1Y8CA

Crystal structure of a s-adenosylmethionine-dependent methyltransferase from clostridium acetobutylicum atcc 824
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
246
structure length
246
Chain Sequence
b'NCYNKFAHIYDKLIRADVDYKKWSDFIIEKCVENNLVFDDYLDLACGTGNLTENLCPKFKNTWAVDLSQEMLSEAENKFRSQGLKPRLACQDISNLNINRKFDLITCCLDSTNYIIDSDDLKKYFKAVSNHLKEGGVFIFDINSYYKLSQVLGNNDFNYDDDEVFYYWENQFEDDLVSMYISFFVRDGEFYKRFDEEHEERAYKEEDIEKYLKHGQLNILDKVDCYSNKKVEKFTERITYLVKLGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine-dependent methyltransferase
publication title Crystal structure of a S-adenosylmethionine-dependent methyltransferase from Clostridium acetobutylicum ATCC 824
rcsb
source organism Clostridium acetobutylicum
molecule tags Transferase
total genus 90
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2004-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.110 Mainly Beta Single Sheet N-terminal domain of TfIIb S-adenosyl-L-methionine-dependent methyltransferases 1y8cA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1y8cA01
1R74A 3GRVA 4PYJA 4YV1A 5CVUA 5IKMA 2YXDA 1ZHFA 2Z6UA 3KQQA 3SSOA 3LHDA 1NT2A 2AOVA 1Y8CA 2OKCA 5CVEA 4HH4A 4BY9E 3FRIA 4IWNA 4GOOD 3ELUA 2AOXA 3E05A 5GOZA 1RI4A 4Y30A 3SVZA 3GCZA 5LSAA 3EVEA 3ORHA 5E2AA 3FPFA 1L3CA 1QANA 3O4FA 4FSXA 4RTKA 1MHTA 5F2NA 2PGXA 2JHCA 4HTFA 1NW6A 3G5TA 1WG8A 3M6VA 2V74B 3R0QA 4C08A 3KHKA 3MERA 4HC4A 1R6AA 1SQGA 3EMBA 5JUWA 1DCTA 2EJTA 3P9KA 1JG2A 5DSXA 3P9CA 2VZ9A 4L7VA 5E1BA 2HTEA 2PJDA 4RTLA 3BT7A 2AOTB 5K0JA 2AR0A 2IFTA 3TPZA 4C4AA 1XTPA 1QYRA 4X1OA 3HNRA 3I58A 3HVHA 2ZLBA 3G7UA 3CJQA 4X60A 2VDWA 5DTQA 3PFGA 3FUWA 3M6UA 3PX3A 3GWZA 1NV8A 3KKZA 4X41A 1EIZA 1T43A 2Q41A 5E9QA 4EK9A 2XBMA 5T64A 4RWZA 5T67A 4RTNA 3LKDA 3E8SA 1KPHA 5GP1A 1KYWA 5E9WA 3P2IA 3TLJA 3OFJA 1XVAA 2AN5A 3NW9A 1YFJA 3ID6C 2OPBA 1N7JA 2R3SA 2CL5A 4F84A 2PBFA 2XYRA 1O54A 2O57A 3R3HA 2OO3A 1IXKA 3QOWA 1UFKA 2PXXA 4WVLA 4DQ0A 4E2WA 5LR6A 3FTCA 7MHTA 3WSTA 2OZVA 3B3GA 3HCDA 2YUIA 3JWIA 4OA5A 5GM2A 3GRUA 5LQNA 3C6MA 1L3BA 3SR4A 2PX5A 4PYLA 1JR4A 1X1BA 3LX6A 3PFHA 3FZGA 2GLUA 1VL5A 5EVJA 3UBTA 3HTXA 2EJUA 4E30A 3HCCA 5K0BA 2NYUA 1P1CA 5CCBA 1KP9A 3KPYA 4DCGA 1JTEA 2XVMA 3NDIA 1TW2A 3GRYA 1TPYA 4PYNA 3CCFA 2AZTA 4DM3A 2NP6A 3IV6A 4E70A 2G70A 2ONYA 3LCVB 2IH5A 3M6WA 1VIDA 4MHTA 3RW9A 1YFLA 2B25A 5K0CA 1XDZA 2CMGA 2PKWA 4LG1A 3EEOA 2O0LA 1XJ5A 3NVMB 5T6BA 3EGEA 3DLCA 4X61A 1O9GA 3TKAA 4PONA 3KPVA 4O29A 4YUVA 4RVHA 2ZZMA 3CC8A 4E2XA 2BM8A 4P7KA 1QAOA 1U2ZA 5FTWA 3OZSA 3R24A 3DXZA 1R8XA 2IGTA 3FPHA 3T7RA 4AX8A 1X1CA 2Y1WA 1JG3A 3KQWA 2FHPA 3GDHA 4FT2A 4C04A 5BW5A 1RI2A 4A6EA 4GEKA 4BP1A 4YV0A 3DXYA 2ESRA 3BGVA 4RVGA 3KPWA 3P2EA 2BR3A 2QRVA 2JJQA 5HIKA 2ERCA 2C7OA 5HIMA 5EMLA 5G02A 3VSEA 1KIAA 3C3PA 1NW8A 4OQDA 4QPPA 5DT2A 1SVUA 2I6GA 3GJYA 3SSMA 5DM1A 3FTFA 3B3JA 2PXCA 1BHJA 2AOUB 3TM4A 1RJDA 2GAFA 3LBYA 1VLMA 2PSSA 1FP2A 5E9JA 2P40A 5F2KA 3L8DA 3A26A 5DX8A 2G8NA 3BZBA 5E2BA 1X1AA 4M7RA 3ER9A 5CVVA 3I9FA 3CJRA 2PX4A 2PLWA 3LPMA 3CBGA 2K4MA 4POOA 2P41A 1SKMA 2JG3A 1V39A 4CKCA 1IM8A 4G56A 5KVAA 3P2KA 2AOTA 3MTEA 5DRYA 1ORHA 4R6XA 4PIMA 1FJXA 3OZRA 1AQIA 2FCAA 2AVNA 2P3QA 4RTRA 3A7DA 1AV6A 3THSA 3KQTA 5HEKA 5GIOE 2HV9A 3PX2A 4YUWA 4RTSA 5U4XA 1Z3CA 5FWAA 1JSZA 3TM5A 3E7PA 2IH2A 3DULA 4QDJA 4QPNA 1I9GA 1VBFA 4PIPA 4C06A 3R9XB 5D1NA 5C0OE 2AN4A 4FSDA 3ELYA 3EVZA 3P97A 3SMQA 5IH3A 5HZMA 5FA5A 2NP7A 2ZIFA 2E5WA 3NDJA 1G38A 4CWAA 3HCBA 2PXAA 4QQNA 2ZVJA 3DTNA 4JXJA 5EEGA 2DULA 4CKEA 3KPUA 1KPIA 3MGGA 1G6Q1 3VC2A 2FPOA 4P7FA 2YVLA 3P71T 2CKDA 3QV2A 5E1MA 3UJBA 3EVBA 3UZUA 3MHTA 3AXTA 2YX1A 3DMGA 4IV0A 2P35A 2H11A 1ZQ9A 3BWBA 2B9EA 3BXOA 3DP7A 3GRRA 3GO4A 4KDCA 3A27A 3KR0A 5K8VA 2UZ4A 2BM9A 2P3LA 4PCLA 2O07A 4PINA 3DUWA 3CVOA 3LDGA 1EAMA 4ZTBA 5F2OA 5K0LA 5LQUA 5LQRA 3CGGA 2OXTA 5FADA 2CWWA 4E2ZA 2ZBPA 2IIPA 3OCJA 1KYZA 2UYOA 3AXSA 3PT9A 3A4TA 1XCJA 1VQ1A 4XUCA 4OBXA 1YB2A 4E2YA 1QAMA 3DH0A 4AZWA 2VDUE 2PV0A 4ER7A 3EMDA 5EKUA 4EMSA 4KDRA 4RVDA 5BXYA 3TRKA 4E31A 1VP9A 3JWHA 5JR3A 3EVGA 5GIPE 3F4KA 4RTJA 5E1OA 2ZCJA 4R8RA 5LQAA 1PRYA 1YZ3A 4ATNA 3QOXA 3G8BA 4BLUA 5GM1A 2QE6A 3FTEA 3LSTA 3KPJA 3UWPA 3VC1A 4ER0A 3THRA 2YXEA 3PLAE 4LECA 1KPGA 2O06A 3LKZA 1UIRA 5EMMA 4EVIA 3G8AA 1NBIA 1Q0TA 5E1DA 1UWVA 1FPQA 2NXCA 1P1BA 3HM2A 3PS9A 4Z2YA 2C7PA 4PYMA 5K05A 2WK1A 4HG2A 5KQRA 9MHTA 1X1DA 3K6RA 2ZWAA 3TR6A 1L3IA 3I53A 5C1IA 5B1SA 2ZSUA 5DX0A 4AUKA 5HIJA 3UJAA 4E33A 2AVDA 1N2XA 1F3LA 2FK7A 4QVGA 5CUQA 5K0GA 2FYTA 3BUSA 2WA2A 2G71A 3M4XA 3E23A 3KQMA 3MAGA 4YMHA 4RTQA 5CCXA 2NXNA 3FPJA 1HMYA 2QM3A 4MIKA 4AZTA 1RJGA 2LD4A 4QTTB 5KYGA 3D2LA 3FTDA 3DMFA 1KR5A 3B3FA 2ADMA 2JHAA 3LDUA 2H1RA 4GC5A 4FZVA 1RI1A 3LDFA 2PT6A 3BGIA 3I64A 4RSRA 1D2HA 1P91A 2HMYB 3EVDA 5DTMA 1JQEA 3SXJA 5DPMA 5EZQA 1RI3A 1DUSA 1ORIA 4ISCA 1AF7A 2I7CA 2JH8A 5E8RA 2UYCA 4X63A 1WY7A 2YR0A 4QQKA 4YMGA 5E8JA 2XYVA 1R00A 2JH9A 2PWPA 1QZZA 2GA9A 3HP7A 3KR1A 3NWBA 4FT4A 4PYIA 4PYOA 5DLYA 4V0QA 2FK8A 5EHIA 4ER6A 2Y1XA 1JQ3A 3AJDA 4BLVA 3MB5A 5DXAA 5FHQA 3G2OA 4KIFA 3REOA 2O05A 4H0NA 4P7GA 3B7PA 5EIWA 2NXEA 1O9HA 2AOWA 3UA3A 2OB2A 