3S1QI

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with atp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1qI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1qI02
3GTLI 1I50I 3I07A 3S2HI 3Q87A 4XX2A 2B63I 4Y7NI 1ZB9A 2NVYI 4A3EI 4A3KI 2E2HI 4A93I 2DE6A 2RBLA 4QTTA 5C4XI 3U50C 3HOZI 2K5RA 4MH4A 3ESWA 4NBHA 4NBEA 2NVTI 4A3LI 1NUIA 4BY1I 1WCMI 3VMIA 1Y1VS 2NVXI 3S1QI 1LQLA 2DE5A 4BBRI 1QYPA 4NB9A 2AKLA 4A3CI 3VMGA 1DL6A 1I3QI 3I4MI 1Y1VI 3FKII 4QTUA 3M3YI 1YUAA 3GTOI 3HOYI 1TWHI 3VMHA 4BBSI 1TWGI 3GKQA 1Y1WI 3H3VJ 4A3JI 1PFTA 2JA8I 3PO2I 1VLAA 2E2JI 4NBCA 2KPIA 3S16I 1TWAI 1ML8A 4A3FI 2JNYA 4BXXI 3M4OI 1L1OC 4Y52I 4A3II 2BJOA 3HOUI 2HF1A 1X3WA 2JR6A 4A3MI 4BY7I 3GTPI 2R7ZI 4NBBA 3HOXI 3S14I 1X3ZA 3GTJI 3PO3S 4X6AI 3HOVI 3RZDI 3RZOI 4A3GI 2YU9I 2NVQI 3I4NI 4A3DI 1RLYA 5IP9I 2R92I 5C44I 2P3YA 2F4MA 2PK7A 4NOZA 4NB8A 5CM2M 3LUSA 2JA7I 1K83I 3D6WA 2E2II 1USPA 3PO3I 3S2DI 1WW9A 1TFIA 3GTKI 2R93I 3S1MI 3GCFA 1N2FA 1SFOI 1RO4A 3S17I 1TWCI 2JA5I 3S1RI 4NBGA 1ZB8A 3GTMS 2VUMI 1R9TI 4NBDA 3GTGI 2JS4A 2J6AA 5C3EI 2DE7A 4NBFA 3HOWI 4NBAA 2JA6I 3K7AI 3CQZI 3EERA 3S1NI 1TWFI 5FLMI 1USPB 3H0GI 3VB9A 5IP7I 1I6HI 3GTMI 4A3BI 5C4JI 3S15I 3GTQI 2F4OA
chains in the Genus database with same CATH superfamily
4RS4A 2O53A 3CCM1 2QKDA 2GTHA 4MXUA 2IZ4A 5T6BA 2B63I 1FDIA 4Y7NI 4A3KI 5T67A 3U50C 3VTNA 3G4S1 3CCU1 2NVTI 1Q821 3NH8A 3CC71 1VQ81 1NP6A 3VMIA 1Y1VS 2Y0SA 3CCQ1 3JAMb 1M1K2 2DE5A 2RIQA 5A2Qf 2W04A 1Z02A 2QRCB 2ZAEB 4E33A 4E30A 1VQL1 1YHQ1 2VUGA 1I3QI 3I4MI 1W2BZ 3M3YI 1YUAA 4MRIA 3CMAZ 4BBSI 1Z01A 1W2BY 3CCV1 1YI21 2JA8I 2WAQA 1QVGZ 2KPIA 4E2ZA 5IT9f 4DQYB 3J81f 1QVGY 4A3II 4Y52I 3IF8A 2BJOA 3HOUI 2JIQA 2JR6A 3G4SZ 3CCUZ 1S7MA 3CC7Z 1VQ8Z 1Q862 4BY7I 3MZLB 1VQ4Z 3CCQZ 1QF8A 2OZKA 4DK1A 5A2Qb 1YJN1 2KI7B 3NFZA 1YHQZ 5CM2M 2V8JA 1AA6A 4E31A 2H85A 2W03A 3S2DI 3CD61 3CCVZ 1YI2Z 1SFOI 3S17I 2R6MA 3NH4A 2JA5I 4NBGA 1Q812 2QRDB 1K9M2 1NJI2 4DGLA 1YIJ1 