1Y8CA

Crystal structure of a s-adenosylmethionine-dependent methyltransferase from clostridium acetobutylicum atcc 824
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
246
structure length
246
Chain Sequence
NCYNKFAHIYDKLIRADVDYKKWSDFIIEKCVENNLVFDDYLDLACGTGNLTENLCPKFKNTWAVDLSQEMLSEAENKFRSQGLKPRLACQDISNLNINRKFDLITCCLDSTNYIIDSDDLKKYFKAVSNHLKEGGVFIFDINSYYKLSQVLGNNDFNYDDDEVFYYWENQFEDDLVSMYISFFVRDGEFYKRFDEEHEERAYKEEDIEKYLKHGQLNILDKVDCYSNKKVEKFTERITYLVKLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine-dependent methyltransferase
publication title Crystal structure of a S-adenosylmethionine-dependent methyltransferase from Clostridium acetobutylicum ATCC 824
rcsb
source organism Clostridium acetobutylicum
molecule tags Transferase
total genus 90
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2004-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.110 Mainly Beta Single Sheet N-terminal domain of TfIIb S-adenosyl-L-methionine-dependent methyltransferases 1y8cA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1y8cA01
1IY9A 4PNEA 1RJEA 2PXCA 2BM8A 3LDGA 3T0IA 1F38A 1UFKA 2PGXA 1RJDA 2ZZNA 2C7PA 3UJ9A 4IWNA 2CMHA 2NXNA 5K0GA 4FGZA 2H1RA 3TKAA 1EJ0A 4QPPA 3JWJA 3OU6A 5E1MA 3PFHA 1R8XA 1JSZA 5CVUA 3TM4A 1AQIA 2ONYA 5DWQA 4QQKA 5JUWA 3DXZA 4EMSA 3O7WA 5GIPE 2Q41A 3BZBA 5T64A 3IV6A 3DH0A 2ZSUA 3AWIA 3HA5A 3LBFA 2OXTA 4BP3A 3DXYA 5IKMA 1TW3A 3HCBA 3OZSA 1JTFA 2Z6QA 1NV9A 2QRVA 5DX8A 1KR5A 4RX1A 5FHQA 3FRIA 2YQZA 4RSRA 2UYOA 3REOA 3JWIA 5DTMA 1N7IA 2G72A 4RVGA 1VIDA 4U7PB 2GH1A 1EJ6A 2PWPA 1R00A 2O07A 1YZ3A 2OB2A 2HTEA 3UJBA 1XCJA 4DCMA 4EVIA 10MHA 2PKWA 5FULA 3NTVA 2PSSA 1SUIA 2F8LA 2I6GA 4MQ4A 5EOVA 1G8SA 4EKIA 2Y1WA 1L3CA 5KYGA 1NBIA 1X1AA 3KR1A 4PCLA 5EEHA 2KW5A 3A7DA 3NW9A 5EZSA 5FADA 3JWHA 5K01A 5FA5A 3CGGA 3SSMA 1RI4A 2PX5A 4HH4A 4RV9A 1WXWA 3CJRA 3IHTA 5E1BA 3BGVA 1KYWA 3TPZA 5HIKA 3L8DA 2VZ9A 5E1OA 4DF3A 3LGAA 1XCLA 3VSEA 5EEGA 2P35A 3T7TA 2PXAA 3GRYA 4QDKA 4ZTBA 4MTLA 2EX4A 2AOWA 2BR5A 3OFJA 5HIJA 1SUSA 4PYIA 4DMGA 1F3LA 3GU3A 4WXHA 3BGIA 2PX8A 2FPOA 4HTFA 1HNNA 2XYQA 4KDCA 5E8RA 5H02A 4CTKA 1ZGJA 4CKBA 3EVFA 4M7RA 4X41A 3KR9A 3FYDA 4YV1A 5GWXA 3ORHA 5ERGB 3ER9A 3B5IA 3CC8A 2AOVA 2ESRA 3I58A 3GJYA 3LDUA 2WK1A 3MQ2A 1TPYA 4ISCA 5EHGA 5HIMA 2N47A 3HNRA 3ELDA 2PV0A 1QZZA 2WA2A 5EQJB 3R24A 3B89A 1XXLA 3C3YA 2NYUA 3O4FA 4C05A 3R9XB 5EIWA 4RTQA 5E8JA 3SR4A 3P8ZA 4OBWA 3DMGA 3EVEA 1ZHFA 2R6ZA 1NKVA 3FUWA 4PYJA 2AR0A 4RTMA 4YUYA 3IEIA 3P71T 2QYOA 5M5BA 1WS6A 1ZG3A 4RTKA 4ER3A 3SMQA 4QTTB 3M6VA 1G55A 3FUVA 4QVGA 5EMJA 3AJDA 5GP1A 5GIOE 3HA3A 5GM2A 5K0JA 4A6DA 2PX2A 2BZGA 3P9NA 2K4MA 3G2PA 4AZWA 5E2AA 1G8AA 1DUSA 1AF7A 2IPXA 3UZUA 3UJAA 5KS2A 1HMYA 1Q0SA 3DP7A 2XYVA 3C6MA 2ZIEA 4DKJA 5FQOA 1QANA 4C03A 4PYKA 5KQRA 1XDUA 1BOOA 3HP7A 3SSNA 4K6MA 3LCCA 5F2KA 1NE2A 5U4XA 2HNKA 1BHJA 3DULA 3OE4A 4H0NA 3EVZA 2CKDA 1N7JA 1M0EA 1X19A 1JSXA 2YR0A 2CWWA 5ICCA 2IH2A 1KXZA 4RYLA 2ZZMA 1I9GA 1VP3A 4PONA 3LHDA 5EMMA 4NECA 1ZGAA 1XDZA 5GM1A 4GOLD 4E2XA 4RVDA 3B7PA 4GEKA 5HFJA 3A4TA 3OU7A 1M6EX 3DMHA 3FRHA 3MAGA 4P7GA 1SKMA 2ZCJA 3G2QA 4PWYA 3E23A 3Q7EA 1YF3A 1O9HA 2HR1A 4IV8A 2ZULA 5DLYA 3OU2A 5FWAA 4C08A 3I53A 5DSXA 5FQNA 1INLA 5LQUA 5BW4A 2QE6A 2QY6A 1Q0TA 1SQGA 1PJZA 2Y1XA 2ZZKA 3GWZA 1H1DA 4GQBA 1U2ZA 4KW7A 3DLCA 3QOWA 3C0KA 3EVCA 5DRYA 5CD1A 4YV0A 3FYCA 3GGDA 4GF5A 5CUQA 4QQNA 2YTZA 5DX0A 2PT6A 3C3PA 1XDSA 3EMBA 4ATNA 2ZBPA 4PYNA 4PCAA 1X1BA 2YXEA 1R8YA 2O0LA 3FPFA 3GDHA 1R74A 4QTUB 5G02A 3RODA 1RI2A 3HCFA 3FPGA 2AOTA 3KQQA 3KR2A 1KPHA 4YMGA 5LQNA 1P1BA 3G5TA 3P2IA 4BLVA 4F84A 5BXYA 4POOA 2R3SA 3FTCA 4KVZA 3K0BA 4KWCA 5F2NA 4PYMA 5HIIA 3UJDA 3CCFA 1O54A 3BWCA 2CL5A 3E05A 1FJXA 3G8AA 4RTSA 4GOMD 7MHTA 5DRTA 3CJQA 2FK8A 5DPMA 3MCZA 5DXAA 3LCUA 3PVCA 1NW6A 2ZBQA 5LQAA 2EG5A 2OY0A 4BLWA 2I9KA 4C04A 3CBGA 3HCCA 3NDJA 5EMLA 2P40A 4RVFA 4OBXA 4PYQA 3OE5A 1YFJA 5K0CA 3T7SA 3R0QA 5E1DA 2CMGA 4FZVA 4ER5A 2IH5A 4R8SA 5EHIA 1JG1A 5GOZA 1AQJA 2UYCA 3TR6A 5DSTA 5C1IA 4R6WA 4P58A 1IXKA 3S68A 3M33A 3PX2A 1AV6A 3M6XA 3O31A 3P2KA 1VE3A 2BH2A 2QRVB 2P7HA 3HM2A 3U81A 4A6EA 4AZVA 2NXJA 2UZ4A 2IH4A 1EQAA 5LQRA 1EAMA 3KU1A 5CVDA 2ONZA 3BUSA 2ZIGA 4BP1A 5FWDA 2AOUB 3P9KA 3ERCA 1R18A 3TLJA 2YXLA 3VC1A 5K0EA 3EPPA 2I62A 5HZMA 3OZRA 2IIPA 3PT9A 2OZVA 1L9KA 2I7CA 4X61A 4E30A 5LSAA 2P8JA 2IBSA 1XTPA 5EG5A 1ORHA 2LD4A 2O05A 4CWAA 3I9FA 3VYWA 3DR5A 5LQKA 2ZBRA 3SX0A 5E9QA 1QAQA 2BR3A 3TOSA 4FSXA 3GIWA 4CKEA 5T67A 3FPJA 4PGGA 4LWOA 1WY7A 3TQSA 4FSDA 2OBFA 2GAFA 2IDKA 1QAMA 2B25A 2OO3A 4CTJA 3FTEA 2ERCA 3QOXA 1KPIA 3EVDA 4DA4A 4FT4A 2PWYA 2JH9A 2NXEA 3EEYA 3FUTA 4HRAA 4KRGA 3A25A 3KQMA 3KQYA 3V8VA 2IFTA 3OPNA 3TM5A 3HEMA 3A26A 1DCTA 5CIYA 4BY9E 3ME5A 5KVAA 3HVIA 3LCVB 4OQEA 5EKUA 4CKCA 2EJTA 5FHRA 2ZFUA 2DULA 3G7UA 4FR0A 2OYRA 2YUIA 4PINA 3LECA 3KQWA 4RTOA 4HSGA 2XVMA 1OR8A 3BWBA 3KHKA 3OFKA 4RVHA 3PB3A 5FA8A 2PVCA 3SVZA 2BM9A 2VDVE 3TRKA 3LX6A 5DTRA 5FUBA 2A14A 1JG2A 4DCGA 5K0BA 3UJ6A 4UOEA 4QVKA 2HV9A 2H00A 2BR4A 2PJDA 3HTXA 2O57A 2IGTA 4LWPA 4QPNA 3AY0A 2UYHA 1NW7A 3ID6C 3OZTA 1KIAA 5K0NA 1Z3CA 3GRRA 2AN3A 3LKDA 4RTPA 3GRZA 