXA 4FB4A 2Q6IA 5BYKA 1JIKA 3CCL1 1OLUB 1ULBA 2CXOA 2QPTA 1EFUA 3LTEA 3PC8C 3RVQA 3ZDEA 3I9OA 3KFLA 5CEJA 1LV8A 5IT4A 2LDXA 2VATA 4WFIA 4DC9A 1JQAA 4IV0A 5FI5A 4NBDA 3LXUX 3V1TC 1QOPB 3GUHA 5FEUA 3WDSA 3FUTA 3SQWA 3ZR4B 1ZD2P 3OZTA 4HRXA 5GP1A 2JCGA 2PU7A 2Q9UA 1ORRA 2VZ0A 3U2QA 3UO8B 1I4LD 4PNEA 3DTTA 4DXDA 1W0JD 2ASEA 5JADA 3WLMA 2FF5A 3L8DA 1OX4A 3DDSA 4DCNA 2OKGA 2JG3A 2B25A 2W2TA 1MEOA 5HTKA 4UJ3A 2WWIA 3ZD7A 1JKJA 1QVAA 1W9HA 2W48A 3WS7A 5I4KA 2GTHA 4LC9A 1I7PA 3U3XA 3DPIA 4L0CA 4LF4B 1JDUA 1C8BA 3T3PB 3HRHA 1DG1G 4WPGA 1FY2A 3RIHA 1RI5A 3ETJA 3Q3HA 2B9EA 4PYOA 3C0KA 3RAGA 5HBRA 2BFNA 5DBFA 4BS9A 3JW8A 2YVLA 3A1DA 4MR7B 4DG8A 5BXQC 2LGJA 1DT5A 3I2YX 3KQOA 3ISVA 5KDOA 2PY6A 3L4BC 4TV9B 1R9NA 4R8LA 1ZM7A 1DCFA 3O4HA 1J8VA 4QUEA 3EZYA 1I7NA 4RELA 1KH3A 3KDPA 3PIIA 5SV2A 1Y6JA 3S7ZA 1J8QA 2H57A 4B73A 1ORIA 1A82A 3K5HA 1ODSA 1EFRD 3FZQA 1QOZA 3SSNA 3R5JA 1B8UA 4FHFA 4UFNA 1XYVA 4PX2A 2JIPA 2PGLA 5AKKA 1N9KA 2QTVA 2YV5A 3WA7A 4CIWA 5BV0A 3T1HB 4YJ2B 4HDKA 4KO2S 3NHAA 4BU1A 4ETIA 5BVGA 2Z8XA 3OZIA 3WAJA 1PDOA 3GLKA 2H4HA 2ODPA 3TO5A 5JZSA 1MO6A 2ZWIA 2V6FA 1RZ3A 3KV3O 5AVZA 1L4NA 1PJAA 3IPCA 2P0YA 4G84A 5HZKA 1K5GA 1MQ9A 1QR2A 1QLHA 2HJ9A 3ASYA 1TQHA 3BDIA 4Q7KA 4QIHA 1K4KA 5D85A 3I45A 1CRLA 3EOBI 3EPRA 5AI5A 1LPAB 1A04A 2J3KA 2P77A 4P98A 4Q4DA 5ALQA 3EWNA 4YT5A 1E59A 5FULA 4BKOA 4PLTA 3ER9A 4M8IA 3VDNB 2E55A 3JATA 4RPIA 1L7BA 5TX7A 3TOCA 4BVKA 4CM3A 5HGXA 3OT1A 2CUTA 2OV8A 1M2HA 2P8JA 4ZGBA 2Z3VA 1CS4C 3N2NA 4NMHA 5D7NA 4HN4B 2HSWA 3PSAA 4U39A 4GYKA 1UP7A 4EDFA 2WYIA 1ZXLA 3LTNC 4UVDA 4HDKB 3I2KA 2JF0A 1N6PA 1DARA 1HWYA 2W6CX 3PI7A 1EUDA 1G1AA 1LZKA 3KAQA 4QL3A 2X5KO 3THOA 4D8UA 4RK7A 5CCDA 3SOZA 3HC7A 3ZDZB 1LNQA 421PA 1VL0A 2BGRA 3WYBA 3K1TA 1H9CA 3HI4A 2FN4A 4P3OA 4IBOA 2DY1A 2VYND 4LDPA 2H1FA 5A9TA 3TOZA 5I9SA 4CLRB 4H6VA 4EMTA 2FRDA 3BWEA 4UOZA 3H16A 4HQOA 4BAGA 4Z6KA 5FV4A 5JFGA 1M1K1 2R6AA 3BWMA 1K3TA 2V7TA 3T9CA 4X8HA 3K8YA 4N47A 3AHJA 4UTNA 5HVNA 1P72A 2I4RA 2HRDA 4HWKA 3LT0A 2GO1A 4C06A 1TKCA 1OPXA 2G9QA 2YV2A 1LFDB 2ZAEB 4RGBA 5IC5A 3TQSA 1NXVA 1NXWA 3OIFA 3G7UA 3A6PC 1YI1A 1DI0A 4PO9A 4MR9A 5EMNA 4MUHA 5I01A 4Y30A 1L7PA 4BMYA 1XEFA 1DEAA 1OXBB 3LQKA 3IVGA 1J56A 3NC0C 4MB6A 4IAOA 3ZCQA 2K5RA 2I3GA 3KLPX 4BNZA 2VWHA 1U3FA 4BNHA 1A5ZA 1QLJA 3CLKA 1LZLA 3G7SA 5G1NA 3I58A 3DZJA 1RSZA 2NO0A 4GWKA 3V34A 5BMOA 1QFMA 2CW5A 4JXXA 1K06A 2JBAA 1Z7WA 2WP0A 3WL8A 1BMDA 4V03A 2BHTA 3SCZA 4OJKA 5K8VA 3CTMA 5B6PA 2M1ZA 1JJFA 4RVNA 2ZAMA 1HLDA 3SX4A 3LLVA 3ZY3A 5BN3B 1QUFA 1KJ9A 1CVRA 2FQYA 2GZ3A 2J0UA 4G0OA 4V0RA 1YFLA 2FSVA 2CEAA 3CCE1 4QA9A 3USCS 4UUNA 4GOJA 2CNWD 3F3SA 2JIMA 4OKNA 3S1AB 5L3SB 1Q74A 4YV0A 5KX5B 4X6LA 3KKPA 4K9OA 1KP9A 3OEWA 3TUZC 2VVTA 1D6NA 1ODKA 4FGZA 4V3CA 4BVBA 3H1BA 3DMDA 3W2EA 1K9M2 2PX8A 3KWLA 4DDWA 1U9JA 3AKDA 3DLTA 4D74A 3JQ7B 3ZVRA 4F4DA 2VPWA 1O54A 1MTOA 4PC1A 5CFNA 1G9SA 3USES 2XZLA 4JEMA 3CVJA 1IIRA 1U28C 3WDLA 4Y7CA 6AT1A 2IV2X 3DA8A 1ECGA 2XGMA 4LVCA 3IE0A 1E3TA 3DV9A 1IQ0A 4Y18A 3RJZA 2ZBGA 3LUSA 2AJTA 4UMEA 1BU5A 3BFJA 3FPKA 5CA0A 3CZAA 5SZIA 3ZU3A 3AEZA 3ZH2A 5IJWA 2XZDA 4I19A 4TN1A 3URMA 4IRMA 4P2GA 2OECA 4C07A 4KOAA 3EEYA 4K9LA 4ZMSA 7MHTA 5U1PA 1LQLA 2O8FA 1RXCA 4P86A 3KAJA 2DJ5A 3FVVA 5CLGA 1PUXA 4N41A 2O7QA 4LF6B 4B3GA 1E3EA 4MV3A 5FRDA 3ENNA 4J4TA 2VPYA 3EXHA 3PJFA 1GG8A 4HOYA 4C4SA 1NW5A 1LBIA 2JBAB 4EVQA 1YBHA 4QHSA 5GONB 1EJ0A 2YS7A 3EXHC 4ALLA 4BFXA 5J2TB 1U5CA 3T38A 3NUGA 3BMOA 2BRUC 3KTAA 3ADDA 1R7RA 4AMBA 2QSJA 3LY9A 4GE0A 4JLMA 4BEWA 5C3MA 1L5WA 4BHTA 2BKUA 4FD3A 4EQ6B 5BWMA 3RTBA 5JV5A 4HAYA 4UM9B 3W5AA 4ZAWA 3TF5A 2ACWA 3DEIA 5K3BA 1U2GC 