4NBDA 3I561 1S721 5D1OA 5C3EI 2DE7A 4NBFA 2LEXA 4RVDA 3CQZI 3S1NI 4CL1A 2QEX1 3H0GI 3CXCZ 2JIMA 3CME1 1VQ61 3S15I 1Z03A 2QLVB 3CCE1 2GTIA 2IZ3A 2EGTA 3CXCY 2G2KA 1YJNZ 2OTLZ 3IR7A 5C4XI 1KQSZ 1K8A1 4HGYA 4MH4A 4NBHA 2JUBA 4NBEA 4A3LI 3CD6Z 3J80b 1NUIA 1VQ91 1K731 4BY1I 3P5JB 4AYBA 1YIJZ 3I56Z 1S72Z 2AKLA 1QVFZ 4QTUA 2QEXZ 1QVFY 3HOYI 3NDIA 3QWUA 3CMEZ 1VQ6Z 2JMOA 3CCEZ 1VQ7Z 4MD8A 1JJ2Z 3H3VJ 3CC21 1VLAA 4NBCA 3S16I 1VQ41 1JJ2Y 3NH5A 3M4OI 1L1OC 1VQNZ 1X3WA 1VQ9Z 3CCR1 5FLXf 1N8R1 4NBBA 3HOXI 4E32A 4X6AI 1RO0A 2YU9I 2NVQI 3I4NI 2R92I 1FDOA 2P3YA 2E9HA 4NH1C 3D6WA 3PO3I 1USPA 1TFIA 3F3FC 1N2FA 1TWCI 1RNIA 3CC2Z 1ZB8A 2JIOA 1VQM1 2V3VA 3GTMS 2VUMI 3GTGI 1VQKZ 3I55Z 4S1TA 4NBAA 1WIIA 2Q4ZA 3K7AI 1M901 3EERA 1VQOZ 2OTL1 2IV2X 3CCRZ 2JIPA 2V8IA 1K8A2 3TDHB 1I6HI 4A3BI 2PMZA 5FLXb 5C4JI 2F4OA 3GTLI 1K732 3I07A 3S2HI 2K3RA 3Q87A 3MZKB 4XX2A 5D1OB 2QA41 1ZB9A 2NVYI 4A3EI 2VPXA 2RBLA 1YJW1 3HOZI 1X0TA 3NDJA 3G711 5IT9b 3J81b 1WCMI 1LQLA 1VQMZ 4BBRI 2YADA 1QYPA 4NB9A 1Q822 1VQ71 4A3CI 3VMGA 1DL6A 2V45A 3CCL1 1Y1VI 1TWHI 1RO2A 3TE5B 1KC81 1VQN1 4MONA 4A3JI 1N8R2 3PO2I 3BG0B 2E2JI 1TWAI 1KQSY 1ML8A 1P9NA 2JNYA 2VPWA 2QA4Z 2HU9A 4BXXI 3IFUA 3HKZA 3FQMA 1YJWZ 5LL6f 1YIT1 4RVGA 2WB1A 1VQ5Z 3G71Z 4A3MI 2RT9A 3CC4Z 1WZNA 3IX0A 1ZH1A 2R7ZI 3S14I 3GTJI 2VPYA 5D1PA 1Q7Y1 3RZOI 4A3GI 2OTJ1 4A3DI 5IP9I 5C44I 3MONA 2PK7A 4NB8A 3CCLZ 3LUSA 1NJI1 1VQK1 2JA7I 1K83I 2I3CA 3I551 2E2II 1WW9A 3GTKI 4RVHA 2R93I 1YUKA 1M902 3S1MI 3GCFA 3KIHA 1VQO1 2JS4A 2VPZA 3HOWI 1KD11 2NAPA 3G6EZ 2P28A 1YITZ 2LFUA 4RV9A 2GU2A 1USPB 3VB9A 3CCS1 3GTQI 2OTJZ 1I50I 1VQPZ 5AN9F 4E2YA 4HGZA 2E2HI 4A93I 2DE6A 4QTTA 4HH4A 2K5RA 4NFRA 3ESWA 4E2XA 3CCMZ 3J7A4 2OOYB 2NVXI 3S1QI 3F3PC 1KC82 4RVFA 1JWHC 3OW2Z 2Q51A 1YJ91 3T4NB 3OW2Y 3FKII 3CCJ1 3GTOI 3VMHA 3CCSZ 1M1K1 1TWGI 2O4HA 3GKQA 1Y1WI 1Y8CA 1PFTA 1VQ51 1VQLZ 3FQQA 2AYDA 3CC41 4A3FI 3EEDA 3J80f 1Q7Y2 2M48A 1SIWA 1RQFA 2HF1A 3BG1B 4TNUA 2QREB 2E7ZA 