1Y8CA

Crystal structure of a s-adenosylmethionine-dependent methyltransferase from clostridium acetobutylicum atcc 824
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
246
structure length
246
Chain Sequence
NCYNKFAHIYDKLIRADVDYKKWSDFIIEKCVENNLVFDDYLDLACGTGNLTENLCPKFKNTWAVDLSQEMLSEAENKFRSQGLKPRLACQDISNLNINRKFDLITCCLDSTNYIIDSDDLKKYFKAVSNHLKEGGVFIFDINSYYKLSQVLGNNDFNYDDDEVFYYWENQFEDDLVSMYISFFVRDGEFYKRFDEEHEERAYKEEDIEKYLKHGQLNILDKVDCYSNKKVEKFTERITYLVKLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords S-adenosylmethionine-dependent methyltransferase
publication title Crystal structure of a S-adenosylmethionine-dependent methyltransferase from Clostridium acetobutylicum ATCC 824
rcsb
source organism Clostridium acetobutylicum
total genus 90
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2004-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.110 Mainly Beta Single Sheet N-terminal domain of TfIIb S-adenosyl-L-methionine-dependent methyltransferases 1y8cA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1y8cA01
1JQ3A 1RI1A 5U4XA 4OA8A 4M7RA 2HV9A 2HNKA 2P7IA 2YVLA 3AJDA 3BWMA 4BP1A 3NWEA 3R9XB 3OZSA 5D1HA 1RI5A 5ERGB 3BGVA 3UJBA 3MHTA 3SXJA 1XDSA 3REOA 4QVKA 4C03A 3X0DA 3O4FA 3VSEA 2Q41A 1XJ5A 3KPVA 3E05A 1NBIA 1RJGA 4IV8A 4FT2A 1SUSA 4C05A 5C1IA 2VDWA 3B5IA 2QM3A 2ZBPA 2HWKA 4PINA 5E9WA 5GM2A 3SR4A 2EG5A 3I9FA 3KR9A 3TQSA 3G5TA 1O9GA 2V74B 1TW3A 4QPPA 5DM1A 5EQJB 5P8WA 1XTPA 4RVFA 1FJXA 4EVIA 1MJFA 3LKDA 1D2HA 3R3HA 2E5WA 2ZBRA 2PX5A 5CCXA 2NNWB 1YZ3A 4GOLD 4RTNA 4E2ZA 2PVCA 2HTEA 5HZMA 3FPHA 4E30A 4CXMA 5DPMA 1SUIA 1L3BA 4OQEA 1DCTA 1G8AA 5LQUA 5DX0A 3PFHA 3P9KA 2JH9A 3BGIA 2FYTA 3HCCA 2GH1A 4GC9A 5FWAA 4FP9A 2OPBA 1KPIA 4RTQA 3A4TA 4FZVA 4DM3A 2IH5A 2UYQA 2XVAA 2YXLA 4DZRA 3D2LA 2I6GA 2CKDA 2ZLBA 4YV0A 3KQMA 1NE2A 1R74A 1F38A 5EZSA 1KXZA 4PONA 2AN4A 3UJ6A 3B3GA 4PYQA 3KQSA 4BLWA 1YUBA 4ER6A 5IKMA 5EIWA 2GLUA 1SVUA 1NV9A 3ME5A 1EJ0A 5LQJA 3P9IA 3EMDA 5K05A 3P2IA 1L1EA 2AN3A 2BM9A 5EMMA 1D2CA 5LQRA 2C7QA 2NXCA 3AWIA 3HCBA 3UJ8A 3CKKA 2C7RA 5JUWA 3C3PA 3R24A 2PX4A 2UYHA 1JG3A 1EAMA 2OB2A 1HMYA 2JJQA 3KQPA 3LECA 3LGAA 1SG9A 2FCAA 1ZHFA 4G56A 1G6Q1 2B25A 2NYUA 4YUXA 4WVLA 3CBGA 1EJ6A 2BR4A 3GRZA 4FT4A 5B1SA 3TM5A 3I58A 2CWWA 3TLJA 4EK9A 2FHPA 4KIFA 4QPNA 5LR6A 2I7CA 5M5BA 4RTKA 4AUKA 4RTPA 3OCJA 1AQJA 2IBTA 3K0BA 3EPPA 3UJDA 1G60A 3EEYA 5EKUA 3EVEA 4DCGA 3PLAE 3GU3A 3FRHA 1G8SA 4YV1A 3UWPA 4GOMD 1WXWA 9MHTA 4RTOA 2G72A 1WXXA 2PX2A 3KPJA 2IFTA 3DH0A 4FR0A 2DULA 3FRIA 2OY0A 3I53A 5FQOA 4KRGA 2P3LA 3SSMA 4RVDA 4CKEA 4E2WA 2AR0A 2ZSUA 1UIRA 2ZW9A 4PYKA 5HOQA 3KPWA 3TKYA 3UJAA 2PLWA 3MQ2A 3BT7A 2ZULA 4PIMA 5IH3A 3M70A 4YV2A 1FP1D 2BR5A 1IY9A 1NW5A 1FPQA 3IEIA 4C06A 2QRVA 1QANA 4RTSA 2WK1A 3NDJA 2IH2A 3CGGA 3LCVB 3OZTA 2PGXA 2V7EA 1I9GA 2ZCJA 1O9HA 3LDGA 2JHAA 4PNEA 1X1CA 1RI3A 2PX8A 2PWYA 2WA2A 3EEOA 1EG2A 5CVUA 4AZTA 5FADA 4LECA 3M6WA 4KDRA 5HILA 5G02A 1QZZA 4X1OA 1VL5A 4RTLA 4V0RA 4FS8A 1JTFA 5LQKA 3HVJA 1R00A 5EVJA 3LCUA 4ISCA 1RI2A 2YX1A 3C0KA 3DXXA 4ER7A 1P1BA 1P39A 1VE3A 2PXCA 4HSGA 3FUXA 3HA7A 8MHTA 1TW2A 1XDZA 3B7PA 3DTNA 3MTIA 5DTMA 5E1DA 3ELYA 2AOWA 3TOSA 3JWGA 3S68A 3UJ9A 2ZIEA 4GEKA 2PKWA 4X60A 2GAFA 2ZWVA 3VYWA 2ZZNA 5LQCA 4PYMA 4F86A 4RYLA 2BH2A 1HNNA 4AZWA 4CKCA 3DXYA 2ZIGA 4E2XA 5FULA 4PYJA 3KPUA 3M4XA 2K4MA 3M6VA 5DSXA 3FUUA 1TPYA 1AV6A 1IM8A 3GCZA 3BGDA 3T7SA 3ER9A 2FRXA 1VPTA 2QRVB 2OZVA 1L9KA 5F2OA 3ANXA 3HVIA 4PGGA 1BOOA 1INLA 2VDVE 3LBFA 2B78A 5EGSA 4PYOA 1X1DA 3NVMB 1R8XA 2DPMA 3HA5A 3VC1A 2IIPA 1XXLA 2B3TA 3C3YA 3UZUA 4DQ0A 4R6WA 3G2PA 1YFLA 3OPNA 4F84A 1RI4A 1ZQ9A 1JSZA 5DRTA 5CVJA 4E32A 3EVFA 5KVAA 1X1BA 1KYZA 3LBYA 5GM1A 1KHHA 1WG8A 2JHCA 4M37A 5K0GA 3GRVA 2YXDA 1RJEA 3EGEA 3EVDA 2Y1XA 2VP3A 3PS9A 2CMHA 4P7KA 4YUYA 4RTRA 2IGTA 2ZIFA 3BWYA 3EVAA 2VDUE 4XUCA 1YFJA 2FK8A 4LWOA 5ICFA 1ZGAA 2N47A 3HVKA 4GOND 5FCDA 5KYGA 3IYLW 5DTRA 2KW5A 2ZWAA 5K0JA 5FHQA 3C6KA 1VIDA 1JSXA 5EZQA 2AOTA 3TM4A 4DKJA 1N2XA 3FUWA 5D1NA 3FYCA 3G7UA 1X1AA 5DSTA 2O07A 2LD4A 1H1DA 3RW9A 3MERA 3VC2A 5K03A 5CD1A 1R8YA 1QYRA 4HH4A 4JXJA 5CVDA 1Z3CA 3GO4A 4POOA 5BW4A 1G38A 1JG2A 2YXEA 2PY6A 4OBXA 1UWVA 1WY7A 3FPEA 3P9CA 3T7RA 3KR1A 3P2EA 2H00A 3EVZA 2H11A 5EIFA 4X63A 4MTLA 3BZBA 5CIYA 3FPGA 3KPYA 2HMYB 2P1DA 1R18A 2YR0A 3KU1A 3B89A 3OE4A 3QV2A 3UJCA 4C07A 5K0FA 3OU7A 2P3OA 5CVVA 4DMGA 2NP6A 3THSA 4KIGA 4QQNA 1OR8A 1XCLA 7MHTA 2EX4A 3ELUA 4R6XA 3FYDA 3HP7A 4ER0A 3G88A 5DTQA 5T64A 1V39A 3GDHA 3P97A 4X41A 4LWPA 4RWZA 5E2BA 5EPEA 3TR6A 2ZVJA 3DXZA 3E23A 5ICGA 2QE6A 2GS9A 2O57A 3LL7A 5CVEA 4IV0A 3OU6A 2BZGA 2ZTHA 4CKBA 2NP7A 5F2NA 4QDJA 2F8LA 5E8RA 1L3CA 1XCJA 2G71A 4Y30A 1N7IA 3ERCA 1YB2A 3O7WA 3BWCA 3NWBA 4RSRA 1VQ1A 3CC8A 2AOTB 5EMLA 2P7HA 1WZNA 1F3LA 2AS0A 4R05A 3DMGA 4HRAA 5K0NA 3RIEA 1AF7A 4M38A 5E1MA 3GRYA 3LDFA 5GWXA 5BP7A 2XYVA 3PT9A 3H2BA 4B17A 2ZZMA 3FTDA 2XVMA 2Z6UA 3E8SA 4MHTA 2CMGA 5E2AA 3L8DA 1RJFA 3SGLA 1SKMA 1DUSA 2H1RA 4RV9A 3CVOA 3A27A 1KR5A 4XUEA 3OFKA 4RVHA 3FTFA 5ICCA 1NKVA 1SQGA 1EIZA 1KYWA 4BY9E 4RTMA 4PYNA 3HNRA 2Y1WA 3R0QA 5GP1A 1QAOA 3PB3A 4DF3A 3FPFA 4PYIA 2A14A 