3UFBA 5MHTA 2G8NA 3KR0A 2NP6A 1NW5A 1KP9A 2ZWAA 3FUXA 4OA5A 4GBED 5LQCA 5EVJA 3PX3A 3HVJA 1VQ1A 2EJUA 5EC8A 4AUKA 1JG4A 1N2XA 4E2WA 5LR6A 1RJFA 1YFLA 3MB5A 4HGZA 3EGEA 2ADMA 2B2CA 2C7QA 3UA3A 2B9EA 1EIZA 1QAOA 4RTJA 2UYQA 1VPTA 3DUWA 4V0QA 1PRYA 3MGGA 4WVLA 3BXOA 3B3GA 4AZSA 3KQPA 3FZGA 4YUZA 3KPYA 2JH8A 1ZQ9A 5BW5A 2XYRA 5JR3A 5BP7A 5DM1A 1FP1D 3FUUA 1TW2A 4HG2A 5DXJA 5CM2Z 5EZQA 4C06A 4HC4A 5K09A 2JG3A 1RI5A 4E31A 2YX1A 5DM2A 4HGYA 2YVLA 4GOND 4MHTA 3HCDA 2XVAA 4GC5A 4KIGA 3HCAA 3KPVA 3Q87B 2JHAA 4FS8A 4QDJA 5HOQA 5LQJA 1FP2A 2WA1A 1G6Q1 1G60A 5CCXA 2HMYB 2YXDA 3B3JA 1I4WA 3NWBA 3NWEA 1L3BA 1B42A 2JJQA 4E32A 4MWZA 2PT9A 4L7VA 2XBMA 4XUCA 2JHPA 4PGHA 5CVEA 8MHTA 2P1DA 3EGIA 4JXJA 2V7EA 3LSTA 4KIFA 1YZHA 2P3LA 3HCEA 4IKPA 5D1HA 3SXJA 5KQSA 1M6YA 3AXTA 2G1PA 3EEOA 2ZW9A 5ICEA 2GB4A 2Z6AA 4C07A 4PIPA 3BT7A 4X63A 1XVAA 3T7RA 1VLMA 1KYZA 3DXXA 3DLIA 5DM4A 2OPBA 3G8BA 3QV2A 2G71A 2B3TA 1UWVA 2AOTB 1VP9A 3TMAA 4E70A 2AOXA 4P7FA 1YUBA 1KPGA 3LDFA 3V97A 4RTLA 1QYRA 5ICFA 1RI3A 3KKZA 3SM3A 3P9IA 3K6RA 3NVMB 4AZTA 1WG8A 5E9JA 3TFWA 2ZVJA 4RTRA 5T6BA 1NV8A 5GINE 3ANXA 3GNLA 3A27A 3BKXA 4GUAA 4R6XA 4E33A 3ELYA 5K03A 3UBTA 3ER8A 3DOUA 3I64A 2VDUE 1JG3A 3OCJA 1NBHA 4Y2HA 5EMKA 5FTWA 4B17A 3NVKI 3MCTA 3UJ7A 1IM8A 3FTDA 1L3IA 2P7IA 2NXCA 1D2CA 3KPUA 5FCDA 5HEKA 4DQ0A 2IBTA 4OQDA 5C9ZA 2H11A 3EMDA 3G2OA 3BWYA 3G5LA 1G38A 2AOUA 2DPMA 3SSOA 3B3FA 5HILA 9MHTA 4YUVA 3G89A 3DTNA 3HA7A 3KQSA 3F4KA 4PYOA 1XJ5A 4DZRA 4EKGA 3MTEA 2OB1A 3HVKA 2ZLBA 4KDRA 4M37A 2AZTA 3KPWA 5EIFA 5K0FA 1DL5A 1R6AA 2JHCA 4YUXA 2FRXA 3PFGA 5P8WA 2FCAA 4C4AA 4FP9A 3E8SA 1BC5A 3FPHA 2E5WA 2NNWB 5D1NA 2V74B 3AXSA 4F86A 1X1CA 2AVDA 2ZTHA 3KQTA 5C0OE 4ER7A 2PY6A 5K0LA 4R05A 2AN4A 3LKZA 4HTFB 4BLUA 1D2HA 4YV2A 3DMFA 1VBFA 2AS0A 2VP3A 4Z2YA 1P91A 3PLAE 3KQOA 1FBNA 3G88A 1ORIA 5CVVA 5K05A 3KQVA 1EG2A 1JQDA 2NP7A 1NW3A 2AN5A 1SVUA 3MERA 4X1OA 5E9WA 4PIMA 3ELWA 3WSTA 4IV0A 3GRUA 3H2BA 5DTQA 3NJRA 2EFJA 2VS1A 2C7OA 1NT2A 4XUEA 4FT2A 3NMUF 5DT2A 3KPJA 2AVNA 2ORED 1D2GA 5ICGA 3PS9A 3CKKA 2GA9A 3VC2A 4DM3A 1SG9A 1UIRA 3GCZA 5IH3A 1BKYA 2B78A 3JWGA 4GC9A 3RIEA 3M6UA 4GOOD 3D2LA 1SQFA 2PLWA 4RWZA 4OX9Y 4LG1A 2P3OA 3M6WA 3E7PA 5EPEA 1V39A 1YB2A 4ER6A 3FTFA 1X1DA 4XUDA 3LPMA 1JTEA 3EVBA 4V0RA 3UWPA 4YMHA 2FHPA 3R6TA 3CJTA 3LBYA 3M70A 5CVJA 2GLUA 5B1SA 2IDJA 3THSA 2Z6UA 2QM3A 4OA8A 3THRA 4EQZA 2GPYA 4LECA 4CXMA 5EKXA 3UJ8A 1NW8A 4EK9A 5DX1A 4R8RA 1JR4A 3A7EA 4P7JA 4E2ZA 3P9CA 3G2MA 1WZNA 2GS9A 3UJCA 1RJGA 3EVAA 3P2EA 1Y8CA 1KHHA 4RTNA 1JQEA 3P97A 1JQ3A 3TKYA 3GO4A 4G56A 5K8VA 4AX8A 1MJFA 3FPEA 1L1EA 2PBFA 3ELUA 1P39A 3BKWA 3CVOA 3I5UA 1O9GA 3MTIA 3R3HA 4M38A 2VDWA 3GRVA 4XCXA 3BWMA 1MHTA 1I1NA 2P41A 4F85A 3M4XA 2G70A 1ZKDA 3GXOA 4Y30A 2ZIFA 3C6KA 3NDIA 5F2OA 3IYLW 5E2BA 4U7TB 4YUWA 2PX4A 2ZWVA 5CCBA 2C7RA 1RI1A 5EGSA 3PTAA 4O29A 2FK7A 1T43A 4M36A 5DM0A 3EVGA 1FPQA 4P7KA 1P1CA 3LL7A 2P3QA 4E2YA 4PYLA 4MIKA 4X60A 3MHTA 3RW9A 1VL5A 2O06A 3EGVA 3X0DA 4ER0A 2OKCA 2PXXA 1WXXA 2FYTA 3BGDA 2HWKA 2IP2A 3SGLA 3HVHA 3UA4A
chains in the Genus database with same CATH superfamily
3G79A 2WHEA 3PI7A 4JLPA 1ELOA 4K3UA 3W8FA 3AWDA 1GSIA 4OPMA 3HSYA 4WFIA 4IP0A 2E9SA 4ZC1A 3CC21 3DDHA 5G1OA 5C8YF 2DTEA 4NG4A 1TUIA 4AKEA 3ADKA 2CNWA 4K9MA 2GCOA 1JSZA 1ODCA 1IY2A 4G23A 4C7XA 1YUKA 2QJFA 3HYTA 2A5LA 4RF2A 5AM0A 4PTLA 4RK0A 2VPYA 2PTHA 3K0EA 5JUWA 5LIPA 4N18A 5AVSA 1M34E 3O7WA 2FF7A 2BONA 3TD2A 5T64A 4YI5A 3GLHB 4CMBA 4IL5A 5ILGA 2B1QA 2GHRA 2VJQA 2HCBA 3N87A 3OZSA 2EW1A 4N0PA 3UH0A 1M902 3AI1A 4BN0A 4IDFA 3FSJX 5TMBA 4G0XA 5CJPA 2Z6AA 5D5QA 5IUKC 4MVCA 3FETA 5DTMA 1RPZA 1KK0A 3FBGA 1FSZA 1PK7A 1BGVA 4D4GA 4JR0A 4A3BI 2WJJA 2DY0A 5TGZA 3AUAA 5C31A 4JBGA 3RC7A 1ZRSA 5EEHA 1DFHA 3WTCA 1JU9A 2FZEA 1WRBA 4XD7A 3WRXA 1KK3A 2CXSA 3CQ9A 2CJFA 1UJMA 4IRUB 4S35A 5IXYA 1H2AS 4JLUA 5JTUA 2C9MA 2H07A 2CSXA 2AFHB 1C9JA 1E2IA 1KZ7B 2B1GA 3A1DA 1AZWA 2KBEA 3IALA 1NR5A 4Q9LA 3S4YA 3UCFA 1Q821 1XCLA 4LAFA 3D2CA 3PUIA 4FGJA 3IUYA 1CEQA 2VBIA 3DO6A 3HJUA 3V3KA 4ETMA 2AV6A 4KGZA 5TMPA 4RMIA 3L18A 1NRJB 3KOXA 4V0OA 4BC0A 1NC1A 4U0JA 4LDRA 3LT4A 4Q1VA 5LMZA 4XYBA 2PS1A 4WOCA 4F3CA 4ZHQF 4EW6A 6ADHA 2A5GA 1FZTA 3O4VA 5H81A 3BIWA 3O74A 3PUVA 4LS3A 2ILVA 4FBMA 1JQLB 3INRA 2JFUA 1F6WA 2VWQA 3HBLA 1PS0A 5HS6A 2R97A 3HOXI 1CY1A 2IQIA 4Q9AA 4BX0A 2XUJA 4J2TA 2EV9A 1AV7A 3A10A 1ZJJA 4I4NA 2CL6X 2HA4A 4QASA 3SR4A 3KQLA 3A70A 4OUDA 4DC1A 4L8WB 1GAJA 1KDZA 2IK8A 1WS6A 1GGEA 2IWHA 4C0WA 3GLSA 4DSTA 3W1VA 1CERA 3HYNA 3PFNA 3N8DA 3LNTA 3TFOA 4DLLA 3RYHB 2GN2A 2JLUA 4J16A 3ZCUA 4ZVUA 1DAFA 2C54A 5JSFA 1LRLA 3GRCA 1GZ4A 2B69A 4AZWA 1X9GA 3GN1A 3DFUA 4CUJA 5CFNA 5AHXA 1BJTA 3T5AA 1VA5A 2JJYA 4KZPA 1KKLA 1VI2A 4NNPA 1LDGA 3F6RA 3ON5A 2IEGA 4BQOA 1ZWKA 2HQRA 4RE5A 1NBWB 4BV9A 1OWLA 4Y1EA 3T3EA 2SCUA 2W8BB 1BU8A 4HAWA 1NIPA 2C4HA 1Z5ZA 4PPQA 1O97C 4QWWA 5FL7D 1I2MA 1TD1A 2DG2A 1CJMA 1ZK2A 2YY7A 4H4DA 3EJWA 4Q00A 2J3MA 2WTXA 3EVNA 3NFZA 1CE8B 4PQEA 4ARSA 3MM4A 4MI3A 3N8GA 1E5XA 2PD4A 1U28A 2QLVB 2YZ7A 1Q1GA 3GJ0A 2C31A 3JRWA 4QDUA 4MW7A 1HDIA 1D4AA 2ZUBA 1ZGAA 3ZGZA 4BIMA 1A8HA 2J6BA 4GEKA 4UPVA 3A4TA 2AQ8A 4CETA 2AL7A 