1BOOA 3B5IA 3FUTA 2CMHA 3VYWA 3HVKA 1RJFA 4P58A 5DM4A 1QAQA 4PYQA 2ONZA 4OBWA 5EEHA 2PVCA 2EG5A 3IEIA 5EOVA 5EQJB 4AZVA 1Q0SA 3FRHA 4IV8A 5KS2A 2ZIEA 5FA8A 3RIEA 1L1EA 4OX9Y 1NV9A 1VPTA 2HR1A 4GC9A 2XVAA 1TW3A 2PX2A 3AY0A 2AN3A 1D2GA 1M6EX 4RTOA 1WXWA 3I5UA 3PB3A 4IKPA 5FULA 3A7EA 3M6XA 3PTAA 5CVDA 3V8VA 5ICCA 5FHRA 3BKXA 1M6YA 4GUAA 3SGLA 1IY9A 3G89A 3M70A 5BW4A 1XDSA 3Q7EA 1SUSA 3IHTA 1NW3A 3EGVA 3KU1A 2V7EA 3V97A 3LCCA 3OU2A 1EG2A 2OB1A 4FS8A 5DM2A 3TQSA 3UJ9A 3FUXA 3UJ8A 3LGAA 2UYHA 3MCZA 4LWPA 2ZIGA 4RTPA 3O7WA 3UA4A 1G8AA 2ZW9A 3A25A 5EMKA 2P7HA 5K0FA 3KQSA 2Z6QA 2YTZA 4LWOA 5LQKA 4OQEA 4GOMD 3OPNA 4NECA 4PCAA 3ELWA 3ME5A 3P8ZA 2C7RA 3AWIA 5GINE 3TFWA 4R6WA 5BP7A 3NMUF 5ICEA 4E32A 4FR0A 1NE2A 1M0EA 2VDVE 2GH1A 3EEYA 3GXOA 4RX1A 3NWEA 3H2BA 3C3YA 4OA8A 2B3TA 5ICFA 3LL7A 3TKYA 3OU7A 1EQAA 1YZHA 8MHTA 2EFJA 2XYQA 4K6MA 4PNEA 5KQSA 2BH2A 3JWGA 1X19A 1JQDA 2ZBQA 4P7JA 2ZWVA 4XUEA 2OY0A 2ZTHA 5CM2Z 4EKIA 1ZKDA 1FP1D 3EPPA 1I1NA 3DLIA 1B42A 2R6ZA 5DTRA 3KR2A 3FYCA 5FQOA 1MJFA 4U7PB 3OFKA 3DR5A 4DMGA 4MTLA 5ICGA 4XCXA 3LCUA 4YUYA 3P9NA 3EVCA 2IDJA 2IBSA 2ZFUA 3KQVA 1HNNA 3M33A 5DRTA 5DXJA 1VP3A 3B89A 4R8SA 2VP3A 4BP3A 4DF3A 2B78A 4RV9A 3ER8A 4Y2HA 1G60A 3FPEA 3IYLW 3O31A 2YQZA 3EGIA 3FPGA 3R6TA 4RYLA 3GNLA 3PVCA 2GPYA 10MHA 1ZG3A 1L9KA 3NTVA 4PYKA 2C7QA 5K0NA 3FUUA 2QYOA 3GIWA 4EQZA 3ERCA 1JG1A 5FCDA 4GF5A 5EMJA 4YUZA 4HGZA 2ZULA 5LQJA 3BWMA 3CJTA 3G2QA 5EG5A 3OE4A 3MTIA 1NW5A 4R05A 1JSXA 2AOUA 2G1PA 3T7TA 5DSTA 2PT9A 1NW7A 3CKKA 1H1DA 1P39A 2P3OA 1D2CA 3G88A 3UJCA 5FQNA 4FP9A 3S68A 4B17A 2PY6A 5HIIA 4ER3A 1BC5A 4DCMA 2VS1A 4WXHA 2FRXA 2IH4A 3HEMA 4YUXA 5CIYA 4GBED 3HVIA 4KW7A 3SX0A 2IPXA 3KR9A 1WS6A 3TOSA 3JWJA 3DMHA 1JG4A 2IP2A 1WZNA 3UJDA 4AZSA 3ANXA 4MWZA 4M37A 2BR5A 3Q87B 3SM3A 3HCFA 4GQBA 1YF3A 5FUBA 1XCLA 2P8JA 3UJ6A 3NVKI 1WXXA 4HTFB 2YXLA 3DXXA 3BKWA 4F86A 2KW5A 2OBFA 3G2PA 3GRZA 2I62A 3X0DA 4CKBA 2IBTA 3KQYA 5EGSA 3U81A 4M38A 3EVFA 5HILA 1XXLA 3HVJA 5EC8A 1ZGJA 2DPMA 2P1DA 3MCTA 5FWDA 2OYRA 3OE5A 4EKGA 3DOUA 2I9KA 1AQJA 4XUDA 1I4WA 1F38A 4RVFA 3HA5A 3NJRA 5HOQA 3HCEA 4M36A 4FGZA 1ZGAA 2ZBRA 3GU3A 5K03A 3TMAA 4HSGA 3OZTA 5EPEA 4RTMA 1SUIA 1DL5A 3C0KA 5MHTA 3KQPA 1R18A 1EJ6A 5ERGB 4CXMA 3C6KA 2EX4A 3GGDA 5CD1A 2BZGA 2N47A 1G8SA 1NBHA 4KWCA 5HFJA 5M5BA 2WA1A 3P9IA 4QTUB 1RI5A 5EIFA 4CTJA 2PWYA 3K0BA 1G55A 3OU6A 1EJ0A 3G2MA 4HGYA 1JTFA 1SQFA 2NXJA 4GOLD 3RODA 1XDUA 5DX1A 3UJ7A 4CTKA 1VE3A 4U7TB 5EZSA 1R8YA 2BR4A 2UYQA 3LECA 2H00A 5D1HA 4C05A 1RJEA 2JHPA 3KQOA 4KVZA 1NKVA 4YV2A 5C9ZA 1KHHA 1OR8A 2HWKA 3BGDA 2ZZKA 5DM0A 4V0RA 2ZZNA 3FYDA 3UFBA 1YUBA 1KXZA 2PX8A 4HRAA 4QDKA 4BLWA 4ER5A 4PWYA 3LBFA 1INLA 4DKJA 2P7IA 5K01A 2HNKA 3T7SA 4QVKA 4DA4A 2F8LA 2GS9A 3HA3A 1PJZA 2A14A 2ORED 3ELDA 3G5LA 5P8WA 2Z6AA 4F85A 3EVAA 4GOND 4MQ4A 3SSNA 4DZRA 5H02A 5K0EA 5LQCA 4PGHA 1N7IA 2AS0A 3HA7A 3T0IA 5EHGA 5EKXA 2NNWB 2G72A 5GWXA 4UOEA 5K09A 3BWCA 4PGGA 2GB4A 1SG9A 3MQ2A 4A6DA 4C07A 4KRGA 1FBNA 2IDKA 4C03A 2QY6A 5CVJA 3FUVA 5DWQA 2B2CA 3BWYA 1BKYA 2QRVB 4KIGA 3HCAA
chains in the Genus database with same CATH superfamily
3IHLA 4R9VA 5A3SA 5I01A 1A7JA 4HHEA 4YV1A 5CVUA 4G09A 3VKUA 1YS2X 1WKBA 1NT2A 4QAJA 4GMDA 4CHTA 4CLOB 4C0SA 1KFEB 2DWCA 4EVQA 5E2AA 2QBYA 1C3OA 5F21A 2PFSA 4M7PA 2HRDA 4FINA 4IDAA 2AQ8A 1JE0A 3ILXA 5IWCA 2I80A 1IRXA 2DE6A 2VPIA 2FHSA 3IKJA 1I50I 3KOUA 1B3RA 1WCIA 4LNUB 4C08A 1OZGA 4NAHA 3HYLA 1PT7A 1PGJA 1NT4A 4PGAA 1V5EA 3VOSA 4D5EA 5DSXA 1RNLA 3P9CA 3UCXA 4C5CA 1J42A 1M2JA 2YIVX 3E22B 3P0FA 2QTWB 1A5ZA 2OD2A 5ALTA 5MN5A 1XTPA 4J0DA 3LUHA 5LQSA 3ABRB 4WCDA 5KDOA 2XDQB 4EY5A 3V8EA 2RGRA 2WOOA 3VNVA 1KFBB 3A6GA 5DEIA 1D1TA 4Q3KA 4CPDA 3SKXA 1M0TA 3GWZA 4D3YA 5E9QA 2PR2A 7YASA 3K9NA 4XYBA 5KJ1A 4EW1A 5CCEA 2XBMA 4WN3A 2ETVA 4Q1EA 1FLVA 4MP6A 3UT6A 1PR6A 3TSYA 1SC6A 2R2AA 4B87A 1UMCB 1WSDA 2N0SA 5A9TA 2B0CA 2RHOA 1B73A 2MTBA 2ROQA 3B2QA 3QOFA 2WV9A 4DA8A 2DPHA 4MV7A 1GLNA 4ZV9A 1VYHA 3L7CA 3FNGA 3W5JA 2Q4OA 5JAHA 3FYSA 2XH8A 2BKVA 1OX5A 1WPGA 3AZOA 1NPYA 3GRUA 1ZOIA 2AUMA 1Z5ZA 3G0BA 3D81A 4IIGA 5CJPA 3TNFA 1U8XX 2HRQA 3N6RA 1CP2A 5EVJA 5C8VA 5JI2E 1CY6A 3CB2A 3U4CA 5CT8A 2R8PA 3TKLA 2RHJA 3HCCA 4XXHA 4EG7A 2QE7A 1CF9A 1XZHA 4A82A 2NU6B 3GRYA 2VIIA 1OKKD 3C4QA 4EZBA 5JT1A 3RYHB 3U9TA 3EOBI 4EUHA 3A1EA 2I7VA 1Q3HA 4R2MA 2ZSFA 3O38A 3A4YA 1IH8A 4OUKX 5D7NA 2AKEA 3R3YA 1SUBA 2YIJA 4I1RA 5J4LA 3KD3A 1A9XB 1QB7A 2ZRGA 4OH7A 3NYIA 2FKNA 3UQYS 2QQFA 2YJ4A 4JHXA 3O8CA 1H5QA 2ZATA 3DLCA 2I6TA 2UVDA 3D0KA 5D5PA 2JA8I 1TFRA 3QZUA 1NYLA 1R6UA 3BICA 3DOHA 3T5AA 1AS2A 2GNPA 1JHQA 2XWSA 3CE6A 4RORA 1PYOA 2QTRA 1KVRA 1U2ZA 3H3XA 1AIPA 2P4QA 1U1IA 2J1LA 1QLWA 2BLLA 1WHTB 4ZCRA 4NZOA 3TQHA 1HZZC 5IK2D 4MJ3A 4FT2A 3C5WP 2B0JA 4DTIA 3UAZA 4CQNA 4YV0A 3DXYA 2JEYA 3FMFA 4AYWA 1C9KA 5L9AA 2IHJA 5CT9A 2VRCA 4W1PA 1JJIA 1G8KA 3OLVA 3F4LA 3MJHA 4KLZA 4U2KA 1YJXA 2IXFA 2GJ9A 2C9BA 5INTA 1ADJA 4LY6A 2CXNA 5A6SB 4PSAA 3FTPA 4LYHA 4MWGA 5KNBH 3QVKA 1XLUA 4O1HA 2B1JA 5EP4A 4EG0A 3NBXX 3X1DA 4WLVA 4DDTA 2Y66A 1YVDA 1ZKMA 3BFXA 4FEAA 4HKTA 4ZD6A 3TVDA 1UMDA 3GOHA 3ROMA 2P40A 2EEPA 3TIVA 1OU4A 1UBMS 3L8DA 5GY7A 4JI1B 2DBRA 3AEXA 