2R6ZA 3T0IA 2XBMA 5HIMA 2UZ4A 5EMJA 4BLUA 4ATNA 2GPYA 2PT9A 5HFJA 4F85A 4WXHA 3TKAA 4AZSA 5GINE 3PFGA 3HA3A 3RODA 3A25A 2G1PA 3UA3A 3BUSA 1T43A 4E2YA 4AZVA 2I9KA 3K6RA 3MAGA 3UA4A 4U7TB 3EVCA 3FUTA 4GQBA 2FPOA 4A6DA 5HIIA 4OA5A 3SX0A 2O05A 3KR2A 10MHA 5E9JA 5F2KA 5FUBA 5E1OA 3MGGA 4YUWA 1NV8A 2HR1A 1JQDA 1VP9A 3EGVA 2PWPA 5H02A 2Z6QA 4PYLA 2AOUA 5E9QA 3GGDA 4FGZA 5C0OE 1EQAA 4E33A 5KQSA 1ORHA 2AVDA 3DLCA 3G89A 4DA4A 1ZGJA 4GUAA 3NVKI 1R6AA 5DM0A 1D2GA 2OB1A 2B9EA 1ORIA 4HG2A 1KIAA 4P7FA 5KS2A 5C9ZA 1M6EX 2G8NA 4QVGA 2UYCA 1NT2A 3QOWA 4KDCA 3LDUA 4V0QA 4BLVA 3GIWA 3BWBA 3GJYA 3BKXA 3DULA 3PX3A 1KPGA 2IPXA 3EVBA 5GIPE 5HEKA 4PCLA 1I1NA 5DX8A 3LX6A 3A26A 3KHKA 4EMSA 3AY0A 3F4KA 2ZBQA 1BC5A 1I4WA 2ZFUA 5K0EA 3SM3A 2AOVA 4DCMA 3IV6A 3EVGA 3G5LA 4YUVA 3JWJA 1G55A 3KQYA 3GRRA 2B2CA 4GOOD 5DXJA 5DT2A 3KQTA 4PGHA 3THRA 3A7EA 3CJQA 5T67A 1YZHA 3KQWA 3MTEA 1ZG3A 5FWDA 4ER3A 5BW5A 1XDUA 5JR3A 1M0EA 1JG1A 3HCEA 4R8RA 2VZ9A 3DP7A 3U81A 2QY6A 3AXSA 2AOUB 3ELDA 4Z2YA 2IBSA 4PIPA 5K09A 3V97A 5LSAA 4HGYA 5CUQA 4RTJA 4QQKA 3M6UA 3MB5A 4UOEA 1VLMA 3C6MA 3KKZA 3HCFA 3OZRA 2G70A 3I64A 1Q0TA 3KQOA 2AN5A 4EKGA 3PX2A 1PJZA 3A7DA 3T7TA 3FTEA 3G2OA 3HVHA 4X61A 2ESRA 1VBFA 1NW7A 1KPHA 2ADMA 3FZGA 3PVCA 1DL5A 4ZTBA 2PJDA 2P3QA 2QYOA 3G8AA 4L7VA 5DWQA 5FHRA 1U2ZA 5EC8A 4H0NA 2IDKA 4QTUB 3SVZA 3WSTA 5LQAA 4Y2HA 5CM2Z 1YF3A 2NXNA 4RVGA 4OX9Y 4OQDA 2NXEA 3HCDA 2R3SA 3CJTA 3DR5A 3ID6C 3JWIA 4QTTB 3FPJA 1SQFA 5EEHA 3KQVA 4K6MA 1P91A 3FTCA 4C08A 5HIKA 2GB4A 2JH8A 3NMUF 2YQZA 4MQ4A 5FTWA 5CCBA 4KWCA 1X19A 3E7PA 3LHDA 2PXAA 1NW3A 3G2QA 2YUIA 4FSXA 2PBFA 1KP9A 3ORHA 4E70A 1NW8A 3CJRA 2BM8A 2JHPA 1O54A 4R8SA 5DM4A 3G2MA 5DX1A 4XCXA 2GA9A 2AVNA 2P35A 5FQNA 1XVAA 4CTJA 2I62A 3HTXA 3LSTA 1JTEA 4IKPA 3TMAA 1AQIA 1P1CA 3I5UA 5EHIA 3O31A 3HEMA 3BXOA 4PCAA 4C04A 4P7JA 3Q87B 5KQRA 2P40A 5K0CA 3V8VA 5BXYA 4RX1A 2UYOA 4CWAA 1RJDA 3QOXA 2P41A 1VP3A 2XYRA 3OU2A 4FSDA 4GF5A 1JQEA 3NW9A 2ZZKA 3GRUA 2YTZA 3ELWA 5K0LA 3Q7EA 1BHJA 3KR0A 4EQZA 3DUWA 4E31A 1BKYA 2O0LA 4MIKA 3UFBA 5HIJA 3GXOA 2IP2A 3IHTA 4HGZA 5DLYA 3KQQA 3GWZA 2O06A 5K01A 2PT6A 3MCZA 2EJUA 4PWYA 1NBHA 5MHTA 5E8JA 4P58A 2EJTA 5ICEA 3SSNA 4GC5A 3DLIA 4P7GA 2VS1A 3EMBA 4YMGA 4O29A 5EHGA 5EOVA 1N7JA 3FUVA 1FBNA 3HCAA 3LCCA 3DMFA 3OE5A 2IDJA 5EKXA 3P2KA 1WS6A 2EFJA 4ER5A 3UJ7A 1JR4A 5DXAA 4BP3A 1MHTA 1IXKA 1Y8CA 2ORED 3OFJA 3TPZA 4HTFA 1B42A 2C7PA 2ONZA 3MCTA 1FP2A 4CTKA 3SSOA 2OBFA 2ONYA 2PSSA 2AOXA 5FA8A 3NTVA 4YUZA 4NECA 1JG4A 3AXTA 4U7PB 4XUDA 2JG3A 5EG5A 2P8JA 3PTAA 2PXXA 1UFKA 3TRKA 2Z6AA 3ER8A 3LKZA 2ERCA 4YMHA 3UBTA 3DMHA 4QDKA 3G8BA 3CCFA 4LG1A 3M33A 3NDIA 3P9NA 2OXTA 4OBWA 1NW6A 3P8ZA 2BR3A 4GBED 5FA5A 1ZKDA 2C7OA 2OYRA 2FK7A 3TFWA 2IH4A 1Q0SA 1QAQA 3EGIA 2XYQA 3GNLA 4IWNA 2OO3A 2PV0A 4C4AA 5LQNA 3HM2A 3DOUA 5DRYA 4KVZA 5GIOE 3B3FA 5T6BA 4HC4A 5DM2A 2CL5A 4EKIA 4A6EA 3NJRA 3P71T 3LPMA 3JWHA 3R6TA 5K8VA 3SMQA 4KW7A 5EEGA 1PRYA 1QAMA 4M36A 2NXJA 4AX8A 2AZTA 1M6YA 3B3JA 4MWZA 5E1BA 5K0BA 3M6XA 1L3IA 2OKCA 3BKWA 5EMKA 4HTFB 5GOZA 2WA1A
chains in the Genus database with same CATH superfamily
5JIBA 1DWOA 3LO5A 1V47A 4NBAA 5CBKA 5KPDA 3C1OA 3KZOA 4CODB 2AX4A 1Y3CE 3VZDA 2DPGA 4YRJA 2A94A 2H7XA 3HU1A 5KYXB 1IK4A 2E82A 5BWBA 1QIIA 1Z2EA 3MJDA 3HXMA 3AEKA 1W1IA 2AQIA 2AI1A 2ZM6B 3GFQA 1GPWB 1KH3A 3IP1A 1NNSA 1CHDA 4F2HA 2PUVA 2EX1A 5C3MA 4MULA 3OQJA 3UYLA 1I4EB 2QPAA 3IIIA 4PINA 3ZH9B 2I6XA 3W5BA 1VJDA 1ST3A 4E46A 1ZH0A 1GA4A 1R6TA 4KLNA 4L6IA 3ZDDA 4AROA 3NUZA 3RT9A 2NVBA 3H3FA 1RLYA 2ZI9A 3DKKA 2JIMA 1DAFA 4KJZA 1DBQA 4HT3B 1D6NA 1FC0A 1SXJE 2BHNA 1QGYA 1V4VA 3DVRX 4I4TF 4AIIA 2PVCA 2VJBA 3BD8A 3JXEA 5DI3B 2A5GA 5JSZA 3EEOA 2HXGA 1DCFA 4BTLA 1XRMA 4NI5A 3DT9A 1T3GA 2JS4A 5DX0A 3WICA 3TCNA 4WUVA 4DV2B 1YMVA 1PJCA 2LCIA 1D1SA 2IVFA 3BL5A 1NVBA 1P0PA 2XITA 3A4TA 3TIGA 3EB9A 4ZV4A 2COUA 1SHUX 4CL8A 1TWAI 1J2UA 3GFFA 2PVSA 1FNNA 4RF3A 2VDLB 2VTDA 3REGA 3WVNA 3LA8A 4QPDA 3N3BC 3H2GA 3GUCA 1NHGA 2DPYA 4GLJA 3P9PA 4BLWA 2AKAB 5TPZA 3G0IA 4ZI2A 2WP8J 4ARIA 1GKKA 1KY5A 4BGIA 2F64A 3RNLA 3A4NA 5GONB 3ZJYA 5JZOA 1KMIY 3RTDA 2CXQA 4QTYA 4K8RB 3NTRA 2PO7A 3BREA 5EXDA 2ZYWX 4R3WA 3EQ8A 3HWWA 2DFDA 3ADPA 2ACKA 4YHBA 2AFVA 3RVKA 5JBNA 1WB9A 3N2YA 3B48A 2DF8A 1N2EA 1WZ2A 4F1KA 2XE7A 3K53A 1RHMA 1MFZA 4XIGS 2FMHA 1CULC 1JQBA 1KJJA 1OF1A 1XG5A 2GD6A 2R1VA 3D7MA 4LBYA 1IIRA 1T1IA 1UZUA 5SZIA 4EUHA 5CEEA 3TH5A 3Q1KA 4A16A 1B43A 1SCUA 3KVNA 2YZ2A 3QFHA 4X9XA 5LA6A 1JQJC 3CCS1 4ZT5A 4NL4H 4U5XA 1MJGA 1RWNA 2I7CA 4KAAA 4A0RA 4AN4A 4AUKA 3HV2A 1SVSA 4M3NA 2GBFA 4WEOA 3RWMB 2BUCA 1HG1A 4ZOLB 2PBZA 2W37A 2RGGA 4XYMA 3I5YA 2H4JA 1I2ZA 2YKGA 3GLSA 5IDWA 2JL1A 2XKKA 4M0UA 4NP6A 1PQUA 4KRGA 1K8RA 3JQCA 4Y2VA 4HVLA 5BSVA 4KUHA 1GLGA 1M6VB 3T41A 5HOQA 4GR9A 4AJPA 1FU8A 4ENQA 2BKVA 3C2QA 3DV0B 1ZIPA 1WF3A 1GL7A 3P4XA 1B8OA 2PMFA 3WBKA 1IY9A 3F6YA 1Q1BA 3NDJA 4N7BA 3OY7A 4XQCA 1A95A 1UKYA 1XHLA 4MS3B 2B5OA 3CGGA 4KPUB 4JT4A 4L6AA 3WKBA 2ZCJA 3DMTA 1YZQA 1O9HA 4NOLA 1XKLA 2I65A 4U5QA 2RMKA 5H68A 5AJZA 3P5JB 1G8MA 1Z4NA 5AKLA 1H6DA 4Z4GA 3JWEA 5G1PA 1YJBA 1E0SA 2D2IA 3CW8X 3WYGA 3JRNA 1DIBA 1H2AS 1XAJA 2QZ4A 2HBQA 4G89A 