3D2LA 1WJ2A 3GTPI 1X3ZA 3PO3S 3HOVI 3RZDI 2VF1A 1RLYA 1YJ9Z 2RHBA 2M6NA 1Q16A 2F4MA 2OOXB 4NOZA 1Q861 3CCJZ 1KD12 2RPRA 3G6E1 2JIRA 4MD9A 2PM9A 3KIFA 1RO4A 3JAMf 3S1RI 1R9TI 2V8KA 3CPWZ 2J6AA 4MD7A 1QXFA 2JA6I 5T64A 1KRLA 4E2WA 1VQP1 3CPWY 3D9XA 1TWFI 5FLMI 5IP7I 3GTMI 3CMA1 1Q811 2LIYA 4EWCA 1K9M1 2QR1B
chains in the Genus database with same CATH topology
4RS4A 2O53A 3CCM1 2QKDA 2GTHA 4MXUA 2IZ4A 5T6BA 2B63I 4Y7NI 4A3KI 5T67A 3U50C 3VTNA 3G4S1 3CCU1 2NVTI 1Q821 3NH8A 3CC71 1VQ81 1NP6A 3VMIA 1Y1VS 2Y0SA 3CCQ1 3JAMb 1M1K2 2DE5A 2RIQA 5A2Qf 2W04A 1Z02A 2QRCB 2ZAEB 4E33A 4E30A 1VQL1 1YHQ1 2VUGA 1I3QI 3I4MI 1W2BZ 3M3YI 1YUAA 4MRIA 3CMAZ 4BBSI 1Z01A 1W2BY 3CCV1 1YI21 2JA8I 2WAQA 1QVGZ 2KPIA 4E2ZA 5IT9f 4DQYB 3J81f 1QVGY 4A3II 4Y52I 3IF8A 2BJOA 3HOUI 3G4SZ 2JR6A 3CCUZ 1S7MA 3CC7Z 1VQ8Z 1Q862 4BY7I 3MZLB 1VQ4Z 3CCQZ 1QF8A 2OZKA 4DK1A 5A2Qb 1YJN1 2KI7B 3NFZA 1YHQZ 5CM2M 2V8JA 4E31A 2H85A 2W03A 3S2DI 3CD61 3CCVZ 1YI2Z 1SFOI 3S17I 2R6MA 3NH4A 2JA5I 4NBGA 1Q812 2QRDB 1K9M2 1NJI2 4DGLA 1YIJ1 4NBDA 3I561 1S721 5D1OA 5C3EI 2DE7A 4NBFA 4RVDA 3CQZI 3S1NI 4CL1A 2QEX1 3H0GI 3CXCZ 3CME1 1VQ61 3S15I 1Z03A 2QLVB 3CCE1 2GTIA 2IZ3A 2EGTA 3CXCY 2G2KA 1YJNZ 2OTLZ 5C4XI 1KQSZ 1K8A1 4HGYA 4MH4A 4NBHA 2JUBA 4NBEA 4A3LI 3CD6Z 3J80b 1NUIA 1VQ91 1K731 4BY1I 3P5JB 4AYBA 1YIJZ 3I56Z 1S72Z 2AKLA 1QVFZ 4QTUA 2QEXZ 1QVFY 3HOYI 3NDIA 3QWUA 3CMEZ 1VQ6Z 2JMOA 3CCEZ 1VQ7Z 4MD8A 1JJ2Z 3H3VJ 3CC21 1VLAA 4NBCA 3S16I 1VQ41 1JJ2Y 3NH5A 3M4OI 1L1OC 1VQNZ 1X3WA 1VQ9Z 3CCR1 5FLXf 1N8R1 4NBBA 3HOXI 4E32A 4X6AI 1RO0A 2YU9I 2NVQI 3I4NI 2R92I 2P3YA 2E9HA 4NH1C 3D6WA 3PO3I 1USPA 1TFIA 3F3FC 1N2FA 1TWCI 1RNIA 3CC2Z 1ZB8A 1VQM1 3GTMS 2VUMI 3GTGI 1VQKZ 3I55Z 4S1TA 4NBAA 1WIIA 2Q4ZA 3K7AI 1M901 3EERA 1VQOZ 2OTL1 3CCRZ 1I6HI 2V8IA 1K8A2 3TDHB 4A3BI 2PMZA 5FLXb 5C4JI 2F4OA 3GTLI 1K732 3I07A 3S2HI 2K3RA 3Q87A 3MZKB 4XX2A 5D1OB 2QA41 1ZB9A 2NVYI 4A3EI 2RBLA 1YJW1 3HOZI 1X0TA 3NDJA 3G711 5IT9b 3J81b 1WCMI 1LQLA 