3G59A 2VZ0A 1G1MA 5TE9A 3UHJA 3SPXA 3PTLA 2QL5A 1NVUQ 2CUNA 2RSLA 2K4MA 1SKMA 4GM4A 4P93A 1E96A 2G76A 1ZMTA 4I50B 2BUBA 2PT5A 3BMNA 5G3ZA 3IOCA 4P4TA 4HH3C 2FZWA 1T3LA 5DRYA 4G1MB 1H6CA 1ORHA 2RCNA 3GFRA 3HKCA 4MVJA 4RH3A 4EG6A 4YMLA 1E18A 1XJ0A 2DU8A 3A9RA 3G5UA 4GL2A 5LZ2A 4EI9A 1YC5A 2R7NA 1K731 2Y8EA 3AF2A 3F6BX 2JGDA 5LOVA 5JHHB 3QVOA 4LJKA 1X38A 5KWSA 4XSHA 3KXKA 5L8VA 2FWNA 1T4GA 3SLGA 4ABYA 5IAAA 3CPHA 1XPOA 3TM5A 2WDZA 3GJZA 3CS3A 1JLMA 1I9GA 2QSZA 3F3PC 4C06A 3FBGA 3IBCA 2ZUWA 3UK7A 2NZ2A 1YRWA 1M5TA 3SMQA 3IILA 2NPFA 2XRYA 3RWOA 2ZOSA 2D2FA 3I6IA 5DNAA 4B9AA 2NP7A 1GZ3A 4OJMX 3D2CA 2PXAA 4CWAA 2H5JA 2B37A 4U4AA 1ZU4A 4GP7A 4Y7DA 2DULA 1CRZA 1OREA 5KTOA 2QZ4A 1EDBA 2AUNA 3S2HI 3IE2A 3L7DA 4OLFA 5EPOA 2VHYA 1TIBA 4H1HA 1I2DA 3A6EA 3M5PA 3MGGA 2JS4A 4JB8A 2CKDA 5HM6A 1JECA 1M74A 4ZZ3A 3QIAA 3VO8A 2PRYA 1VPWA 5FR1A 1AZWA 3MJEA 2NYAA 1DKMA 1ZFNA 1WXGA 3FDJA 4PBTA 2NNLD 4Q4DA 4X6YA 2X2FA 1E8MA 2P9ZA 1U80A 4G1BA 2H8GA 2N1BA 3TL2A 3KZMA 3OCJA 4RL6A 3AXSA 3TFOA 1Q862 1QHXA 2FXIA 1JYSA 2HYDA 4KX5A 1WXQA 4IXTA 5T8KA 5KVCA 1AS0A 3O4IA 3ISTA 3QA3E 1H8EA 1E79A 2CFCA 3KEGA 3QNWA 1H6AA 2GM5A 3QP9A 4IS2A 4REQA 5EZYB 3TRDA 3ZGLA 4KDRA 5FPKA 1PJLA 2H51A 1A0OA 1UQTA 3C43A 3VUFA 4KAAA 3DBRB 5LQAA 2B4KA 1SC9A 5HHTA 1H2ZA 2G2KA 1VQ7Z 2XGSA 4IXNA 1QVFY 3FPKA 4KV9A 4F5DA 2D6FA 1UDCA 4NBBA 4V38A 4ND5A 4D41A 1MAWA 3A0RB 5ADHA 1AA6A 1CUAA 4YALA 5GOTA 3AV3A 3LKZA 2P69A 3PXAA 4W7IA 4IWXA 1GNSA 2VTDA 3C14C 2C3MA 3ILHA 1E2UA 4H3HB 4PO9A 3HSSA 4OHKA 1IB6A 4E4TA 2NYRA 9MHTA 3IP7A 3TR6A 1NQ5A 2PKRA 3BSFA 4B2PA 4B3SB 4RPLA 1TK2A 2X2EA 4KR7A 1LQLA 3NVDA 4EL5A 1F3LA 1QC5B 3A04A 1T1GA 1HTTA 2FYTA 3PQ7A 5CCDA 2C58A 1I3MA 4G5RA 2B5VA 2QG4A 3WZLA 2QLJA 2NXNA 4JITA 3VTNA 4JROA 1ABBA 5TMPA 2QM3A 1SELA 5KYGA 3LA6A 4TWIA 5B1HA 2HQ1A 1SHZA 1PZXA 2YWEA 3WGJA 4N7BA 1CC1S 1G0OA 2BOVA 3BIFA 4B73A 1TQ4A 3U56A 5DBEX 1NXPA 2B21A 3BXZA 4QU5A 5AKXA 1A9PA 2JEOA 1S8OA 1U7OA 2R8OA 2VJMA 4L5YA 1RMQA 2ZJFA 1W87A 4YRQA 3RANA 2ZM5A 3MHPA 1XZDA 3GAFA 5DKFA 1SMKA 5AVZA 1EGMB 5CURA 3ZU6A 1M2OA 3C6BA 4KO1S 4RO0A 1I7DA 1Z2EA 2VHEA 1JDJA 1NUHA 1Q3KA 3F2IA 5CLFA 3OOWA 4I81A 1FXWA 2B8NA 1ZISA 1JQ3A 1V3VA 4PW0A 1X92A 2YXBA 5BVHA 3ML1A 3CD6Z 1CYDA 1FVOA 3H8WA 1N33B 1O96A 1A50B 5B58T 2NLOA 1T36A 1PR4A 2IP4A 2NXEA 3QYJA 5KYXA 4EHNA 4AN1A 1K4KA 2V65A 1UJ4A 1OTXA 2ALJA 3EXEA 4RKQA 4HVLA 5JS6A 3PNOA 4CCYA 1NVDA 4A3KI 2J33A 2QI9C 5JOQA 5JWHA 4N12A 4G81A 3UMMA 4GGPA 2C00A 3CLUC 4L6CA 3C5CA 1Q0SA 4X8HA 2F1KA 4CQLA 5IBCA 2WFAA 4CLEA 3DOFA 3GC6A 4WLNA 5JDCA 1U9IC 1T5SA 3HFGA 1H69A 3U5ZB 4MYTA 1D4AA 3AY0A 3I92A 3H2GA 3VR6D 4BO3A 2EU8A 3AINA 4EVRA 3PCRB 5ICCA 3CT4A 1U3CA 5FHRA 4GZ6A 1Q0PA 2V6JA 4DGSA 1FUIA 3M70A 1NBME 1R64A 2ZAYA 4C0LA 3GNQA 4QBHA 2ONJA 2OKGA 4YI3A 4BB0A 3MW8A 3X43A 1XDDA 3V97A 1LFAA 1CRWG 4DBLE 1DB3A 5KSYA 1E1RA 2KHZA 1NNSA 4JJKA 4KN9S 5EJEA 3JYHA 1WVMA 1MJGM 3DYIA 4ZYYA 1OE0A 3K7EA 4NF2A 1ICEA 3JQEA 1SPXA 3V1YA 621PA 5IM4F 3PUIA 3CZPA 3TE6A 3T1HB 1VIMA 1ZUNA 4O25A 5A71A 1K0UA 4IHQA 3QA9A 3V7YA 2DUMA 4ZCLA 3MEQA 1QVGY 1R88A 3HI4A 3BN3A 4FUTA 4BGUA 1YDMA 2RGYA 1P74A 2ZYWX 1G21A 3BRCA 2B3TA 4LX8A 3ZV4A 4US2R 1YZUA 1YZHA 2GZDA 2HSJA 3EUAA 1JAZA 3KXPA 4WESB 1Q1GA 3VJMA 2Y0PA 3EAQA 4ZMRA 4R51A 3GDWA 2FY8A 4JLUA 4Y9SA 1QP7A 1JW9B 2EV9A 4IH4A 4EB3A 2HQOA 3WIOA 1W44A 3EPPA 3ZR4B 2EBFX 1TFIA 4MRMA 1OU0A 1W4LA 2D1RA 3DAOA 3NJ4A 4UBIA 2NX2A 1OI3A 3E27A 4MTLA 3VU3A 2RI0A 2TECE 1QLJA 3CINA 3FFTA 4JQSA 1KIFA 4HQ6A 2IBSA 1VPEA 4RETA 4Z86A 4KR6A 4L07A 1ODIA 2J5KA 5K3SA 2QT9A 3MFQA 3PE3A 3BX1A 2C92A 1A8UA 4GH5A 4XASA 4YJDA 3BAZA 3FGNA 3FPEA 4R1LA 2IZZA 3FPGA 4PNHA 4QQ8A 1Q2XA 1ZM2A 1OJLA 1C9DB 3UH0A 3R5TA 2D3WA 1ZSNA 2BKXA 4IIJA 4M6WA 3DUFA 5FCDA 4FCWA 3IMCA 4RYDA 3C6ZA 3CW8X 1L9XA 1LF0A 5J47A 5ELLA 4DLVA 2ODAA 2AOUA 4EF5A 1CUDA 2E2JI 3CO0S 1LVGA 3U7EB 1LBIA 4J4HA 1PVDA 3N8NA 2QLMA 3DTYA 5IHPA 2Y67A 3P9RA 3UJCA 4JI0B 2IVZA 3AFNA 2PY6A 2XLBA 4NCIA 1PYDA 2WJPA 4TYQA 2JFWA 4ARZB 4COOA 4KSYA 3KSZO 1P9NA 4PXYA 1PEDA 4Y3UA 1GZHB 3W90A 3TOSA 4B81A 1Z03A 4PCUA 1TU0A 2ZE8A 4PICA 1PVVA 4UVGA 4DIMA 1SCNE 1E4OA 3AL3A 1ZK3A 3GBPA 3SXUA 3ZGNA 1GKKA 2Q0SA 2TMKA 1QSGA 4B0OA 5IAGA 3WQSB 1WUTA 2VQFB 3KV1A 1DIBA 4GGOA 3DXXA 3K30A 2GFHA 3NNSA 2OCAA 2PX6A 3WJ2A 2O54A 4B2LA 3MJTA 2OR3A 5CFLA 1DTWB 1DADA 2E5FA 1XLTA 1GG9A 1UPCA 3NIBA 2RGGA 5TXGA 3MCTA 5JFOA 5CDYA 4WK4B 2BGGA 4B6OA 1A4IA 2BCJQ 1U8AA 2FPLA 1P6XA 1N3LA 4NBKA 2AFHB 3LPAA 2GVDC 3HCEA 1TK3A 1E2EA 1EIWA 4YIKA 3QVXA 1BN6A 3OZTA 4EUSA 3DAPA 2EDAA 1XEWY 2AN1A 5H80A 1WCYA 5IASA 1RPJA 3WYDA 3I1JA 3DQQA 2HPZA 1T9GS 2JI4A 5FRDA 4CL2A 4CXMA 2CHVA 2X19A 3BB4A 3D6TB 4Q6WA 2MJLA 1YZGA 4PPYA 1WQ1R 2FG5A 4ZCTA 3DEKA 4CDRA 5KTNA 3I5XA 3PF8A 4KJZA 2A58A 4EDHA 2OORC 2Q3FA 1Q14A 3UWKA 1E3IA 2NXJA 4ADSG 4E1BA 4RXMA 4FZ3A 3O82A 4HVAA 4RKEA 3UF0A 2YVAA 1XEXB 3PIIA 1QCCA 5D8DA 4F0JA 3I2FA 4G67A 5JSUA 3LECA 1UMKA 5IEJA 1U1GA 1VQ5Z 1KI8A 1IZ0A 2EBHX 2Q1WA 2XCQA 4BIIA 3ZWCA 1ZESA 3QJ5A 2YOHA 4A3SA 4L0MA 4MWDA 4U7WA 4XGQA 4RF5A 3VGJA 4EQ6A 2ZZNA 3SKVA 4KQKA 2IY8A 2HIAA 1YR3A 1M1NB 4HWOA 2IV2X 1Y81A 4LZOA 1GUDA 1ACMA 1A2KC 1QK3A 3VTZA 4MA4A 1TOAA 