3I07A 4ISCA 4UTXA 3F6CA 2R84A 2I4MA 3V1NA 1HE1C 4ZXPA 1YUAA 1EX9A 1G2IA 3DBOB 5DGHA 3A37A 3QXJA 1WV1A 5EHXA 4XGQA 2G88A 5AVJA 3T5BA 3G0HA 1BXKA 1U8YA 2Q9AA 4PHCA 3UJ9A 2ZIEA 3CUKA 3UMGA 5LQCA 2DBYA 4PYMA 3QITA 4OJTA 1ABFA 4RHXA 1B0PA 2WFMA 1HNNA 2ZUEA 1Q7EA 1W4BA 2FTKE 3GT0A 1E98A 5ILGA 8AT1A 4UVHA 3USES 1GZUA 4XYGA 5LBUA 4D0RA 3H4MA 3BB1A 3CF4G 3IT0A 3W2GA 3FNQA 3U40A 3U4DA 4RCYA 1AUPA 3MMPA 2V7QA 4LMBA 4MLCA 4C2AA 4PFQA 1E1MA 2I3BA 1IB0A 3R3SA 4U7HA 2IV3A 4HB2A 4BNMA 1HDYA 4XX0A 3HB5X 1G3MA 1JU9A 2NU6B 3ESAA 2PZEA 1PR9A 2GVDC 2YHSA 3HJNA 1MIOB 1Z9BA 3OOSA 1K0FA 1P5FA 1UC4B 1P74A 2BMAA 2UXBB 4M1KA 1TM2A 3K94A 5ALEA 3LP5A 4EFLA 1UK9A 5FUVA 3CVUA 1RI4A 1EGHA 3MNFA 1EP3B 3OX1A 2B8JA 1QUEA 4OBBA 4Z7NB 1Y5NA 4LOHA 1WU7A 1R66A 3EVDA 3D5EA 3OD5A 2Y1XA 4YRDA 2VTBA 2DTDA 2JCXA 3BWYA 5CLHA 2VDUE 3PYXA 2SNIE 3I9MA 5BV8A 5TJHA 5K3SA 2P6PA 1UFOA 1DXYA 4LGMA 4N0DA 5ICSA 4HCJA 1EK5A 3NIDB 3OKPA 2ORWA 1OREA 4G67A 4RU1A 4YRKA 2I1VB 1T9GR 2BWJA 3N8NA 3H7AA 1EDDA 1JGTA 1G2PA 4QE3A 4GPBA 1G38A 3H2HA 2B98A 1HLDA 4KRYA 3S16I 1DT5A 1I4DD 1ZISA 1GCIA 2AF4C 2P5SA 4A3SA 1FU4A 2B35A 3TDNA 4WNAB 5KTYA 4RTPA 2C4UA 2HN9A 1U90A 3H65A 1FFHA 4RAQA 1NUUA 1CJBA 4C07A 1EFAA 3E5RA 3HKDB 2GCIA 4O4HF 1OR8A 1YBMA 5IM4A 1YZFA 4ER0A 1EZ4A 3Q9SA 3P97A 4X41A 2W7TA 2W70A 3HSYA 5FUXA 2Q5EA 3ILYA 3QPWA 5C4XI 1EINA 1KKMA 4KLCA 4PS0A 1Z7WA 2DWQA 2GF2A 5IAAA 1TRKA 1C4KA 2X15A 4FW8A 2BMFA 5KWVA 1GP2A 4PNHA 1J99A 5I7HA 1W96A 4XCVA 3BE4A 4DYDA 1DBRA 1ZXXA 1FL9A 2JVKA 3CC71 2EJBA 4J49A 3TE6A 3ND5A 3KOXA 1A8IA 3LUSA 4OLAA 3AF0A 3F8WA 2NV0A 4EATA 1EFKA 3KUDA 1F3LA 1H4SA 3NXSA 4HRAA 1T4BA 1BO6A 3SYNA 1JEJA 5C1BA 1SM4A 2CB0A 3LDFA 1TU0A 2FG7C 3I45A 5IBCA 5JS8A 2C5GA 2PLAA 1W9HA 1SQ0A 3KOYA 3L8CA 3MTBA 3SNKA 3GDOA 1G7CA 4E5DA 1FMFA 4R8LA 4DE5A 4DTIA 1RYZA 2B4RO 2JFVA 3WK4A 3NCTA 3A6GA 4ETWA 1G59A 1JDNA 4RADA 3JQBA 3EDQA 5J2UB 3HFGA 1EIZA 1ZDMA 3IR6A 2RDMA 2X7JA 1W36B 1GR0A 2G04A 4HLQB 4BNIA 1GPAA 4RS4A 1DRJA 2GPAA 3Q0EA 1XMVA 3Q9UA 4MS1A 3R9KA 4CR7A 4EPXA 4HNAA 1JWLA 4CUZA 5AQEA 3S1AB 4V03A 1R5JA 4AS3A 3HE3A 4XVHA 1QUFA 3G82C 1QGUB 4D3YA 1U1CA 4N3AA 1KI2A 2VHJA 2NO5A 3M6FA 2PE5A 4CKBB 1BCRA 2GVZC 3K7AI 2OD7A 5BSRA 2YN0A 1KEVA 1UJMA 1W34A 4WXHA 5AI0A 2BSQA 5HF6A 4EKEA 3WJ7A 2G1PA 2I9KA 1M5TA 2XRMA 3MEQA 1CUFA 1MAVA 3BSYA 3L0BA 1ND6A 2I29A 3N7UA 4UE6A 1ZZGA 2JAPA 1XEWY 1LS1A 1R50A 2P5TB 3EXHB 3TCKA 1W0KD 4G1BA 4MVJE 1B0UA 3FMFA 1UDXA 1H94A 2C4VA 2QI9C 4YO8A 5IVIA 4N76A 4UQOA 3TVYA 4LF4B 2W6ID 4K9SA 1KC1A 1XZNA 1NV8A 4NDNE 5EPUA 2G5TA 4LRWA 1QWOA 1C0LA 3AVTA 5E9QA 3V2HA 3ADOA 1EQAA 3SBXA 5L45A 3WAGA 4GUAA 1QK4A 1K8A1 1ZBQA 2YXPX 4A82A 1YDFA 1LBTA 4F60A 4G8JA 1D2GA 4KQ6A 2JH3A 3JAWB 2QIOA 1RPJA 1SCDA 2J3QA 1KI1A 1WMAA 3QE0A 4HQNA 3K09A 3J81A 1ODCA 3ZQUA 1VJRA 5INTA 3Q6MA 3TNLA 2WZBA 1Y7PA 2WHPB 3FTPA 1FTNA 4XPIA 1Q0PA 3LCJA 5K3CA 4C0LA 3JR7A 4NRDA 4OQXA 5DDIP 3DZHA 1XZIA 2WFLA 1KPGA 5JSKA 2V7PA 1R6BX 4BNTA 4MQ5A 4YAJA 2QRMA 4FOSA 4JBYA 1TUIA 4MDYA 4ZOCA 3W2EA 1JKJA 1MCZA 5TMBA 2X0IA 2ZTVA 3QELB 4EMBA 3R76A 1VQK1 4IF6A 2VDJA 4L5IA 1JQAA 3RRXA 4RW0A 3GA7A 4D8YA 3C5HA 3I4CA 1SZPA 3NEPX 3GK3A 3YASA 5BVHA 5KOJB 1WMDA 4RZUA 2HBZA 1Z7EA 3AESB 3THRA 4ITRC 3CEPB 1JHYA 3ZH2A 3UUFA 1PHPA 2XUKA 3CJQA 2OGUA 5J58A 3M1IA 3N8IA 1IBCA 5AKYA 4ED9A 1ZCZA 4LYYA 3F78A 3NU1A 5I9MA 1NMQA 4LDQA 2PUJA 2ZT5A 3TINA 3L6EA 3TRDA 4REQA 1WPRA 4JBIA 4Z2YA 4CQMB 4ZYLA 2ILVA 3SJAA 1HT1E 1XQVA 4QGAA 1VLMA 3C6MA 3SXUA 4EPYA 3MT7A 2BOVA 1E89A 3ZXUB 1Y6ZA 2LXNA 4P6VF 4H6XA 4ZCPA 2YN4A 4Q39A 5EKDA 3FTEA 3H9BA 4GRIA 1GZ5A 4OG2A 3CCSZ 1R9NA 4C7OA 5JNTA 1EFTA 1QS0A 1TMOA 1W5EA 1U2ZA 1ZM4A 4GLLA 4HD8A 4QGHA 1DI0A 2LNDA 4H7JA 1YA6A 3U17A 1JR3A 1C9JA 1QIHA 3BG5A 1AQUA 1QR6A 4W5HA 3USZA 4A8HA 2NXEA 2JFNA 3QW2A 4IHJB 4IEIA 3RZDI 1XVUA 4YJDA 4DNPA 4ALKA 1UDAA 1J4AA 2Y6VA 5H70A 5C37A 4E14A 5HIKA 4KVGA 4LJ9A 2JIBA 5DBOA 4KWCA 3WLPA 1F0YA 2RGWA 1UAGA 4FSXA 3VYRB 3L8YA 4YCAA 1T5DX 3ZDCA 3QX3A 4BVKA 1QDLB 2PBFA 5F77A 4D9IA 5IASA 3EAGA 4ZO4A 3F3PC 2M32A 4UC0A 3PQ6A 4Y1RB 3AINA 3DDZX 4YWHA 1DCKA 2L0XA 3G5MA 5BW6B 5FQNA 1PJ2A 3F2VA 2P77A 4RESA 2OYCA 3HR7A 3RUDA 3RS0A 3DAGA 2PS1A 3LYHA 2ATCA 4NBVA 1KTIA 5JV5A 2QPLA 1L7PA 3K8QA 4DSAA 4GZMA 4EPRA 5JZ9A 4OBEA 3ETCA 4BQSA 4MROA 1MAHA 3CFYA 2J0EA 1X3ZA 4L4YA 3NHFA 1GPUA 4MWOA 4XQ9A 3RS5A 1RBQA 2K2WA 4YFYA 3CVXA 1VP3A 5DE3A 3TD9A 1SULA 2RI0A 1E2DA 1OOEA 3PHIA 4JYPA 5EE3A 1MRSA 1W93A 5KJCA 3K32A 3KR0A 5IF9A 3HB7A 3NJ4A 5PNTA 1YJXA 4MLPA 2OHFA 1URPA 3I05A 1F0PA 1N4DA 4KQJA 1DFHA 4OOEA 3DE6X 2V97A 4Z1MD 1U0HC 3CCL1 2XR1A 1OFIA 3IB6A 3BB3A 2CJXA 4GBMA 3IQWA 5DYNA 1CW2B 3Q15C 4EJMA 4MQEB 1JNXX 1Y6JA 4XCQA 3AHJA 1PR3A 3M6MD 2X5OA 3EMBA 3QGMA 2WD8A 5EHGA 5MGNA 1N7JA 3HGMA 4W8GA 4JFRA 1U6KA 2ZAIA 1Z4LA 4C4RA 1E2PA 4ND1A 1C3XA 1PX2A 4MP8A 3FJYA 4P08A 3WKEA 3DCJA 3FPKA 3SD7A 3G9ZA 4PZLA 2I99A 2X86A 4W8OA 2NV2B 3P0FA 2J5BA 5JJKA 4YUZA 4ZJUA 3D54D 3NIBA 4ZMSA 2XMRA 3P52A 3K35A 4XUDA 5KYXA 4LYEA 3A32A 4ZMRA 4C21A 2LDBA 1S7GA 5HKOA 1FMLA 4BBJA 1YNOA 2QGNA 4AJIA 4HGRA 2PJUA 2WJAA 3U48A 5FTKA 1QPZA 2O3TA 4P4LA 3P9NA 2H1IA 1E99A 1KSGA 1WRBA 1NP6A 1TVEA 1QHFA 3MQ4A 5E95A 5DWVA 1LVHA 