3GGPA 1K88A 3INRA 3I39X 3KJXA 1P74A 1SBYA 2BE9A 3A3YA 2PGIA 3GCWA 4OHKA 1P1BA 3V1KA 1L8AA 1CJTC 2NSHA 3KHTA 5HKAA 5T41A 3SHQA 2LFUA 1PQPA 4HAIA 2YMMA 3QLUC 2WAXA 1RVV1 2Y6VA 4BY1I 4KO8A 4BWYA 2C2MA 1OLSA 1NASA 4TKVB 1ZH6A 5KVSA 2AOUA 2PRZA 4LYGA 5G1PA 3RJ5A 3V00A 1MAUA 3J80b 3N0VA 4AQYB 4QOGA 3WISA 3RYIA 4B47A 3HN2A 3ZWQA 1G7SA 2UZ1A 2BFFB 3SXUA 1AY0A 4Q37A 1JJAA 4IYJA 4YGYA 5HQ3B 4OREX 1FP6A 1VRVA 5DX1A 5I9BA 4JV5B 1ENOA 1NF2A 2HF1A 2FFAA 2YVAA 2F4VB 4ALIA 4B33A 4BFWA 13PKA 4X7MA 1YR8A 2BZSA 3CUWA 3EF1A 1ZJ6A 2JFOA 3KB2A 3MFYA 4JQOA 1PJ2A 1T2EA 4GOND 1D6SA 2G04A 4ROTA 4JD5A 3S2ZA 1FB5A 3AETB 3N74A 1XB2A 5A5GA 4YRQA 3NMUF 2GRUA 1B6TA 3ORRA 1ZM9A 3UTDA 1BDHA 1SNYA 1QCYA 1ZI8A 2PQMA 3KT3A 3AIOA 4L28A 2QM7A 2BFPA 3FGNA 2EP8A 1XRRA 3BFXA 1XQ6A 3BL8A 1M75A 1Q0UA 5BSVA 4R69A 3RHZA 3TTUA 3K92A 1AGYA 4QLAA 5BSHA 1Y80A 4WJKB 1JQKA 1UEIA 1NKTA 3RQSA 2EFEB 2XE7A 4F72A 1L8OA 1ZVJA 4WH0A 3FAZA 4RUKA 3V33A 5D86A 1ENZA 2G9UA 4R6XA 1GAXA 4HB0A 3ER6A 1TMOA 3N2KA 2GXSA 3BMQA 4ITRC 3T35A 1CLEA 2PMDA 2ZYRA 2CMDA 3FYSA 1N75A 2WVJA 4WVFA 3RLFA 3SVZA 5IT9A 4LYJA 2WIDA 3GGCA 4D9HA 1DSSG 5B7NA 2JFGA 4PFQA 2DT5A 5FR1A 1D3AA 4EB6B 4FYYA 3U3ZA 3F7OA 4I2VA 4ARBA 4EW3A 4GSKA 1RO2A 1AKNA 5BMVF 3BRSA 5KJ1A 1KC82 3Q72A 2Q21A 1N78A 3HMKA 3B78A 3GUCA 4X90A 4D6XA 4GH5A 2PCJA 2QD3A 1PFWA 3CXUA 3DGEC 3H13A 1NXTA 4DM4A 2VAWA 5ERYA 5A2Qb 2NXNA 4J1SA 1KZYC 1P19A 2QTMA 4QXQA 4CL2A 1QE3A 3HADA 1B42A 1NMSA 3P96A 1CXZA 5FYDA 1C0EA 2FHPA 1E2MA 4NPCA 1UQTA 1IPFA 1SQ6A 3DCJA 1YJ9Z 3DHWC 2FWMX 4UVEA 2FSPA 2ZYIA 1BX0A 1JUDA 2CBXA 4J6EA 3CRRA 4F5DA 5JPCA 1W4RA 4AF6A 4G1MB 3PDIA 1JKJB 1RP1A 4JKIA 4YPOA 3ADOA 3AFOA 1XZNA 1I6KA 4M3NA 4UKDA 4NLLA 2PZEA 3V1MA 2IWRA 1P1IA 3EA5A 2AXNA 3NHUA 1P75A 4G36A 2CCJA 2SBTA 1DKPA 2X8BA 2OCXA 3BSSA 3QWHA 1IHYA 2GJ4A 5DN9A 3MJCA 3ZX4A 5AM3A 5U4XA 2FZGA 4ZJZA 1E5XA 2XKAA 3FJYA 5D5PA 1B2LA 1N33B 3BMCB 4RJIA 1FPMA 2FOIA 2V0CA 4YJ2F 5EZ6B 4HDQB 4M9QA 3FPCA 3S2EA 4S1VA 1NVEA 2HT6A 2X41A 3NONA 5LD2C 2EJWA 3T7TA 1YV9A 1NE7A 4YRSA 5FWNA 5FA8A 5KTRA 2H06A 6ADHA 1X94A 2JI6A 2ORYA 3HFGA 2JCVA 1B7GO 3BB3A 1N7IA 3H9GA 5ITZB 3T06B 3AC0A 3F78A 5FWXA 2Q4TA 2YADA 3H11B 3KYIB 3LMKA 1R3DA 4OP1A 5LCXA 3S29A 2M6KA 1Z29A 3R75A 2IYEA 3A1TA 3GTMI 1VPLA 2R8OA 4QSHA 5EJAA 4PQRA 1WCIA 3BQMB 1HDXA 2A0KA 2P4EA 1DTWA 3G2JA 4MLCA 4JYPA 2OK8A 1WUKS 3Q9LA 3PNBA 3QY9A 2XA1A 3ZY2A 3EFBA 4MDHA 5H3CA 4C20A 3AYXB 1FQWA 4LA4A 3VPGA 3WK9A 4MGHA 1HFEL 3TNFA 3G8AA 3PNKA 1VLAA 2XNDA 2EYQA 3L7NA 5KTYA 4FZ5A 4EY7A 5ITSA 3VAYA 3TZ6A 2WKWA 3UWMA 1IG0A 2I4NA 4AJPA 1E79A 1FFAA 1JT2A 1NVTA 3U7EB 2IHTA 1UJ4A 3PJDA 4GDMA 4U2GA 2IE8A 3NNNA 4EELA 1EH5A 1UBMS 5DTEA 3N8DA 3QWFA 3DYBA 2DQZA 5FLXb 3EMVA 3EARA 2RGUA 1N3IA 3GJZA 2KS6A 2QX8A 2P65A 3ZKWB 1VE3A 2CLSA 4N7RA 4YRFA 4MROA 2WUDA 4EI9A 5JS1A 2OP1A 3IIKA 4R2IA 5EYPB 5HF6A 1Y5RA 2PAFA 3FSGA 1U0OC 4EHFA 5FA6A 3SE0A 3K70C 1CS0B 1P4SA 3AIIA 1ZM4A 3SD7A 3F9CA 4WASA 2NU6B 4A3SA 4IDGA 2M2IA 4CU2A 1M34E 1E9AA 4TTAA 1U2TA 1EIZA 5FQOA 5JSZB 1B3BA 4IW3B 1F7UA 3CRQA 3I56Z 2HQRA 3RFXA 1NVVR 3AB3A 2Z1DA 3PQEA 4KQKA 3WLKX 3M0EA 1C4KA 4P32A 4XWAA 2FPMA 4FFSA 2R5WA 4MVJF 3OT4A 3PIRA 4DLYA 1WA5A 2PVPA 4ADSG 2QTTA 3B38A 4G0ZA 1XXHE 3TTWA 3ETCA 3NG1A 4EW2A 3I2GA 2CYBA 5C1DA 2XW6A 1UP6A 3FG9A 3LC1O 4PSAA 5BSWA 4ZYZA 1FXWA 1R6UA 1LEHA 3FCXA 4TS9A 1ULUA 2XEDA 4IF4A 4DJJA 4MGYR 3C3WA 3C5VA 2RHRA 3CME1 5B6IA 2C7PA 2NGRA 2CT8A 2RHMA 3BE4A 5CPFA 5A3SA 1XR3A 2C9YA 2P2DA 2WKSA 3VU3A 3TWOA 1QC5A 3ASZA 4B7AA 2VUIB 4YMUA 3DKKA 2I91A 3I6ZA 4YI5A 4OLHA 3PCXA 3C1TA 4GI3A 1DG3A 4DJEC 4BPRA 1ATIA 1TAGA 1SKMA 5L3SA 2E4YA 3GLVA 2V6JA 4ZJPA 