1VQMZ 4BBRI 2YADA 1QYPA 4NB9A 1Q822 1VQ71 4A3CI 3VMGA 1DL6A 3CCL1 1Y1VI 1TWHI 1RO2A 3TE5B 1KC81 1VQN1 4MONA 4A3JI 1N8R2 3PO2I 3BG0B 2E2JI 1TWAI 1KQSY 1ML8A 1P9NA 2JNYA 2QA4Z 4BXXI 2HU9A 3IFUA 3HKZA 3FQMA 1YJWZ 5LL6f 1YIT1 4RVGA 2WB1A 1VQ5Z 3G71Z 4A3MI 2RT9A 3CC4Z 3IX0A 1ZH1A 2R7ZI 3S14I 3GTJI 5D1PA 1Q7Y1 3RZOI 4A3GI 2OTJ1 4A3DI 5IP9I 5C44I 3MONA 2PK7A 4NB8A 3CCLZ 3LUSA 1NJI1 1VQK1 2JA7I 1K83I 2I3CA 3I551 2E2II 1WW9A 3GTKI 4RVHA 2R93I 1YUKA 1M902 3S1MI 3GCFA 3KIHA 1VQO1 2JS4A 3HOWI 1KD11 3G6EZ 2P28A 1YITZ 2LFUA 4RV9A 2GU2A 1USPB 3VB9A 3CCS1 3GTQI 2OTJZ 1I50I 1VQPZ 5AN9F 4E2YA 4HGZA 2E2HI 4A93I 2DE6A 4QTTA 4HH4A 2K5RA 4NFRA 3ESWA 4E2XA 3CCMZ 3J7A4 2OOYB 2NVXI 3S1QI 3F3PC 1KC82 4RVFA 1JWHC 3OW2Z 2Q51A 1YJ91 3T4NB 3OW2Y 3FKII 3CCJ1 3GTOI 3VMHA 3CCSZ 1M1K1 1TWGI 2O4HA 3GKQA 1Y1WI 1PFTA 1VQ51 1VQLZ 3FQQA 3CC41 4A3FI 3EEDA 3J80f 1Q7Y2 2M48A 1RQFA 2HF1A 3BG1B 4TNUA 2QREB 3GTPI 1X3ZA 3PO3S 3HOVI 3RZDI 2VF1A 1RLYA 1YJ9Z 2RHBA 2M6NA 2F4MA 2OOXB 4NOZA 1Q861 3CCJZ 1KD12 2RPRA 3G6E1 4MD9A 2PM9A 3KIFA 1RO4A 3JAMf 3S1RI 1R9TI 2V8KA 3CPWZ 2J6AA 4MD7A 2JA6I 5T64A 1KRLA 4E2WA 1VQP1 3CPWY 3D9XA 1TWFI 5FLMI 5IP7I 3GTMI 3CMA1 1Q811 2LIYA 4EWCA 1K9M1 2QR1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL I;  1I50 I;  3I07 A;  3S2H I;  3Q87 A;  4XX2 A;  2B63 I;  4Y7N I;  1ZB9 A;  2NVY I;  4A3E I;  4A3K I;  2E2H I;  4A93 I;  2DE6 A;  2RBL A;  4QTT A;  5C4X I;  3U50 C;  3HOZ I;  2K5R A;  4MH4 A;  3ESW A;  4NBH A;  4NBE A;  2NVT I;  4A3L I;  1NUI A;  4BY1 I;  1WCM I;  3VMI A;  1Y1V S;  2NVX I;  3S1Q I;  1LQL A;  2DE5 A;  4BBR I;  1QYP A;  4NB9 A;  2AKL A;  4A3C I;  3VMG A;  1DL6 A;  1I3Q I;  3I4M I;  1Y1V I;  3FKI I;  4QTU A;  3M3Y I;  1YUA A;  3GTO I;  3HOY I;  1TWH I;  3VMH A;  4BBS I;  1TWG I;  3GKQ A;  1Y1W I;  3H3V J;  4A3J I;  1PFT A;  2JA8 I;  3PO2 I;  1VLA A;  2E2J I;  4NBC A;  2KPI A;  3S16 I;  1TWA I;  1ML8 A;  4A3F I;  2JNY A;  4BXX I;  3M4O I;  1L1O C;  