3AOEA 3HB0A 4IUDS 4AG5A 2RD2A 1HM5A 1LW6E 5FJJA 2ZR7A 3FGPA 1GCOA 1KI4A 1FK8A 1NL3A 2HWYA 4MUBA 2VZEA 5MF6A 1MJGA 3IUSA 5KTPA 4LMAA 2QY6A 1U7DA 1JDBB 2DUUA 5B7PA 1P7VA 2Y1XA 5DRYA 4DHEA 4NK4A 3D7NA 1WW8A 1Y1TA 3HU3A 2F8MA 2IEAA 3ISJA 3P26A 4RM2A 4WN9A 1JWLA 5C3EI 2YTZA 1XDSA 1QUFA 3R09A 5DYYA 4X3OA 4Q15A 5EIBD 3ZQKA 3FHJA 3AKEA 2ZYVX 1U80A 3EISA 3T95A 1C3JA 4OMFG 1E3QA 2MSDB 1OU4A 1XN1A 3UAVA 1HNZB 1RI2A 1NVEA 1RYDA 5J5VA 4NYMR 3SYLA 4BTLA 5A3QA 1X3ZA 1RBZA 3HJRA 3KZXA 3NH6A 4H1UA 2PJUA 3WRYA 4POOA 3O0DA 5ALZA 1U7OA 2VPPA 3EQ8A 2LV8A 2RAUA 3R5HA 3SZLA 5G0VA 1J33A 1YJQA 4DY6A 3V4RA 1F8YA 4J29A 4ON9A 1QFJA 5KQMA 3E05A 4BGUA 1QP8A 5SZIA 3AEUA 1QLWA 4NHOA 2F8TA 1KMMA 1EFPA 2PRYA 3TRJA 4ZI7A 1L8XA 3UW3A 1QKJA 4DILA 1EFTA 3G9UA 3H4MA 1QS0A 5GGXA 3PVCA 5FX2A 3FOFC 4G8DA 1ORWA 1NVVR 2GJ4A 1NU6A 3H7AA 3PC6A 3PQ4A 4JYMA 4OXIA 4WNCA 2ZYUX 2IZ5A 4U7DA 5DXFA 3WV5A 4K9OA 2WT9A 3DWIA 1YFJA 3FMIA 1DIHA 1KFBB 4OUKX 2HC9A 1K6XA 3U49A 3WNDA 3ZDFA 5BMVB 3O8OB 1SCKA 1FYDA 1K06A 1AB6A 4C22A 4N3GA 4R2MA 1SKUA 3PITA 4YI3A 1MGPA 2WJ3A 4R1QA 4UHHA 4YRGA 2I4OA 4C5BA 4ZO4A 3R4CA 1R8JA 5EE5B 1GADO 2LE0A 2FXVA 1VMIA 3IHLA 3HM2A 3EGOA 3O1JC 1YCHA 4AC9A 4UC0A 5AJVB 3ROKA 5L3SA 2FR8A 2D5LA 1HDRA 1SIBE 2PZKA 4H7IA 2BM1A 1V37A 4RLHA 1KFKB 4C7JA 2FLVA 3FF4A 3PNQA 3DUFB 5CM2M 5TMDA 1AC5A 3BH7A 3ECAA 4R3WA 4AN1A 1WB4A 1RJ9A 2COUA 2IQ5A 1XD2A 4OD0A 4RHCA 5B3AA 3EPPA 1TF2A 2I62A 4H3SA 4IHAA 4F12A 5K4HA 2H5JA 3LBAA 4BNYA 3HWRA 3CVXA 3S2DI 1YFKA 1K08A 3HDQA 2X9QA 2CDCA 2WFMA 1R4ZA 2AD1A 1PT9A 1NG9A 3I28A 4JD5A 4XM2A 2H1LA 2DECA 4LZOA 3KLMX 5AJXA 4CDGA 4HNRA 4MWBA 3A1UA 2CLOB 2E89A 2I71A 2W6JD 4BBSI 1OLUB 1JSRA 1QAQA 2JFXA 3GPIA 2FRVA 4NJMB 1P0QA 4O1IA 4ALMA 5C3MA 2PRKA 2P78A 5IDVA 3IKVA 1YS2X 4UM5A 4X1KA 3FNIA 2AKLA 3BWVA 7MDHA 4JQYA 4CMIA 1XD9A 2IHJA 3CSSA 2WJVA 5LB4A 1WLSA 4ZVTA 4RELA 3E7FA 3PSHA 4D96A 3KSAC 3ZBPA 2XXJA 3ZJ5A 1TQHA 2V9PA 1Z63A 1J0XO 3BRWD 3BK7A 1XZDA 3DMNA 2Y9PB 1PBTA 4MGHA 1JJ7A 1EVLA 1XC7A 3BIOA 3FDZB 4AJNA 2MJLA 1ULTA 3JQAB 3EX7C 2SKCA 4U9HS 3BWXA 3QELA 3QRWA 1S9HA 1T4BA 4JELA 4P34A 4R71A 1YIT1 3LXXA 1RC8A 3CR8A 4R2XA 4LXGA 4QYXA 5FLXb 1XDGA 3L41A 1C7RA 1HE4A 3UJ6A 3W79A 4C7OA 1CV2A 4MQEB 5BXQC 1GL6A 2F3QA 3WHPA 2WUWE 2I4MA 3FNHA 3QNMA 1PZMA 5I4CA 1OFTA 2V3CC 1E62A 1IOVA 2OD7A 4TYQA 5AKEA 5LXTB 2JFWA 3N75A 1RAHA 2VTVA 4IICA 4UZFA 3MQ4A 1Q14A 2E4YA 3IHKA 4MDYA 4C7KA 5AM3A 3NTLA 1AKYA 2GO1A 4BXOB 1JEAA 2OUIA 3DVAB 4BEJA 5BY2A 2QMQA 3OZEA 2PZEA 3V33A 1A9XB 1N1DA 2GERA 3AF3A 4UDYX 4QHSA 3ZIUA 3I6BA 4BE9A 4CYMA 2RGWA 1TZCA 4PLPA 4YO7A 1WD7A 1KRXA 3DBLB 4KGVA 2GZMA 4ZAWA 1ZUNA 3NIFB 3CF4A 3ZXYA 4WMLA 3C43A 1GLVA 1KAEA 2QPTA 3BD8A 4TTQA 3ZV7A 2YIDA 2BEWB 1H3FA 3UK2A 2A0XA 1CD5A 4TSRA 5DXJA 4HG2A 4Z9FA 4BNXA 1T8RA 2WKQA 1C1DA 1DC5A 1Q7TA 1W4LA 5FI1B 5JD4A 3QX3A 3GZNA 5DGDA 5JDCC 1E3JA 3EEIA 3TECE 4ZT2A 1XNQB 2K7ZA 3HWX1 4FS8A 1L5FA 3FDIA 2II6A 3R7WB 2Z09A 1TJPB 1GR0A 3TE6A 1NXTA 3NBFA 1U9IC 4A27A 5FTJA 3AEYA 4WEQA 4XOUA 4AO7A 1MVLA 3CXCZ 1IE3A 1O6FA 4DIKA 1ZN2A 1CVIA 1AO3A 2P1DA 2VUMI 5LP6F 1Z18A 4N6GA 1K8ZB 3GFTA 4FNGA 4WCFC 4HDSA 5E6RA 4ARZA 1G5TA 3DOJA 2DFKB 1VG1A 2HJVA 1T2UA 3Q12A 4NB8A 4MVJG 2QLLA 3HJTA 3WSVA 2CSUA 3K9FC 4B9EA 2TYSB 3HC7A 3NTUA 3OOEA 3WZ2A 4ZI7F 1IVSA 1IXRC 2W11A 4NFSA 1J1ZA 2BL4A 3NM5A 4I36A 3IODA 4NBWA 3GVXA 1WPRA 2GPBA 3WIEA 4HUQB 821PA 3F8TA 2LIVA 3CS3A 3AP3A 2FI1A 2W2TA 3A3OA 4LC1A 4N7BA 5G1NA 4R6XA 1E3DA 1W73A 2B1RA 3ELYA 5T57A 1W94A 3U2QA 2HB6A 1PKEA 4M7WA 1XZ8A 2WV9A 5IDWA 2D5IA 1T1JA 3VR3D 3M9LA 4DL9A 1ORDA 2EW8A 2HF1A 2X6QA 4TL6A 5HRCA 2X5NA 3G2HA 2R4QA 4F5EA 4QT4A 2FDXA 1DAEA 3MHPA 5IEBA 4OAPA 5G4KA 1EXNA 2AW3A 1WCIA 2VBCA 2VF7A 3IAAA 3UMMA 3SSOA 1BH6A 1PG2A 1SK9A 3IOMA 5AKJA 4COKA 4KLCA 3QX9A 3A3YA 1N25A 2G9UA 3RHSA 2COEA 721PA 2Z6VA 4RL4A 1L4BA 4UCFA 3ZE6A 3HO1A 4GBJA 1UEXC 2O3SA 3RJMA 3VV2A 3WHIA 1ZGZA 3HWSA 5FTNA 5TQ2B 1MAHA 2ZGVA 1OV4A 3CF2A 3ADOA 1P77A 3QE9Y 1CJVC 3BXEA 3ZGNA 2DBYA 3RJ9A 3C2QA 3HDJA 2AMFA 4X95A 4BAZA 5HKOA 1E63A 1GD1O 4X0EA 4HOYA 5IASA 4AYBA 2WF8A 5JZSA 2OTL1 1AY0A 4P93A 3IAHA 3R9WA 4I3HA 5AJZA 1G42A 3PO2I 1KI7A 1QX3A 3GA5A 2XRMA 1GSHA 1MKYA 1DQZA 4Q12A 3WLSA 1HFKA 2J4FA 2RHWA 4A10A 4X90A 1XRQA 4GLBA 5CVVA 5AKIA 5JAOA 5EXDA 5K05A 2FZ5A 1EG2A 2G8LA 3NP7A 3MERA 5DF1A 5DO9A 2H9AA 1L5NA 4LXIA 1QYCA 4WESB 3NIBA 4L3OA 5L95A 1SUPA 3IFUA 4MV1A 1JHAA 1X92A 2BGTA 4DR3B 3Q5EA 3PNOA 1PS9A 2BKAA 3NEPX 4CG0A 4WXPA 4L0QA 5EJ4A 3L84A 4UOZA 2C82A 3FI9A 3B1JA 4BQRA 2OG2A 3CG4A 4P4NA 4PY2A 4B35A 1UOOA 1LK5A 3EE6A 3DMPA 2K7FA 2J30A 1Z38A 2LVBA 3DEFA 4MKZA 3NV9A 1TQ6A 5ALSA 2YNMD 4K9NA 4TS9A 1AHPA 4ONEA 5KTYA 4A5SA 3G3EA 5KNLA 2GFHA 1UFVA 1NZFA 1JTEA 2IYFA 2OQVA 2O0JA 1AXRA 1JHDA 1SOAA 3IRUA 5A0VA 3H97A 2Z95A 2C7VA 3M70A 1KBZA 4Q1DA 3IDZA 5EHZA 5JEDA 3RRBA 1R88A 1R0SA 3B1WA 1XCPA 4MYHA 2RE8A 1XHFA 2EL9A 4E51A 4ETNA 4RQTA 3OZFA 4WINA 1XJQA 2ICAA 1HDYA 1RJGA 2H17A 3UJHA 3VC7A 1R5OA 4O1MA 4QNRA 4C4TA 3D7MA 2WMNB 4ZCTA 1HZJA 2H4XA 1IC6A 1MW9X 2W5UA 4TQAA 3WSWA 5IYZB 3FPEA 5K7SA 5K8LA 1UKZA 3P9YA 1II9A 1D2AA 4DM4A 4C30A 1MHTA 4EI9A 3FLAA 3K9QO 3J7AC 1Y1VS 4JEMA 5LKRA 1FLNA 2GN0A 3N6RA 2GEJA 