2O8NA 2ZJOA 2YFYA 2JFQA 3W7BA 3H0GI 2VT6A 3C6QA 4P4NA 3LVQE 3RSSA 2FR8A 3V4ZA 4ECEA 5JS2A 2IHUA 4J1SA 1N5IA 1J7KA 5IVPA 1U99A 5LPNA 2XXAB 2X5KO 1K08A 4GECA 4IL5A 1QONA 3Q11A 4TRNA 1Z0DA 3S28A 1P6XA 3W5HA 2A9VA 4BQEA 1Z6XA 3BMOB 5DI3A 4HWPA 4XJXA 3FPAA 4WDQA 1EK0A 1ZH2A 3GPIA 4JB8A 4KAXA 1D4FA 1TZ2A 5KKNB 2R6JA 3HDQA 3PNPA 4AMVA 4HQFA 4HZUB 3U49A 1G8JA 1ZMOA 4L5JA 3VC3A 1BW9B 5GOZA 1QPBA 2ZT7A 2X7HA 3FIUA 3OQ6A 3L1VA 3WHPA 2A92A 2HNKA 1LK5A 2NW6A 1TWHI 2XMCA 2PUTA 3DZCA 1PYGA 3H84A 3FNGA 4YLEA 4C6HA 4DWJA 4HUJA 4UNIA 3QSYA 1CZHA 4NYMR 2UAGA 5JMTA 1S89A 2FW1A 3MPUA 3N07A 3EFOB 1NM5C 4KLZA 5KUTA 1JJBA 5DP2A 2PYZA 3H2ZA 2P2ZA 3CC7Z 2BGLA 3UWDA 2J9FB 4G63A 1SGWA 2ZBPA 2HWKA 5IS2A 2IZ0A 3P0JA 3RGWS 1Q822 2BMWA 2YZMA 4WLFA 1B0AA 1C0PA 4FQ7A 3RWBA 4Q3NA 4L8WB 2O3UA 3D4IA 1N4AA 1WQ3A 2QZSA 4FGWA 2AC7A 2Q4OA 1YITZ 2RAFA 3DZFA 3OFNA 3H42B 3KV3O 3RVQA 1G1AA 2E5WA 4LX8A 1C2TA 2YZNA 2A7XA 3EIWA 4W9MC 3OWHA 2A7QA 4UZSA 4E2ZA 1GA6A 3DL7A 3LSYA 4LF8B 1O87A 3RTEA 5KSOA 4I9HA 1MX5A 1SKBA 1I4LD 3HYSA 2OFWA 3GLIE 4CUJA 4AS1A 1YOBA 4PNPA 3LKBA 1R3UA 3L3BA 1MAWA 4LZZA 2H8GA 1TCAA 2CBGA 2YZGA 4Y7CA 3VR6D 3OTOB 4IHJF 2FPLA 4IYRA 1IUOA 2OP0A 2EX0A 1UK8A 2HA7A 2O52A 3TLCA 5ALPA 1MH9A 3OO1A 4ZOLA 1QVGY 1YQWA 5L51A 5KU7A 2AUMA 1PO7A 2I6GA 2C42A 2IYVA 2ZUDA 4OQQA 3SZMA 3C3JA 3PKJA 3WZMA 4B6FA 1HBJA 1M1NB 2Z04A 4XM2A 4KCGA 4O6VA 5KX5B 3V7NA 1O0SA 4KNWA 1H2YA 1M6VA 3CCU1 1LDMA 2VSQA 1ECBA 3AHEA 3PQFA 3GZ4A 4MWBA 2QJRA 3DV0A 2Q1UA 4CMEA 4F46A 3N8KA 3ME5A 1J1ZA 4TTQA 3AEYA 2XUOA 5KVVA 1DUVG 1BS1A 1XOIA 3QTLA 2YC4C 1O96A 1U4SA 4V38A 4ZEWA 5CB8A 5DCUA 5HIAA 2FFQA 2VZEA 4FDMA 4MS3A 4KPUA 2L42A 3R24A 1OSNA 4LHVA 3RFTA 5G4KB 3T3PB 3PNOA 1E9EA 1K5PA 3KSAC 2ZVDA 3QLTA 4HFNA 3MT0A 1ADGA 4WVFA 5LIPA 2XRZA 4LHYA 2BJVA 2XGMA 2R47A 4TVBA 3H2KA 1G6Q1 1XVTA 3UK2A 2NYUA 4P84A 4YUXA 2IS4A 3TM5A 1SXJB 2H85A 1G19A 3V46A 4F4UA 3B9RA 1F06A 1LV8A 3HBLA 3FCUB 2C3UA 1GXSB 1CJSA 1AQJA 2EOAA 2RGEA 3GLRA 4Q15A 1KO4A 3OZWA 3UUEA 3P0EA 1Q7Y2 3JYQA 3KXPA 4RHYA 4I55B 1XZFA 3MSXA 4J03A 2Q5HA 4YN3A 3RH0A 4AL4A 2X19A 9MHTA 3HXOA 3BK7A 3FRIA 3I53A 1RAGA 4MA4A 5AK6A 3UANA 5LBIA 2RIRA 1O97D 1GN8A 3L7JA 1XTTA 4QXRA 4W7HA 5DLEA 5K4GA 1J5EB 4CCYB 4AY2A 3EDOA 2FRDA 2QS9A 7ADHA 3PO2I 1QO0D 3D8UA 4A92A 1VQKZ 4XDYA 3JQPA 4PG7A 1MO2A 4RGQA 3WYBA 1JEEA 4EEXA 1QK3A 4LPKA 4RTSA 1JA1A 3T61A 4C87A 1M75A 4G1MB 2NU6A 4DEXA 1MIOA 3IMFA 3KLNA 1H0KA 4M9ZA 4CV3A 4DMKA 2JHAA 4MGIR 3SM9A 1RI3A 2H0RA 2PWYA 1JNYA 4B9AA 3ER9A 1JI0A 4AZTA 5FADA 1AQ6A 4KXNA 3INYA 1N75A 1C41A 3U3DA 4D9EA 1WETA 1CYDA 4QUBA 1NF3A 2WT9A 4ON9A 5JVDF 5DSZA 4M9SA 2DFPA 2W6CX 4JYMA 4ERNA 3K0CC 3RAPR 1JXAA 1N2BA 5K45A 3FWPA 5THXA 4X97A 3GEHA 4A9AA 1P1BA 2PSFA 2W6NA 3C3WA 3IPXA 4GHWA 5HX7A 4YPVA 3TAXA 1RM3A 8MHTA 1MC4A 3MTIA 3T9AA 5B1EA 3R5TA 6CHYA 1UPTA 3TOSA 4A1FA 1JF8A 1H6AA 5CNMA 2V45A 3FOCA 1CR1A 1CS0B 3U80A 2CUZA 2QNBA 1CR6A 2WAMA 4E7PA 1E1NA 1Q11A 3OZCA 2JA5I 2XF2A 1EQUA 3WHIA 4LYHA 1P9RA 3F6BX 4D79A 3X1YA 2R44A 3TSCA 1TFRA 1XDWA 4UNQA 2LCQA 1IM8A 3BK2A 4MRSA 2A1TR 3VU8A 5MN4A 3FAZA 1KYQA 5HF8A 3GVCA 4WNAA 1UXIA 3CVVA 3LLCA 2GILA 2ZRLA 3UHOA 4LSMA 1FUIA 1T1JA 3HKDA 1ZCJA 2G67A 3HA5A 5F5NA 4WKCA 2IIVA 5I9TA 2VTEA 3RJ5A 3LIPA 4C1BA 4R6WA 1TFIA 4GL4A 4U2DA 4AY3A 5FBZA 1TQ6A 5L3ZA 3C45A 2Z30A 4NYJR 4F8YA 2PLFA 1KHHA 1LZLA 2IZ6A 4BY1I 3RVMA 4UBNA 4DA8A 2NYAA 1F9EA 1EP2B 1QZ3A 1G18A 4P7KA 4HAVA 1I7PA 5D5QA 4P98A 1ZD2P 3IE0A 4XUCA 1YFZA 2J5KA 2GYYA 2Q3LA 4GOND 5IN4A 1JSLA 1LLCA 4GR5A 1H5NA 1YQUA 5DTRA 4C0SA 1ZOIA 5BNWA 1IEQA 3UJHA 3TM4A 3WK6A 4H08A 4UBIA 2HHAA 3RBZA 3PC2A 4PO1A 5K03A 1C50A 1F6BA 1I33A 1YB7A 2AUTA 3GFGA 3H04A 3IAAA 2G9VA 5DO9A 5AW3A 3CCBA 5C5IA 1J00A 1WX1A 3FJ1A 3NH6A 1ZRNA 1XN1A 4G4JA 4MEAA 3KR1A 5BSGA 1K6JA 1M83A 4CG0A 2AXPA 3FCOA 2HO4A 5J2UA 2H63A 4LMRA 5HMMA 1SVIA 1UANA 3QV2A 2IHZA 4FFLA 1E9VA 1GILA 2EC5A 2I6TA 3EXG1 3ZX4A 4Q4AB 3LDHA 1C7QA 2WG2A 3IUJA 1UOPA 4BBZA 3S1AA 4D4IA 1OZGA 1E9FA 1W4RA 4L02A 1J0AA 2HRDA 1QGUA 4WK6A 2WNHA 5CVEA 1VMDA 2XIJA 1TWGI 4QGSA 3DDOA 1XDBA 3GEPA 1NRJB 1Z0UA 1FS5A 2Q6OA 1PJBA 3CH7A 4NZNA 3RVPA 4BFUA 4XXHA 2DETA 4QJBA 1IAQA 3QBTA 3RE1A 5DYWA 3O9MA 1VSVA 2X5NA 2G28A 2G1AA 1L5HB 3I9JA 1V9SA 5JJ5A 3N39C 2EDCA 2VJLA 3OIFA 1TO6A 1TUGA 3EXHA 2RHBA 3OFVA 1GG8A 2NAFA 1IPEA 4GI2A 4H1HA 4UDOA 4OQYA 1Q57A 2OECA 1KZ4A 2XDWA 5CT5A 3Q3HA 3VKVA 2Q45A 5LJLA 2GF9A 1T29A 1G8KA 4RE6A 4BE9A 2QY9A 1O5IA 4PBSA 3HDGA 1SIWA 5JQGB 2PD4A 1TK3A 1DS6A 2ODEA 3KUUA 4IKEA 1J9ZA 1PR5A 1EWYA 1W5BA 2BBTA 1DX4A 3D8BA 4PYNA 5FAKA 3JAWA 1I32A 1ESMA 1A8HA 3WP1B 5TQ0B 3ND7A 4JC4A 2Y1WA 2R85A 1RQRA 4QICA 4GX5A 3IERA 2B2XA 1DAHA 1VQO1 4BTVA 4UASA 2OCKA 2WHPA 4UATA 4NX2A 2D1SA 2EU8A 3O3MB 2R6ZA 3DONA 4KH1A 2GK6A 2WICA 1QZTA 1DQYA 2IELA 1HL3A 1UKZA 4PSVA 4AS2A 3E2PA 1L5WA 4NOMA 3SS8A 4M53A 1IPHA 2QAIA 5DLYA 4EI7A 2PM9A 4F3CA 3I5XA 4MUXA 1G20E 2VT7A 1XMJA 3QELA 1WUYA 4E2YA 3M2PA 3UA3A 5B7GA 5JE8A 4OHBA 5KOJA 3EVCA 3K6JA 4MO9A 1VXOA 2FPOA 3RUEA 4LSWA 3AESA 3NGMA 5B6IA 1NBMD 1OLXB 3Q9LA 4OA5A 4BL5A 3I32A 1QRUA 3T7AA 4B6SA 1ZXBA 3V4OA 5F2KA 4IDDA 5FUBA 5E3HA 4DWWA 2CEAA 2QD5A 4L3WA 3WL6A 2OAQ1 4L50A 1KK3A 1PQ4A 