4Y52 I;  4A3I I;  2BJO A;  3HOU I;  2HF1 A;  1X3W A;  2JR6 A;  4A3M I;  4BY7 I;  3GTP I;  2R7Z I;  4NBB A;  3HOX I;  3S14 I;  1X3Z A;  3GTJ I;  3PO3 S;  4X6A I;  3HOV I;  3RZD I;  3RZO I;  4A3G I;  2YU9 I;  2NVQ I;  3I4N I;  4A3D I;  1RLY A;  5IP9 I;  2R92 I;  5C44 I;  2P3Y A;  2F4M A;  2PK7 A;  4NOZ A;  4NB8 A;  5CM2 M;  3LUS A;  2JA7 I;  1K83 I;  3D6W A;  2E2I I;  1USP A;  3PO3 I;  3S2D I;  1WW9 A;  1TFI A;  3GTK I;  2R93 I;  3S1M I;  3GCF A;  1N2F A;  1SFO I;  1RO4 A;  3S17 I;  1TWC I;  2JA5 I;  3S1R I;  4NBG A;  1ZB8 A;  3GTM S;  2VUM I;  1R9T I;  4NBD A;  3GTG I;  2JS4 A;  2J6A A;  5C3E I;  2DE7 A;  4NBF A;  3HOW I;  4NBA A;  2JA6 I;  3K7A I;  3CQZ I;  3EER A;  3S1N I;  1TWF I;  5FLM I;  1USP B;  3H0G I;  3VB9 A;  5IP7 I;  1I6H I;  3GTM I;  4A3B I;  5C4J I;  3S15 I;  3GTQ I;  2F4O A; 
#chains in the Genus database with same CATH topology
 4RS4 A;  2O53 A;  3CCM 1;  2QKD A;  2GTH A;  4MXU A;  2IZ4 A;  5T6B A;  2B63 I;  1FDI A;  4Y7N I;  4A3K I;  5T67 A;  3U50 C;  3VTN A;  3G4S 1;  3CCU 1;  2NVT I;  1Q82 1;  3NH8 A;  3CC7 1;  1VQ8 1;  1NP6 A;  3VMI A;  1Y1V S;  2Y0S A;  3CCQ 1;  3JAM b;  1M1K 2;  2DE5 A;  2RIQ A;  5A2Q f;  2W04 A;  1Z02 A;  2QRC B;  2ZAE B;  4E33 A;  4E30 A;  1VQL 1;  1YHQ 1;  2VUG A;  1I3Q I;  3I4M I;  1W2B Z;  3M3Y I;  1YUA A;  4MRI A;  3CMA Z;  4BBS I;  1Z01 A;  1W2B Y;  3CCV 1;  1YI2 1;  2JA8 I;  2WAQ A;  1QVG Z;  2KPI A;  4E2Z A;  5IT9 f;  4DQY B;  3J81 f;  1QVG Y;  4A3I I;  4Y52 I;  3IF8 A;  2BJO A;  3HOU I;  2JIQ A;  2JR6 A;  3G4S Z;  3CCU Z;  1S7M A;  3CC7 Z;  1VQ8 Z;  1Q86 2;  4BY7 I;  3MZL B;  1VQ4 Z;  3CCQ Z;  1QF8 A;  2OZK A;  4DK1 A;  5A2Q b;  1YJN 1;  2KI7 B;  3NFZ A;  1YHQ Z;  5CM2 M;  2V8J A;  1AA6 A;  4E31 A;  2H85 A;  2W03 A;  3S2D I;  3CD6 1;  3CCV Z;  1YI2 Z;  1SFO I;  3S17 I;  2R6M A;  3NH4 A;  2JA5 I;  4NBG A;  1Q81 2;  2QRD B;  1K9M 2;  1NJI 2;  4DGL A;  1YIJ 1;  4NBD A;  3I56 1;  1S72 1;  5D1O A;  5C3E I;  