1GGMA 2CFIA 3Q2IA 5B7GA 3ICCA 4J0KA 1SCUA 1UFQA 4U7TB 5AKGA 1I94B 2YVUA 4D4HA 2C7RA 3DFMA 4JU9A 4B1FA 3HWWA 4I3FA 4NY1A 1T43A 3B38A 4M36A 4XFDA 5K3FB 4AJ2A 2D7JA 1RS0A 3EBOA 5I7FA 1E5TA 4XX0A 5K0SA 4YY3B 1GYPA 3HQ4O 4X60A 2PM8A 1PIWA 5F5LA 3DFZA 3RW9A 1TWAI 2VJDA 1HYGA 2BJWA 1K3FA 1DEAA 3F7TA 4R2HA 3V7YA 1P9RA 1O95A 2C98A 3SOPA 4IINA 2I22A 3E1SA 1YE5A 1C4KA 4YXWA 1EVZA 2I6FA 1USUA 3ILHA 4EIWA 1QIFA 221PA 2MSEB 3PFCA 3VH1A 1A2QA 2JLQA 3H9BA 5EKSA 2XR1A 1TDJA 1HG0A 5AJWA 4LK3A 3TGWA 1GXSA 5H80A 4BY7I 5CH8A 4I4TA 3UC5A 2QSZA 2IV7A 2BY4A 3M1LA 3TXYA 3LLVA 2PMWB 3P1JA 1OZFA 1HDOA 5LA6A 2JGKA 2GXQA 1X80A 4E4RA 5C8YB 3H65A 4MCHA 3S99A 2ZEJA 4RA9B 3TAHA 3HCBA 1FP4A 2OHJA 4P81A 2X2FA 4K5QA 3X1ZA 5FHQA 2OFWA 3NTOA 4YPFA 3DEKA 1OASA 2Z5VA 4JXZA 1R2QA 2QQGA 1LV8A 3ISTA 4M76B 4J94A 3GNTA 2OB2A 5HRAA 1PT6A 1UXIA 4PSVA 4MLZA 2JLYA 2QD4A 10MHA 1OIWA 5C44I 3T94A 1YBMA 3M1IA 4MB2A 3BB3A 3QBVA 1B1AA 3I5YA 2KW5A 1AE1A 4P84A 5I01A 4OHVA 3QF7A 3OKCA 2C57A 3K15A 2HMUA 5INTA 2UVPB 3CCJ1 3RRZA 3OPYI 3VPCA 3NOQA 4HH4A 1KBQA 5E1BA 1P4HA 4JUIA 4DF3A 3HHEA 4EO9A 4FM9A 2IP1A 2X8BA 2NVXI 3O8DA 3TTVA 3EXFA 3TL3A 5LN1A 4KN6A 4TVBA 1M1YA 3KJFA 1BFKA 1SUSA 3I2GA 4RQAA 1KYXA 5EUMA 5HQJA 3DV0A 1NX9A 2FSPA 4KDCA 4OGFA 5GINE 3QPAA 4K26A 3W5HA 2QA5A 2VF4X 3EZXA 3LTEA 4LXYA 1N2SA 4BVLA 4N0EA 5DYWA 1OB2A 4LSGA 4L3VA 1NPDA 2YNMC 3ZDXB 2JJ1D 4ISCA 3UGJA 1Y3AA 2X0EA 3EARA 1E2KA 4V02A 1IBSA 2M9MA 2WMYA 3I42A 3VPBA 4ZHQB 2Y6VA 3QXGA 4QT0A 5GJWC 4BQEA 2Z2ZA 1LY1A 1UBRS 2NO4A 2CD9A 5H1YA 3IEIA 2GAJA 3ZE7A 2O1EA 4TTAA 1ZMRA 5UKDA 3ETJA 1G55A 4NZOA 1A98A 3BFPA 4OAOA 1M1ZA 5B12A 2ZJBA 4BRUA 2ZIVB 5KOHB 2GXSA 1V71A 2E4XA 2RG1A 1DJOA 1GUYA 3IIIA 4JSRA 4PG5A 1N7HA 2P9HA 2VP2A 4GPBA 2V7PA 5AJUA 5E2AA 4J4TA 1FL9A 5L45A 3BC1A 1U9ZA 3AEKB 3VTZA 4DCCA 2OV3A 2C7GA 1ETUA 5JRZA 4N41A 1JZQA 1Q3KA 4QQFA 1QVGZ 4Y2YA 3ZHRA 1NNUA 2W2LA 2HK7A 3FCOA 1RBMA 2EERA 1Y9ZA 2QX6A 3Q0EA 1KD11 2FHSA 3SSNA 1OYYA 1TLTA 2OK7A 2VYVD 4CIYA 1TAGA 1U4NA 3P0FA 3P5BA 5TR9A 3HJNA 4HT3B 1O8BA 3H2YA 3NQ41 4KP7A 3ZIDA 4GE3A 1ZH1A 5ELXA 1OREA 1YDFA 5DV9A 4G5QA 1UBNA 1VZ3A 1GRNA 1Q19A 3RZDI 1XAGA 3A1CA 3O82A 4K2HA 2ZZMA 3NZEA 1OBVA 2W0SA 1DUVG 1CP2A 5BQPA 1XB2A 1SULA 3PWZA 4O2LA 5LM3A 3ZDDA 4Q21A 2ZB3A 2BKVA 3D5TA 4LRUA 1NR1A 3OPYA 5IHPA 5JW6A 1VKRA 2FZGA 3F97A 3WLMA 4PN7A 3EERA 3K30A 1NY5A 3OWXA 2MYTA 2D5BA 3AERA 3OJEA 2FSVA 5CT8A 4EDHA 1T5BA 2VDQB 1TC2A 1YDGA 3PPVA 4C08A 4OQXA 5K45A 2XH8A 3IX7A 1RWXA 2BKXA 1YB1A 2NVOA 5BW6B 4JOSA 4XQGA 4AY4A 5JNLA 4KW7A 3SQOA 3CG0A 3KKOA 4KO2S 1EINA 3O4HA 3LI2A 3B5JA 3QSYA 3VKGA 1Y0BA 2DPHA 3PKIA 5ALNA 2IEYA 4W99A 2PT6A 4PYNA 3HBJA 5DDIP 3TNLA 3NGXA 4QYIB 1QHGA 4JP3A 4ZRDA 3ZHSA 2ZI7A 4EVSA 2IOFK 1GQQA 4G5RA 5T3YA 4PLFA 4K7JA 3SHVA 2AWOA 5I9NA 1GTMA 3KBOA 3K0BA 3OBIA 4TV9A 5F2NA 2B5VA 3HN7A 2EL7A 1XQXA 3ZKWB 4OI0A 3GP3A 4JHXA 4LZNA 3WGZA 1KRHA 1SMKA 5DGCA 2P2CA 4I4TF 4B3HA 4C2BA 1GA1A 1M74A 3ZCQA 3QENA 5EHNA 2OFPA 5LA6F 1DO8A 2CC2A 2EG5A 4MJXA 1GZ6A 3U4CA 2D4AA 2O2IA 3LWBA 1TIPA 5IP7I 5LZ8A 4JR2A 2BV3A 2GCOB 3ETDA 4DZZA 1CRQA 3IBSA 2O9JA 1SOUA 3FPCA 3ZQ4A 4DQUA 2EIXA 3D1VA 5JCZA 2MINA 1T3SA 1ZNQO 3E84A 4CR6A 4C88A 4ESVA 1A72A 2QBYA 2CLIB 3SXPA 2H1WA 1L4GA 5TQJA 2C2ZA 4B5LA 1IXKA 2JHGA 4BFLA 5F35A 4F8YA 4US1R 1SG0A 2QE7A 4GFDA 4HZUB 3NHAA 1VQN1 3FYHA 1PJQA 4L74A 5I9BA 3OD1A 2IELA 1CJBA 2H31A 1H23A 2C1EA 3F6CA 3B48A 4R8MA 1QE5A 1P7ZA 3OEHD 2AQKA 3QKIA 4X1IA 3NAGA 1GQYA 2VOEA 2SECE 3MBOA 4BMYA 3OZRA 5JV5A 1GQFA 1W48A 2Q2VA 5JJIA 2JGAA 5B6IA 2P8JA 3GLGA 1FVFA 1BDIA 5A5GA 3E9RA 4RNDB 2Y76A 3CNHA 1RHRA 4MRSA 2J5RA 3VTNA 1XNHA 4WVFA 3ZY3A 3SX0A 3LQ2A 1B93A 2H0QA 2X9VA 3OA0A 3LHSA 4CKEA 2DHEA 1Z0SA 3BYZA 4XGNA 3BBPA 4XASA 2LFUA 2BGMA 4ZALA 4A16A 4Q3BA 4W5JA 1NBOA 5D3MA 3TQSA 4QM6A 1H2ZA 3VR4D 4XKJA 4BX8A 2J3HA 4ZK2A 2H06A 3LUFA 1OT3A 2BUCA 3AUFA 4RLFA 3UGQA 5U9CA 5KOYA 3QYFA 3FYUC 4FYYA 2G0TA 5BNTA 2M1ZA 2ZIXA 2F43A 5BURA 2PWYA 5E0OA 3EEYA 2RARA 4UVHA 1OPXA 3WIUA 4INAA 2IZOA 2WU3A 2D59A 2G6BA 1Y3HA 3FLMA 4RESA 4AF6A 3TW0A 2IGBA 1L8OA 2OOKA 1S3GA 4GSLA 4DB4A 3NKLA 1SZPA 3GV0A 1DKRA 2HCTA 4CKCA 4IJKA 4MKGA 1SCBA 5CM9C 4EATA 1RW4A 5ER6A 1R27A 2V7XA 2ZE7A 3NONA 3LBNA 3LQRA 4PLVA 3WLEA 2N75A 4Q3OA 3PHJA 4CMJA 3IQIX 3GJ5A 4AFNA 1U3DA 4HNUA 2HBYA 3BWBA 3GUCA 3LRXA 1V3QE 4OUDB 4DNQA 2J4CA 1TZBA 2C5EA 2O23A 3OQBA 1ONSA 2B9VA 3TRKA 4PN3A 1Z6YA 3K4QA 5B37A 3RS0A 3RU9A 3UMVA 3D7LA 4C5AA 1QRUA 1YZUA 4HDNA 1YQWA 3B7GA 1NXSA 3O1LA 2RB5A 4Q18A 4ZVVA 3W1EA 4B73A 5LBTA 1VGQA 4TXMA 1YIDA 4XQ9A 1GY8A 4RTPA 3ZD7A 1E2BA 4AKHA 4JP1A 1PFGA 1NJ5A 2H4ZA 4LXTA 3G59A 3JAMA 5G40A 3KZCA 2Q0HA 3ZVNA 2QXUA 4G6ZA 4MW6A 4Q7MB 3H0GI 1YI2Z 4DA7A 1WUIS 1TXGA 3OM9A 2QKDA 3AOGA 2HHCA 1CW2B 4E2WA 2X0JA 4P1ZA 5JZBA 4IS2A 1XTKA 2I7XA 2PUHA 1ILWA 2VJPA 4R68A 2B8WA 1RXSA 4UUNA 3G9QA 3FHLA 4B0OA 4R31A 1P80A 2UYQA 1PJRA 1J99A 3V1LA 1G2OA 3WIVA 5IXJA 2YJ5A 2I8AA 1T5TA 1SPXA 1CQXA 1GHTA 1FU4A 3B3GA 3MZ0A 3KQPA 3UJNA 1XZBA 4TLEA 2QGZA 2FEMA 5KTKA 3OE7A 3H4IA 3AQIA 3FSGA 3FUUA 4OQLA 4V0KA 5L3ZA 2GN6A 1U9JA 2NWQA 3LDHA 2GVZC 2EJVA 5TE9A 1HE1C 5I8PA 1Y6RA 3KT3A 3FOZA 3OC6A 2Q21A 4YJGA 4A3DI 1VQ7Z 3UMJA 