2QVXX 4AJEA 3DWIA 3E5NA 2Y6UA 4CQMA 2AVDA 3D0OA 2L82A 3FPCA 4XPZA 5LP6C 3RT7A 3KOUA 1R6AA 1ULZA 1AK1A 4D8XA 3RB8A 5EP3A 3D4LA 3JQFC 3UKOA 3T3DA 2CVZA 1BKDR 2BFMA 3ONVA 5HZGA 3DZ8A 2YIJA 1JJAA 4BJHB 2CF6A 5CTAA 5KKAA 1FFBA 4RXUA 5HQJA 3T1YB 3VU1A 3PEFA 3D81A 3BWDD 3F7TA 4PCLA 3V8EA 5CG1A 3GGOA 1L1QA 1EX1A 2FR0A 2TRSB 3RRNA 4UCWA 1JJ7A 1V8PA 4WECA 4IHJA 4LE2A 4PLPA 4MJ3A 3FI9A 4PPQA 4W1QA 3RG2A 3IUEA 2OAGA 1OAKA 5B58T 4B76A 3GVXA 3IQHX 4B5LA 3GARA 3CCUZ 1E6KA 1EWKA 2QVGA 2Y4NA 4DIEA 2E2II 1II8B 1NF8A 1JT9A 3C16C 4NYIR 5BNZA 5IABA 5FTLA 2JIOA 4UAJA 4Y1RA 3V3KA 1UF9A 3R77A 1E5XA 4GUDA 2VZ9A 4LRXA 3KLMX 4TL6A 5CX4A 3NBMA 4NCNA 4FQ5A 4LCEA 1Y7IA 3I6MA 4P5DA 4UEJA 4Q66C 1FX0B 5K09A 1HFKA 4PHTA 5E4TA 5KTTA 4MV9A 3IV7A 1NJI1 1J5XA 1Y1QA 3KQOA 2OXCA 2AN5A 2N75A 2RSLA 3OHSX 4DLRA 1OFHA 3O47A 1M73E 1P1HA 2BFDA 3I6YA 5FO0A 5LXTF 2A0FA 1DL5A 4LVUA 3JVEA 4E09A 1JDPA 1MAUA 2P2LA 3ESWA 5EJMA 2ENWA 3NBKA 5KEIA 1E3MA 4M55A 3VXKA 2CNWA 2WF7A 2AF3C 4D92A 5LQAA 4QQFA 1QKKA 1R16A 3DD1A 3WXMA 3ID6C 2IU4A 3H5VA 1JAZA 1VSUA 2OQVA 3EBPA 1WJ2A 1P72A 2JZNA 3IKJA 2V6JA 5BWMA 4MQEA 1CRQA 5K3DA 1KYYA 1WCMI 4IJVA 4TKMA 3OLZA 1XF9A 4UDNA 5H0IA 1E1DA 2VUGA 2PXAA 4DUPA 2E21A 3THXB 1OZAA 3UIEA 2IU3A 2CFIA 1AVTA 4N7RA 2XSZA 2B4QA 3A06A 3UF0A 4HEA6 4NR0A 1OMOA 2MSNA 3GDGA 3WGKA 4DA9A 3STWA 3TLGB 4JXXA 2OORA 1F48A 3K5WA 3EMVA 2O2ZA 1OWLA 3DWGA 5AM1A 4A3DI 5FL7A 4EHAA 4OP1A 2W71A 2JARA 2QUZA 3ETHA 3EZ6A 2CXHA 4XARA 5DTEA 5FI0B 3BXOA 1MB2A 1U1GA 1VIAA 1WW9A 3Q87B 4IUBS 2JCGA 1ZK0A 4P9NA 1DOHA 2OXRA 1IM5A 2FKAA 1YVRA 1Z6PA 5CCEA 1DAIA 2WAAA 3N0XA 2H1CA 2OVBA 5ALTA 5BWOA 1RHUA 1DWQA 1H66A 2V6FA 1JEOA 3L1HA 3GRUA 1HFJA 4PPGA 4WCDA 3JD0A 1P4GA 1E79D 3LGXA 3U50C 1UAAA 2ZI7A 4FNGA 3AF1A 4RELA 2GEJA 4ZYXA 3MA0A 1PLKA 3GA0A 4H4DA 3RUHA 2XXAA 1DNPA 2Q4ZA 1QG4A 3A1DA 3A70A 3M0EA 3S1RI 4LF5B 3DLIA 4KIJA 4P7GA 2ZRIA 4OI4A 3QBJA 3O8LA 1ICIA 3BMOA 1N6OA 1X1EA 4OGKA 4ZT4A 5THQA 2B6NA 2JHFA 2DCUA 5ER6A 3C3KA 2XHEA 3DZGA 3AETB 3HUTA 5SZHB 4F96A 1NVKA 4UBOA 3DLAA 1RM4A 3MWKA 4HZUA 1UEJA 5GOTA 3ZV3A 4DLNA 3GEMA 1BW9A 4QXMA 4FGSA 1DO0A 4TXJA 4DMLA 3NKVA 1F2DA 1L4BA 1JAXA 1A4UA 4ND6A 3ZHSA 1DX6A 1E7YA 1SKAA 2ID4A 2J87A 5F1OA 4TPKA 2JG3A 4M60A 3WL8A 5J1SB 3ND8A 4N12A 4LGYA 3VM6A 3AP1A 5JPCA 4DK1A 2DHQA 4REOA 4FFDA 3EFOA 4CG2A 3BD6A 1L7EA 2NYRA 1ZMTA 2ZT8A 3Q40A 1UPUA 1NW6A 2V3WA 3IVMA 3SP1A 1CUCA 1SVKA 2J9FA 3MWYW 4R9RA 4BXXI 1CQXA 1PWHA 2CBXA 4OLJA 3UYKA 3GFPA 3WBFA 3GNLA 3B7GA 3KAKA 5AW0A 3OX4A 3NOVA 3DOUA 1YIAA 4FILA 3CT4A 2Z4TA 5KNCA 3FDXA 4NC9A 3SJZA 4B2YA 3EGXB 5ECGC 4ETNA 1OBCA 5K8VA 2VAWA 1TQDA 4KYUA 4RQUA 3IE1A 2XAAA 5JU6A 2ISQA 2OGSA 3H5LA 1G2OA 3IOCA 4PZCA 2GAAA 1COWA 3HEBA 1G7RA 3IIEA 3QNMA 2Y71A 4R2KA 4RMJA 4RBNA 1JL3A 3EQ6A 3WAKA 3PICA 3VZRA 2I1QA 3OW2Y 4C29A 2DLNA 4ZAVA 3PFFA 4OA8A 5CM9C 4CNBA 2KHZA 1DTEA 4YMSA 4HX2A 3VUEA 4HYTA 2J6IA 1TAQA 3OZSA 5GZ6A 3C7AA 3PGA1 2MIIA 2W0SA 1M1NA 4AX4A 2ZUBA 5TX7A 4HQ6A 5E7MA 4M1WA 1N0UA 2HMTA 3BQ9A 4Y98A 4DOMA 3KZXA 1P29A 1UBJS 2HGZA 2WAYA 1YS6A 3ICVA 4KKXB 4MVJF 4QXOA 1OC4A 2BP7B 2HPAA 2QG6A 3I9FA 3NFRA 1RWMA 4MTCA 1O9GA 3TQSA 1N2CB 3JVIA 1ZK2A 1OB2A 5I4BA 2R7KA 3FDIA 4PC7A 4XDHA 2QD3A 1FJXA 2J0QA 2XVXA 2IF2A 4GOXA 3PXAA 4CL3A 1M5RA 1K732 1FSFA 2NNWB 2MCFA 3KK0A 4JQZA 4Q5IA 5G4KA 5EFZA 1PZXA 3MD0A 4IWXA 1I2AA 5LYJF 4D4KA 1U2PA 2G9QA 4D0SA 2JRLA 3F9CA 1FFEA 3OWOA 3QQPA 1O97C 1SXJA 1Z6ZA 4JKYA 2VQ6A 3EVNA 4JJEA 4HGPA 2FYTA 1ZY2A 4QBTA 4RJKA 1WL8A 4TWRA 2F55A 1FW6A 1GXSA 4BMXA 4OHXA 3H2JA 4PC6A 2FSUA 4FZVA 5AHWA 1JE1A 3GTKI 1DO8A 2B20A 3AL3A 4Y2SA 4I55A 4WPGA 1Q44A 3ZJ5A 4PGAA 4NKRA 4QOSA 3VI4B 4HADA 1VQOZ 1IDN1 5EIAA 4H3HB 3UK6A 3MJSA 2O8CB 2YU9I 3ABQB 1X70A 1J8DA 1I4OA 2QDXA 3KG2A 1WCWA 2JI4A 4BNXA 3QEMB 2WDZA 4NBTA 2PGLA 3TB6A 2F67A 4CCYA 1Y42X 4N7JA 3S7ZA 1IQPA 1QJ4A 2WJ4A 1W581 4PRYA 4X1KB 3GLGE 3AB3A 1NLYA 4HH1A 1ODSA 3SCZA 3UAVA 3RRZA 1JIXA 3N53A 2ZDGA 3WO1A 3HOYI 2H07A 2OK8A 1YHYA 4H1UA 4OHFA 4LSGA 3WB1A 5BQFA 1P19A 1IONA 1E0KA 1IN5A 3BRSA 3PNBA 1HG0A 1KAEA 4H35A 1Z0FA 2WWRA 4I1OA 3CKKA 1DBWA 4JB3A 1B4DA 4Z9BA 3GZTB 4HX5A 2HJVA 2XUFA 4IIVA 3O0DA 3OQOA 3EEQA 2WE8A 4A5SA 4QASA 5LVAA 2BTQB 5ALQA 4X3OA 3HZZA 2AMLA 4KFTA 5EE0A 7MHTA 4CMCA 2BLNA 1W29A 1PIWA 3H5AA 4M9QA 3GDFA 4PXYA 3R1IA 1YUNA 1Y6FA 4YCLA 4P7BA 2LR0A 5FNVF 3MS2A 1KO1A 1GAWA 1U8AA 2HF7A 1JHMA 3L82B 3DE1X 1K8QA 3OPQA 3RD5A 1G98A 2H5JA 3VMFA 3W79A 3A6PC 1K8YB 1B8PA 3GU3A 1WSAA 3GBVA 2E6KA 1Q6ZA 5EIHA 1QU2A 1L6RA 3ZTWA 1WXXA 4QHSA 2VNKA 4YRQA 3R0XA 3QV1A 2AZXA 1CS0A 2AXQA 1NVDA 3L92A 1I7NA 1M74A 4FGJA 4LY3A 1FIUA 4J0FA 4AQ7A 2AR0A 2E4UA 3GYBA 3OM1A 2P1ZA 2DJ5A 2AA3A 1CUWA 2J5QA 3IFSA 4U6QA 5HCNA 2KM1A 3BRCA 2HFJA 5BYAA 2AFHB 3RF7A 4UHJA 3DHNA 1AKUA 4L16A 5HKKD 4CM8B 5JZMA 2IDZA 1D2RA 3ETLA 3EIXA 1A8QA 3P32A 2WLSA 4UZEA 2IH2A 1KJYA 4OOFA 1N77A 3P19A 1B0ZA 5ELXA 1EM6A 4X8HA 4MUHA 3C1TA 5ERXA 1E9AA 1SO8A 2UZ1B 3NUQA 3OI7A 1ZA2A 3GEGA 1X14A 1YS4A 1TT5B 3FOAA 1OW3B 3OEWA 4L78A 4ZQEA 3VI3B 3F7OA 4L8VA 3WGTA 3WRYA 4ARBA 4I8DA 3QE9Y 2KQUA 1PFGA 3JQRA 4NAUA 4CL2A 4HAOA 5F73A 5UKDA 3PCRB 3L2OB 2F43B 1IIBA 3CLTD 1PKXA 1KH2A 1IY2A 5E2IA 2FUEA 2FZCA 