2DE7 A;  4NBF A;  2LEX A;  4RVD A;  3CQZ I;  3S1N I;  4CL1 A;  2QEX 1;  3H0G I;  3CXC Z;  2JIM A;  3CME 1;  1VQ6 1;  3S15 I;  1Z03 A;  2QLV B;  3CCE 1;  2GTI A;  2IZ3 A;  2EGT A;  3CXC Y;  2G2K A;  1YJN Z;  2OTL Z;  3IR7 A;  5C4X I;  1KQS Z;  1K8A 1;  4HGY A;  4MH4 A;  4NBH A;  2JUB A;  4NBE A;  4A3L I;  3CD6 Z;  3J80 b;  1NUI A;  1VQ9 1;  1K73 1;  4BY1 I;  3P5J B;  4AYB A;  1YIJ Z;  3I56 Z;  1S72 Z;  2AKL A;  1QVF Z;  4QTU A;  2QEX Z;  1QVF Y;  3HOY I;  3NDI A;  3QWU A;  3CME Z;  1VQ6 Z;  2JMO A;  3CCE Z;  1VQ7 Z;  4MD8 A;  1JJ2 Z;  3H3V J;  3CC2 1;  1VLA A;  4NBC A;  3S16 I;  1VQ4 1;  1JJ2 Y;  3NH5 A;  3M4O I;  1L1O C;  1VQN Z;  1X3W A;  1VQ9 Z;  3CCR 1;  5FLX f;  1N8R 1;  4NBB A;  3HOX I;  4E32 A;  4X6A I;  1RO0 A;  2YU9 I;  2NVQ I;  3I4N I;  2R92 I;  1FDO A;  2P3Y A;  2E9H A;  4NH1 C;  3D6W A;  3PO3 I;  1USP A;  1TFI A;  3F3F C;  1N2F A;  1TWC I;  1RNI A;  3CC2 Z;  1ZB8 A;  2JIO A;  1VQM 1;  2V3V A;  3GTM S;  2VUM I;  3GTG I;  1VQK Z;  3I55 Z;  4S1T A;  4NBA A;  1WII A;  2Q4Z A;  3K7A I;  1M90 1;  3EER A;  1VQO Z;  2OTL 1;  2IV2 X;  3CCR Z;  2JIP A;  2V8I A;  1K8A 2;  3TDH B;  1I6H I;  4A3B I;  2PMZ A;  5FLX b;  5C4J I;  2F4O A;  3GTL I;  1K73 2;  3I07 A;  3S2H I;  2K3R A;  3Q87 A;  3MZK B;  4XX2 A;  5D1O B;  2QA4 1;  1ZB9 A;  2NVY I;  4A3E I;  2VPX A;  2RBL A;  1YJW 1;  3HOZ I;  1X0T A;  3NDJ A;  3G71 1;  5IT9 b;  3J81 b;  1WCM I;  1LQL A;  1VQM Z;  4BBR I;  2YAD A;  1QYP A;  4NB9 A;  1Q82 2;  1VQ7 1;  4A3C I;  3VMG A;  1DL6 A;  2V45 A;  3CCL 1;  1Y1V I;  1TWH I;  1RO2 A;  3TE5 B;  1KC8 1;  1VQN 1;  4MON A;  4A3J I;  1N8R 2;  3PO2 I;  3BG0 B;  2E2J I;  1TWA I;  1KQS Y;  1ML8 A;  1P9N A;  2JNY A;  2VPW A;  2QA4 Z;  2HU9 A;  4BXX I;  3IFU A;  3HKZ A;  3FQM A;  1YJW Z;  5LL6 f;  1YIT 1;  4RVG A;  2WB1 A;  1VQ5 Z;  3G71 Z;  4A3M I;  2RT9 A;  3CC4 Z;  1WZN A;  3IX0 A;  1ZH1 A;  2R7Z I;  3S14 I;  3GTJ I;  2VPY A;  5D1P A;  1Q7Y 1;  3RZO I;  4A3G