3W9UA 5ELLA 4FFBA 4UEOA 4DV1B 1KEPA 1WCV1 1JAHA 2HEIA 3K92A 2D1YA 2EKDA 3Q7IA 2BCGY 2XZTA 3F3YA 4UULA 2P0YA 2BKEA 2N9UA 3UK6A 1B42A 3VVCA 3SOZA 2PT9A 1LCIA 1L5KA 4CV1A 1DFGA 3AG5A 1NM5C 4N6OA 4S1WA 3L8YA 3ZZUA 3L46A 4CF7A 1QWOA 5CNIA 4JXJA 4MW5A 2RH8A 3C3CA 5HCUA 3QM1A 1XRPA 4HI0E 2QX7A 3IE1A 5HDQA 4LSZA 1F51E 3CNEA 3R8XA 1JHQA 3PHCA 2R6JA 5IN4A 2ZVQX 4QBGB 3K73O 5DM4A 4OYLA 1PL7A 1UWVA 3EUWA 4YAIA 4C1NA 5F78A 4MCJA 4C9BA 4FIDA 1KNQA 5JRJA 5D7NA 1YDWA 4AIRA 5LP6B 3TX2A 3LUPA 2FFBA 5JO0A 1IXSB 5ICFA 4U2EA 1SRQA 3SM3A 3E2MA 4A6XA 5DB4A 2XUQA 2RGEA 3DTVA 2WY2D 5DWVA 3AVQA 3GPDG 4MO2A 2YXBA 3BKXA 2OFOA 2R11A 1G0OA 4UE2A 3RM3A 3M34A 2NQTA 3FPAA 4F56A 3A58B 4ZI7B 2IU6A 3R7FA 1L7NA 3VZSA 1ZL2A 1QS0B 4HX2A 3AVXA 2GCNA 4OQZA 5FCDA 1DEKA 1V1MB 1W0JD 3GMTA 3G2OA 1E60A 3B1FA 1NLUA 4D02A 4ZYLA 1G38A 5CG1A 1O94D 2C3YA 5HF6A 2V8KA 1MB2A 1OQAA 2WVHA 1R0LA 1TJ5A 5MN6A 3F5MA 1FTYA 4FIZA 4IOLA 4D80A 3TG2A 4DZRA 4KUGA 3VNAA 4X6XA 3LGSA 1AH2A 4EKGA 3ZH9B 5JCOA 1SKYE 4RANA 1AUXA 1BRTA 2UZ1A 2DBQA 4JSYA 2JGLA 5L3SB 2DR3A 1AQYA 3HDHA 3V42A 1TEXA 1QKIA 1D4OA 1ST2A 3OZXA 5CDGA 1ISPA 5ALVA 2AXEA 2NTEA 2F9FA 1RWKA 3LWDA 3MTJA 4I50A 1RJWA 2CHEA 1QYXA 1RJ9B 3ZWCA 1VBKA 4KQ6A 3ZCRA 4DV7B 3C48A 1C41A 3EASA 1COZA 2B83A 2IIVA 4HTFB 3OO1A 4D0GA 4RKYA 1YL7A 2TSYB 3HI4A 4YRMA 3EA0A 4J3NA 1MABB 3GUHA 4WOPA 3LUBA 3U7HB 3IKJA 4IPTA 2GQ0A 2QRGA 1RYYA 4FEGA 1C7ZA 4UU1A 4UBLA 1E6KA 2Z4RA 2G6TA 2AQHA 4X1KB 3L4SO 4J03A 1BDJA 4D98A 4F9GA 3HR4A 3VHLB 4JB3A 4J1QA 1YI0A 4HMQA 2EQAA 1NT2A 2NSDA 2YJZA 4MJLA 2BMFA 4YCBA 4HVAA 5AK4A 4LYEA 2I7TA 4BNMA 2ODAA 4QLOA 4KREA 2HJHA 3K94A 1KZ9A 3X2SA 1WF3A 1W34A 2IHZA 3CY6A 3QPBA 3OY2A 5FP0A 4HTAA 1CTQA 1I2DA 4YASA 5BR7A 4KR6A 1Y7IA 2JBWA 1WV1A 2Q6OA 3I45A 1ENYA 2WG1A 3K9BA 4LG1A 4XM1A 4BQNA 4V38A 3PEEA 4DCOA 3D6TB 1GM5A 1JIJA 1X1SA 1VPLA 5BYKA 2VTEA 4V0MA 1LQUA 1E2PA 3ICPA 2BE7A 1DKQA 1WIWA 3PDWA 4GS5A 3JYOA 2ODQA 2QTVA 1DBIA 1U8TA 1FFAA 4MVJH 1EUDB 3BQNB 3C3JA 3A9SA 2QIOA 2ZRPA 5EKXA 2I33A 4Z5XA 4NICA 4P7JA 4XD7D 4TTRA 3BM5A 4AWXA 4R0MA 2L69A 1ZH8A 1KKMA 2Q4OA 4J4HA 4P3PA 3EG5A 3NYQA 4LZLA 5B55A 2C5AA 2O5EA 1ZH2A 1G3QA 3OTQA 4HQOA 2DU8A 3AU9A 4RD6A 4B79A 3F3MA 2DR0A 5TXGA 1O9GA 3INNA 4BWVA 1Q3HA 1NBEA 4OKSA 3A6HA 1NJI1 1VE1A 4UD2A 3NO4A 3TSYA 4YLYA 3UGTA 3GCDA 4O6VA 4BFUA 3ZWXA 1UXHA 3S6JA 1W46A 3BCSA 3PGLA 2N42A 1VIVA 3BGSA 4IOJA 5A2GA 2VPXA 2BDEA 2I2AA 1KQOA 1TRHA 1ODFA 3QXJA 1C7EA 5EIAA 2CXRA 3HI6A 1RIFA 3DQPA 2PL3A 3QXHA 2LW7A 1ZUNB 3KXPA 1M76A 4J7XA 1IPEA 4ZK6A 1NSYA 5JSZB 1GWNA 3EULA 4IUCS 4U1RA 1A8UA 3HBAA 3TRFA 4DXAA 1J0CA 5D7BA 2FYTA 3IQGX 1TFUA 2GWHA 3DBRB 4J7AA 4LYJA 2BTQA 3F2IA 3V6LA 4DN6A 1VCHA 3LDGA 3S5JA 1XWFA 1OXKB 3EFBA 4R7ZA 1KYIA 3PE6A 1M34A 5DNCA 1S2NA 1GZ5A 3V00A 2RGCA 4KQ2A 2Y0SA 2GHIA 4PZLA 4CM9A 3ANMA 4OHBA 4WQMA 5A5DA 1WAMA 1QDUA 2GRAA 5HE8A 3T9CA 2IYXA 5HXAA 3IMCA 2H7CA 2MSCB 2TMYA 4PGFA 4GI7A 3BJZA 2C99A 1TWHI 2G5TA 3MJSA 4NCHA 4NPHA 4Q9IA 4P22A 5JJLA 1MEEA 3MCVA 4JHLA 5FI3A 1F9AA 3U7RA 4DJEC 1YBFA 2HO5A 3AWIA 2OXTA 1DIGA 5E6RB 4ARZB 5BN3B 2ZBUA 5BVHA 2YIMA 3DT9A 1XCBA 1GEEA 1OC4A 1XKTA 5T6MA 2RI1A 2E2II 1RWNA 4EB6A 1Q2XA 3FRIA 2DY1A 3LL4A 3TEJA 2A1TS 1FFCA 2VDNB 2VDMB 1PR2A 3OTHA 4RAQA 4B6RA 4E5NA 1DHRA 4A0HA 1DRKA 1UWCA 4B84A 5CDSA 5C5IA 5DBIA 3RASA 1LBTA 4D3DA 3NTVA 5KHAA 2VHUA 5U1PA 2NO7A 3TGPA 1E7YA 3KFXA 4HN2A 1RD4A 3KR1A 2FW1A 4HUTA 3CTPA 2ZYRA 4C2AA 4F4CA 1FRZA 3ABRB 4LY3A 2QTAA 3IJPA 4PLZA 3SSMA 3IJ5A 5B1IA 2M6KA 1I3CA 1QBKC 3DMTA 4DSNA 5FUMA 2H2DA 3NBXX 5IBPA 3WBJA 1R0WA 3ZQ6A 5H70A 5HJ7A 5G4KB 4KFCA 1RZ3A 1UJ2A 1W29A 1BRMA 3K7AI 2CBXA 3CCBA 5F12A 1T0HB 4AZ3A 4EI7A 3OPQA 3EAFA 4CMGA 2BR5A 1V7QA 3BXGA 1FQOA 4DNPA 1F3LA 1YMUA 1TCAA 2F4NA 3C3EA 3GU3A 3VPSA 5AIBA 3GH1A 4I50F 1CVRA 1KY2A 1VLQA 3C15C 4X41A 2VT3A 2NZJA 4DIEA 1RR6A 2C88A 1ENPA 4BVGA 5A6VA 1BIFA 1IBCA 4FR5A 4LV5B 1ZN8A 2QZJA 1P0CA 3WGUA 1UK9A 5F51A 1XRLA 3O4JA 4OMCA 2R751 4XGQA 2XGGA 4BDSA 1NKSA 1QOPB 5DYGA 1PS8A 2IEBA 3EN0A 4QUBA 4RF3A 1QP7A 1PEDA 1T25A 1EQ2A 3RDPA 4E07A 3X3HA 2IHVA 1I9CA 4U2FA 3IR7A 2OFXA 5E8JA 2DLDA 3WRXC 4XFKA 4JEIA 4ZP1A 4C89A 2E2HI 3DDNA 2VHQA 3TYXA 1IHOA 5JDIA 2JFHA 3OECA 3AV0B 4AB1A 3HVRA 1KJYA 3WRWA 1KY4A 4DQKA 4BVFA 3WLPA 1Z4NA 3M8KA 2UDPA 3DXFA 2PX2A 4HFRA 1YK0A 4TT3A 2GYUA 4LQ4A 1RQ7A 1YZVA 5F73A 2NYVA 3WMEA 2PE5A 1GNTA 1DUSA 2AG1A 1XV5A 1MHPA 3G6KA 3VNUA 2ZBVA 3R7AA 2YWXA 1WSDA 1K3UB 2IL1A 3DO8A 3KX2A 4FYXA 4ZIRA 2WWGA 4LNUA 5IUNC 2R7AA 2X4DA 3ECCA 4URWR 4C03A 3W5DA 3EPLA 2KPIA 3ZE2B 1P4AA 1DOZA 1G17A 1XZGA 3QEMB 1YZNA 2IWRA 1Q11A 3ZH2A 3FQMA 3JQRA 1QYDA 3R9IA 1CZHA 5CFLA 1X19A 2YR0A 2C7BA 2IZ0A 5HW0A 3K9NA 4MARA 4JYCA 4RM3A 3LMKA 4U6SA 5AK6A 5GONA 5J4VA 2B1IA 4JS0A 5ALTA 4CFYA 4ZEVA 2PPVA 1EH5A 4NAHA 3EODA 4UXJA 5HTKA 1VJTA 4L4XA 5JBIA 5IT0A 3S2YA 2ZVPX 2YY5A 1MTOA 3G0HA 5KOIA 4W7HA 2V4UA 3G2QA 1HT3A 1KDYA 4EG8A 4J16C 3PQ7A 4EG4A 1XCGB 2BFCB 5AKXA 2VF2A 2JGDB 4RS4A 1NZDA 3B6MA 2DLNA 3G23A 3E5MA 3X1MA 3OQHA 4Q7EA 5EWMA 2QSUA 4OM7A 4NEHB 2XBLA 1H1DA 4Q4CA 3QOWA 1TTPB 2XCIA 1JH8A 2IODA 3MGKA 5EXEA 3AL0C 1W87A 4D9FA 5IKOA 5E3HA 1C9YA 5CT4A 4IIXA 2UU9B 1W5SA 2QPOA 4FK8A 2XTJA 1JDJA 