3BD7A 4FHCA 2C2BA 4WVLA 1Z4QA 3DVQX 4OXXA 2PL1A 2HEIA 2BMEA 2HKIA 3I3OA 3S2SA 4CHTA 1ZIYA 2I8CA 1XNGA 2EDAA 4FYWA 1Q0TA 4N5LA 1QG0A 1U5BA 4MYHA 1K08A 1T1GA 1W0CA 2BEWB 3L8YA 5SZJA 3PB3A 1VJ1A 5HHTA 4QYWA 3C85A 3E9QA 4ARAA 4G8JA 4QTUA 2ZFUA 2P90A 4PGAA 5T3UA 1S3IA 3A6HA 2PGNA 4IOLA 5EN4A 3TNJA 5KYXB 2CVPA 3IP6A 2ATIA 5D84A 3IERA 2XHEA 3KPUA 3RSOA 4XWGA 2HNBA 3G89A 3HUFA 3X2FA 3FIJA 1KMNA 2QSZA 4QFBA 2BFCA 4RK5A 3BH6A 4ZVKA 1IDN1 4D6YA 1JRLA 2R8RA 3VKFA 1AB5A 1FW8A 1RHQA 4MLPA 1OVGA 2EEPA 1CSEE 5A7GA 2C9OA 5IBQA 1AKVA 1EXMA 5DFAA 2V96A 3H2IA 3O47A 4QU0A 1CUGA 1WVGA 4NMXB 4OIMA 1KI4A 5GONF 3VX3A 3ZU5A 5L4SA 5K01A 4MZDA 2H2DA 1DX6A 4KMSA 1I2BA 1TM2A 2H0QA 1SIUA 1GZ4A 2RAUA 3ESXA 3Q88A 4L6CA 1UWLA 2ES4A 3BF8A 3UENA 4NG5A 5EESA 2JA1A 1CR0A 5EKTA 1NG9A 4RTNA 4J29A 2PUFA 2NO4A 3HDYA 1ZOIA 4BNJA 1DQZA 3NDIA 1EK1A 2B7CA 3E53A 4UNRA 4NJOA 3D02A 1KDOA 4I08A 1CT9A 3V2GA 1PX0A 4URWR 3BZBA 1E3IA 4FGUA 1ETUA 5EKSA 1C4OA 3QVSA 1VJ0A 1GGVA 1QDEA 2DKNA 2QAIA 3H2HA 4S2UA 5AKJA 4CQMD 1Y33E 4FLMA 4JFAA 2Q2NA 2HTFA 3AGQA 3H83A 2O3RA 3K9NA 1A8UA 4ZT4A 3V97A 1S72Z 1GGMA 3NQ41 2VDQB 3A25A 5JJIA 1Y1TA 4JBXA 1ZK2A 1INLA 2A7XA 5JRJA 2IIQA 4CMBA 5IAJA 4QXRA 1K8ZB 4F12A 5A4MS 1S9HA 4RK0A 3PFWO 4MKIA 4ENWA 3LZCA 5BWLA 2HU9A 3MOGA 4FGJA 4JKYA 3UM9A 4C0KA 1ZIPA 4UCXA 2XEXA 3MWKA 5FPYA 5IHXA 1UMKA 3DE4X 5KWIA 3CCSZ 2NG1A 3HWRA 4O2BF 4TRNA 2BR5A 1RRMA 4XQ0A 4TXLA 4TLDA 1YNOA 1N0UA 2OLEA 3D7NA 4GU5A 4G9EA 4EG8A 4GOXA 2FNAA 3GGDA 4OFXA 2QR2A 5DVZA 1CIPA 5I47A 4I5GA 5IF9A 4NY1A 4RIEA 2NVYI 1P77A 5LMNB 1ICIA 2INGX 2QPLA 1AK9A 4HNRA 4L5IA 1C7JA 3I72A 1RWOA 4NI5A 4ZCQA 5TQ0B 3NWPA 8OHMA 1BG6A 2WLSA 1A50B 3HCBA 4IZ6A 1QYIA 4D9BA 2CLLB 1SU8A 1TIKA 4A3II 3F6SA 1ZW1A 4OGWA 1AZSC 3A9RA 2C9DA 1CNMA 3QOFA 1FSSA 5D6NA 4ZYXA 1KKUA 3IJEB 4OBEA 2RKOA 3K9LA 4XE5A 3MELA 4BQRA 4ZYLA 1FP1D 1SA0A 3DF7A 3KDAA 4J7AA 2WDPA 3AKYA 4IHJA 4MWDA 3GJYA 1WUJS 3CZCA 1R9JA 1SOWA 3K1AB 1TVKB 4LJ4A 4TVKA 4V1CI 2FFQA 1CY6A 1GGJA 1XRPA 4YCDA 5EQFA 3TAXA 1ADGA 3L7BA 2GQ0A 3NC1C 5FHRA 4URVR 3GZ4A 2IYUA 1E1KA 4OQQA 2VIIA 1X9IA 2JBWA 4HGRA 1UAGA 2AEEA 3TJRA 3ZU6A 4EZEA 1UK9A 3C7AA 3E03A 5KYNA 3HBLA 5EI5A 3HSKA 1L5VA 2X5JO 3BMQB 5DM1A 1JIJA 5IJAA 2VDOB 4MGEA 2OAQ1 3F49S 4FN5A 4QG7A 1BROA 1E1DA 3HO6A 1KA9H 2NNLD 2AJBA 3NXKA 4XGNA 1CIJA 2OV2A 5E4JA 3ZDQA 1ULAA 4QGHA 5C4JI 3LUKA 2OZKA 1RKXA 1ULSA 4LV5B 1W4LA 3AMVA 2XKBA 4CLOA 1NRJB 2IZOA 1VYVA 4FN4A 1ADCA 3KXDA 1KJQA 1EK5A 4PCVA 4N76A 1T8TA 3GLFB 5JCOA 1QG2A 3K20A 4MHSA 5AVKA 4ZZIA 2XTAA 2JMOA 4G4GA 4MCAA 2CDCA 4DMFA 2VK2A 3GLFA 1I2DA 3GUUA 3KOXA 1FNBA 3FUCA 3Q3VA 3R6LA 3OUZA 4J43A 3QXGA 2Y0DA 4K7JA 1P80A 4YJ3A 2AFIB 4UE2A 4WOJA 3BULA 3F8SA 3VI3B 1HG1A 1E2PA 3U6BA 4G56A 4ZCTA 4U02A 3U7RA 1EK2A 2HCFA 3GJTA 2BP7B 3R4VA 4YP9A 3MWDB 1MA3A 2XITA 1TVMA 3QLVA 5JPDA 1CQIB 1YB6A 1IN5A 2RGBA 3IE2A 1O95A 3P1JA 4L8VA 4FZRA 4U6QA 1II8A 2R6GA 3USZA 3RROA 4FFBA 4GKKB 1IONA 1NJ8A 4MSUA 1SIBE 4TV8A 3AQ4A 5FP0A 3SHFA 3NPMA 1NVVQ 4REQA 1N9GA 3QTBA 4NENB 5GQSA 3U44B 1WCIB 1Y4ZA 3AL3A 2EAUA 2BM1A 2XQKA 5K09A 2WTEA 3MRSA 1HQYE 1OILA 4ESEA 5J4LA 1N2ZA 5L7WA 1BFUA 3QVGB 4NNJA 4BBPA 2VHJA 2G3YA 3K9QO 1R8YA 5DHAA 1TA4A 2GDZA 2C4HA 5FEMA 1Z37A 1R4MA 3OUTA 2HU2A 5F23A 5JC8A 1ZIDA 3L7KA 1NKVA 1JXAA 1JWAB 4GPIB 5GIPE 2C4TA 2PSJA 4MB2A 5I51A 3D7LA 4IFTA 4FT4A 1GUDA 2XUQA 3ONEA 2JDID 2G67A 1WX1A 2XCRB 2O2DA 2BJHA 3G6KA 3MUNA 2PYIA 3IIJA 4E94A 1S3SA 4R41A 2FUG1 2GEFA 3EZNA 4DNFA 2Z2KA 4X92A 3RRJA 2HV9A 3UAOA 2Q9BA 4YCBA 2W2KA 2PRJA 5TPZD 4BC0A 1S2NA 3RSHA 2HRCA 5ITVA 3PPVA 1BQ4A 3W4JA 1T5HX 1GG5A 5I7RA 2NYRA 4MQ6A 2DPHA 1U0HC 1SD1A 4Q82A 4CFSA 