4KVFA 1M1YB 1DKNA 2L82A 5DNEA 1TQ8A 4BXXI 5IAOA 2ENUA 2ZJYA 4EA8A 4EHFA 1C7IA 3J80A 5A4KA 1FS4A 2ORWA 2X0KA 3FKQA 3ESCA 2H3HA 3TLAA 2A88A 1QVAA 3NTLA 2AV6A 3BE8A 5GWXA 5K09A 1CJBA 2CBXA 2ZT5A 3U19A 4W5NA 1GA6A 3GPDG 2VRBA 1ABEA 2POQX 1NFQA 4C07A 2A9VA 1W5FA 2HIMA 2OCXA 3GVXA 2HGSA 4W8GA 2HCRA 2BIFA 3VVBA 2BDTA 3LL4A 3ZU2A 4BCDA 1HT2E 3KC2A 1TM2A 2DFVA 4F1JA 1JR6A 2I7TA 4ND2A 2A0XA 4D0LB 1DT5A 1Z4NA 2NSHA 4TXJA 3RHSA 1Y8CA 2XZDA 4IWNA 1BMFD 5IM5A 3VMHA 4MV9A 2BGWA 3TEFA 1L3CA 3JD2A 4RTKA 4QO7A 1FMTA 2CD9A 3RK4A 4AX4A 2ZKIA 3QW2A 5J43A 1SN7A 3R0QA 3OO1A 2IKQA 3HZHA 1BE1A 2XTZA 3B6EA 3FDXA 2WIDA 4WCFB 5DI3B 4E46A 2JMOA 5BR1A 1JG2A 2J9RA 3G49A 2VP6A 2C9OA 3JZDA 3WR5A 3R7FA 2AOTB 3BT7A 2OGWA 4M0MA 1JQBA 3UAWA 3QXXA 5HP4A 3CIOA 1TNDA 3GFSA 2XRZA 1CY4A 2CLKB 2CNWD 1QX3A 4Q1FA 3WIVA 5EERA 4DLUA 3WBJA 2NT3A 2PZAA 2PUAA 4HATA 4A0QA 4KFSA 2I3ZA 1IUOA 4HPJB 1NQVA 4JQOA 5GP1A 3DR3A 5BRAA 1Z9BA 2EKLA 2GXSA 1QVWA 3D4BA 3AP2A 3VO2A 4C6TB 4R0VA 2CL5A 2ACWA 2XHEA 4QTUA 1BGXT 3UUFA 4B3DA 2PBFA 2WU8A 3D8HA 3OIGA 4NJMA 4OX9B 5LR6A 4BKQA 1IBSA 2EKBA 3W9BA 5A0VA 4BNJA 1XJCA 3TRIA 2M9MA 5GM2A 5EY5B 2DFTA 4S1WA 2XR1A 1NMSA 2QZPA 4WCFC 5BSTA 3D43A 3OHPA 1FF9A 2JFNA 2QEQA 1F5NA 3PC2A 2WF6A 3A3YA 3O3NB 3M34A 3TUJC 4F8EA 1XCGB 3JQAD 5LB4A 1RYYA 3O7MA 3QFFA 5G0TA 1JA9A 1E7QA 5BVGA 1XNRB 2HF9A 4F06A 3HTXA 3SHFA 1KP9A 5EE5B 3V2IA 3ZS8A 1TW2A 2I4TA 1T13A 3GPCA 4DM3A 5B4UA 3E18A 3IODA 3KD2A 1XVVA 4GICA 4IKOA 4S2EA 2V9PA 3M6WA 3E0QA 1K6JA 2NVUA 3L49A 4HNAB 4ODIA 3EDOA 1E60A 4BX3A 4BJ6A 1UP4A 1XT6A 3N5CA 2DLDA 2DOKA 3WB0A 3D9QX 4XQ9A 4G89A 3WGZA 3LP8A 3HRIA 4EA7A 3GFGA 3DVAB 5FWYA 4ZI2A 3AOEA 5AMXA 5EZYF 2OWDA 4E4YA 3M6FA 1VXOA 2BM8A 2RH4A 2GK3A 5EJGA 1EFRD 1QMPA 3DXZA 4P3PA 1L7NA 4FS3A 2D00A 4HDMB 4ZGBA 5F3RA 1X1CA 2B4TO 2I3GA 3C7CB 3DLAA 2WHXA 3U6KA 1U9JA 3PNVA 2VAPA 3S1SA 4JI3B 1Q6ZA 2I3AA 3GQBB 4J2TA 1XGKA 4XDGA 3K0AB 3JAMA 3F8WA 1NR7A 4NC9A 2GTPA 4P86A 2VKTA 5CFQA 1Y63A 4YP7A 3VNUA 1AK9A 4V0LA 3DDSA 4BNHA 5L4NA 1R4ZA 1UDBA 1NLFA 1TF5A 4LAFA 4QUKA 1GARA 2W6OA 3ANLA 3K2BA 1WZIA 1CLUA 3EXHC 2VNIA 3PG5A 2JZCA 2VR1A 3AHHA 3B3JA 1OF1A 3DNMA 2IS4A 2DBZA 3QE3A 3JAMb 2DMRA 2FQXA 2WZQA 4JP3A 4ZOLB 1I13A 1N6RA 2RC5A 4L74A 3VAAA 4BMPB 5A9SB 4LYFA 4D26A 3NU1A 2QTTA 2A5FA 1J7JA 1RKVA 1X1AA 2ZP1A 3DTVB 3GFVA 4UFOA 5JYBA 1JF8A 1KR2A 5A03A 2JG3A 3BXFA 3GT4A 5FEUA 1VDZA 5KVAA 3VYRB 2FKAA 3P2KA 4YEDA 1XDGA 5GMOA 2PU5A 3QPCA 2JGJA 4A03A 2GAAA 3E9NA 4CV0A 1Q1AA 1AV6A 1WF3A 5KTKA 2VWGA 5LZ9A 3HBNA 2PEYA 1ENYA 1Q17A 3N58A 3NBFA 3R3ZA 4R7ZA 5LBIA 3RRXA 4KXYA 1DLIA 4C3VA 3ZD9A 1RR6A 2C5GA 4IR7A 1Q7CA 3JQGA 3NC4A 4UUPA 5E7JA 2C4NA 4IYJA 1JSZA 4MJ7A 3LHIA 2H1IA 3WTCA 4ZXPA 3CLKA 1VBFA 1OXSC 4ARIA 1QBKC 3RIMA 1CY0A 2GCOB 3EK2A 3SHQA 2GYUA 1SCUB 3P97A 2DBQA 1KRWA 3IAFA 2OFOA 1A8QA 3D8RA 1JIQA 3N2KA 3PCXA 3FCXA 3PDUA 4JBYA 1E92A 2UUOA 4ZI3A 4MGIR 4B46A 1U4NA 2XNDA 3KCNA 3UMVA 3IF8A 5JQGB 1MEOA 4GYKA 3QPBA 5EWLB 3F0TA 3IBSA 2ZAIA 1V5IA 3ACCA 4DN6A 1QF6A 4F6LA 4YBZA 5LQDA 2VPXA 4P7FA 1FVFA 5E1MA 1QTQA 1GQOA 1PYGA 1ECFA 4EKEA 3ADBA 2JCVA 1BXRA 4BO6A 1B14A 3F9IA 2Q07A 4KUHA 1T0UA 3AQ4A 1MTZA 4ZAVA 4MO2A 1WOYA 2C2WA 4NCHA 3L01A 3QYAA 5C8ZA 4G4GA 4MVJH 4NRDA 5LQRA 5F2OA 3TLGB 2XWQA 2G5TA 2QNIA 4PO1A 1M6NA 3ESDA 1E1MA 3NWJA 3QE0A 2P2YA 1MAVA 4KP7A 2J9XB 3RUIA 4YHHB 1EI9A 1JU9A 2FWRA 4TV8B 1AT1A 4IZ6A 4U2GA 4WZBB 3RRFA 4BIMA 1FQKA 5AKIA 3GT7A 4E2YA 1YB2A 2PWAA 3K0HA 3KZVA 4DA9A 2Q1SA 5DCUA 3M4JA 3INGA 1YVRA 4AY6A 1DPFA 4YQZA 4IAOA 1CS4C 2IRWA 2VP2A 3H8VA 2VDUE 4M7OA 5IVPA 1XN4A 3D02A 1J33A 3PNBA 4G01B 1NX6A 1BEEA 3TRKA 1B2LA 2AEEA 4FFBA 4RELA 2JB9A 4LJLA 3R3UA 3WMFA 3K0CA 4PPQA 3GP8A 4MTCA 3L46A 5A3VA 3TR0A 5FUXA 4EHLA 4RZ2A 5KUTA 3ISJA 5CP8A 3DDOA 3D2BA 3KYBA 1BCSA 1MB3A 3ZGYA 1WPXA 5EAIA 5D3MB 3RIYA 3VX4A 3IQDB 1Q0TA 3I2KA 4UNNA 5SZKB 1SZPA 1FPQA 1WB4A 1P1BA 4ZHSA 3DL4A 4FFWA 2WK1A 3PDJA 1DC3A 4ZARA 3ZU5A 2ZT8A 5KNDA 1SCIA 5JC1A 4UVHA 1L5LA 3AI1A 3CCR1 3G68A 3PD7A 2FMFA 3ZV7A 2JASA 3PYMA 3E61A 2WF7A 4KO4S 4MDHA 3WGMA 1F2UB 2W11A 1F6BA 2B35A 4H6XA 1TVKB 2D7JA 4X3CA 2FK7A 3GCXA 2HCTA 3IC5A 5CUQA 5KX5B 2VH5R 4BFWA 3T6KA 3IP3A 5M3BA 2ADOA 1IWOA 2WHRA 2WHPA 4EG8A 1JIXA 3L6RA 2W70A 1M1K2 5DI9A 4DDWA 3DV9A 4MZXA 2FW0A 2DPGA 1LLUA 1YDEA 3ECAA 3QELA 3RGWS 4INPA 4WX2B 1WUYA 4N40A 2J6CA 3VRHA 1Z06A 4AJOA 3IEKA 2PV7A 1QTNA 1ZJ4A 3WO0A 5A5DA 2FEWB 1D3AA 1N5DA 1F9AA 1XA3A 1TAHA 1V1MA 2JBAB 1BXGB 3DJFA 3IP6A 3JQBA 4G5SA 4RAOA 4Y1FA 5F5NA 3TEMA 4BO4A 3F67A 1S7GA 4TGLA 1P73A 4Q5IA 3TOXA 1DUSA 3N2NA 3NV9A 5IN4A 5JIBA 1PEKE 5CFPA 1GNQA 3M4ZA 3OLZA 2YR0A 3RU3A 4JUCA 5FOUA 3LXUX 4HLCA 4MCHA 4F2PA 4MR7B 4O2BB 2B3DA 1TIPA 1Q50A 2VTKA 2JDIA 4C3ZA 2FFRA 1CQXA 3DFIA 2WG2A 2PUCA 4FVTA 3PXUA 4EARA 5B7QA 3HP4A 2PCJA 1KARA 3BAFA 4TZ6A 3CR3C 2F59A 3D5QA 1PZMA 4DV4B 2WG0A 1IL0A 2ZYDA 1QM5A 1VLJA 4G63A 3BRSA 4ENSA 1EFAA 4FDLA 1D4ZA 5T7BA 1GQFA 4C2BA 1ZONA 4J1TA 4H27A 3TQQA 2AN9A 1L4YA 1YR9A 1GT6A 2BI7A 4K9MA 3CISA 5LIPA 2R6GA 3LYLA 4PAGA 4H1TA 5L7TA 2FPMA 3C45A 4MK4A 2DWPA 1FTGA 3GF4A 2WJGA 3MJRA 4BBRI 4BQFA 4EGJA 3FYUB 4CIVA 1QIKA 2QZ9A 4MAFA 2HIHA 5AJHA 3RIEA 3PXBA 4P3OA 5K6AC 4HX5A 2CVPA 