1UH5A 4IQFA 4ZPXA 1GUBA 5AW2A 1IN7A 3TEFA 4GXRA 5JAHA 5G02A 1U2TA 4EL0A 2P4QA 4Z7OB 2MSLA 4C4RA 1DKNA 2Q4BA 1TWFI 3PZBA 3NPMA 1KQNA 3TRIA 3LZCA 4I5IA 1ZBQA 4ID3A 5AVYA 3PDIA 1U28C 3EDMA 4MH0R 4DLYA 3F4LA 2FG6C 3MTBA 1H5NA 3A9TA 4KVZA 3KFLA 2XLBA 2IXTA 2NYAA 2R7LA 4HBZA 2CL5A 1KTVA 2R60A 3CF4G 3HXKA 4JUDX 3ET5A 1RZUA 1W1IA 2X7HA 4CIBA 2VBGA 1Q861 3LYHA 4EVQA 4ZMBA 3AOEC 1UR5A 5DPMA 2H92A 3K0AB 2VUTA 1O4VA 3O9MA 4JL5A 4NDZA 2AK2A 1MXFA 1T6BY 4H60A 3ICQB 1PJTA 5HKKA 1BMQA 1UKAA 2B6NA 3HU2A 4NP6A 3U3RA 4ILKA 1CQIA 3FGZA 3SP1A 2ONKA 3WDMA 2JAHA 2Q1WA 1SKAA 3BMQB 5KNBH 5FBLB 5KPDA 2JIQA 2CMGA 1RXYA 3Q8LA 2XQVA 3H83A 4I4TB 2IP4A 2JH3A 1FNNA 1RPNA 1AQJA 1IJFA 2BMDA 3RUPA 5LA6B 2Z8YA 1N2JA 1G63A 4P58A 1QHIA 5AVTA 1H42A 1X80B 1HETA 2BIFA 2BOVA 1U0FA 2O50A 4J2HA 2PGIA 4U3JA 3AH8A 4JR1A 3VO9A 3M6XA 5HTOA 4X7BA 1Z22A 3QLEA 1D1QA 3U81A 2NXJA 1EQAA 2IX9A 3UK7A 3WRYC 1GZ3A 2XMSA 4WFQA 1NBAA 1NOJA 3LYUA 2IVFA 4MDHA 2B1JA 3AF4A 3IDAA 3MCUA 5IVHA 5HKAA 4W7SA 2VA9A 3HVUA 4JYAB 2YASA 4U8GA 5BNFA 3VC1A 4RCZA 1ZHOA 3L06A 1CZKA 1T35A 2IIPA 3KLNA 4KVGA 5J4HA 5C8VA 2OZVA 3TNJA 4MX8A 2ONJA 2ZYSA 2ZJ3A 2G4CA 3NHMA 4PLCA 4D8XA 1KS2A 3DAOA 4NV0A 3AHFA 4PG8A 4A0SA 4R83A 5KINB 5IJ9A 5TDHA 1PHPA 5G0WA 4AMUA 2ZUFA 1HT1E 5LCXA 2YWCA 1KJ8A 4FCVA 3WYCA 3SICE 4H35A 3HEAA 2JGMA 2NM0A 4JUBA 5H59A 4HDMB 4LFCB 1K3TA 1M1YB 3CUVA 2ZQ5A 2C2WA 4J90A 3PGMA 3DV0B 5EZYF 3ITNA 4ND1A 2O0KA 3IVCA 1E7SA 1DRVA 2DEUA 4WZAE 2JAOA 1DCTA 2D2VA 2XNHA 2FR8C 4WIAA 4XX1A 1FXWA 2EHDA 2TMGA 4OQEA 1N5MA 3VOAA 3JARA 1GG8A 3IOYA 1TYCA 1W49A 3U3ZA 4UHDA 4BNTA 4CKXA 3Q3JB 3FDFA 3FFXA 2G09A 1Z06A 2XDQB 4JUCA 3R4VA 2Q7DA 4YBZA 4IGIA 2AG0A 4H77A 2FG7C 4F8EA 4E46A 2VDVE 4EFDA 3ZZ1A 2JS7A 3NUZA 2YWRA 5EHQA 3NYIA 3Q9NA 1ML3A 2EOAA 1TMGE 3RNOA 1IATA 2JGJA 2PLRA 3G8DA 1GTVA 3MMNA 4LRYA 3HE3A 4UNNA 4WJZA 1SOVA 2XZDA 4B87A 1CPYA 4TTPA 3PTZA 1DKMA 2DE5A 2B4KA 3LKDA 1UXKA 2PLAA 2FDRA 3TTUA 3GP5A 1CZLA 1D1PA 1SK8A 4OA5A 5CT9A 5LQCA 1F0KA 5GONF 2GF0A 3VU8A 4NQZA 4EX7A 1N2XA 5LR6A 1Z5VA 1RHKA 3O38A 1ARZA 4MI1A 1AUVA 1FUKA 2ADMA 1J0DA 3G0GA 2ST1A 3V34A 1DPGA 1QYWA 2X77A 1E4OA 2ZETA 5FO0A 1RYZA 4HAYA 3VBCA 3VUEA 4NG5A 4G5XA 3QYPA 3V2IA 3VU0A 3VR1A 1RRVA 2ID9A 2Q5JA 1DL6A 4LDJA 1JSLA 2RBKA 4KQJA 4GIBA 4M9QA 4ND8B 3ZEAA 2QV0A 1OFUX 4MMYB 4LYFA 1A3CA 2VDWB 2AEMA 2IF0A 4ND3A 5ALOA 5EI5A 1DWQA 2XYRA 3VR4H 3WKBA 5BP7A 5JR3A 5JU6A 2BI7A 4PO8A 5ECGC 4MPTA 1VJCA 4HPWA 1PWYE 1HUQA 2HBZA 4CM5A 3TQHA 4FE3A 4B3FX 2Y4NA 3LCJA 4QX6A 3F5DA 3BVPA 2XNDA 3KOZA 1QO7A 3AONB 3OPYB 5FPHA 3RF7A 2JIMA 3ACCA 4N12A 5K2MA 4BNKA 1FP2A 2QL7A 3TBKA 1I80A 3W8NA 5IP9I 3NWBA 4C20A 3DBHB 4HZGA 1COWA 4KQCA 5L4LA 3O9VA 2YCLA 1ESMA 1FX0B 2SKDA 3P9SA 5K3BA 4L7VA 2HTFA 2EFYA 2PQ2A 3WTBA 5ERXA 4BNIA 1F06A 3GRFA 4A3GI 1FYWA 1RRFA 3L01A 3MW8A 3PXEA 1USPB 2C4NA 3LQ4A 2WE7A 3M0EA 4C4PA 5DNWA 3DF9A 5IAEA 4KPYA 3PLNA 1QHHB 3WLHA 2HEGA 1QE3A 5ECWA 5LU8A 3WY9A 2AJLI 3AHIA 4BMCA 4DDWA 3ZTTA 4P9NA 3HJFA 4FZJA 4YJ2A 4FB5A 4MS4A 1A82A 2BE9A 5C3UA 3LGXA 3MCWA 1JMYA 3WGHA 3LDFA 3KUKA 3V97A 5BWMA 3BTUA 4JODA 5A4MS 4KNYA 3RU7A 4BEVA 4I1UA 3U5TA 3Q72A 2JR6A 4HQNA 3WMFA 4UJ5A 2COKA 2DYKA 5EESA 2IDMA 1ZVJA 1NXVA 2VSFA 3GNLA 3N53A 3N2GA 4FHZA 2NZWA 1G2IA 3OJWA 4QRHA 4ETIA 9ATCA 2O59A 3I64A 2ZTLA 3OCJA 4MVJP 4B7AA 3GJ8A 4K9DA 3X2EA 3VHRA 1L3IA 2IS4A 3AM5A 2IBTA 4DQ0A 2AYXA 5BSEA 1II8A 4EUEA 4OQNA 3TMYA 1GGFA 1ECGA 5EJGA 2RJ3A 2TECE 1T8PA 2ZJ4A 4K6CA 4QWMA 4D8WA 3FNRA 1E2HA 4XGKA 4NBHA 5H5JA 3HA7A 2WSMA 4PC2A 1LZLA 2QBYB 4F0JA 1MG0A 1H05A 4JK3A 3WYNA 3ADDA 4Y2RA 1IN6A 1WZCA 2GZAA 2N46A 1TZMA 3NPAA 3NVDA 3ZU6A 4D9CA 1JYEA 3THXA 2VYCA 2AF3C 1G5QA 1VIMA 4GXNA 1AK1A 3L0IB 4AJPA 3DEYX 2H1HA 2UUCB 1RXCA 3BHIA 4S04A 5KZMB 4BXXI 5TJ9A 2W6CX 4TMWA 4IW3B 1B0PA 5ER9A 4IUBS 1YJAA 2BHTA 1O95D 3WWCA 4CF4A 2W6OA 3IEXA 4QXOA 4EO7A 4ZARA 3PC7A 1RWOA 2JAXA 4R05A 1CJUC 1ZOOA 3BT7A 4YXWD 3GLGB 2FN4A 3K5PA 4FFPA 4YQEA 2A0FA 3WLLA 4MVYA 5FR2A 4YAEA 3G88A 2AXNA 3VKVA 4QZVA 1Q0TA 4EF6A 3PICA 1SQ5A 3C70A 3K05A 4I14A 4W9RA 2AN5A 4TTVA 1AZSC 4X1OA 3EQZA 4CKEB 1Z5UA 2QP3A 4O08A 3AHHA 2VSOA 5JCJA 2H48A 1XGKA 3L7CA 1I7SB 2XUFA 3HNPA 4GT1A 1P7WA 5JC1A 5IJWA 1TQDA 2QZZA 4JGGA 1HT2E 4N0DA 4II7A 1QQ5A 4YAGA 2I0FA 4UARA 4CLXA 2K5RA 1YMVA 2BFDA 5SZKB 1NLZA 1XQ6A 4EY7A 2XODA 1IUOA 2F43B 3PENA 5D00A 3LY5A 4XPZA 4EG7A 1XLVA 3RVRA 3SEQA 2WD8A 3BF8A 2C96A 3H18A 1Z6GA 5EQFA 3PNYA 1A7UA 3IP1A 1FNCA 2VJNA 3MTAA 3WS7A 4BGDA 2WAMA 1A9QA 4CKCB 1XU9A 2RFLA 3DDOA 1XBTA 2F3RA 5I7UA 3F6SA 5SY9A 3RS5A 2Y6UA 3NAQA 1EA5A 3LPDA 2ZSHA 5LMCA 4AY5A 4JQCA 1E0AA 4L5AA 1JRLA 4A1FA 1MW8X 1KY5A 4I5DA 2QDXA 4ZAYA 1NQ5A 4BLSA 1KMIY 3D54D 4FXPA 3UJCA 2PZBA 5BN5B 2EZ8A 1IVYA 1XP8A 2GAIA 1O58A 4M0DA 4DADA 5AVXA 3P97A 2JLWA 3O1IC 4GZ6A 4DANA 4P38A 1VFNA 4HNTA 3LQYA 5JAZA 3DE2X 1C2YA 3CEJA 4NBVA 3SKVA 4H7HA 3JXEA 4LXHA 1EWYA 2OLEA 1H1LB 2P9GA 2C78A 1SY7A 5DHAA 3B82A 1E2MA 3GQVA 3BZWA 1N6NA 1RLIA 4Z99A 3I30X 2D6FA 1MG5A 3K5WA 5EP2A 4YUWA 4I46A 3GKQA 1XX6A 2M32A 2Q5CA 4GKJB 3G0DA 5WRFA 2VJMA 4TMVA 4HPJB 5ALEA 2ODNA 2JI6A 5D1PA 5ADVA 2W6IA 3F6PA 4YX9A 5FPQA 1SFOI 1C8VB 2Y1OA 1J8DA 1VECA 4PYLA 1E32A 3UY4A 5AHOA 