1XTUA 4WW0A 5EJIA 4PZDA 4TPKA 3AHIA 4UHCA 3CCS1 2OGZA 3VPAA 4BFZA 1K8RA 4A73A 1Z06A 1E61A 1I3KA 5HZMA 4WLVA 2VSFA 3TZLA 2UYOA 2H2FA 4ARZB 3LQRA 4Y2UA 4L2IA 3IC5A 3EEFA 3B6KA 3AM4A 4FW9A 3P0RA 5DBEX 2NU9B 1HE5A 5J43A 4D43A 1LSSA 4OSOA 1JJ7A 2QN7A 4KUHA 2VH5R 2D4AA 3OLCX 4TQGA 1KQFA 5CDFA 3G59A 2YNMA 4XGRA 4MMYB 1VIAA 2ILTA 3DOHA 4JP2A 5B2EA 4WNAA 1NTOA 3UIEA 3L06A 4HX5A 1T6YA 1L1RA 1J8MF 2VDWB 1N57A 4QXPA 4BMCA 1M76A 3GDHA 5LJIA 5L95A 2DFTA 1XGKA 1DIBA 1RNLA 1J97A 2NUTB 3T3GA 1LPMA 3OIYA 4RJLA 1Q57A 5KTNA 4OX9Y 2GPWA 1JHPA 2B1QA 3S2UA 1MC8A 4AB1A 3CZRA 5D3ZA 1L5NA 2X0DA 4CU5A 5FOSA 4L78A 2R6DA 3EB9A 3R5KA 3RUEA 4DLBA 1M6VA 4H0NA 1CF4A 4BMVA 1WG8A 5IX8A 1CHNA 1ORHA 4DVJA 4K2AA 2WSLA 3ZLJA 4LVNA 4TYQA 3AOGA 3W5DA 4CM7A 2RHOA 1WWKA 1ECPA 4X3OA 3R76A 1Z6ZA 4M98A 5EUBA 5C3EI 3E0XA 2B2NA 1GTSA 3CPEA 2J87A 1K7EB 4UDNA 3VHXA 1QAMA 4F56A 4G0UA 2PZMA 4YCMA 3ONWA 1DJMA 1FYWA 5HTOA 2HSGA 2IX3A 3UB4A 5IEJA 2J1LA 5JALA 3KEFA 1XKLA 1PR1A 3CU5A 3NM5A 3PFHA 1SUEA 1O3YA 3OCCA 1GAQA 1LPOA 4FYVA 4PCAA 5LZ7A 1YB1A 1TECE 2P2LA 5NLLA 1P4RA 4R54A 4ENVA 3VOTA 1P5ZB 5C46F 1Y5LA 3P9SA 2ZE5A 3D7KA 1PL0A 4EI8A 2ZXUA 3RK0A 3B9PA 4O4IB 1YKGA 3ZHSA 4BGIA 1GHTA 3OFSA 3EDYA 1TFRA 2RHTA 4KGZA 4LYEA 4TQAA 1RAAA 3W77A 1D4OA 1A2BA 2PJUA 5CD1A 4OUKX 4D0NA 3L9WA 4ENUA 3D3WB 4KN8A 3OCZA 1DXQA 3LP5A 4CDRA 5C9ZA 1XCOA 5J2UF 3JAMb 5TF4A 4DIMA 2DUJA 1ZN2A 1D0SA 3S17I 1NVMB 1V1JA 3CBGA 3T1OA 4CM4A 4PLWA 4EOGA 4GPAA 1C41A 2WB2A 1MABA 2PXAA 4I50A 3P4YA 4KMMA 4XR9A 3R5TA 3UHAA 2GU2A 1RU3A 2WWWA 4HTFB 4IIGA 2JGLA 1WB9A 2YV1A 4YP6A 1ZK4A 1C50A 4BVLA 1ISRA 2QNBA 2E2JI 1IBRA 4H18A 2HDNB 1TU3A 1RPTA 4M1ZA 4HX9A 4W5HA 2CV2A 1ZOLA 1PUIA 2QQGA 2GXAA 5G4KB 4RVHA 1KFJB 4MS4B 1FS6A 4BNGA 4J75A 4ZQGA 1J0EA 2GCOB 1DBWA 2KLBA 3QPVA 3SDZA 4QTXA 4NS1A 1XTKA 3OZFA 5DM70 5KBYA 4M7RA 1KSHA 2G70A 5D1OB 5TMBA 4F45A 5JBIA 5JR3A 5JWOA 1FU8A 2W0SA 5IVPA 1JSZA 2BBWA 1BEUB 1WMAA 4B31A 2YX1A 4Q3LA 1KQNA 3STHA 2C7VA 1QHIA 3RVNA 3V3TA 1K8A1 4NV1A 5HBGA 4DR7B 1KERA 3CPWY 1QO9A 4KRFA 2IGBA 4RZSA 3C16C 1SQFA 3D1LA 3NHKA 4O4HB 2OSVA 1TAUA 1NZJA 4HYTA 1KMQA 2DECA 2XUFA 3AUJB 4FX5A 3TK1A 1OH6A 1Q50A 1U2EA 3HV2A 4NCBA 2WB1A 3EF3A 3EVZA 3ONNA 4C0JA 3DEJA 1K68A 2IHNA 2A2ZA 3DXZA 1U4NA 4WN9B 4Z8XA 3WMWA 1TPYA 4D81A 1YI8A 5B4VA 3ORYA 2AJLI 3BIFA 3IV7A 3MTIA 1ZCZA 1DKNA 1O94C 4IDPA 3ZHYA 2BGKA 2O8VA 3C74A 2E5WA 4GZLA 3LYUA 5GONA 1PZHA 2HQSA 3JRXA 3LX6A 2RBEA 3D8RA 3MVEA 4JJ7A 3RVOA 4NQRA 5DHTA 2VH2A 5LLSA 2PKXA 3CX3A 1K8QA 3S5UA 1DEXA 3TG2A 2AX3A 3L7CA 4L50A 3MS4A 3OQBA 5IAEA 1M54A 4B0OA 2JVJA 2G5PA 3RSQA 2D1YA 3NOVA 4D8XA 1OV6A 3WLRA 1ILWA 1E9RA 5K3SA 1RYZA 3QUQA 1Y63A 3EDQA 3PLNA 2DSNA 3REGA 3FNRA 5DBGA 1LDEA 1M1YE 2XTNA 1I7SB 1E5LA 1R0BA 2MYUA 2BEVA 3D31A 2GHRA 5AW8A 4Q48A 1Q12A 2IZ1A 1YE3A 2J67A 4D4MA 3H3VJ 2X7JA 2IP4A 3NWJA 4HEQA 4GDFA 4BNFA 1FU7A 2I2DA 3LBIA 3KV1A 3DNFA 1QVWA 2NXJA 4WE3A 5FFMA 3QVWA 1A5SB 5B2ZA 5F12A 1LPSA 3SQLA 4B3IA 1TZ2A 4I3HA 1E7WA 4LF5B 3QYJA 4TT3A 1M1UA 3BTOA 3TOXA 1PI3A 3PDCA 3VVMA 2O1WA 4KW7A 4KQGA 2X0FA 3WLEA 4RNCA 4YROA 3EPHA 1N2CB 4B6SA 2J7PD 3CSUA 5GM1A 1FLVA 1G6OA 5J4HA 5ECGC 4A36A 2QJWA 4FCTA 1ESNA 5BSUA 2VPZA 5CYPA 1WSDA 5BUQA 1QXFA 2O0JA 3H6HA 1QF6A 3P5BA 3G711 1JZTA 1RRFA 1SXJE 2G4VA 1R10A 3UFXB 5ICEA 1Z15A 1WHSB 3M81A 3JXEA 3LCUA 2V65A 3V8NA 2OM2A 1VMEA 4TWRA 3SS8A 2GZHA 3MD9A 4KAFA 2PHZA 5EY5B 1VMKA 2ZIXA 3LRPA 3OC6A 4FMDB 1ONPA 2W2XA 1BWPA 1PGPA 1AN9A 3O2QB 4BGUA 3PNQA 2HGSA 3NGMA 3U4DA 2C0PA 2ZR8A 3AG5A 2XSZD 2YHBA 5BSKA 4RTSA 4L4SA 4A0QA 4UTPA 3OEED 1HT2E 3M6WA 1QH9A 3GPBA 1X3SA 2UZ0A 4PC6A 4QZVA 3GRYA 2WT8A 2UVPB 4RVGA 1WSBA 