3DEZA 4PSCA 5A5FA 4U9UA 1NNEA 2CT8A 2FMXA 5KWSA 1U0LA 1XDZA 2PRJA 1YBHA 5AKIA 2RGXA 2C99A 1OA0A 3DEHA 2VYVA 5GJWC 5AOAA 2QB5A 3AB8A 1LBIA 3CBQA 3WMEA 1UOOA 4CIYA 1VLLA 4E1VA 1GZ6A 1YD7A 2DG2A 2FPMA 2LV8A 5EJ8A 1JEDA 5EXEA 3DXYA 4DBLC 3QVWA 3U56A 2J3EA 3UUGA 5KX5F 3IAUA 2CY0A 4QQ8A 4Z0HO 1DEKA 1QH8B 3MGCA 4CV1A 3ED1A 2MYPA 3N7AA 3W90A 3VU3A 1AS3A 4IMPA 4DABA 1E4OA 2IIQA 2JFPA 1QDEA 2B8EA 2MSKA 1VQ81 2YFQA 5F2OA 1JIQA 3ZNPA 4YAUA 1MB4A 2VDVE 4HYQA 3U4CA 1V5WA 1AO0A 3GLHE 3LX4A 1X7YB 4TVKA 4K28A 3NVMB 3VC1A 2FWAA 4BCCA 2QSZA 4R71A 2JKVA 4Q4AA 4YDSA 2FSPA 1EZZA 3OSZA 5TEVA 1VQ4Z 3T38A 3FOZA 5CVJA 1DX9A 3VZBA 3DKRA 3HC7A 4XWYA 1RRCA 2NTNA 2YJ3A 1WG8A 4UNNA 3O83A 1LLQA 4DR3B 2Y99A 1P3DA 4JI6B 5CA1B 4RTRA 3DGFC 4IIEA 5MN6A 2ZIFA 2C1ZA 4WXPA 4IDCA 5EERA 1U6JA 2Q1YA 2YWXA 3AUYA 1GU0A 1CXZA 3CIOA 4FEEA 4NH0A 2LIYA 1G9SA 1ZIDA 4KE6A 4W7SA 1JSXA 3KSDO 2JAOA 1HE2A 1ZWKA 3W5VA 3UPTA 4GPIB 1L5HA 5C5DA 1Q7CA 4KUEA 1H1DA 2VF7A 2QEX1 1TCBA 4OI2A 3EGOA 3VKHA 3CSDA 1OJ7A 4FBMA 4PO9A 1ZJWA 4NBFA 3EJ6A 4RFVA 3PCTA 5REQB 4OBXA 1T0IA 4FKBA 4Y2QA 2OHIA 4PYRA 4HWKA 2XGJA 4WIAA 3O1LA 3OCUA 5LZ7A 1DEOA 2OWDA 3WWEA 4BKMA 4BLQA 5KTNA 5KQGA 3LFTA 1X92A 4NY1A 1AKRA 2ZUCA 1CX9B 2ZJ1A 5JS7A 4HR7A 5ALSA 3KU1A 3KPYA 3CINA 4HH0A 3JAMA 4IJUA 4RQBA 6REQB 4TLAA 3THSA 5AK4A 5KAMA 4C7BA 1TJ4A 4C20A 2HMUA 1VL6A 1N0IA 3H86A 1FVFA 5TQ0A 3S1LA 3R8CA 2HO5A 3EYAA 1YKFA 4KI7A 4R16A 4OLFA 5I7UA 3AJAA 1CF2O 4Q9NA 1DC8A 4BO1A 4ZYUA 3NTLA 4FC7A 4QBHA 3I4MI 1ZJJA 3ESRA 3ZW8A 1K27A 3AQIA 1L7BA 1CUZA 1NXOA 3DEKA 3L7MA 1I8TA 3L7CA 1RWOA 3ZGLA 3PIRA 1XCJA 4L57A 4IDQA 1UMKA 1YDHA 1ZVVA 1JAIA 4X93A 2JJYA 4RANA 2JBHA 2QTTA 2VJYA 5HGXA 4YT5A 4IVQA 1WZNA 4JBGA 3QYJA 4RLHA 2JIZD 5K0NA 4QJIA 1AF7A 1Y9ZA 4M38A 4WCFB 1L5GB 5BP7A 5A2QA 1A9XB 4B17A 1OLXA 4DV3B 1UK6A 1O58A 2XI4A 4JVMA 1MW9X 4R1QA 1MNAA 5IXSA 5JEEA 3TSOA 4TS9A 4PX3A 1GZ7A 1QG2A 5FEMA 5AVSA 4BMPB 4RV9A 1S5PA 4MGEA 1RRPA 2BGWA 3GT7A 2WKRA 3F67A 3UM9A 5JW6A 2GN9A 1KNXA 3SKYA 1NKVA 1XUOA 4N3CA 2W83A 3DFFA 4MJ7A 4NE7A 2BMVA 1TK2A 1W8DA 1T1EA 1Z2DA 2QN3A 4HNGA 5EGNA 2VSNA 1VQLZ 3FROA 1Q7GA 3GCGA 4UHFA 4KGDA 1XWWA 5FBRB 1BS9A 3IEPA 2WINI 3GD7A 4I3FA 4OHMA 3L7LA 3PITA 3FPFA 2JLCA 2CFRA 3T0IA 2ONKA 2WB4A 1IG3A 3BC1A 3KWLA 3QJYA 4R2XA 4UUBA 5EMJA 1QGOA 4WL0A 3SYTA 3UK7A 1OASA 2GDJA 5A4DA 2NSJA 4PF1A 1JT2A 3R7NA 2GERA 2NWQA 1I5OA 3X2EA 3G0GA 5FH9A 2VJOA 1YT5A 4B81A 1RC1A 3SYRA 1Y33E 4CLOA 3RPEA 1AQNA 3D2BA 4L0QA 4FCCA 4QYWA 2PLRA 4GSKA 4DLZA 5DNCA 2WTEA 3DFMA 4AJOA 5DYIA 1P2TA 5JCZA 4YGXB 3LNCA 1M1YE 1OXUA 3M81A 4RHTA 4YQYA 2JAWA 8ADHA 4NBEA 2QTFA 4RH0A 3LJKA 1II8A 4KQXA 4YQZA 3IBCA 2X77A 3KR2A 3LC2O 5EQTA 1CDZA 3OC0A 3V9PA 1PJLA 4IAOA 1D7OA 2HCJB 5DLPA 3U31A 3NHLA 5JYEA 2ZTUA 4B6PA 1RWVA 3R3VA 3CVJA 3I04A 3ZCUA 4E33A 4MPJA 5L95A 1FX0A 1IHOA 2J3IA 3BEOA 3MGAA 3AC0A 3NX4A 4BUZA 1TZCA 1C8VB 3I8XA 5AM0A 4B3IA 1RQGA 2DERA 4CKXA 4F3NA 4YR9A 4XWAA 5EJAA 1KH1A 3V8PA 2RHMA 4BLTA 4L5AA 2ECOA 2B9EA 2IEBA 4IXDA 4D56A 1FJGB 4N39A 4PZAA 4EG3A 1SIUA 3PF8A 4ZJYA 1Y89A 5CFRA 2WNSA 1ODJA 4HXGA 3MCAA 5JQWA 1UXJA 4CF3A 5JS6A 1PK9A 1GRRA 4NPHA 4WKGA 4LQLA 5BNIA 3X2FA 2HSEA 1ONSA 4FLEA 1MD9A 5KHAA 3URMA 4DCJA 3FHOA 3HPRA 5ALWA 4BUJA 5T7BA 1XI2A 3S29A 4TMKA 1D8TA 2FZWA 1T25A 4EMSA 1FXUA 2WI8A 4DCVA 5EAIA 1BEZA 3F49S 3UHJA 2HQRA 2Z1MA 2QTCA 2GTPA 1TXGA 1QDUA 1QRTA 3A0RB 2G2KA 1AO3A 1UP7A 4JL8A 2CZGA 2O8FB 2WIFA 3KQYA 3PTZA 2B2CA 2JEYA 4L5BA 3BHJA 5L7WA 1USUA 3U3KA 3DVLA 3KQTA 5AI9A 3THXA 3VDRA 2UUBB 1SVNA 2DE0X 4YPOA 3FZQA 1U9YA 3KQWA 1G4AE 1P2VA 2E1PA 1BYIA 1GZ3A 3K2IA 1IVYA 2GZ1A 2QOEA 1OI7A 1CUBA 2NLOA 3DFIA 3EPRA 2UVPB 3TLGA 3DP7A 4RF4A 2REBA 4TS4A 4KXXA 5FLXA 3COSA 3A9SA 1YR7A 1GG9A 2ZAMA 3CLVA 4Q34A 4UE3S 1NUIA 4HGYA 1QFYA 4TLBA 5TT0A 5TV2A 4N4AA 1MF7A 5BURA 2QW1A 1TTQB 2G70A 3Q87A 2PKQO 3ZU3A 4AULA 2DUUA 1E2MA 3H6KA 1E6WA 1R3DA 1VB3A 2B1RA 1RP7A 1R0RE 3FZGA 4B87A 2FG6C 1WNFA 2GZ2A 3AP2A 1KE2A 2OFOA 1PUIA 4HB0A 4ZGWA 1L4FA 3LD9A 5JROA 2BFAA 2IDKA 3DVAA 4I6EA 4JSTA 4DTCA 4K0KB 1JQKA 1QYVA 3ZOKA 5DCWA 4Y2HA 2JRCA 4D44A 1KI7A 1T3ZA 1ITZA 2IYAA 1U7TA 3HCDA 4LZJA 1OBFO 4KR2A 4QM6A 1GJRA 1QH0A 3N87A 2FPSA 3PFBA 3U5TA 5EEHA 3L0DA 1W2BZ 5JSUA 121PA 2XCUA 3PC3A 1E59A 3FVTA 1KY4A 2JH8A 3MILA 3MWFA 1RU3A 3OG9A 4L8GA 3NMUF 4W1PA 1RMQA 5IBRA 1CK4A 3ODGA 3G9TA 5LZ2A 3L8GA 1KP9A 4Z2AA 1XJWA 2WQZA 4JR2A 2RG7A 1YH3A 4A0GA 3NM6B 3IUPA 5I7FA 2DFNA 3AETA 1WPXA 2GHRA 2O2DA 3G2MA 3JZMA 2I62A 3A58B 2OENG 2WV7A 3HOVI 3TMAA 3I5UA 1C5KA 1P0CA 1PL6A 5F7JA 2VHZA 1HE4A 1YE3A 2JIRA 1TRHA 4MKZA 3UWMA 2GCEA 4ESEA 4ZHQF 4C04A 1LJLA 4JH0A 3J81k 2NZVG 1U0RA 3UCEA 2AD1A 4JHXA 1QTIA 1Y9AA 5BPHA 2QRGA 2DM6A 2JJ2A 4DXHA 3PX7A 5EFOA 2PZ8A 5EE1A 3OBBA 1FYDA 4K3UA 1MBZA 1EXVA 2VDQB 3Q8WA 3TLAA 4Y6OA 3QLJA 4E31A 1IDOA 2O0LA 4LF9B 4B8ZA 1T8TA 3SBOA 1N6RA 4NZPA 3KD2A 5F9HA 3KXLA 3LI2A 1H0SA 5FYDA 3LWDA 3A2KA 1MRNA 3G3EA 5DBEX 2YICA 4YT2A 3RYTC 1T5BA 1KQFA 1WD5A 3CKLA 3I28A 4J29A 3JY6A 4C6TB 4LXTA 3EGXA 4ZVMA 1DZ3A 4D3SA 5MN5A 3FSEA 3P2OA 4GG1A 4DREA 2Q0QA 2WOOA 1POXA 3NV7A 3ZZ1A 2PLNA 1YS9A 4MMXB 3E2MA 5E7QA 2BEJA 4YPFA 3I83A 1N2JA 3DE7X 1T35A 2XCOA 1OXBB 1PX0A 1MA0A 