5I9IA 1EK0A 3FQQA 1K8QA 2HSZA 1J56A 1EGVB 2F1KA 3EW7A 3ESYA 2QTZA 3MQFA 2BMVA 1N0WA 2FGKA 2ZQZA 1KJ9A 3LWZA 4JVSB 5A62A 2CHQA 1DG3A 1M2EA 1TNDA 1PHRA 2Q3HA 3BRQA 2P79A 2NVWA 2QTLA 1NMZA 2WAYA 1KI2A 4Q4HA 4YJGB 1UP6A 1ZMXA 5DCLA 1ZVVA 3A06A 2V98A 2W6ZA 3F98A 4FFBB 4LRTB 4IHQA 1X42A 1PR3A 3PGXA 4ZO8A 5JHHB 2I2CA 2DX7A 1E4YA 1RQGA 1PP4A 1RP1A 2UZIR 3O3NB 4MOWA 1M1K2 4ND6A 5CXQA 1RBQA 1XZKA 1KAQA 2HT1A 4AIIA 3H11B 1UC4B 4JOCA 5EAIA 1C9EA 1LI7A 2BI4A 4RY0A 3QA3E 4EG3A 2FN3A 3GZTB 3DXZA 2Q5LA 1ULSA 2NAPA 1J25A 3C4QA 3HCPA 2W2LD 4NMLA 2BGLA 4WZ6A 5FR1A 4F9EA 4G0UA 1AO0A 4H7FA 4LJRA 4BP3A 2HQBA 3O83A 3T3MB 8LDHA 2DT5A 1JTFA 1ZDMA 4FVTA 4GP9A 3RTEA 1P9LA 3C97A 4YRQA 3ASYA 2W03A 2HGZA 2YQZA 3OIUA 4MULA 4P80A 2EVWX 3DZFA 3JWIA 1N7IA 3KYIB 4XWGA 1KJWA 1RHQA 3WK5A 3ZK7A 2HA3A 2C84A 2ZSIA 4RGVA 5K3AA 1M901 4DA0A 1PL6A 2JFOA 3IELA 2Y68A 1EWVA 1O95C 3DM5A 2FR0A 4LF8B 4NH4A 4EKIA 4YJ3F 3DTVB 3BWEA 4MDFA 1LDYA 4ER5A 4Q3KA 4D46A 1FUYB 1ZLXA 4KDFA 1N0UA 4WK4B 2P6PA 4CGZA 5GZ3A 2V4MA 3BXHA 3D7KA 3NX4A 5KYUB 2HI0A 4ANFA 421PA 2V59A 3K2IA 3GTQI 4NCNA 1KMHA 2V0NA 1M54A 3OOJA 4OP1A 2OBMA 4IEFB 4ZI5A 5SYMA 3BSSA 4E5PA 4JKYA 2BD0A 1E4VA 3PUXA 5FI5A 3I3OA 3F90A 2HCFA 4EJMA 1YJ5A 1ZK4A 1X7YA 4U39A 1BZYA 5CT6A 6PFKA 2JARA 3U80A 4I8XA 4FJ1A 2IHTA 3SBDA 4IO0A 4LOAA 5B4TA 1T6NA 4JI3B 3TAUA 2TMKA 2HY7A 2ORWA 1CUBA 2IZZA 1RM4A 5HK8A 3W5SA 2UZ3A 4P08A 3ORHA 3QZUA 4M8KA 1NURA 4ZU1X 3K2BA 3GJ6A 3MQ2A 2J9ZB 3D3EA 3R2JA 3TQIA 4BV3A 1KMNA 1MORA 1Y63A 1KEWA 2PV0A 2I1WA 4AQYB 1DMSA 3R20A 2JZCA 2NYUA 2R6FA 3KV3O 1OZ0A 4G1VA 4I50B 1CBUA 4DTCA 1UZMA 1IQ0A 5D1OB 2F9MA 4PLTA 3HKZA 1FUUA 3TCXB 4IJVA 4B6SA 4P35A 1JHZA 3R5FA 2R6ZA 4ZQHA 2H1VA 3BB4A 4PYJA 1N34B 1ITZA 1NGSA 1IQRA 1G18A 4K46A 5TT1A 4HRXA 1UBFA 4P4GA 1US8B 2WMDA 4EHFA 5IC6A 1QH1A 1QNLA 2ZRGA 4RH3A 5GIOE 5GM2A 3WL4A 3F3KA 1PNVA 3ILSA 3A4IA 4JA0A 1SNYA 1RQNA 4I5FA 5FO1A 3S1QI 3L4KA 1P75A 4JLKA 1EDBA 1HMYA 2DFPA 4OB7A 1HTTA 3CMEZ 4AP9A 5AOBA 3OLWA 1XDUA 3A6PC 1GKYA 3QIVA 3RQSA 4RY2A 1KAOA 2E4AA 1ZM7A 3I2KA 4I99A 1KTIA 4CCYA 1FFEA 1EP3B 2JNWA 2O8BA 1WXEA 1UXGA 2QLTA 1H4SA 3CW8X 1NP3A 1IN5A 3D6VA 5TS2A 2CVPA 3LUHA 1ENZA 2WB1A 4LE1A 2FW9A 3H9CA 2B8EA 3RC3A 2QTVB 4RH0A 3IP3A 3WGNA 1CZUA 3PD0A 2AX4A 4S1VA 1Z0UA 4M0FA 2I91A 2QG6A 4ITVA 1M6EX 3AINA 2QW8A 2J5BA 3SDBA 3T9DA 2Z1NA 2IYUA 2VPIA 1QFYA 4A91A 2ZCJA 2DERA 2Q6LA 1Q1ZA 1RTTA 2AFRA 3WOHA 2HA5A 3MF4A 1AOXA 2ZULA 1RPJA 3PQ2A 4RPIA 4U2GA 3ZX4A 2BSQA 5JISA 5JBQA 2JLVA 5AOAA 3FBWA 5F9HA 2CGEA 4G0VA 1ZO8A 4PZ9A 3KLPX 5LFAA 4MS3A 1VLHA 3A4NA 3U48A 4A9AA 1BEUB 2ZRJA 4IS3A 4Y6GB 1RMYA 5TVGA 3UHJA 3JALA 4NAUA 1NUTA 1GAQA 1GQSA 1THMA 2YDXA 4YJHB 2Y1CA 4EY4A 3KKLA 1U0NA 3SYKA 2VAVA 3TLXA 3FXAA 5IXSA 3RADC 1ISHA 1XKQA 4U0KA 3WMXA 5FEUA 3NBMA 1UEJA 4C2UA 3FPFA 1FS4A 2WM2A 4HH1A 5A04A 3I32A 1P1BA 2CB0A 1ZD4A 4XWTA 3N0TA 2PFKA 3KB1A 4V03A 3ZR4B 1F4VA 1ECFA 1T5DX 1SURA 3I1FA 4GI3A 1DBPA 4JIMA 1Q0LA 4NLLA 3S70A 4EFLA 4M53A 2HU8A 4W8HA 1RHUA 4HSEA 4H18A 4ZDIA 4PYMA 2ZXUA 3HOWI 2ZATA 4QDOA 4WNYA 1BS2A 4MINA 4BBRI 2B21A 2MIIA 4G0YA 1GNRA 2AC2A 2BTQB 4WXEA 2VJKA 3ZGXA 4B4VA 4N1AA 3T5GA 4YRCA 3W3AH 5AH0A 3TX6A 4W1RA 3TJMA 4UTRA 2O14A 1K27A 1SWWA 1K98A 2UAGA 1N3YA 2FSVC 4GW3A 3LQ1A 3VPFA 2P40A 2F1RA 1H6DA 4E6EA 5AXDA 5BSMA 3L9XA 2I3CA 2NUAA 3M6MD 1RE0A 2PSFA 1ZCJA 3GLHE 3LIIA 3OIYA 4DQLA 1ZK0A 2PMKA 3N74A 2FPPA 5AI5A 2BM0A 1LPMA 1DE0A 2J6IA 3ZJYA 1CIVA 4IDCA 1TYBE 1OLOA 2MHCA 3VGJA 3E7XA 4JU8A 4FI3F 3NHBA 5IMSA 2J07A 1W4AA 2VYNA 3MD0A 5BVHB 4MSUA 3NV7A 1AKMA 2P7HA 4HLCA 2YN4A 1L9XA 4JIGA 4GP6A 2WFLB 1X3WA 1E3LA 2HREA 2VHWA 5JATA 5LL6P 1NXWA 1CYEA 3PQ8A 1XUOA 2DOKA 1BVUA 3OE7D 2FY8A 2YXLA 3FSGD 5B7QA 1PL8A 1ZY2A 2DUMA 1UZAA 4OF4A 3WDKA 4BN5A 1X7WA 2GKOA 1YQDA 3OT1A 5J47A 2AFHE 3SC3A 3JPYA 1DUIA 1JSCA 2ZE6A 4M0LA 4CIDA 4G4IA 4ZHSA 2HPHA 3VYWA 1CNMA 5BYAA 1IN8A 3NM4A 2C8VA 1G1AA 4WLOA 3WGYA 3UT6A 2BR3A 1M1NA 3GIWA 3CUUA 1BE1A 2FSSA 5FNZA 3AUKA 1PNOA 3LJKA 3WG9A 3M3YI 2Q2QA 2R8PA 3NH5A 4G1FA 5E4JA 1FOEB 3ZXXA 4ZYUA 1FA9A 1UBSB 3G1WA 3EZGA 4YCCA 3HFJA 1XMXA 5IJ0A 4E11A 4HK4A 3RBZA 3TM5A 4ZOQI 5F23A 1PVVA 2HWUA 2ZB2A 3MJVA 3QVOA 4TMZA 4OLFA 4FZ3A 1W4BA 2GU2A 5I7EA 1OXUA 3RLIA 3H9UA 2PBRA 2H4HA 1D1TA 1DIAA 2XMPA 1NBME 3COZA 4NYJQ 4R8LA 3U50C 1VC2A 3DCNA 4MXUA 3QVGA 4BZWA 3LUCA 5BQXA 3G7UA 4FR0A 3R7DA 3GCGA 5EZYB 4D3YA 4MPJA 3DTVD 4KNWA 1ZW6A 3RFUA 4KMSA 3ONFA 4K6GA 5T4FA 1JN0A 3KCQA 3OF3A 1EK5A 2OCAA 1PJBA 2CLKB 5JNTA 1W4CA 3U4DA 1U3UA 1L5HB 2OESA 3MRVA 5ALHA 3QOFA 2PQ6A 2PJDA 1MA3A 4JL8A 3R3ZA 3W9BA 4EL5A 2J3LA 4EEZA 2VQSA 2GLXA 1D6SA 3F78A 2AN3A 1VHLA 4N7RA 3GRZA 1VQL1 1FFDA 1LNQA 3L7DA 3VXKA 4ES6A 1B76A 3I1IA 2ZWAA 4R9VA 3WLNA 4FBLA 4OJTA 1K8YB 2C2GA 5EVJA 4LCEA 4LOHA 1HQKA 1KERA 3F1KA 4J49A 3HZZA 4D82A 3UHFA 5A4KA 1KRWA 2C7QA 1XU4A 5LBIA 4UTPA 4GM4A 4UVGA 4JJ6A 1D1SA 3QVVA 3TH5A 2GRJA 3FVWA 2BLLA 4IDQA 4MZDA 4V0QA 2O2YA 2PUVA 4TL7A 4B32A 2PKEA 1K4KA 2P9QA 1U4SA 3KVOA 3HBNA 4MR9A 5GONB 1EGAA 3TAXA 3U7FB 2V7GA 3QK7A 3RFVA 1T13A 3G0CA 3V3TA 2JCGA 1N8KA 5JALA 2GZSA 2WPNA 4P98A 1HTBA 1KU6A 4GKVA 1Z39A 1FFBA 3TXXA 3BXFA 4PSUA 3HCDA 4BWGA 3ORQA 3VH2A 1U7UA 1EP1B 