3T12A 1QS0A 4MKGA 4WNYA 1GPUA 1UMBB 4GECA 2FRXA 3R40A 2VF8A 2JIBA 3CMEZ 1E7SA 3KJIA 4LXIA 4UXJA 4X20B 3VJKA 4A3KI 3JWGA 4P84A 2JIQA 1YQQA 2P9ZA 4KVGA 2Q4OA 3FHOA 4GEKA 2Q5EA 1TWFI 3M6MD 1GADO 3CO0S 4QTTB 2NVUB 1W36C 1FFYA 1T0JB 5EE1A 4MRMB 4Q12A 3RK4A 1LS1A 1X8XA 1OI7A 1TRKA 4RFLA 3L7AA 4MQLA 1XZQA 5TEWA 4AP9A 4MYUA 3E9EA 3I4LA 4G86A 1MOSA 4FDAA 5H4GA 3AB8A 2R1ZA 3UPTA 3ILYA 2OZEA 4JK3A 4I5EA 4EJSB 4B43A 4Y6OA 4W4TA 1CB7A 3AFGA 3U09A 3P4UA 5F51A 1W44A 1E1QA 2V6MA 1G8HA 2B1RA 5KSYA 2QY9A 1FVXA 4PRYA 3UY4A 4G41A 4IF6A 4PQYA 2FLVA 4XM2A 1LQTA 3N0WA 4WI1A 3AL2A 4LJLA 2RGRA 1U2PA 4OHUA 5ICMA 3D3EA 4JP1A 1MENA 3DAYA 3ZLUA 1D2HA 4TM7A 1JHDA 1P0MA 1XJQA 2O2HA 2VDLB 1ITZA 3U9SA 4FYIA 4YRLA 5C31A 1XT6A 4MXDA 1ZNZA 3OF3A 2AX4A 1W5AA 2DQSA 2CDAA 3O93A 4RY8A 2CFIA 3CV3A 3A14A 3K4PA 3WADA 3RI3A 1V11A 3E1KA 1I1NA 2VT7A 4I81A 1W93A 4V1CA 3B51X 3C7KA 3IMCA 5AM1A 4S3MA 5FH9A 3VB9A 1UDWA 2VQFB 2NUPB 4XGIA 3SBXA 1XPOA 4QGGA 5G0SA 1U1EA 1VA4A 3ZGNA 1OHHD 3W5HA 2ETXA 4D4GA 1OWMA 1Z7BA 4D4JA 5KNDD 2GI4A 3RS2A 2R6JA 4K9KA 4CZ2A 3NTQA 1NMZA 3DEZA 1LDYA 3CD61 1H65A 3QNUA 1TQ8A 2I6TA 2GM4A 4QG3A 5I48A 1XMJA 1A2KC 1IXYA 3FFXA 5A7FA 1F20A 4MVXA 4PNPA 3RRBA 3FTCA 4N7BA 4EGFA 5J40A 1D04A 4ZIRA 3NYRA 3OQMA 4XX0A 2OL4A 1C3LA 2ZRBA 4EY8A 3AZOA 3CCQZ 2I62A 2PSDA 2MSCB 3O8QA 5EPUA 3T9DA 2WTUA 3B1FA 2HTEA 3HP4A 3HEMA 3AM1A 2ZSBA 2Y66A 1GZSA 4WBXC 1M2WA 4YQZA 4PZLA 4XYGA 3ON5A 2H2AA 2BFEA 2VQDA 4A5SA 4C14A 5HSGA 1ACMA 2FMKA 4RC9A 1K27A 5ES4B 3W5SA 1H22A 3NH4A 4YRMA 2VNHA 4ZAZA 3JAMA 4JB0A 1RE0A 2RH8A 1I33A 4PLHA 3BQ9A 1U3GA 2QU8A 1I6MA 2XF2A 4QASA 1OH5A 3OZGA 3AFNA 1Z03A 1G3QA 1E2QA 1GZ5A 2I3AA 2O2CA 1L5FA 2WW8A 5YASA 3EE6A 4NYJQ 2ACEA 3PO3I 1Z75A 3DHVA 4L8WB 4R2LA 1WLSA 2QP3A 2W93A 1G8AA 2CJXA 4MH0R 2EW2A 3STWA 3HUUA 3NAZA 1ZG3A 4FDVA 4JITA 1JDNA 3MGCA 2D2VA 4WXEA 4LJ8A 2ZDQA 4L6IA 3ELWA 3GEHA 1AHPA 1WUTA 3A0UA 1LI7A 3NDJA 4TRMA 4GF5A 1LA2A 1AKTA 1LBTA 2IS1A 1C30A 3CX7A 2J30A 2PR2A 3GLHB 4QRDA 1XEXA 1XXHB 2FWBA 1BIFA 3B2EA 3C43A 3DV0B 3NHJA 4I5FA 1JXQA 1Q1ZA 2BISA 2WAOA 2EX0A 2KBFA 4BRSA 1WF6A 2G7MC 4XX1A 5ALGA 3PUZA 2D8AA 2O50A 2WF7A 1LK7A 3W8DA 5IULC 1MB9A 4TT3D 1P18A 1F4VA 3VPXA 3T1YB 5TJHA 3C2QA 1RS0A 2V0GA 2WJGA 4Q9LA 5LB4A 1L4FA 4M76B 3HBMA 2UXBB 3B2NA 1ZH2A 3BH0A 1XLVA 2PX2A 4DE5A 1AV6A 2LV8A 2QTGA 3C5EA 3Q2IA 4P58A 5K0LA 1POXA 3CF4A 3WZLA 4OHRA 4NZYA 3KB8A 4BX9A 1YI2Z 4HPJB 1WAMA 2PXCA 4HI0E 2JI4A 1XEAA 4J0KA 1WJGA 1P7ZA 3FWYA 4TTSA 3D9QX 1G2OA 4JI0B 3KXPA 4U9IS 1RWVA 3ANYB 4JXJA 5KNCH 2P4HX 5JYBA 3FLBA 2ZEJA 2F67A 2J9FB 3AIKA 4O2AF 4LE0A 5DI3A 3CPSA 5LXTF 3B7GA 5EIBD 5IHPA 4HUJA 2VNKA 2QX4A 3QVVA 4WCFA 3ETHA 4YUVA 1W7AA 4AKGA 1N2SA 1TQDA 3VR5D 4G4JA 3EVEA 3MSXA 1ZGJA 5IKMA 4ZI7A 1Y8QB 3EA0A 3DJFA 3JQ9A 3MTAA 3PHIA 3Q7SA 1L5SA 1GG9A 3GAAA 5WRFA 3GEEA 3KL4A 3PQ2A 1XDBA 4FJ2A 4NAHA 1WVIA 4BO0A 4RCYA 3THSA 4QGSA 1AQJA 3DLCA 5E4YA 3RU7A 2C29D 3L07A 3CS3A 2PBRA 2OESA 2V03A 3FD8A 2XCQA 3H8JA 2FCAA 4JLNA 2JGRA 5CHYA 5J5VA 3ZJ5A 1UPUA 3B48A 4R3NA 2Q5JA 2VTVA 4XDYA 3U5TA 4EB8A 2LIYA 2BL4A 3L8CA 2XJ4A 3PYXA 4IL5A 3F3PC 2EEZA 1FVHA 1CJSA 2Z5LA 5ICGA 2R7LA 2NO7A 2CF5A 4G5GA 3RIEA 1CRWG 4HEJA 1E0KA 2ZE6A 3SQOA 4DLAA 2VJKA 3GDGA 2WFMA 2G9RA 2ZAIA 3GT7A 2EKLA 4O4JB 1ZB8A 3SZRA 5KVAA 2YICA 3MAGA 4LYAA 1FBNA 2KM1A 4Q15A 4QYSA 1KWGA 4LYHA 3DJYA 3BTSA 2A0YA 5BO5A 3RVMA 4L8LA 4H7HA 4DA0A 1FFHA 2P9TA 4LI3X 4L6AA 3GZJA 2AFHA 4GG1A 3MT9A 4ZQEA 4UCQA 4A7PA 3VNBA 4DMRA 6ABPA 2EGUA 3BXEA 4NHEA 2YQZA 4N5DA 4DTIA 2DFVA 2OOKA 4ZEWA 3EK2A 2WFLA 4IVRA 4Q3OA 3W3AD 5A5FA 4KGVA 4LXUA 4PIPA 5HJEA 2V9CA 1Z26A 3OY2A 1UFVA 3A6LA 5CURA 2B63I 1QRSA 