3MJVA 1JWHC 1YC2A 3QVMA 2XVAA 1WL8A 3AF5A 3KFVA 3UCFA 4BFTA 4D0NA 5IJ0B 3I61A 4DPLA 4TSFD 5C3EI 1G8HA 1PR1A 3ZUGA 4UPDA 3GG2A 3BKXA 1DEOA 4AJ2A 1E9FA 3UXMA 2V59A 4M0UA 4HEQA 5JSQA 1VQ71 2C3YA 4CKBB 1QRRA 2I8LA 1R5JA 2QW0X 2FEMA 3CPSA 3KAPA 4J8PA 3EGVA 4JQZA 4OB8A 3LAWA 3L7KA 2YN4A 2WY2D 5ADUS 3NH8A 2D5BA 5JY1A 4TLMB 3AETA 3MIIA 1T9ZA 1J99A 1U9CA 4QLBA 5LP6B 1EUDA 1TQ2A 3AB8A 4RGVA 4ZJYA 2ZTLA 2VSNA 4IIDA 4UEOA 5FPSA 4CI9A 5FBVB 4MW2A 1FP4A 3UMYA 5DBFA 1VPVA 2QRQA 3LK6A 4LWOA 4MSUA 4GX1A 3QE4A 4PBSA 1DQZA 5HX7A 1YS4A 1UBSB 3BVPA 3MUNA 3P8ZA 4GO1A 4NKRA 1TEXA 4Q47A 3DAGA 4R6WA 3TFWA 2DFLA 3HB1A 3ROGA 5HKKD 1M0EA 1YB6A 2HNBA 1Q2UA 1X80A 2VDVE 3FYUC 3EEYA 2Z5VA 4IPTA 4YJKA 2AYXA 1EWTA 3ZC3A 3QENA 3B9QA 1XF9A 1QFZA 4B7ZA 4L50A 2BTQB 3AUYA 2HJHA 4KPFC 4EPXA 2VDNB 4D02A 3F3MA 5FOXA 3HKEA 1R8SA 1Y8QB 4P7JA 1GDHA 4ZRNA 1CG6A 4BMDA 4AURA 2D2EA 2W6NA 4PRLA 1FP1D 1XNJA 3COYA 4RULA 2WJ6A 1GSIA 3FSGA 4A0HA 3ZTYA 1MAAA 4OREX 1JN0A 2BN4A 1FJ2A 4JB3A 1HY3A 1T29A 3GEPA 3UKJA 4AZ3B 1BA3A 4YNBA 2YVKA 1Y7PA 2F90A 4WHMA 1KMMA 1WKVA 4XCXA 1SHUX 3K4HA 5C1OA 1B0AA 1S2NA 2V5AA 3OTQA 3JYQA 4ECEA 5DRTA 3FR8A 1VTKA 4R8SA 4ZA2A 3I04M 1MC4A 2J3LA 4NB8A 2Q28A 3H0GI 3CB4A 1PW5A 1CIPA 3NFRA 1NNUA 5LZ4A 1W48A 4Y18A 4DV2B 2RB4A 1DOAA 1WVGA 3EULA 5LUAA 1OAOC 2ZYSA 2C4KA 2PZJA 4YROA 4GPBA 2QZZA 2C7QA 1HE8B 1GCGA 3GIWA 1SUCA 2DWQA 3VJLA 2IEZA 4DA0A 2ODPA 4WY2A 5KYUA 3LPCA 3L7LA 5EG5A 4Y6QA 3E9DA 3UAVA 2ZTUA 3GFOA 5C4JI 2EBUA 4ZN6A 1NW7A 5DBGA 4L0QA 3PQ2A 5JO9A 2GPSA 4LJAA 3ZX5A 1Y4SA 4NCBA 1V37A 3QK7A 4JYCA 3STTA 2CCGA 4B17A 4GW3A 4CCSA 4A2CA 3ZU4A 1QFXA 3N5KA 2EQBA 4HN4B 1YZQA 3S2SA 4C4XA 1E2HA 4KW7A 5KKAA 3KR9A 4PR0A 4ZVLA 2GJKA 4HQNA 4Q39A 2P9BA 4EY4A 3CLSD 3D6UA 2OD7A 1LXCA 2X4GA 5TSDA 3UW3A 4DNXA 4Q19A 3OT1B 4JXZA 2IYYA 3Q1LA 2RGNA 2FVYA 4GQBA 4DYHA 5JNVA 2BH9A 1O0BA 4Z4HA 3ZHTA 1GEEA 3NCHA 3V3TA 1DG1G 3QITA 1VCIA 2RAFA 4I5FA 4P2BA 3ORSA 4RHEA 3RIHA 3SVTA 1KI2A 2MHCA 4LJ8A 3GRZA 3WWPA 5ARCA 2IYRA 3PQEA 4HAXA 2E2HI 1SU8A 1P0QA 3LSYA 4E1AA 5EJ9A 2GJ8A 1TM3E 3KDAA 1ULHA 1Y33E 2BGLA 4O0MA 2FW6A 4H7PA 4L5AA 3L6DA 4KH0A 2QA4Z 1SHLA 1Y7IA 4CV2A 5EHXA 5L4SA 4OHYA 1A88A 2LNDA 3U3DA 2ENWA 4KRXA 3TQRA 2O8NA 3F71A 1WVIA 1GTMA 3C0KA 3K0FA 3LX4A 3ZWAA 2DHQA 2H1CA 1FUEA 3DW1X 4EHKA 2PS0A 1DIRA 1M6VB 1VZ2A 1X1SA 2QDKA 3ASZA 3NALA 4L95C 1MXHA 2H4WA 3QXCA 5A7GA 3T9BA 4ASUD 4EKYA 5CG2A 5K8UA 2WA1A 3F3SA 3L41A 1RI5A 3DMTA 1V7QA 4FD2A 4ID3A 4UZFA 4E03A 5LA6F 1AK2A 5K8LA 1MN6A 4IOMA 2YWFA 3OH8A 2VDRB 2Q62A 4U3JB 5LWHA 1V7ZA 4JL6A 1NJI2 1O0SA 4DRYA 2PAFA 4U7TB 3GLFE 1U1CA 3KB8A 4F93B 1H0HA 1RQGA 1TF7A 3H5RA 1CWUA 1KEUA 4J4BA 4M0EA 4TKVB 5TDHA 5G0VA 5JROA 2OUKA 3OZDA 1Y5MA 4I3GA 2QQEA 3ICQB 2FCRA 4JUDX 2WKSA 3AGQA 1PNOA 3MCAA 3OKFA 1R4NA 1JLRA 3RS8A 1B76A 3PHJA 5HF8A 3WLRA 2PX8A 4X85A 5LB2A 5ERYA 2N9UA 2UVQA 7MDHA 1INLA 4Z6KA 3RIGA 4TT3A 4D43A 1LBHA 1W1WA 5BO5A 4DJDC 2FDCA 4XH9B 3TZBA 3TG8A 4P36A 2RIRA 1OC2A 3HA3A 4BJHB 1FX0B 2HU5A 2P30A 2FQYA 2WTUA 1DHTA 4DMFA 1F4VA 3A10A 3MPUA 4W5WA 4YAEA 4A16A 1HF3A 3O8LA 4EYOA 5K0EA 2C82A 3IBFA 3CRVA 1TVCA 5AI0A 4YMSA 3A1CA 3IDQA 5KHLB 4C30A 2VXBA 3DWIA 5HGXA 5L3VA 3UMBA 1T0PA 1TYBE 1NONA 4DA6A 2VYND 3KYDA 3QVGB 1EMDA 2P6MA 3VH2A 4HFJA 3FUVA 3QUAA 4IZOA 3IXMA 3MSXA 5DWQA 3J81f 3O21A 1RTKA 2BZ1A 2L0XA 1EFUA 1QK4A 3D6FA 5JCJA 5T6MA 1PR5A 4O6VA 4XWYA 4J9UE 1MGOA 4K2HA 2XSZA 3ZKAA 2GD1O 3RUFA 4BCCA 3GROA 5IKMA 2D4AA 1QH1A 2YXDA 2Q8NA 1PGOA 3GJXC 4LSMA 4ZOAA 2C97A 4Z9BA 4ZEWA 4CM1A 1O08A 2BHNA 3LC1O 3PQ5A 5DV9A 1R0BA 1BFUA 1WEKA 3BZUA 3H4TA 4MR9B 3TSAA 3GCZA 5LMUB 1YOVB 3ORHA 5SICE 4Q7QA 4PZ9A 2EP7A 2JHCA 1HLFA 3I52A 2WIAA 3HJAA 4RIEA 5L3SA 4Z4IA 2WFZA 2XBLA 5AJUA 1DCTA 5JAUA 3FOEC 1ESNA 1YHNA 3H9UA 1T1EA 2Y76A 1TRHA 5DYIA 1YUKA 5JZVA 4QUHA 2ZB7A 1P4JA 1VJ5A 3SJZA 5I7HA 2QTBA 3THYB 1A1VA 1NJ6A 3O1JC 2X0EA 1T25A 1F8GA 4OJTA 2Z2ZA 1T2FA 2EKDA 1NAIA 4OLBA 3SLRA 3FWNA 2QAGA 4K86A 1QYIA 3ECCA 3G7UA 3C6YA 3T7CA 4YCMA 1R9GA 4OB7A 5FL7A 4DVJA 3PX3A 2JD1A 2AYDA 4G1VA 4BFZA 3K15A 5CA1A 1ECCA 1GWNA 1SBQA 2IC5A 2ZI7A 3OA2A 1XQ6A 4OHPA 1RWNA 2YYZA 3OFJA 3FROA 3SE7A 3HS3A 3E9ZA 4F84A 3NAQA 3Q7QA 4WXPA 4BWYA 2QUKA 1BCRA 1N34B 3K70D 1ZN7A 3DT6A 3RVOA 1Q811 1VQ51 4AYXA 1EGHA 3ABQB 7MHTA 2W2PA 4G41A 4MRVA 4RCVA 4GZ5A 1T9BA 1PDVA 4ETWA 3E7XA 4QL3A 1I7LA 2A67A 1Q57A 2PX5A 1JU3A 3AB3A 3DVLA 3GNTA 4Q37A 1X1BA 3FFBA 4TSKA 4CKEB 2V96A 6AT1A 1VL5A 3B12A 5C18A 3DPSA 2JI7A 1HPLA 4CN8A 5DH9A 3I3SR 4S35A 2AZTA 3N8GA 1YXMA 4U02A 4ZYWA 2AWOA 3VPDA 3NFYA 3AR5A 4XFKA 1S8NA 3PIDA 5K0CA 5A62A 3NAMA 2ZXUA 1C5KA 3AP3A 3DBLA 3GRFA 2PD4A 4CT4B 1L0BA 4RJIA 4TSRA 1XRQA 1XJ5A 3CNLA 1O95A 3IKLA 2MYPA 3FBWA 4O2AB 5AVOA 2GBFA 2WB2A 2JD0A 4UDXX 4AU1A 3QI2A 1GKYA 1J0DA 2IZ5A 3FMPB 3CX6A 4NI5A 4BZZA 2BPOA 3H9GA 2C94A 1CCWA 3T06B 1V95A 1UBHS 3R24A 5FOTA 3I76A 3VNAA 1TFUA 2HK9A 3ZIAD 1JG7A 2L42A 4W6QA 5BW5A 5FPYA 4MKIA 4KZPA 3C85A 3ZHSA 3MS7A 1F8YA 4PG4A 1TZJA 3NIDB 1YE3A 1T6BY 1XVIA 4N49A 4NCXA 5EKSA 7GPBA 1IYZA 2PK3A 1IQ0A 3ZHXA 4O3FA 1FNSA 3AF4A 3Q0TA 5H3LA 3W8EA 1YCDA 1ST3A 2IOQA 2VC2B 2WLSA 2WU0A 3LNCA 5U4QA 4BLOA 4R83A 4CV3A 1C14A 5JD6A 4QPPA 2BM1A 2B6NA 3IOMA 