1AURA 2VT7A 3AHJA 1FTGA 1MEOA 1FLVA 2VRWA 1IZZA 2R00A 5FWYA 3G2LA 5CLHA 2GZ3A 3KUXA 2O8CB 3ZVLA 1W9HA 4LJLA 3MOIA 1CR0A 1FXSA 5EWMB 3ILVA 3KU4A 5DYIA 1PDVA 2ACKA 3DCIA 3PUHA 1QUEA 1ZK3A 1DPFA 2V7EA 4LQDA 4B6JA 2GYWA 5ARBA 2FH5B 5L4NA 2H1OA 4KI0A 2JK1A 1M6YA 2G1PA 2ZJFA 2GB4A 5JHGB 1YWGO 3SLGA 3SIXA 3FIUA 3RLFA 4DIUA 3DXXA 4GYWA 3TSOA 1VFPA 3A2MA 3L40A 3ZK9A 1I1QB 4RZHA 2Z98A 1VP9A 1E92A 1D09A 1LF0A 3FB1A 5JFTA 3CV3A 1U7PA 1FDRA 3PDIB 4N8EA 4RTLA 1U7TA 3V4SA 3GJRA 3MS7A 1IH8A 2D06A 4D41A 4RHUA 1YHZA 3LZDA 3ADPA 3ETCA 4L75A 4C0BA 1TT5A 1RPAA 5CH5A 5E9JA 3WNCA 5JNVA 4I7EA 2YWDA 1GT6A 3A6JA 2GWRA 3F6YA 4MYSA 4KHZA 4YRTA 2VNSA 3VQTA 2FFAA 3ONDA 3IURA 4QOSA 5I4IA 1P1FA 3NVKI 2NMVA 3UUFA 1AK2A 2I99A 5C34B 4WACA 1VMAA 5BN4A 4NPAA 3D8RA 1N5DA 2P2GA 1BFUA 3G5LA 5ADUS 3U44A 2GUGA 3LHFA 2WYOA 3VR2A 1GLGA 4E5DA 4K86A 4EYKA 3CVVA 2QTWB 3JVEA 1S2IA 4MVXA 4EJSA 1M8GA 2DQKA 3F7MA 4JYZA 1NAIA 5EKDA 4B6PA 4L9RA 4PAQA 1YIAA 2JATA 4ML3A 2NO6A 2FR1A 1MT3A 1SVNA 3MTEA 1YR6A 2BWJA 3A4VA 4U3JB 3ZE8A 4YIKA 3UHOA 5EIFA 1Q822 3IA7A 4ARAA 2WIDA 1EDZA 4UJ3A 3EGWA 3STYA 2G04A 2Y1FA 3K1AA 2IOHA 3NKFA 2JHCA 3Q88A 4FLFA 3H87A 2IV3A 3JAWB 1T0PA 1XLUA 2DB3A 2AJ8A 4K0RA 3RO7A 1KO7A 1JTVA 1JKIA 5HFNA 3G6E1 1Z2PX 2G36A 1SU7A 3N0RA 3P27A 1EEXB 4L8GA 3VKWA 1N4DA 2AMLA 4MV8A 5C0OE 3ZI0A 1I7QB 3FSEA 3HKEB 1ETHA 2R84A 5L7YA 2VP3A 4BP9A 2GT1A 3RANA 4Y0AA 3I1JA 5KVSA 2QYSA 1KOJA 3WZMA 1ORIA 3Q1KA 2YMLA 4PTZA 3UMRA 1RZVA 2ZXFA 2UXDB 2O7RA 1GDHA 3U13A 1UP4A 5IJ9B 3DMRA 3K9GA 3OJXA 4J8PA 1AZTA 1ODIA 3SHTA 2FPIB 2PMDA 2VNAA 1ZFNA 3WFZA 3F2VA 1E66A 4KN9S 3QU2A 4KH0A 3LRPA 1Y9JA 4KQXA 3H19A 3TZ6A 1G291 5A5VA 3C6ZA 1LWNA 2DT8A 1SZJG 3L07A 1D2GA 4F5YA 3IKTA 1NI4A 4TMKA 3WNZA 2F3UA 2QD2A 5IH3A 1QTIA 5LYJA 4R1SA 5JCOC 3EH2A 3Q0TA 4GOOD 5E4TA 5L7TA 1HE2A 2G25A 1GITA 3IILA 4I1IA 1Q95A 1QGAA 3CN9A 4KLAA 1NF8A 1LDMA 4FD2A 1HOXA 3SJBA 4E6PA 1IU9A 2RHTA 3E3OA 4TKZA 3FAZA 3AF2A 5DWDA 3IUBA 3JARB 3A1NA 2QQ5A 2B4TO 2TMDA 4R41A 1K68A 3R6TA 3L8EA 4M0KA 2YHUA 3EK2A 4QUAA 3ZDRA 3ZWMA 2ZAGA 2YHSA 1N9ZA 1P18A 1RYEA 3LRTA 1QZTA 1W581 1YONA 1YI21 3KP1A 4PPGA 5ITWA 2QDKA 3E61A 2PFSA 1WETA 1R0YA 4PNPA 3QWBA 1FMTA 1WSAA 5DLEA 3FWPA 3TB6A 5CNJA 4TROA 4MAMA 3SF0A 4M1QA 3CCQZ 4MS1A 3ROZA 2YVQA 3H6GA 3DPSA 1Y4ZA 1IUNA 2LCQA 1T8UA 4IGEA 3ULKA 4F4DA 5BV0A 4AX8A 1NMQA 2W2MA 2OAGA 3PUZA 4GGPA 2V8IA 1B23P 2V6BA 2XUPA 4DCTA 2NT3A 3PPIA 4XCXA 2J46A 2K6GA 3ZE1B 4EHIA 4F7DA 3HB5X 1ZKDA 2WZCA 1E1CB 2FCRA 4NHEA 1EHYA 5KYKA 3PE3A 1F1JA 3WO0A 1I5RA 3PTAA 1OAAA 4W5WA 1QH9A 3IDFA 4LGCA 5GJCA 3U4AA 1IMJA 1VQ71 2Q3DA 1HTWA 2P6MA 2KI7B 1ZKMA 1CHDA 3KWMA 1MFPA 2N1BA 4JLVA 4BZZA 4MIKA 4XGIA 1XAHA 1YDEA 1GARA 1N2IA 4ZQGA 4BE4A 4CKWA 2DQYA 1VL5A 4UMFA 3FUCA 4V2UA 1SD5A 1WXGA 3F5SA 3T7CA 3LCRA 3BL8A 5KSWB 1WXXA 3RYIB 4C21A 1LC3A 4L3WA 1Y34E 3KJXA 4MLPA 1NULA 2I34A 3RK4A 5KKCA 3O3CA 3R5JA 2P91A 4CUKA 1RJDA 5IJXA 3BB1A 2GF2A 4BLQA 2C07A 1CUFA 4WH0A 1XG5A 4N5LA 2H1RA 2WYWA 2EKQA 3M83A 1VMKA 4PANA 2I54A 2YC2C 2TS1A 4P7BA 3M6LA 2QUZA 2C8LA 2ZBDA 4ND7A 3TM4A 4XD2A 4AMVA 4AS3A 3GEBA 4KYTA 4I6JA 4CZ2A 4ZGWA 3B60A 5CDTA 1PZXA 4QQKA 4BFXA 3D43A 4BCCA 1YB6A 4CFZA 5KBYA 4LF4B 1EK6A 2CDNA 2Q5OA 1X7XB 1CJCA 3BFVA 4WDRA 4QG7A 4QBFA 4X3CA 2Z6QA 2HN9A 1V11A 1K2VN 4MJ7A 3ZWVA 3AU8A 1L5MA 2NZYA 4BN4A 5JQGA 2HGSA 4D3FA 3CH4B 4DG8A 2HU7A 1FDOA 2G72A 4U7PB 1NMXA 1VIDA 3RUAA 2PUCA 1YUNA 1T3ZA 2CLMB 3KVVA 1WKVA 3CZPA 4Q3CA 4CRWB 1AT1A 5C80A 1J2RA 2V9CA 5EFZA 3GFSA 4BVAA 4DKXA 4Z54A 2VTBA 4M9CA 3EAGA 4TQUS 5AVUA 1H5QA 1L3CA 3IS3A 5KYGA 4PCLA 1GNVA 1ML8A 1NY6A 3D4BA 5EZSA 2P9TA 4J2OA 1A96A 2NQ2C 5KYXA 3RB8A 3JWHA 1EHCA 1NVKA 2GJ8A 3HL0A 2PD3A 1XP5A 2OENG 5DU2A 1EX7A 4RV9A 4HDAA 5LMNB 1NRIA 4YJ3B 3DAFA 1XKLA 5E7JA 1MT0A 3VSEA 3WGGA 1FTSA 4PGMA 5LVAA 3KSBC 2FEXA 4JI7B 4Q7KA 4F4UA 4ZYYA 1Q20A 4TVKA 2FKAA 4BHTA 4RDHA 4WLVA 3GTMI 2RB4A 1YL5A 4DMGA 2FUKA 3JVDA 4DLNA 5HGXA 1G4AE 2ZSEA 1FSPA 4XTCS 5FBHA 1FW6A 1QRAA 4L07A 2JGRA 1PWXA 4R40A 2OBYA 1J70A 3D1LA 3NFRA 3VUFA 4LRXA 3I37X 4ODIA 4EBBA 1VJ5A 5H9WA 5BWLA 2MYUA 2DFDA 1BMDA 4UCWA 4BNFA 4MUFA 3RRNA 5CDFE 5LJLA 1L6RA 3GHYA 5M2QA 2P9BA 2CXNA 4JVMA 3JYNA 2HMAA 1A8QA 1O03A 1HYQA 4W9NA 5JLJA 3P8ZA 2WP8J 4QAJA 4PTYA 2H0RA 4UTZA 2Q8NA 2O20A 3HCRA 4EYEA 2R92I 1V43A 4X7RA 1RRPA 3L0SA 3P71T 3OQMA 2P2DA 2AT1A 2FA9A 2RBGA 4QTTB 1JEJA 3GGOA 1QR6A 4CG3A 2GM3A 3EOZA 1KNXA 1NVTA 5IAGA 3VNVA 5HKKD 2JB9A 3WL5A 5K0JA 4GQAA 2WM8A 3D64A 3O8QA 2ZT6A 2AN1A 4GX1A 5A3RA 1AF7A 1DV2A 1BJKA 4EMBA 3LVRE 1DQSA 4AKSA 2RGGA 1VL1A 2WB4A 4E5YA 2GR9A 1WF6A 2FU5C 2GD1O 4TWRA 2WIAA 2P69A 3S1SA 1LUAA 1L7QA 2HU2A 3U62A 2ZYTX 2BFPA 3HZRA 3T54A 4OHCA 1EK1A 1E0DA 3AW8A 2WF7A 3MINA 2HL6A 2GEDA 5TGTA 2ZJ1A 1SCJA 4B6OA 2J09A 3G8CA 1ACJA 3IERA 3A28A 1ECJA 2QEQA 1L5VA 1DDGA 2ZI9A 1TCUA 1VGRA 3AFGA 5JAMA 1ZR4A 1Z82A 3B7PA 3VGPA 5JDIC 1VQMZ 1LSUA 1II0A 3EGDB 1P61B 4RGBA 3CSUA 3ZDYB 4D57A 5KCZA 1M83A 4KQKA 4EG0A 1K8XB 3UYLA 5HVNA 1EFKA 4G4GA 4JVLA 4LF6B 2V97A 3LIPA 3OQJA 4WXRA 3OTIA 1TUEA 2D2FA 3OBBA 4O4LF 1SA0B 4NCAA 2GEBA 3D5EA 3V7WA 3LNCA 5KU7A 3OP4A 1SUBA 3OWHA 4Y9DA 3K20A 1POXA 2ZB4A 2X23A 5IFKA 1X38A 1ZCFA 2MYPA 1PUXA