3DBHB 4FYPA 3LECA 1MB2A 3W1EA 2ZUFA 4P92A 4ML3A 4L4RA 3STVA 1O6CA 5DWQA 1BS1A 5EHQA 3R7SA 2VRWA 2UKDA 2ODWA 1IB0A 1LLFA 2XMZA 1YUKA 1YS6A 2QQ5A 3C8ZA 3CNEA 3FR8A 3OA2A 4TYPA 4F1WA 2PE5A 2FPIA 2R8YA 2X8WA 4YR9A 4NBUA 3N6VA 3WJ2A 2DBZA 2IEYA 3FZNA 4A0HA 3GPLA 4NFLA 4OFWA 3DXXA 2E49A 2RK3A 3WNQA 3VR2D 5HX7A 5C7LO 1W35A 1V1RA 1TQ4A 2OFWA 3DZBA 3FFTA 4M7WA 3QFSA 5B2FA 1UKVY 4B79A 5AD1A 2LNDA 3JQ8B 3ZYZA 1JR3A 1XCPA 3AHCA 3GLHE 1UADA 1JILA 1NBIA 3KKOA 1UDBA 4NBTA 2BONA 4ZO8A 5L4LA 4QM6A 1JYEA 1J5XA 2XIJA 1IBSA 4M9XA 4LQCA 1F8GA 3AY6A 3P5SA 3PGMA 3M2PA 5AHRA 1NUPA 4IGIA 3EQZA 5BNWA 5EMLA 5C1BA 5KJ6A 2Q6KA 2HJRA 3OQ1A 4NJMA 3UK6A 1GZ7A 3DXYA 3F74A 5J4KA 5I4IA 2P9GA 1FZQA 3Q8MA 3S40A 1N8KA 3D6WA 3SEZA 1U31A 4G5SA 2GA8A 2PJZA 1N8NA 3G85A 2FMFA 4IQ8A 1UBKS 4X8OA 1IVNA 1UK8A 4MDFA 2NVXI 2VDUE 2NZ2A 3DOUA 4H17A 4HN2A 1FW6A 4XLZA 1F0PA 1PQYA 2ENUA 2WKRA 2HBRA 2VCEA 5ALYA 1CC1S 4ACBA 4WK0B 1L4MA 1HE2A 2BJVA 1NW6A 2B36A 3ZDYB 3EYAA 3MEQA 4RCZA 3C3BA 4XUEA 1YGPA 1DLJA 3D6MA 1IC6A 2Q4RA 1H3FA 3Q12A 3RSLA 4NBHA 1GPBA 1SUIA 2XUHA 3DPSA 1R66A 3C39A 4LX0A 1E1RD 4J7CA 7GPBA 3OP1A 3TIFA 1NY5A 1VBFA 4JC5A 4RY0A 1XRMA 3I73A 3VPBA 4DLWA 3BD9A 1XTIA 3K53A 3R0ZA 2RJ3A 2ZB3A 4BB6A 1R50A 3MJSA 1KI3A 3IALA 5EXEA 2O19A 2Q7OE 4RKEA 3P26A 5KHAA 1T26A 4OJQA 1GITA 2CVOA 2AJCA 4BE4A 3DE2X 3GW8A 2D0DA 3K05A 1NOIA 3MRXA 3T7RA 4A82A 3X1ZA 3UGTA 4DLRA 3DMNA 1MW9X 4BNWA 1QYDA 1YOVB 4ZCSA 5DN6A 1V1RB 3QPAA 4EFNA 3A36A 3QA3E 4OTZA 2Q1UA 1X8LA 2PH5A 2OG1A 3QTLA 3TL2A 1T3SA 2J3MA 2DLDA 1GTG1 4FKBA 4MJ3A 5DF1A 5A5DA 2B82A 2NZ8A 1O58A 1WIIA 2OFFA 3RANA 5I3CA 1Y42X 3Q2KA 1XAGA 2HA2A 3NO4A 1Q91A 3BXFA 4QUHA 3UJNA 1XZGA 1XJ0A 2JJ1D 2P30A 3IDAA 4H6PA 3IT3A 2NOAA 6YASA 2JLYA 3QXHA 3RFUA 1JKXA 3X2SA 4FB5A 5KU1A 2QIPA 5M7EA 4DW8A 1NT2A 2IF0A 3GAFA 5TS3A 2HA3A 1UPTA 3A27A 4ONEA 3UV6A 1OE0A 3W4KA 4CWAA 5DASA 1WUHS 2LKCA 1MRSA 2PWPA 2QUZA 2R25B 5CGQB 3ONVA 2G09A 4QPPA 3KQWA 3U3OA 4E0BA 4DR6B 1U1IA 2PZFA 3HYTA 3PUIA 4NESA 4C6TA 4EHIA 4ZIRB 1UR5A 4P8RA 3MZLB 3MMZA 5A3RA 1TUBA 2N42A 3IQEA 2JJQA 3TBHA 3RAFC 1IU9A 1GL3A 1RO4A 1T4MA 4YPFA 4U7PB 1D1SA 3IOBA 1JIIA 3P9PA 3MS2A 1R00A 2B69A 4QDJA 3RT9A 3VKWA 3GYGA 3ZQJA 4OH1A 5AKYA 2VDKB 1TADA 1CDDA 1LSOA 1XTSA 1JDZA 4NCJA 4KPEC 2DEUA 2C20A 2OR3A 2YOGA 5AI8A 4E70A 2IDJA 3U5ZB 1JMKC 4NCKA 1A1VA 1GU1A 1PZEA 2YWFA 3TBFA 1V1MA 1MABB 2X1MA 1DKRA 1YJAA 3W5UA 1N34B 4YASA 5J47A 1CYDA 4X1YB 3HBFA 4E4YA 4RDCA 2QRCB 3HNRA 4IXDA 4P4UA 5ER6A 1V9CA 4WUTA 1VJTA 2CC2A 3EG5A 2NAPA 4YX9A 3QJ5A 4DUPA 2AYXA 5JNTA 2R8BA 4LRTB 1L5RA 3N0RA 1BE1A 5IVHA 1IG3A 1X7WA 4U7DA 1L7QA 1X1RA 1Z74A 3DT9A 3E22B 2Z5VA 3KUKA 4PYMA 4EYQA 1RAEA 1ZU4A 4RWEA 5KDLA 3CHYA 4KPGA 4JVLA 4B7CA 3L84A 4RJTA 2HUNA 4AJJA 2LCQA 1KVSA 2RI1A 2Z2ZA 5IDWA 2AN1A 3QF4A 3C4QA 1HGXA 3D6AA 4EJ0A 4KR7A 1E63A 2WTMA 1IDOA 4Q6BA 3NIDB 5E7MA 1KVRA 3FDZB 4BN5A 5JPIA 5FBLB 3MILA 1K9VF 3UANA 3U3MA 2X6RA 2J9YB 4L4YA 1MJGM 2O7RA 4MI1A 2RI6A 3CRMA 1BWRA 4RORA 1KRLA 1Y1WI 5H68A 3ZWBA 1XRLA 3EY9A 3M70A 1M0TA 4LY0A 4BLQA 4DCVA 3OIGA 1TA9A 1S2GA 2RGGA 2M48A 3HYCA 1U0TA 3L7OA 4G67A 1ZD9A 5DWVA 3WFJA 3U9LA 1I2CA 4BVAA 1HNWB 3H5TA 1EFKA 2X5OA 3EVAA 1NN1A 4BNVA 2XWQA 5FI0B 3OPXA 3CURA 4DGQA 3VH3A 5DHPA 2IYFA 2F1HA 3QKWA 2P4UA 2R44A 2R11A 1GCGA 1JDSA 4RH3A 1UXGA 1V26A 1DBRA 3ZK8A 4OY3A 4QPZA 1ZUWA 2H1WA 2JA5I 4DZTA 4TT8A 3ABIA 3KWMA 3BS4A 5NULA 1DOAA 2DVMA 3ZTWA 4L08A 1XTPA 3VNUA 2OO7A 5I7UA 4HMOA 2C0CA 4GZ3A 3H2JA 4CMJA 3OO0A 1NV8A 5IJ9A 1DS6A 5DNWA 2GN8A 4HAUA 4H16A 4K1LA 1F2TB 2F1RA 2HRQA 2JB9A 5ALWA 2IXDA 3BILA 5JO0A 5SY4A 1X7WB 4GS5A 4BUCA 1U0GA 3DDUA 1B0AA 1O2DA 1IJEA 2LEXA 