1E7YA 2RIPA 4OQZA 5DM1A 1JDPA 1JKMA 5BV8A 4NG5A 3KYIB 2F1RA 3OPXA 2RAVA 2JIOA 5DTEA 2C5AA 2H4XA 5A4AA 1Z5UA 3PYLA 1MOSA 2PSSA 4JJ4A 1WDTA 5ALGA 3VZCA 3OZXA 3DJYA 3WGTA 1LWNA 1I3LA 8ABPA 4XVRA 3BGOS 3MMPA 4FR5A 4IO1A 4CKCA 1DKUA 4M9QA 3U4GA 4EKNB 4EO7A 4OXYA 2Q2VA 5ARDA 1BXZA 3MGKA 2GN4A 2VNKA 1E4VA 5LUBA 3FWZA 1I24A 2XUJA 2A2ZA 1L5QA 1F4LA 1WMBA 3L0DA 5A3QA 7REQB 4B4DA 4MKHA 1E7WA 2FP4A 2CD7A 2C2ZA 2ZPUA 2ZYIA 4MH0R 4WGGA 1MIOB 4BCBA 1V9CA 4J0EA 5J63A 3CXCZ 1PUJA 2I2BA 2OTJZ 4M1YA 5ALZA 3PX2A 3B8EA 5LMNB 2JLSA 4BDSA 4LRSB 2CXPA 1JYEA 3V6MA 5LPNA 3L43A 1FDSA 2GDJA 1MA0A 5A5GA 3C3AA 3ONVA 3R9KA 1I5OA 1W5TA 2NZUG 5HDBB 1EBBA 2Z8ZA 5EUMA 3RK0A 3SBEA 1R9MA 1PT8A 1S9HA 1EFKA 1SC3A 4Y2YA 3WIEA 3EFOB 1AS3A 3F96A 2QLTA 3HP1A 3QH4A 4BXOB 3A14A 1YU6A 1SKQA 4OYHA 1W1IA 4TUYA 1IBKB 2ZJOA 1TVMA 2PBRA 3ICWA 3C1TA 4OU5A 3QRWA 2YV3A 3KPUA 2FU5C 4N7RA 3WRVA 2FPIB 2NADA 1WD5A 5MN6A 2JHFA 2FPOA 3K05A 1HDEA 3DMGA 2J6IA 1P0PA 3K70B 2P35A 2ZI4A 3PJFA 3VU9B 2R1VB 5AI4A 4ECAA 5NLLA 2BLNA 4PCLA 4E5NA 1NF9A 3DUWA 1EAMA 4FOTA 4MS1A 3W7BA 4A2QA 1JLKA 5IJZA 5B58C 3L6BA 5D3QA 3JQ9A 4L15A 2JGKA 4ZODA 1GSHA 4KQMA 2VP9A 3CUWA 4X1IB 3EH1A 4G0XA 5IBRA 4GZMA 3JYOA 4P92A 1IIBA 3JVUA 1ZS9A 1QAMA 1HO3A 2OL4A 2ZUUA 4B6RA 1CIVA 3M5WA 3D59A 3L79A 2PV0A 4QJ4A 3FFWA 4DPMA 2K2WA 1Y5IA 3GZNA 2CZQA 3HCRA 3IPCA 4M1QA 2GUWA 4MITA 4NS1A 1DFHA 4AY5A 2B4QA 5JR3A 1CTQA 2A6PA 2RHWA 2AL7A 1IJKA 1W93A 2FN7A 1YZ3A 3D3QA 4E51A 1BX1A 1N8SA 2OXFA 1O94A 3BHMA 1WE2A 3F6EX 4P4NA 3JAWA 1TQ6A 4HDOB 5K0TA 3WK7A 5IN5A 4Y2SA 3ASUA 3PLAE 2O06A 3IUBA 2EWVA 1KP2A 3LWBA 1KDOA 1Z6ZA 1NNEA 4S24A 4OKNA 1UFRA 3DT9A 1R50A 3H1TA 3OESA 4IHKA 2CNLA 1EP2B 1THMA 1J39A 2XT6A 4RH0A 5AHKA 1JMVA 4OBEA 2MR5A 4B45A 5E0KB 2BCGY 4AUKA 4BE4A 5L3RA 3GLIB 2FFJA 3MT9A 1ZZEA 4MPDA 1DJPA 1GLVA 2WKQA 4INAA 1UT5A 3L02A 1QZTA 2CK3A 4XLZA 5C4MA 1IK4A 3H86A 4L8GA 5CCXA 3ZE6A 4RFSA 1Z2DA 1AZSC 1YK1A 3H11A 4X94A 2IPLA 3ZH9B 2JGIA 3BCUA 5CR9A 4DW8A 2QUIA 5HOEA 1KR5A 3LFTA 3GZTB 3L1UA 1Q83A 5E4TA 4C7OA 1QGYA 1SCJA 4B71A 1RI1A 1XHLA 4H6VA 3B6KA 3X44A 2EWWA 1TUEA 2ONKA 3PXXA 4BV9A 4EIWA 2JGLA 4YPOA 2YZ7A 4Q93A 2HBRA 3FHCB 4XTRA 4L3OA 2EBWA 3T5BA 4F71A 1QQBA 5E8RA 1OASA 2DFDA 4AY4A 2WJIA 1GG5A 4QQKA 2M98A 3KZKA 3HM9A 4JVLA 1PGNA 3T54A 3CC2Z 2GA9A 3PWSA 1QHEA 4JP1A 4OGWA 4D96A 4YRZA 3TGWA 4BATA 4FEEA 2QG6A 3SR3A 3EIEA 1C30B 4NTZA 4R2JA 1I6LA 1NF8A 3A0UA 2VUHB 3G9UA 1MRZA 5ALIA 1UDWA 2DHEA 1DINA 2B4YA 3HN7A 5KNDH 4DB4A 3AFIA 1CUJA 5BN4B 1ATZA 2IELA 2VK4A 4X0EA 3RCBA 5AJWA 4FCTA 3A6KA 3UA3A 5C7IO 5CLQA 3DPIA 1VL1A 4YXWD 5ISMA 1WP9A 5REQA 1XQVA 3GFFA 4P58A 4QGGA 5EEHA 3RVBA 4D99A 2XOEA 5J23A 4OHMA 1KRXA 2ZSBA 4NLLA 5KYYA 2FPPA 1V6SA 4AUMA 5ALEA 2ZQZA 3WYBA 1L1EA 2B4AA 2HBYA 3FYHA 3Q10A 1AUXA 1Q7Y2 3I9LA 5MDHA 3CMEZ 5HBRA 4ZYUA 1HMPA 1S1MA 2A1UA 2P6NA 4K6FA 4Q34A 5FULA 8ADHA 3GCFA 1QV7A 2WD9A 4QSMA 3V8VA 3H19A 4LHEA 4N0EA 1N2GA 3SSAA 4OTZA 4RA6A 1T6NA 1DOHA 3SD7A 5IX8A 1E6MA 4H7DA 2AEJA 1X7YB 4ALNA 1XROA 3ZJVA 5KB3A 4KQIA 3CZAA 1YJN1 1P4AA 1ULTA 2YMLA 3ABSB 3HDVA 1FNBA 3A25A 5HFAA 3RVJA 4U7DA 1TTPB 4LCEA 4UTRA 2Q3DA 2Z6QA 1K0FA 4PAOA 5LQKA 4DCUA 5JYDA 3OF2A 3FJOA 4PCAA 3K0SA 1W581 1YZTA 1YT5A 2GRJA 1SXJE 3ZTTA 2ZUEA 4ZO8A 4IHAA 1TMOA 3KKNA 4F4HA 2I87A 3H13A 1VQOZ 2BMDA 2Z9DA 4YMWA 2J48A 2I4MA 2TRSB 3H2BA 4JUIA 3TZEA 1AM4D 1F0NA 3S1RI 1HI9A 2YICA 4JHLA 5IP9I 4YP1A 2J7PA 4UTNA 5T4FA 7ADHA 2DUWA 4LUCA 2AEMA 2OY0A 2IHNA 2WJYA 1W47A 4MARA 1GTJ1 3TDKA 3JVIA 3GP5A 1YS7A 3JQCA 1GSAA 4RFLA 2RB5A 2BGIA 3IMGA 1Q19A 1B0UA 3H18A 3E9QA 1CNMA 3D31A 3OFKA 4AP5A 5GAJA 3NHPA 3Q40A 1TTTA 5I3ZA 4A10A 4WNIA 4QFDA 1GNPA 4O33A 3UWOA 2PS1A 4J43A 2DG2A 1RQXA 1ZMOA 2VXYA 4PVCA 3T5CA 3USES 5E6SB 2V8BA 3G2LA 2W71A 4RV9A 4GD3Q 1T0IA 5BUZA 2O6LA 4JVNA 1X0XA 4URYR 3W8FA 2V55B 3H2JA 1T5TA 1HX7A 1KAMA 1NQWA 1R8QA 2H92A 3MINA 3MWYW 1L9KA 4QWMA 4TZTA 2G9NA 1GADO 1UZNA 4N82A 2WJWA 1PWXA 9ATCA 4WZ6A 4F1KA 3ZDDA 2GZ2A 2AE2A 4EYEA 5AVQA 2LIVA 1G3QA 1DC4A 1ONSA 3HRHA 3WGNA 5IS2A 3MONA 1H2FA 2OE2A 3KEQA 4OM8A 3FG9A 3U40A 1KC82 4W5RA 5BMOA 3E3LA 2FQ1A 2H1OA 4IDCA 2VF7A 1VI2A 2XECA 1N0IA 4CMEC 2Q3JA 1ZUD1 1Z2OX 5JD5A 3HWSA 1PZFA 1H3NA 1QIJA 2Q4ZA 1QRDA 3I01A 2IH4A 4YUXA 1CQWA 4DF3A 1RO4A 2A0UA 3PD1A 1XZFA 1Y1SA 3H8SA 2A3NA 3GD5A 2Q6VA 3KOOA 4GG1A 4GYWA 3V55A 4KQJA 4OGLA 3FAKA 5DN9A 3WI7A 5ESWA 1TKAA 1U99A 4WKBA 3UJ6A 1N2CE 1UPXA 1GFWA 2H8KA 2ZROA 3RJMA 1KDTA 2YXLA 2QMZA 3HR7A 1OBOA 5D87A 3GGOA 4D0GA 5AVUA 3B52X 1RQ7A 2Q6TA 3IHKA 4LZJA 4IBOA 3OLCX 3SEQA 3I4LA 4NJEA 3D1JA 3ZGOA 1W2GA 4DLAA 4ZK6A 3JAKB 2QP3A 2GESA 2WT4A 1F6DA 3ZY6A 3VPFA 1QWSA 4P32A 1OFGA 4RVFA 3NJRA 1QH8B 3K1TA 4H6PA 4CUKA 1XQYA 3VSDA 1UFVA 2W2KB 3CRQA 2LDBA 5J5VA 3I23A 4RTMA 5H4HA 1GFSA 1W25A 3EWNA 1NUTA 1O0CA 1QIHA 1KRHA 1NTRA 1RM0A 2KLHA 3LWNA 1SM4A 3KSBC 2QLVB 4OHCA 3OQIA 3R7NA 4UASA 2N47A 3U9LA 3NNNA 4A8JC 1KI7A 4O4JB 4WPGA 4QECA 1UJCA 1T9CA 2VJDA 1WMSA 4N3NA 1JTFA 3L8EA 3CR8A 4B34A 1JA0A 5FUYA 4WBNB 5HDQA 1LS1A 2JAOA 3VBEA 4U1RA 1PFQA 4OVKA 5I51A 4LOHA 4NE7A 2V0NA 3NR2A 2BMEA 1N5OX 2XHZA 1OTYA 2A92A 2BZSA 3FMVA 4TL8A 5D1HA 4J76A 3U7QA 5J2TA 3D4PA 1MB9A 4KXNA 1DIGA 5THXA 