I;  2OTJ 1;  4A3D I;  5IP9 I;  5C44 I;  3MON A;  2PK7 A;  4NB8 A;  3CCL Z;  3LUS A;  1NJI 1;  1VQK 1;  2JA7 I;  1K83 I;  2I3C A;  3I55 1;  2E2I I;  1WW9 A;  3GTK I;  4RVH A;  2R93 I;  1YUK A;  1M90 2;  3S1M I;  3GCF A;  3KIH A;  1VQO 1;  2JS4 A;  2VPZ A;  3HOW I;  1KD1 1;  2NAP A;  3G6E Z;  2P28 A;  1YIT Z;  2LFU A;  4RV9 A;  2GU2 A;  1USP B;  3VB9 A;  3CCS 1;  3GTQ I;  2OTJ Z;  1I50 I;  1VQP Z;  5AN9 F;  4E2Y A;  4HGZ A;  2E2H I;  4A93 I;  2DE6 A;  4QTT A;  4HH4 A;  2K5R A;  4NFR A;  3ESW A;  4E2X A;  3CCM Z;  3J7A 4;  2OOY B;  2NVX I;  3S1Q I;  3F3P C;  1KC8 2;  4RVF A;  1JWH C;  3OW2 Z;  2Q51 A;  1YJ9 1;  3T4N B;  3OW2 Y;  3FKI I;  3CCJ 1;  3GTO I;  3VMH A;  3CCS Z;  1M1K 1;  1TWG I;  2O4H A;  3GKQ A;  1Y1W I;  1Y8C A;  1PFT A;  1VQ5 1;  1VQL Z;  3FQQ A;  2AYD A;  3CC4 1;  4A3F I;  3EED A;  3J80 f;  1Q7Y 2;  2M48 A;  1SIW A;  1RQF A;  2HF1 A;  3BG1 B;  4TNU A;  2QRE B;  2E7Z A;  3D2L A;  1WJ2 A;  3GTP I;  1X3Z A;  3PO3 S;  3HOV I;  3RZD I;  2VF1 A;  1RLY A;  1YJ9 Z;  2RHB A;  2M6N A;  1Q16 A;  2F4M A;  2OOX B;  4NOZ A;  1Q86 1;  3CCJ Z;  1KD1 2;  2RPR A;  3G6E 1;  2JIR A;  4MD9 A;  2PM9 A;  3KIF A;  1RO4 A;  3JAM f;  3S1R I;  1R9T I;  2V8K A;  3CPW Z;  2J6A A;  4MD7 A;  1QXF A;  2JA6 I;  5T64 A;  1KRL A;  4E2W A;  1VQP 1;  3CPW Y;  3D9X A;  1TWF I;  5FLM I;  5IP7 I;  3GTM I;  3CMA 1;  1Q81 1;  2LIY A;  4EWC A;  1K9M 1;  2QR1 B; 
#chains in the Genus database with same CATH homology
 4RS4 A;  2O53 A;  3CCM 1;  2QKD A;  2GTH A;  4MXU A;  2IZ4 A;  5T6B A;  2B63 I;  4Y7N I;  4A3K I;  5T67 A;  3U50 C;  3VTN A;  3G4S 1;  3CCU 1;  2NVT I;  1Q82 1;  3NH8 A;  3CC7 1;  1VQ8 1;  1NP6 A;  3VMI A;  1Y1V S;  2Y0S A;  3CCQ 1;  3JAM b;  1M1K 2;  2DE5 A;  2RIQ A;  5A2Q f;  2W04 A;  1Z02 A;  2QRC B;  2ZAE B;  4E33 A;  4E30 A;  1VQL 1;  1YHQ 1;  2VUG A;  1I3Q I;  3I4M I;  1W2B Z;  3M3Y I;  1YUA A;  4MRI A;  3CMA Z;  4BBS I;  1Z01 A;  1W2B Y;  3CCV 1;  1YI2 1;  