1A7UA 4M1YA 4OQXA 1ZINA 1VQOZ 2Z0MA 4YAOA 2EJTA 1PNQA 4BO7A 5KNLA 3KQUA 3W79A 2NTJA 1T1RA 3ZW7A 2MSEB 4UPVA 3IO3A 3VNAA 1DBIA 3E3LA 4B83A 3JZDA 5DNAA 5K6AA 1AV7A 4KRXA 5DDIP 4NBNA 1YQDA 2GN1A 1B0PA 4HFMA 2J6BA 3D5EA 1GQ2A 1FMCA 4EGCB 5FL3A 1D8AA 3S81A 3DMFA 1MPTA 3KJHA 1TJ4A 3CX8A 2J09A 2C07A 1NF3A 1OUMA 4M1MA 2BBTA 1ODIA 3WGJA 4DWWA 5IH7A 3S55A 2Q8NA 1J5PA 1ZD1A 2WC1A 3ANMA 2OQRA 1GWNA 4IVQA 4NDNE 3HJCA 5GV8A 1ST2A 2OCBA 4RIFA 1V71A 4ZGWA 1E6KA 3IQZA 2AXPA 4FHGA 4IGFA 3I1JA 2YWDA 5KHLB 1JT9A 3P9CA 4NP6A 3EFOB 1UBSB 1E2HA 4V2IA 1CUCA 1AUXA 1UZAA 1OXTA 2Z8ZA 2DUMA 2QTHA 1XTQA 1OOEA 3INYA 3O8CA 3W06A 4LX8A 4FEEA 4P5PA 1FDWA 5I5GA 1J07A 4M36A 3VU1A 5JAUA 5KOYA 4P4NA 2C3YA 3DVRX 1NBHA 4KPUA 5CW1A 1O9BA 5BNZA 5LLTA 2WD7B 1HO3A 5AP9A 3VRHA 1VLMA 3R3JA 3CXCZ 4MPDA 3QPBA 3CLUC 2V3CC 3KTFA 3CF2A 3TE6A 3OEYA 1QRDA 4G2NA 3K6RA 2CMKA 1TCUA 3MM4A 4OXIA 1FVFA 4K86A 3TGWA 5K8UA 1PZGA 2OFPA 3QKSB 3DHEA 4M1WA 1Y3CE 2E9SA 1HM5A 4B3FX 5DBOA 3EYWA 4DARA 1QK3A 1ESZA 3G8BA 2Z3WA 4I1UA 1NP6A 4XRGA 3EGIA 2AF3C 4M89A 1T9BA 4LVUA 2WVAA 4ACAA 4LAFA 4LGVA 1KY3A 5TE9A 2D3WA 3N75A 4TXHA 1PWYE 2WSSD 3K1JA 3LD9A 1M1K2 1NVUQ 3RM3A 1Z12A 5CAEA 5JVDA 4X1KB 1SKYE 2PMEA 5FLMI 3BE5A 2WAAA 4Y7NI 1FX0B 4QTTA 2C2OA 4MRNA 1TFIA 2V5VA 4JL6A 3ROKA 1H4VB 3V8VA 1XU9A 1ZL0A 5EWLA 3G2QA 4MKRA 4ZVSA 1NU6A 1Z5OA 2IPMA 4XJVA 1P8AA 1FFEA 3FE2A 3DLPX 4XSVA 1IY8A 2I65A 4U5XA 1NXOA 4I6JA 3ZV7A 2P9FA 4QOFA 1EM8A 4MPJA 3HOUI 4BLRA 2Q5HA 3WV4A 4NMLA 1XHEA 3GMIA 5D51S 2G40A 1LTKA 1YJ91 3QRWA 3PI6A 1GKLA 2QUHA 2XQFA 1ZRMA 1KEUA 3GRPA 4H59A 5ECWA 2GK4A 4KQHA 1TKRA 3U62A 4D9CA 2IS2A 4ZAGA 1VFPA 1NYRA 1YJNZ 2ZP1A 3L0PA 1MRNA 3RUDA 1Q15A 4MV1A 3EDCA 2PM9A 1G63A 4WLEA 2NUAB 1UFOA 1PEKE 1QGUB 2ZI3A 3AQIA 3DS8A 4MI6A 4UNPA 2R00C 3PUHA 5B1HA 3ICVA 3ZVLA 4WV3A 2PJDA 1PFTA 2GZ1A 1XMPA 4PRZA 5L3ZA 5C5IA 2WB4A 3N3AC 2H4XA 1URPA 2PAAA 1W36B 1OIWA 3ZI7A 4ARIA 3EZGA 4KEAA 3PQ4A 2BCJQ 2W22A 4CN9A 4BATA 2H29A 1AG9A 3MJFA 1OIXA 2VUSA 3L6DA 3TPFA 3CPWZ 1R4AA 4OCZA 2JS4A 1D2EA 3HI6A 3ENVA 4HDNB 1WO8A 3SYTA 3DKRA 5C1OA 2X4DA 1EVYA 5JJCA 2DFLA 4JJ6A 3H5RA 2BGIA 1A3CA 4FVTA 3S68A 1FUKA 1GZDA 3NV9A 2HU7A 2F17A 4C87A 3ZIAA 3KSDO 2AQKA 3ANXA 3W5CA 3PUYA 4PSUA 4B3CA 5BV1A 1NYLA 4DYVA 5LL6P 4BTVA 1J0BA 5JZBA 1D2AA 1E89A 2KQUA 2ZRQA 4R9VA 5FOWA 1W2BZ 4ZOLF 1DV1A 3L1UA 3MYRA 3DDWA 1K5HA 3RAPR 3IX0A 1CEQA 1RACA 1WCYA 2LP4Y 1SRRA 5BSFA 2MR5A 2SKCA 2I7DA 2YFKA 2EFYA 5DNUA 1LKZA 2A5LA 3HJNA 4HR7A 5ARCA 5CYGA 4ND5A 1QFZA 1SZCA 5EKUA 3GAMA 3FOZA 3EZ7A 2GUGA 1TDJA 1LTHR 1I4WA 4KP7A 4RS3A 2D7JA 3AEUA 2OD2A 2E37A 1CDOA 2P3QA 5H80A 2DH5A 4H7IA 1COZA 4MHTA 3CC2Z 2ECPA 3KJQA 4BBAA 3DUWA 4K03A 5JLJA 5FJJA 2VS1A 3BTUA 4CI0B 2X7HA 1D4FA 4FK8A 1GNLA 4GKVA 1VBKA 1E8NA 1TFUA 2G5TA 3HPRA 5SY9A 4KXWA 4DR1B 3U4MA 4NCXA 1BXGA 1DOHA 2I3BA 3HFJA 2IYXA 4ON9A 3U7QB 1BA2A 3AHGA 3OM8A 1XVLA 4JROA 2PSFA 5L51A 2UUBB 4G23A 1WZNA 1P3DA 4MW5A 2WF9A 1ADFA 2GLUA 2I5PO 1ID8A 1NLMA 4K81B 3EXIB 4AQ7A 3GLGE 2PK7A 5H7XA 2O4CA 4DY6A 1GTL1 2JKVA 5SZKB 5AESA 1T2DA 2ZRNA 4D26A 3H97A 1JA0A 5K0CA 1K2VN 4CLRA 3IAS1 4C6SA 3O9MA 5I9MA 3UMFA 3G7NA 3OLYA 1LPBB 2WIBA 3IAS6 2I9KA 4EARA 3M5WA 2D59A 3RWOA 3P7MA 4TLBA 4QELA 4TWBA 1JVBA 1O96B 3ABQB 3KOOA 4X7RA 3ZI0A 5A06A 1CUIA 3KT6A 4IDDA 3WMGA 4BQNA 1S0UA 2K5UA 5DPMA 1C1HA 2X9QA 3HHEA 1O6FA 1I9CA 1ST3A 4B9EA 1WVMA 4O2AA 4C22A 5LXTA 5IUNC 3M8KA 1RIFA 1XAJA 1X0VA 5B7GA 3FYTA 2PUAA 4KUGA 2QA4Z 1OX6A 2QMUA 1NXQA 4NE7A 1RZUA 3C45A 2WIGA 4TQ9A 3DOOA 4R4JA 4HRAA 3SSMA 4AMYA 4EYOA 1F17A 5K0NA 4WFJA 2OG2A 3FY4A 1RAGA 3CW2A 3E58A 2I4OA 4N7MA 2H17A 2EGTA 1JJ2Y 3RZOI 3CT4A 4PRLA 5BRNA 4AUKA 