4L4SA 2RG1A 4A26A 4PX9A 4PC3A 2HWKA 5ALQA 2Q4RA 1C7FA 5BSMA 3LIIA 1Y3HA 1NURA 2QROA 4MW9A 4XVCA 3H1GA 3S1AA 2AXQA 2INGX 4BVKA 5BRJA 1W88B 4N5IX 1W5BA 4MEJA 4N6NA 4PWYA 3E9YA 3A36A 4O2AF 3OQMA 3R77A 1F2DA 4OFWA 5FL3A 4BKPA 4MS4B 5M29A 1MP0A 2ZJ0A 3V4VB 3P5SA 2H2DA 3R40A 3ELDA 3ZY5A 1SU4A 4K1LA 4GPZA 1XRPA 3DT8A 1X3ZA 4QDZA 4XPZA 4ZO7A 4YAKA 4MQ4A 3M2PA 3EA0A 2J7KA 1DPGA 3S1MI 3MZLB 1JQ5A 3N75A 5EHGA 4B09A 2NNWB 5K3OA 1AGYA 2G72A 4NMWA 5FO1A 4UOEA 2WB1A 1MZVA 1UPUA 4KN6A 4UAUA 1BWRA 3L7IA 4A9AA 5DN6D 3GLFA 3ZOKA 4XPIA 1WCWA 3K09C 4G0VA 1A2QA 3DXFA 4EEKA 2WYWA 2O2IA 3E3NA 2AD1A 3QY9A 4KIGA 2QRVB 1W7AA 3QX7A 1LLQA 1LNSA 1EHIA 2OV1A 3B6JA 5TGZA 4IDBA 1GP2A 2IA5A 2QAJA 3C6QA 2G63A 1O5OA 5T4HA 1MX9A 1J0CA 3HK2A 3DBIA 5HZHA 4NBTA 4F6RB 3OOJA 3FBTA 4Y2JA 1R0SA 4HMOA 3GJ6A 3BMCA 2GCEA 3FNBA 2PRIA 3HDJA 4B6PA 1T9KA 1Z13A 1E3WB 2NYVA 1I3QI 5DYWA 4LJRA 1FW8A 3IH5A 2I3CA 3KOWA 1Z2NX 3MERA 4Q4HB 1K5PA 1QVFZ 1YGPA 3CHYA 3P9KA 3RJTA 4HRYA 1YE5A 4UBMA 4RGYA 3DC7A 3GJ7A 3NRJA 3NBZC 1E98A 4A4DA 2DPXA 821PA 3QLUA 4W6ZA 4FJ2A 1GZDA 4KXXA 5SY9A 3ZDAA 3NZEA 1B4DA 2W4IA 1TYEB 1R4MB 3BB3A 4RY0A 2O7VA 4TRMA 5K8JB 2VJKA 2QDXA 3SNHA 2BONA 3K6SA 1M7BA 4TWBA 1BFKA 2P2DA 2SNIE 1NV8A 4XD7D 5IDVA 5K3DA 3WL7A 2BFAA 4B82A 1QX4A 4DRZA 5I4CA 4ZEXA 5T67A 1GD1O 1TU3A 3U7FB 5FR2A 3SLKA 1J8YF 1T8WA 3WTBA 3D6WA 1VMAA 3P2IA 1TC1A 3QE2A 1E2QA 1TGYA 2OUIA 4EY3A 4DMLA 3HO1A 5EJ8A 1HEYA 3ENQA 1JQJC 4U6QA 4BVBA 3NH9A 5ARBA 5BNIA 3NP9A 1P5FA 3RC9A 1X42A 2OZVA 3B3GA 4NBRA 1S6YA 3IEPA 1XPUA 1QHFA 3NOOA 3T3DA 1JAYA 4FW8A 3GMTA 3COZA 1NJ5A 3HUEA 4KOAA 4TROA 1OIVA 3FZGA 3OEHA 5CX1B 1YRQA 5AKJA 2V45A 1CE8B 2ZYHA 4LC9A 1JTEA 1SRRA 2CYAA 4PYNA 1UODA 4CGYA 4D97A 4D82A 3WS7A 4RQAA 3UW1A 3Q9LA 4HEA6 4NE9A 4TLBA 4QLOA 3ZIDA 4ENUA 4JEHA 4UOZA 1VIDA 5KI6A 3WK6A 3UUEA 4Z7JA 4MR8A 2ZSJA 3GX1A 1T4BA 1NI4A 5HPYB 3FZEA 2PX0A 2P67A 1RM4A 4OHVA 1L4BA 4B7AA 5HQ3A 2LWIA 2IXEA 4G5HA 3SN6A 4REOA 2O5EA 2XLCA 4CEJB 4LS3A 4YMIA 4I55F 1HTWA 4YRLA 3RKSA 1N6HA 3OQBA 1GDDA 2QLNA 3B53X 1NIJA 1XQXA 3EYAA 2JLAA 2Y1WA 1SBYA 4QWWA 4X93A 2OMEA 5FTKA 2VCYA 2VJLA 1SQ6A 2ZR8A 3AHEA 5L3QB 3GTQI 4GEKA 4YCBA 3VKHA 4YJGB 1RRVA 1MR3F 2X3YA 3AR4A 3C3DA 2ESRA 3S44A 3ROZA 2C03A 3WOVA 5K4GA 4E22A 2R7LA 1AUVA 1TJPB 2J9GA 2WD8A 1DBVO 5EWJB 3F7MA 1NXSA 1YIOA 5KVQA 2JJ1A 4C0JA 1W36D 1B1AA 4HZUB 3C3PA 4MLDA 3TBFA 5C4IA 4KQWA 4OAQA 2CE2X 4BLTA 2I6GA 2QQGA 1GRVA 2Q1UA 3CUEF 3PPIA 4OYLA 1CIJA 3SYLA 5TS2A 5LM3A 1SFOI 2OC9A 5HS4A 2JJMA 4MWSA 3PQFA 2HF7A 3CBQA 3LBYA 5E3IA 3SYMA 2WD7A 2XIQA 1CDZA 3BZBA 4YLGA 5DX8A 1I10A 4M7RA 5E2BA 2AMJA 4FC6A 3U60B 1K3TA 4I99A 1Y6RA 2PX4A 4KE9A 4LJYA 3AI3A 2ZTSA 4PSDA 2P41A 1TT5A 5LDHA 4FC7A 2D1FA 1NVVR 3CG0A 4W5OA 5IT0A 4M8IA 2IXBA 2VRWA 4MH4A 4ZO9A 2CXHA 4G5OA 4GKAA 4B75A 3V42A 2LTAA 4LA4A 1FJXA 2FLWA 5CT4A 3BILA 1XK7A 5EWMB 1SVLA 2EP8A 4N3AA 1QVGZ 4D4KA 2N75A 1Z33A 4QSHA 5GJCA 4ABTA 1DRJA 1NUQA 4JZKA 3E15A 4JSRA 4P38A 3MG9A 4DIUA 1SOWA 1O6ZA 1RWKA 1P6UA 4CLRA 3RRMA 3INRA 3HY6A 5CM9C 3H4IA 1AN9A 1Q3TA 1UXGA 3EZGA 3R9XB 1RQRA 1E3DA 3HB9A 2R84A 1QYPA 3AR3A 3C8HA 3KBOA 4R3WA 2JAXA 1YFZA 4PG5A 2OESA 3URKA 5HVNA 2GK4A 3SBOA 2B5OA 3H9CA 5IHXA 4NB9A 1FRNA 3RSZA 4ACBA 4QQNA 4ETNA 2VBGA 4P4GA 2VYVD 5EEGA 4HL6A 5IK2A 2LKDA 2QRUA 4QUJA 1IN1A 4X6XA 3WNZA 1Y34E 4P4SA 3AUUA 5DGHA 2C9DA 3OOSA 3PNLA 1E4EB 3R7AA 4XLTA 3S2YA 3TINA 3EGDA 4DBZA 1T2CA 2OGZA 5IUNC 3I09A 4QULA 1HZJA 3PJGA 3EGXA 4RY2A 3RSGA 3WIBA 2P4UA 3GRRA 2OXEA 3A27A 4BRZA 4CV1A 3AVQA 1V3QE 2M6SA 3LDGA 5FAXA 4PYRA 5AP9A 1D5CA 2DQZA 3DOCA 1AA9A 2CWWA 1ZITA 2WKRA 4H60A 2HT1A 2J59A 2J85A 4WV3A 3OJLA 2W2MA 1XQWA 3EUFA 2IZ0A 4XLLA 4IUYA 1DOZA 5ITZA 1IM5A 2JFXA 3D8UA 4HBGA 1CJSA 5TPWA 1SHJA 4HPWA 3C39A 1VLZA 3W9UA 5I4KA 2VOEA 2FZLA 2WQ6A 3TG2A 4TV9F 3I9OA 3T95A 3ORFA 1YS6A 2YC4C 2A0KA 3U2QA 3Q9UA 1P2FA 1APBA 4UXIA 4DLRA 5FWXA 1Y1VI 1CUVA 4B79A 1QHHA 1T8SA 1W85B 2BGJA 2DAPA 4BEVA 4X90A 2BC9A 3CLHA 3HJUA 3TEJA 4KQGA 1P60A 4D80A 4L0CA 2HLNA 3DBOB 3DOOA 4IDGA 4JVSB 4QICA 4RKRA 3Q8KA 2Z3ZA 1IONA 3WLKX 5J5AA 2QVBA 1TCUA 4BUJA 1R2QA 2BFCA 2HCBA 5E6RB 1EWYA 4Q7KA 4OSOA 2FFBA 4RADA 3QU9A 4LY3A 2ZWAA 2QRZA 3LV8A 4OKSA 3IR7A 4MUHA 1UBTS 3UG7A 1W36B 1WV0A 4OSPA 4E33A 2W8ZA 4BBAA 4YMHA 2XCOA 4JN6B 1ZD2P 4W82A 2ZAOA 3RVQA 4KLRA 5EHNA 2CXSA 2VPZA 2W43A 4PY2A 2OTJ1 3LVQE 1E2FA 1B41A 3D8BA 4BMNA 3X1XA 2WSLA 5JYEA 1Z38A 1P44A 3UO8B 1ZK4A 2CFIA 3DDNA 4GRAA 1QS0A 4GX0A 1ULAA 2RARA 3UBMA 5L7WA 1HH4A 3BGIA 4EI7A 5TMEA 3QX3A 2O8CA 1LI4A 2EKQA 1EINA 4V02A 3SZGA 1CUYA 3TZCA 1LY1A 5EZQA 1UBLS 4YJ2A 2MMCA 2MSEB 4QYIB 4OAOA 2P27A 2J5BA 4RD0A 2QP9X 4E5VA 4WW0A 4HY3A 2QT0A 1U0LA 1WW8A 4BX9A 5BSFA 1L4NA 5BSWA 2EEZA 1AC5A 2HM7A 4PYOA 4QARA 2XT0A 5B6IA 1QRUA 2OQ2A 1ZLYA 1Q22A 3CF6R 2YY5A 3L0YA 1FYDA 3LUCA 2NV2B 3GGJA 3NHMA 5LU8A 3BSWA 3GR6A 2P6OA 2WMDA 3KIHA 4IZHA 3LMKA 1UH5A 3R9WA 3D7KA 2NPOA 3WV4A 4AJEA 2DJ5A 5KYKA 1UT8A 2JNWA 2PZGA 1H3FA 3LZDA 3WKDA 4EECA 1K8YB 3KWJA 1X94A 3A1FA 2L19A 3TW8B 3NGMA 5I3CA 1P19A 2DERA 1MENA 2PZEA 3DGEC 4FNOA 2AJ8A 3VYWA 2K2QB 5B1DA 1GU0A 1NJ2A 1A5SB 4S1VA 4DAOA 5K51A 3K31A 1Z68A 3HRKA 3PGLA 4TZKA 1OYVA 4RCZA 1J2YA 4A3CI 2IYSA 