3GW8A 2AJBA 3NH9A 5DASA 3RVSA 4XVQA 4JBNA 3P26A 1OAAA 4CV2A 3JQDA 1ATIA 4OATA 2XWJI 4JLSA 4PZZA 2P8JA 2QTLA 2NPFA 3ER8A 3G6WA 2OV2A 3I1FA 4CMKA 3H83A 3O4IA 2J67A 3PVSA 3PHBE 2Q4BA 4CCAA 3OLYA 2QMUA 3OIDA 2ODBA 3E1KA 4NBDA 2R60A 3AH8A 2BP7A 1V8DA 3D6TB 4GNKA 4YDHB 1JIIA 4FE3A 2CLKB 3EGIA 3O38A 2IV7A 4EECA 1N2CA 1SAYA 5LQNA 3KFLA 4BFZA 3HM2A 2PGDA 5DRYA 1KFKB 1N7GA 1U6IA 4TL9A 1N34B 2CKMA 2YWBA 2GPJA 5A3QA 2D8MA 4NG5A 1DV2A 2GBLA 4BZXA 4DLBA 5LDDC 2VHYA 4ZPXA 1R6XA 3OUZA 2RH8A 1E2LA 4IG9A 3J81b 2GWHA 5K8CA 1J56A 2IKQA 2DHDA 5I3ZA 4BFLA 2GM4A 2BGTA 4J0EA 3W7AA 4HNTA 4GDFA 1MA3A 2HF2A 3C4VA 4AU1A 1NUHA 2D0IA 3M49A 1KU6A 1QV7A 4HTFB 5K1ZA 4MIEA 3VO8A 2ET6A 1O94C 2RONA 3QMPA 4NEGA 3BEDA 1PS0A 1U8XX 2TECE 3F1LA 1S1CA 4YEDA 5ALIA 1DRVA 2HQBA 2O1XA 2VBGA 4NICA 3LY7A 4RA9B 1D09A 2P4HX 1DJLA 1NVXQ 1OHHA 4WBXC 3GNTA 4AMGA 4AO6A 4BFVA 4DG9A 5JLJA 2O8CA 3BH6A 3ZHQA 2RBLA 1CNEA 1HDXA 1I51A 3CUUA 5BORA 3COYA 2WOJA 1KQSZ 3QEMA 3E05A 2VXYA 5SYMA 1U2GC 3VR3A 3ZDEA 5ESDA 3BIOA 3IEVA 2PD6A 4IV8A 1BH6A 1GTMA 1GCGA 5F35A 2GJAA 1T9DA 3G5TA 1YWGO 2B9VA 3FWHA 3QVOA 3ZD8A 1DRWA 4GP9A 3H5WA 4QUEA 2LWIA 4LJAA 1UBKS 4POAA 3ZWQA 3MGKA 1SPXA 2OCYC 2JIQA 1LI4A 3EZ7A 3L4KA 3U7FB 4EVRA 4BNJA 2Z8ZA 1FP6A 4XX1A 5A5GA 4KI0A 3NHJA 1U7XA 4LRSB 2VQ3A 1VL0A 4A3FI 2I34A 3FPHA 4UXJA 4C3OB 3AF2A 4HK4A 3CUVA 3SHFA 4YB8A 2QYTA 5F52A 3E3NA 4JI4B 1KEEB 1YUMA 4I6GA 3AKCA 3HB1A 4NCJA 2WJ3A 4Y8VA 3E2IA 3TZBA 3L6UA 2EW2A 2AEMA 3CU5A 3UT0A 1CZUA 3ZCXA 1MORA 2YMQA 3L8ZA 4P8RA 1BE8A 1PQPA 3BIFA 3OJXA 4MB6A 3KAJA 2FF5A 1ACJA 3S15I 2ZVPX 3EASA 1JDUA 1TTHA 3SDZA 4MRRA 5KU1A 2R4UA 3C41J 2BONA 1FVXA 4H3SA 5KYTA 2H5EA 3EFEA 3KM0A 5AVKA 4TSFD 4IR7A 2V3VA 4LXUA 2F62A 4RIGA 4O3MA 5FV4A 4OGGA 5HM6A 3KYIB 2YYYA 4US0R 4UOQA 3RYHA 1HTTA 1WR8A 2GARA 5F7ZA 2ZJ6A 4P83A 3VGPA 1LBQA 1SVUA 1NQAO 1ONOA 2AFHA 5JMWA 5I4IA 2GCOB 4CM8A 5LQJA 2M2IA 3ZS8A 3CLTC 4E13A 3I8SA 1L1EA 4GR4A 3BULA 5EMMA 1QCDA 1KI8A 3L4EA 2NXCA 1AURA 2GN1A 2QAGB 4HN9A 4AJ4A 3HCBA 2QK4A 4FHCA 1GT91 5TLSA 2XEDA 2WJZB 4LK3A 1V6CA 1JG3A 2A67A 1TO1E 2UZ1A 5DMXA 1RYDA 4MZXA 1ZK3A 1KERA 3DJFA 3WLOA 1PBNA 2AN9A 1J20A 2BZ0A 3KJIA 4LN1A 1QF8A 1IBRA 4WVLA 4MPRA 2QI9F 5LUBA 4ERXA 2ABWA 3D8NA 4FZ5A 2F43A 2OXEA 5DTJA 3HBNA 3NWPA 4BLSA 1RMTA 2VF5X 5EKUA 2O0JA 1AUXA 1QZXA 3DQZA 3SXPA 2WQ6A 3RKRA 3QF7A 4BQNA 1JYFA 4DIDA 1DEXA 4Q9AA 1P4JA 1J5PA 1QVRA 1QNFA 1FFCA 1TL7C 4FFBB 2OG2A 1DAKA 2O48X 4LYGA 4UREA 4XJSA 4D8TA 4US2R 3OP1A 3NT5A 2CDNA 4G0ZA 3VZPA 5H9VA 1D4ZA 5JRZA 1QH8A 1W44A 4GYJA 4J90A 4AUMA 2W2XA 4EZEA 2CE2X 4LVNA 3KX2A 4L27A 1MHPA 2BR5A 2CWDA 4C06A 3C3MA 1EUZA 1MPTA 1E64A 3CPSA 3CNHA 2WJPA 3NP7A 4ZQFA 3FIJA 5EXTA 3TS1A 2C2XA 1V25A 4BZZA 3LCVB 2FPRA 2OVFA 5C53B 4IMIB 2G77B 4F5EA 3DWFA 4PNEA 4KBFA 2IXTA 1G8YA 4P22A 4I3GA 1K9VF 3AVVA 3TI7A 1Z8NA 3W3AD 3BWVA 3J81f 2GJSA 1B6RA 1ZVJA 2ZB2A 4TMWA 3ORSA 4WKBA 2WU1A 4ZEXA 4EFMA 1JEAA 3VZCA 1A04A 1TZBA 5BSEA 4YRCA 5CA1A 1P39A 3R6GA 1E9RA 3IQEA 4MQUA 1TWFI 2CCGA 2HLDD 3F71A 3F9RA 2ERYA 4P0QB 1M2OB 3S68A 2K7FA 4V2IA 4BATA 4LC0A 3PLRA 3QXHA 4F86A 1L7OA 4ARUA 5G3ZA 2BH2A 3B5JA 1C0KA 3Q2KA 1RBMA 2XT9A 3HXTA 5JRDS 4QUKA 3VR5D 3EERA 5REQA 1GNVA 4II3A 1DKUA 2W6JD 1XELA 3E9CA 3EDCA 4KK4A 1P7WA 1EX7A 1JHQA 1VE7A 4BKPA 4LF7B 1Z18A 2V4UA 3H75A 2ZRDA 3HVIA 3IP3A 4CM5A 5D85A 1CLEA 2G9UA 6REQA 3OPYB 3BIJA 2C0PA 3HJBA 5B58C 3FKJA 5KVCA 2F4VB 4MH4A 4YI3A 3U7RA 2CHUA 3GH1A 2CXNA 3PT5A 4F84A 1OGJA 4DARA 1N5MA 5LCXA 3HJUA 1MB0A 2W2NA 4V1CI 2JHCA 1QMPA 3VR4A 1ILEA 2CDAA 2VUHB 2GX6A 3PNLA 4QJ3A 3LXXA 4XD2A 4OEHA 1EA7A 1NFQA 4Y2TA 3EVAA 3WBJA 4FLFA 3UAWA 5AVOA 2K5UA 3DHVA 4TMFA 2J85A 5FCDA 3ZQKA 4EYKA 5C7OO 4ZHQA 3OEHD 5SYNA 2XUZA 1TECE 2TMDA 4NZZA 3TTSA 4YCSA 4DKJA 5BQ3A 3OKAA 3HYTA 2YY6A 1SEPA 2O7SA 2W6PA 3PTLA 3RQSA 4WCFA 3MK31 3W5SA 4QWWA 4CKCB 4PLYA 4HH4A 4ZIRB 1A9XA 1Z3CA 4UVDA 3ICWA 1BGXT 2HRQA 1W2HA 1XCGB 4XASA 5H81A 5F1YA 1VE1A 2DHEA 4BEJA 3Q41A 4IMRA 3VV2A 1GUZA 2XTAA 3QKWA 5DM60 2VF8A 5C8DA 3FYTA 1SKYB 3AR7A 3GG2A 2H11A 4JS0A 4X63A 1SUEA 4Y1GA 4L6CA 1TUBB 2P6MA 3FLBA 4L73A 2ZAYA 3ZZ0A 1E20A 2NP6A 2WHRA 3ND6A 2B30A 3GD5A 3WYEA 1ICEA 2EX4A 1J97A 2X8LA 2XB8A 3S2IA 4DBLE 1ZNYA 1HX7A 4KQWA 4RPJA 1P9WA 2B4YA 3ROMA 4RWZA 3UG6A 4UHKA 3T5AA 1HM5A 3LXUX 1U28A 5CDFE 2IUTA 5ICGA 4Q3EA 2G9RA 2IYQA 3HN7A 2W4IA 3WLQA 5BN3B 3UWSA 2R96A 5NULA 1GWNA 1KAGA 4E11A 5EJEA 4LKOA 3O84A 4MOWA 4PHHA 4B4KA 4N54A 1CYEA 5E8RA 4YMLA 2QMOA 4R5HA 4R83A 1WCV1 1HPLA 1YB2A 3QY9A 4GOKA 1FFDA 4X45A 3WNDA 3DOJA 3S1NI 1D1QA 1TF2A 1X0XA 1JV2B 4EVSA 2XOEA 4JL6A 2Q2NA 3GRYA 3AERA 3T3HA 4HLNA 1Z83A 5CA0F 2Q27A 4F3KA 2E5LB 2BHLA 2YYZA 3NFZA 1B3BA 2E4YA 4MMZB 3VPCA 4EYOA 1NBAA 3CWZA 2C84A 4DV0B 3HXLA 1P0IA 1EE9A 1NRXA 3L84A 5ICCA 3RLIA 2XCTB 4S1OA 4TN5A 5SY4A 1YL7A 3NDBB 2CJFA 1GV1A 3O95A 5EJ7A 4LFAB 4JEIA 4C0QC 4NYMQ 3EEDA 1G5IA 2OTJ1 1TQ2A 1E8NA 3CH6A 1YVUA 3P96A 1DRUA 3PRKE 4TLEA 3E6AA 3AR6A 4X1YB 2W42A 1R0CA 1FQKA 4BJ1A 5IKOA 4TT8A 2PR7A 3I2KA 2QGZA 4DILA 4IFBA 1BWQA 3OWXA 1B1AA 2P91A 3BE6A 4JCCA 3IIJA 5HIMA 5KWJA 4BLUA 3SEZA 2NVUB 3ONDA 4LZNA 3J80A 2C2KA 2Y0EA 5AKHA 1FU7A 2I2WA 2ZYHA 1BXGB 5AVQA 3PFGA 4I50F 2C9BA 