3SGLA 3C1UA 3EEOA 2ZBUA 1M901 1B8NA 3U4IA 4PCLA 4CT4B 2O53A 4KXFB 3A4NA 2PSHA 5FPSA 2V6BA 3KE8A 4OQPA 3UQZA 2X9NA 3QBTA 4OXNA 3QEMA 1PT9A 5D1HA 1CB0A 2G72A 3MCWA 2O0LA 4GC9A 5JOQA 1FZTA 1YRQA 1MX1A 3DWFA 2N47A 1GU0A 2W6ID 3O4FA 4KSYA 4D56A 5EZQA 3V1LA 5AHXA 2XYQA 2BJOA 3QU4A 2IYTA 1AHHA 1NJI2 1MOZA 2ECFA 1I10A 3Q3JB 3ZCVA 5ITWA 2M1XA 3GPCA 2WU1A 4C4OA 2WHYA 3ESWA 4LZPA 1Z5WA 2FDCA 1JVNA 4LYDA 1GAWA 1BE8A 3QOWA 3WTBA 5JWRA 2YWBA 1ND5A 3DPUA 1Q1EA 3WG9A 1EBUA 3F5DA 5T5QA 1TGYA 1YL5A 3UMJA 3L6OO 4R8SA 5KWSA 1YA4A 2WDZA 3FDJA 4BZXA 2D2XA 1UJ2A 3H3JA 3OPVA 3INTA 5D3KA 4NICA 4Y2TA 3D43A 2AW3A 2RCYA 1Y89A 2QU7A 1S3GA 3D6HA 3CEMA 4DEXA 1NRXA 1JV2B 2B83A 5LOVB 2LVBA 2CHQA 2J48A 4NECA 5CA1B 3QE2A 3U0VA 2A84A 2OXIA 1YR3A 2P2NA 2YJNA 3FOWA 3PRHA 3AO0B 3VPCA 4A16A 5IWCA 1QDLB 2DGDA 4WZZA 5FUXA 3A6FA 1RYDA 2VTDA 1XDGA 1OY1A 3JQ9C 3MS7A 3F73A 4IKOA 5JG7A 4KACA 3N8GA 1YR6A 2PS3A 3V8MA 1BGXT 1OI4A 2IYQA 2GJKA 4OB6A 3L7IA 4Y1RB 3RW9A 4D3XA 4F7DA 1E9VA 1SU7A 3G5LA 3UYLA 3IEVA 1NMEA 3EZXA 3O95A 2JL1A 4Q7JB 2OBXA 3JAKA 1YR1A 1R3UA 4LSZA 5I8ZA 3KUCA 3UAYA 3DE0X 1H94A 4U7HA 2QYSA 4ENPA 3TMYA 1FP2A 4TTJA 5JZVA 3BCUA 4LQ4A 1DU4A 4CRWB 4ZOCA 2OVBA 2H9YA 1MR3F 4DG9A 1P5HA 1FMFA 4X8LA 3A6KA 1JAIA 2YC2C 1TM5E 2J0UB 4B3MB 4BNKA 1U63A 4G1CA 1ZH1A 4FINA 3EASA 4OF4A 3MB5A 4P4SA 2AWNA 1V41E 3W4IA 2BFBB 4L8FA 3DWIA 4LDJA 3JS5A 1JTEA 3B3JA 2BKLA 2J3QA 4S12A 5K6RA 3FOFC 1AUQA 2O8EA 1I24A 3VC2A 3LXMA 1N2HA 2EKPA 1FC0A 1KOFA 3EAQA 1J24A 3KOWA 3TIIA 1WXFA 3B6ZA 5FI3A 3SHVA 5ALXA 5EEHA 5IZCA 1ZN7A 1CEYA 1EJ2A 4Y6PA 3Q11A 1DBVO 3QM1A 2LCFA 3ZV5A 2G63A 2FPIB 3JYLA 4J0CA 4LPKA 5DHSA 4URXR 4RPCA 4LXQA 1BVRA 2H7CA 4JASB 3ZWPA 3DKVA 1CZHA 5D87A 1UXJA 1IHUA 1UEXC 3UJ7A 1H5UA 3U4QA 4TYYA 3I30X 2HPHA 4KMOA 3ZWVA 4D45A 4ARCA 2DBVO 2EG5A 2PBFA 4YJDA 4EGQA 1VYHA 5TC4A 1XNJA 2QV0A 3T5TA 5IAKA 2FPOA 5C8DA 3FVRA 1BHSA 1DWUA 3OJXA 4IUYA 2PZAA 1M6NA 4CEIB 4FU0A 3JZMA 1KORA 1OBCA 5F3RA 3WGOA 3MMSA 4FS8A 4UBOA 5LP6A 1DMRA 3V42A 2R6ZA 3HB5X 3LZDA 3T1NA 1LQ2A 3DZKA 2HMUA 3FNQA 5IRCD 2FWPA 2WM8A 4G81A 5KHOC 3UZUA 4P3KA 4UBMA 1ZSYA 1W0KA 2AOUB 4OPMA 1UXOA 2YRXA 1SOMA 2ZIAA 1NQOA 2XI4A 4FFNA 2AFHE 1E79D 5J58A 3JRWA 3JQBA 4KZKA 1P31A 4F0JA 4M1KA 3H1GA 5KQGA 1S9DA 1YBVA 1QANA 1H1DA 1XZIA 2W8BB 4ZANA 2I7VA 4UMVA 2X3YA 3GNTA 1SVKA 2RG7A 2J5RA 4LF7B 2XBMA 1FFBA 2XNSA 3AJDA 3RUPA 1GLGA 3CNBA 3UOAB 5D1OA 1WHTA 1X42A 1QS0B 3MCVA 1E0DA 1MO2A 2C9CA 5DLYA 2P67A 5HA5A 4KTVE 5J9FA 3I4MI 5THKA 3RHSA 4AZSA 4PZ9A 4K6CA 3DD5A 4HP8A 3CA8A 5ALSA 5E7JA 3TB6A 5KTPA 1Z18A 1Z8FA 2CL5A 1P5FA 1Z5ZA 5GZ1A 5AI0A 1ZCJA 4B3JA 1G6KA 2O14A 2ZBVA 1CUZA 5B57C 1EWRA 4RK4A 1JIVA 3PWKA 1HETA 1PK9A 2FMIA 3QLTA 5CVCA 1S8OA 5T4FA 5CA0B 3FHJA 4M8NE 1IQRA 5H8WA 4AS3A 2IYSA 4PLFA 3ZQ4A 1SXJA 3OQ6A 4Z1OA 3DC7A 1E3DA 3C6ZA 4REMA 5JJKA 4OQZA 4DHWA 5JWHA 4FXPA 1E3WB 2WU8A 4KO1S 4PYKA 1RYEA 4JMLA 3WL6A 2ANBA 3NVDA 1BYUA 1L9KA 1L7XA 1NUHA 2IHKA 3F4KA 4LQLA 3AVUA 3QUTA 1U8ZA 2B7LA 3AVWA 4Z7OB 2JA7I 1L4GA 2PCLA 2RK4A 4K05A 1RCUA 3KXKA 1RT9A 1USKA 3HE3A 1CQWA 1Y7IA 4RH1A 4LWZA 4BB5A 2CUKA 1FPQA 1I9GA 3HUEA 4J07A 4LPSA 4RACA 1O0CA 2PUEA 2ZDHA 3ORHA 2J3IA 4RIGA 5IZ4A 2Z6AA 1Y0BA 4KVZA 2GUWA 3NBFA 2VHQA 3JCZA 5AKLA 1LWOA 2QRUA 4NNOA 5AUOB 4GMHA 5ER9A 1KU6A 2XMRA 4BRWA 5G0WA 4Z7JA 2A1TS 1R4NB 1XK6A 1VHJA 4A3JI 1Q1BA 2XKJE 4M1OA 4PY2A 3TJZA 4X63A 3TEFA 1YB4A 3AF0A 2QGZA 3AIMA 1E4OA 2ZIWB 4OKIA 3OJFA 4BKUA 1K83I 1YAJA 5B1SA 1P5RA 1W5BA 5CFQA 3ER8A 2W2MA 1NT4A 2VA8A 1WBBA 5B6JA 1I4DD 1NWCA 3AUYA 1NW9B 2WVHA 5JNUA 3DEKA 2JCYA 2G4CA 3BFVA 1PNVA 4Y2VA 5EG5A 4D3DA 1UPCA 1W88B 3OX2A 4GP7A 4RPLA 5CDGA 7AT1A