3LHFA 4IV8A 3IXQA 1HETA 1E9EA 1KMQA 4IG9A 3HJNA 5TF0A 1JFTA 2HHLA 2MWMA 2ZS8A 3U31A 1NOJA 4I36A 5CH8A 1SUAA 4WD3A 3Q3CA 1EJBA 3HZOA 2XQIA 3V1KA 1L7VC 4KV7A 1O77A 4D4JA 1L5VA 4HDAA 2Y71A 4A3II 1UANA 3GH3A 4LXQA 4AO8A 2HD4A 1PJRA 1TUBB 1B7GO 5FYQA 4AKTA 2N1MA 1Y0BA 1XDSA 1C9NA 1VHQA 2R00A 3C4JA 4YN3A 1N25A 1NW3A 2I5PO 2V7EA 3HU1A 3RABA 2PVPA 1N4AA 1NP7A 4MKFA 1FFXA 1ORVA 3B7WA 1ADBA 5KOHB 2QQ5A 5J2UF 3MCZA 4ZDIA 1XTQA 1JDSA 4C4OA 4LRXA 2ZW9A 5CXXA 2GSDA 5EMKA 1UMBA 2P7HA 5HF5A 2R47A 5BV1A 3NG1A 5KTTA 1B3BA 1GIAA 2PUTA 3ESZA 1IOZA 3K20A 4N0MA 1TA0A 3ZNNA 1FJGB 3EBLA 3JVVA 5KC8A 2CB9A 3H5IA 1OIWA 1PWZA 1YA6A 4UCQA 4DEVA 2R97A 2H59A 3NWEA 1NOKA 2IQIA 3GJ3A 4WBNF 1QF7A 2QE7D 4ZK2A 2AG1A 3Q41A 1R9NA 3OG9A 4RK4A 3D8SA 3IPYA 4ND8A 1JU4A 5KQSA 3C8DA 3SJAA 1N8R1 2ISSD 1E63A 4J1SA 3NVAA 3MMXA 3CT6A 2BMWA 3K32A 4I5DA 2J3EA 1GU7A 3SE0A 3LTEA 4BX8A 3V4RA 5D1OB 2GNOA 1MJFA 1HWYA 2ZBDA 2B36A 1J49A 3E7DA 3DR5A 3M1LA 2QM8A 5LL6P 2ZUBA 4CTOA 3RTGA 5G1OA 2ZU0C 3BD7A 4TVOA 3UK6A 2JRCA 5AD1A 3W5BA 3S1LA 2VT3A 3PEFA 1VP3A 3WGKA 1I94B 3CC21 4PF1A 3ER8A 4EMUA 3U61B 1M7GA 1SXJA 4LEIA 1VSVA 1ZD8A 1UL1X 2HPHA 3DKIA 3RVLA 4CMIB 1P81A 4RZUA 1CERA 3ANNA 2PS3A 2DX7A 4NZYA 3JW8A 2YMQA 4G1FA 5JS2A 1EXVA 1I80A 1AF4A 3BFKA 3MWFA 3FUUA 4Y7NI 1RKBA 5ALMA 2BHLA 2B6HA 2F1OA 3QBEA 3OX3A 2HZBA 2QYHA 5H16A 2R4QA 3MN1A 3AU9A 3W77A 3Q3IA 2J4FA 2W6MA 1RKXA 2XA1A 3KNZA 1HOTA 5AVYA 4BMYA 4IJMA 1FC0A 3CKKA 3ZZ0A 1H1DA 1P39A 3OMLA 4PBRA 1BO6A 2XMPA 4S0XA 4RJJA 1ZWLA 5IYZA 4WFQA 1XLWA 1VQ6Z 4BJ1A 5EGNA 5KKNB 1K7FB 2RC6A 2PKYX 1HFWA 1SKYE 2QF7A 1EB9A 3WOHA 1U1DA 3CME1 2H65A 2IPXA 3BB1A 3LZ6A 4R2LA 3VDNB 1WXEA 3CVVA 3CMAZ 3ESYA 3K9BA 3F3YA 2Q0QA 4GWKA 3SQXA 3WIUA 2IEYA 4IMPA 1ADYA 1PAUA 2EZUA 1FZQA 3S14I 2FUCA 1C3OB 2VZ8A 5JD4A 1KIMA 5LBTA 3HPQA 3PYXA 2QPLA 5FFMA 4BASA 4MQ6A 4PVDA 2OG1A 3QX9A 3NKFA 4MMXB 3KWFA 5FOSA 3GEDA 2I62A 4PX5A 3VU8A 1HDYA 2C2OA 1AHPA 5AYVA 4ZAXA 5HILA 3O4VA 1ZYUA 3FCOA 3ETNA 3SC2A 5ECWA 4DS3A 3UPTA 3AF6A 2E82A 4GVXA 4U6NA 1RU3A 4DXHA 3TK1A 2HA4A 4U39A 2QV7A 1ML4A 3AJAA 3IIKA 1JFFA 4TLDA 3PFKA 3AHIA 5SV2A 1VQO1 3A9CA 4HNSA 5JZOA 5K5EA 5FF9A 5A4IS 2C07A 4C3OB 5MHTA 1K27A 1E5QA 2PLNA 4ND6A 4AO7A 4NFLA 1OB5A 5D85A 3W78A 1VQK1 3L07A 2FX2A 3BGSA 1LNQA 2J3DA 3P9IA 1NU6A 1GAJA 1R0WA 2F9MA 2Y4OA 3PGXA 3VYVA 5B5SA 3K0BA 1TLTA 2VT7A 3UJ7A 2G09A 3QQ5A 1UC4B 2X6RA 4MRIA 3TB6A 4XGKA 3GPIA 5BW6B 3WLAA 1VJDA 4L9AA 2I3BA 4TTTS 3IESA 2UYQA 3PCTA 4RZHA 1WMFA 2W0MA 1XMOB 1FFYA 5TJHA 2IK8A 3KVYA 3NAGA 2HA0A 4D9EA 1Z73A 2OTCA 3EFEA 4DREA 5MFZA 1OROA 4OMDA 3PFFA 4JD5A 3SDZA 3UFBA 2KI5A 2CV2A 2X5OA 1H8ED 2AR7A 4UMEA 4HEA1 5IZCC 1L6RA 4ER5A 4TKUA 4YJ3F 4OXNA 5SZJA 4N41A 3KIFA 3ZHVA 3QFCA 3RRNA 1WHSB 2ZCVA 1M2EA 1X7XA 1QPZA 2C77A 3B6ZA 5I9LA 3BXGA 4NXMB 1V2GA 1FXUA 2OAGA 1P5HA 3BIJA 3OC6A 4GLJA 4CUJA 3AW8A 2NO5A 3TLXA 2PO5A 5H02A 1W4RA 2Z1DA 3OQPA 2HU8A 2X9LA 1P1RA 1IBRA 4PZ0A 2D1QA 2MR6A 3HN6A 2R5NA 3OOYA 3P45A 3W5SA 1NZFA 3IRUA 3OE7A 3PSAA 4MX8A 2GB4A 2PH1A 1J2EA 1JG6A 4P34A 3TW6A 3BRWA 5JMOA 4TYWA 1Z26A 1YHQZ 3QLEA 4ZVVA 3LLSA 3CY6A 2IDKA 4OCZA 4MKGA 1EFVA 3SZUA 3U3ZA 1QO9A 1CY7A 1VLHA 3VYTB 1UBEA 4WVLA 2Y05A 4JYBA 1KFCB 4BQSA 4JWTA 3EG5A 1JHRA 4FGLA 4N5NA 2R65A 1FCJA 5LA6A 3OIUA 4RZQA 1V8BA 1QVVA 4IGAA 4RLQA 1VL6A 1QV6A 1R4AA 1VRVA 4YLYA 3Q87A 1P29A 2FH5B 5KOIA 4QDTA 1MCZA 4GUDA 1YITZ 1AGPA 3QPVA 1UMDB 1XTJA 2UAGA 5FPPA 3SK0A 3SOZA 5F2NA 1LPMA 1QCDA 4M55A 5FWNA 5A2QA 3AERA 4IHJA 1RRMA 3OJWA 5HQJA 1JR2A 1NHGA 1Z5NA 4E5KA 5F33A 1ZXXA 3ZZTA 2V6IA 3CZRA 3S55A 2HSDA 4GPAA 2QX9A 4A5SA 1NOIA 5BWBA 3CZMA 3BMNB 4L7VA 4KUEA 2HTEA 4HQ0A 2Z8YA 4JEIA 4L75A 1RP7A 1P9OA 3HKCB 4JS0A 1FQOA 3QOYA 2FAXA 5FB3A 4I9UA 5A2GA 4LF7B 3IP1A 2DTEA 1PE0A 4J3FA 2QN2A 1JXAA 5LOVB 4NBUA 1VQMZ 1LSJA 4JOCA 5ITVA 2HXSA 1BVUA 1KPHA 5DIFA 3OIDA 4L8WB 4KK3A 4D8UA 2F8MA 3DZ8A 4NOMA 4V0SA 2R3SA 1IDOA 2ACEA 2OMKA 2Z9CA 3V4FA 5JEEA 1BS2A 4F2GA 4F8YA 1O54A 2IZ1A 2O57A 4S04A 3QOWA 3GVHA 1J8QA 5IRCD 1Z5VA 2RHTA 2XKJE 4O08A 3ROXA 5ANRB 4LF6B 2LW7A 4GXNA 3V7FA 1G16A 3C6MA 4HWKA 4RHYA 3SQWA 1FSPA 4B83A 1J8FA 1U7DA 1T9DA 3T3PB 3GLVA 3KUUA 3SQLA 4UM9B 5IWAB 1YJ8A 3P4UA 4RLSA 2PJZA 4ZAGA 5CCBA 3PQ4A 3NDIA 1RW4A 1KQSZ 3TN7A 4LGMA 1MHPA 3VR0A 4AQYB 3LCVB 1DIHA 3Q2OA 4E88A 5CDTA 3H3VJ 3IIJA 2MIIA 3HGTA 4BNDA 3KTFA 4G4SO 2ZE7A 4WAUA 3ZEIA 1J7KA 2HUNA 5T6BA 2OZLB 4KX3A 3LRXA 4MVJM 3X1ZA 4F21A 4BO5A 4LRQA 1E1RD 3MS4A 4R1QA 4IDNA 1CRLA 4M0PA 1N32B 4I9FA 5K3CA 1GG2A 1DV1A 2QR3A 3SP1A 3U16A 3JSAA 4NU5A 1K68A 4REQB 3U4IA 3SI7A 3TGLA 1R8XA 3RLFA 3CR7A 4I4TA 2NTEA 4ALIA 4G2TA 1JG3A 3I0ZA 3GDHA 1N8KA 4L5JA 1YI0A 3B13B 3BCHA 2C2YA 5ALNA 3GLGE 4JENA 4TTQA 3X1JA 3D3EA 3WNVA 2IUEA 4B3RB 3QI7A 1SPBS 3RV4A 1OTHA 3S17I 2GOYA 4MIOA 4S1NA 5K99A 3VM6A 3U6BA 2X4DA 4KBYA 4E4RA 2XBUA 4JKOA 3ZYZA 1PS0A 3PJDA 4UQOA 4ERNA 3SSMA 1UOQA 3KK0A 2YOGA 4LWQA 3RASA 3ZWOA 4K9PA 4N03A 1FNDA 4C4PA 3X3HA 1VBKA 3ER9A 4AMGA 1NTOA 3CJRA 2PLWA 1G8GA 3LPMA 4MGYR 1NKSA 2Q4EA 2D0PB 2TSYB 3NT2A 1AJEA 1ECPA 2N46A 3AK4A 4HDRA 2WVHA 2WE8A 4JCOA 3RDPA 2FW7A 1L6IA 1P0MA 2WIKA 4KQ2A 1JI0A 1SA0A 2O3UA 2GBPA 2E6KA 4O02B 4U5QA 4A6PA 4EPTA 3KUKA 4BNVA