2PH5A 1AKVA 1P5HA 3UA4A 4C5AA 2O8FA 1W76A 4IZOA 1EDBA 3DO8A 3T15A 1NBME 4FFMA 4TL7A 3ROPA 5AWFC 4UHBA 4DSZA 2O2EA 2YJ4A 3LV8A 4WXMA 3W9YA 2WWXA 4P54A 4ZDKA 2PJRA 3EHDA 4QEDA 4M1MA 4BGVA 2XUPA 4EUFA 2UVPA 5G0UA 4ARCA 3ZKWB 3GV0A 2WU8A 4AJ9A 1M7GA 1HE3A 1NZFA 1PNQA 1NQUA 4FGZA 4PYLA 1XA3A 3VUFA 4YUAA 2KB0A 5KMGB 1O0BA 2FDCA 4EGQA 2NO9A 1K8A2 2P9FA 1Z0ZA 2PG3A 2X8WA 3WTCA 5BYKA 1X0TA 1G9TA 1KIAA 3LK7A 1SCJA 1GGNA 1X7WA 3O1HB 1NF2A 2G8NA 4HBZA 5EJGA 4CQNA 2H7VA 5I4CA 3GJXC 3BWBA 4TXHA 3U61B 1RYHA 2R87A 3PZRA 1PW5A 2O6LA 4X6LA 4YACA 4O3FA 4BN0A 5GIPE 1IZZA 4XWTA 2FEAA 2ZJ0A 1TUEA 1QIJA 3OCVA 1K2VN 4A3KI 4HEQA 3UK0A 2JCSA 2EFCB 3B2NA 4QWMA 5KX5A 3KELA 3BIWA 2ORYA 3CME1 3H3JA 3RU3A 4CT4B 4ZI7B 5C8YB 3IV6A 3A9CA 4E4TA 4QELA 3T3IA 4TXLA 1I7QB 1A2QA 3DO5A 4WNYA 4DY6A 5IK2A 1EIWA 3UB4A 3M1LA 3OA2A 3TQHA 3URKA 2MSDB 3MF4A 3EG9B 2QGFA 3G6KA 4PN3A 2D1YA 4FONA 1M1YB 2P4UA 2QP9X 4L28A 2LKCA 1M8GA 2GBIA 2BF4A 1K75A 1Z33A 2QY6A 2UDPA 4QLOA 3PE3A 3U3ZA 1AQLA 2M6KA 4H1TA 2GI4A 2GLXA 2JI8A 2RI6A 3SFZA 4FE7A 1DQPA 3ZI0A 2JC3A 1E62A 4XTRA 1ID8A 4MKHA 2ESRA 2OBLA 1KPHA 1VC2A 1VDZA 2XD4A 3DJYA 3KJXA 3R0IA 3G8DA 4ZTBA 4IDFA 4L7VA 5DWQA 4YJHB 5AH0A 1AK2A 4IXNA 4B33A 3GFRA 4JBXA 2ZVQX 1PYDA 5T5QA 3O8QB 2PZLA 5CM2Z 5I7RA 4CEJB 1XU7A 3IALA 3L46A 4JZYA 4TXNA 4GT1A 3DR5A 4YK7A 4RPCA 2Q29A 2IEIA 1Y63A 3PUHA 5CYPA 3C8MA 3QLUA 1RQFA 1V43A 4K6MA 3VVCA 3L43A 5GVRA 1F2TB 1GG2A 3ZK8A 2C95A 2E87A 4C6TA 5AD1A 3KAQA 4F92B 2Z43A 1KBOA 4RHEA 1AHHA 1KMMA 1SK8A 2E0IA 2XW6A 1NW8A 4IOKA 4LCBA 3SK0A 2O0MA 3V1KA 2GXQA 3FGOA 2FETA 2CYAA 3ZWYA 1AQYA 4IKPA 1RM0A 1ZI8A 1RQLA 3ETNA 5CNIA 2H7YA 4LYAA 5YASA 1BWPA 1HLGA 1HUQA 3AUJB 4I19A 4NQRA 2EYUA 2OWEA 4QBFA 2AR9A 3X3HA 2UYOA 5LD2C 2V7VA 2V98A 1A4IA 5HE9A 4AT1A 5HNKA 3RSZA 1W4CA 2AUNA 4A10A 4KFCA 1TU3A 2GKOA 4UU0A 4BBSI 3OZ7A 3L6DA 3JYPA 3IHTA 4HN4B 3ZQJA 1F1BA 1KTVA 3EWNA 3K4HA 5CP8A 4ZV9A 4YXWD 5K01A 3C43A 1ECFA 1I7SB 4JI0B 1P7VA 1YQEA 1VI6A 4HNQA 3JV7A 3K16A 1VRCA 1F51E 4G81A 2ZPAA 3HACA 3E9EA 4LY0A 4YMGA 3VA7A 4NYJQ 2GJ9A 4G8CA 2D6FA 1FEZA 4WLNA 2XQJA 3RNOA 3OOYA 2J4CA 1E4YA 3L6CA 5KJEA 2GZDA 4BFWA 4BP3A 1BMFD 3TIVA 3H5RA 3ZZTA 4EJFA 4HTFA 4R1MA 3AB7A 2WIGA 1PV1A 4XH9B 3EF0A 2FNAA 1T15A 4TWJA 2B5VA 5HQTA 4CR8A 2F7SA 4M4SA 1VLAA 4LZLA 1U0EA 2DWCA 2XBUA 2ZAGA 3IP8A 1P7CA 4RA9A 4MVJG 4RLFA 3GTJI 5AKJA 1IC6A 1PG2A 3J7A4 3VNVA 1CQPA 1YZGA 1Z5OA 2SHKA 4E5YA 3WA7A 3L9XA 2FE1A 2FSVA 3KTFA 4RO0A 1EWTA 1XTZA 1FDRA 3VSBA 2GYUA 1NUPA 2Q3MA 3L6RA 1S7CA 1YS1X 2Y68A 1ZD9A 1P5JA 1SRQA 1UDRA 1PZEA 2DLDA 1WB5A 2IYWA 4DM4A 2R62A 5EA2A 1DVRA 1KZ1A 2GLTA 2X58A 1FTGA 4LRTB 6NULA 2YHUA 3G8YA 2OMKA 3W6NA 3IFUA 3GTQI 3B2EA 4G8BA 4OCZA 4EQ6B 3W8DA 1WF6A 4KQIA 4DT1B 2BIFA 4M8SA 3S8EA 5KVQA 4AMYA 4DWVA 2C54A 2BFBB 3W2TA 5K0BA 1KEEA 3K5PA 3BWXA 4EAAA 3F1KA 1OLUB 5A1TA 4BKQA 4L85A 5FF9A 3HOXI 2MYNA 3ESZA 4H4CA 3R9XB 5C8YF 1MG0A 1NRIA 1KETA 1UC8A 2R86A 3UJBA 1T2CA 5K6AA 2JGJA 3EPJA 3WK7A 2FQWA 1MUUA 1CB0A 1PGQA 2H4XA 2H2WA 2NZ2A 4H9GA 3AUXA 5G40A 4FMDB 3VSEA 3ZG6A 3NNNA 2ZPUA 5AICA 1XZJA 4P0PB 2R7LA 4LHEA 2QYSA 1V1JA 5E38A 4ZC8A 1MX9A 4GM0A 4P4TA 4P1ZA 5FTJA 5A3VA 1S96A 3H7IA 1GARA 2CNKA 3UMFA 2GCOA 4G6ZA 5DM1A 3BCHA 4Y2XA 4RVFA 4RJ2A 3VU0A 3WK9A 1GOTA 4MK4A 1XD2B 2B5WA 2QAGA 1D2HA 3R3HA 1U7HA 1TIKA 5G2OA 2W2LD 3QE3A 1JB1A 1WJGA 3Q3EA 3WGLA 3CF6R 3OQNA 4L72A 3D4OA 1MJNA 3FD8A 2ZKIA 1PTJC 2ZJ8A 2P5UA 3OD1A 5JQGA 3WADA 1G8AA 2Q6LA 1GL6A 3T9FA 1CY4A 1E32A 3PFHA 1VE9A 3HGTA 2GO1A 2Q28A 2RC6A 5DISB 2DTEA 5LN1A 2GH1A 1YCHA 3S70A 1C9MA 4A3EI 3QFCA 5EWMB 2OTJZ 3G7SA 1D0SA 1UBNA 1Q19A 1H2RS 1G3RA 2A9OA 3RSQA 2QSJA 2H0AA 2FKNA 3I61A 4KE7A 4OAOA 3L18A 4D4LA 3PZBA 3A4YA 1AOXA 1LPMA 1NP7A 4NBNA 2IT1A 4FFBA 3UOAB 1KAQA 3SI7A 1Z0JA 2ONCA 1C4OA 2WUFA 4XSHA 2WFAA 2BKEA 3V7YA 2JW5A 3I6IA 5IH7A 2ZE7A 3BTSA 2ZB8A 3LCMA 1Q74A 3EMDA 4MPDA 3I2IA 3P2IA 5D7BA 3A3PA 3BDIA 3EA4A 3ZGXA 4BE7B 2IX3A 3BJRA 1U3DA 3AWIA 2P65A 4FXPA 4L9AA 2WMOB 4ADSG 1XMXA 1GSIA 1SBNE 2EL7A 4QPCA 4IFTA 4BZQA 3PJRA 2P68A 2XUAA 1EE2A 3Q72A 4YQEA 1ZHHA 2PQ2A 1ENPA 3H11B 1NVUQ 3R3YA 2VF2A 1A8PA 4TYQA 1PKEA 2C00A 3GJQA 3ZXXA 3GRZA 4NZ9A 1NM5A 4UHHA 2ZT6A 5FEUA 3FTFA 1N5LA 1OI3A 4WZAE 1DINA 1XWIA 1AXGA 2OQIA 3CZMA 1E3WB 3F3MA 4Q03A 5EZYB 4AMZA 2IRWA 3FNIA 3B7WA 4CHTA 2WY2D 3ABIA 3EEYA 3CYFA 4YAEA 2VHCA 3QU4A 3A4LA 3TQTA 3T7KA 3PKZA 5LP6F 4TMYA 1M2OA 4RTOA 1MO4A 2AFIE 3QKSB 1FB5A 3TWOA 1U0TA 1XGKA 2CDCA 4QIHA 3OQ1A 4ZYTA 2ZSUA 1VKRA 3JALB 1UBMS 4WGGA 2LZ0A 4CMBA 1CVIA 1DT3A 4XIFA 1ABBA 3BT7A 4Q48A 2Z3WA 1FYFA 4PC2A 5K8JB 3CMEZ 1FP1D 5FPQA 2WTMA 2I71A 3KDPA 3GLQA 3DWEX 1QP0A 3G2NA 1CTQA 5G1OA 4GWGA 1B74A 3AHHA 4DBZA 4E3WA 4A93I 4LOIA 3UY4A 3OPYA 4EJ0A 4JI3B 3E3AA 3FCAA 3MZ0A 1Z38A 1CQJB 4KQ2A 1HEUA 3OPXA 2V96A 5B3JA 5TT1A 5CGQB 6GPBA 5BT8A 1JMKC 1RD4A 1LSJA 1Z88A 2HLPA 1JDTA 2NO7A 2O8DB 1A7JA 3LRPA 4QUJA 2M9MA 3V48A 5KPJA 2YIVX 3FJOA 3ONEA 2VL7A 2HSWA 5CLQA 1U1FA 3HXKA 1MO6A 3OQVA 3GFOA 4HXEB 3TSYA 3WWPA 1TA4A 1UKCA 4X8LA 1QGZA 3ELYA 2QTRA 3TXXA 2E5FA 1LRLA 1KVQA 3ZZUA 4KPGA 3PFNA 3C6ZA 2I6SA 1JA0A 3AYZB 4CKEB 1QM5A 1XHEA 4CKCA 4ZIRA 3KQNA 4ZANA 1JHVA 3ND9A 4Y52I 2Y0PA 4TROA 3HCOA