2JA8 I;  2WAQ A;  1QVG Z;  2KPI A;  4E2Z A;  5IT9 f;  4DQY B;  3J81 f;  1QVG Y;  4A3I I;  4Y52 I;  3IF8 A;  2BJO A;  3HOU I;  3G4S Z;  2JR6 A;  3CCU Z;  1S7M A;  3CC7 Z;  1VQ8 Z;  1Q86 2;  4BY7 I;  3MZL B;  1VQ4 Z;  3CCQ Z;  1QF8 A;  2OZK A;  4DK1 A;  5A2Q b;  1YJN 1;  2KI7 B;  3NFZ A;  1YHQ Z;  5CM2 M;  2V8J A;  4E31 A;  2H85 A;  2W03 A;  3S2D I;  3CD6 1;  3CCV Z;  1YI2 Z;  1SFO I;  3S17 I;  2R6M A;  3NH4 A;  2JA5 I;  4NBG A;  1Q81 2;  2QRD B;  1K9M 2;  1NJI 2;  4DGL A;  1YIJ 1;  4NBD A;  3I56 1;  1S72 1;  5D1O A;  5C3E I;  2DE7 A;  4NBF A;  4RVD A;  3CQZ I;  3S1N I;  4CL1 A;  2QEX 1;  3H0G I;  3CXC Z;  3CME 1;  1VQ6 1;  3S15 I;  1Z03 A;  2QLV B;  3CCE 1;  2GTI A;  2IZ3 A;  2EGT A;  3CXC Y;  2G2K A;  1YJN Z;  2OTL Z;  5C4X I;  1KQS Z;  1K8A 1;  4HGY A;  4MH4 A;  4NBH A;  2JUB A;  4NBE A;  4A3L I;  3CD6 Z;  3J80 b;  1NUI A;  1VQ9 1;  1K73 1;  4BY1 I;  3P5J B;  4AYB A;  1YIJ Z;  3I56 Z;  1S72 Z;  2AKL A;  1QVF Z;  4QTU A;  2QEX Z;  1QVF Y;  3HOY I;  3NDI A;  3QWU A;  3CME Z;  1VQ6 Z;  2JMO A;  3CCE Z;  1VQ7 Z;  4MD8 A;  1JJ2 Z;  3H3V J;  3CC2 1;  1VLA A;  4NBC A;  3S16 I;  1VQ4 1;  1JJ2 Y;  3NH5 A;  3M4O I;  1L1O C;  1VQN Z;  1X3W A;  1VQ9 Z;  3CCR 1;  5FLX f;  1N8R 1;  4NBB A;  3HOX I;  4E32 A;  4X6A I;  1RO0 A;  2YU9 I;  2NVQ I;  3I4N I;  2R92 I;  2P3Y A;  2E9H A;  4NH1 C;  3D6W A;  3PO3 I;  1USP A;  1TFI A;  3F3F C;  1N2F A;  1TWC I;  1RNI A;  3CC2 Z;  1ZB8 A;  1VQM 1;  3GTM S;  2VUM I;  3GTG I;  1VQK Z;  3I55 Z;  4S1T A;  4NBA A;  1WII A;  2Q4Z A;  3K7A I;  1M90 1;  3EER A;  1VQO Z;  2OTL 1;  3CCR Z;  1I6H I;  2V8I A;  1K8A 2;  3TDH B;  4A3B I;  2PMZ A;  5FLX b;  5C4J I;  2F4O A;  3GTL I;  1K73 2;  3I07 A;  3S2H I;  2K3R A;  3Q87 A;  3MZK B;  4XX2 A;  5D1O B;  2QA4 1;  1ZB9 A;  2NVY I;  4A3E I;  2RBL A;  1YJW 1;  3HOZ I;  1X0T A;  3NDJ A;  3G71 1;  5IT9 b;  3J81 b;  1WCM I;  1LQL A;  1VQM Z;  4BBR I;  2YAD A;  1QYP A;  4NB9 A;  1Q82 2;  1VQ7 1;  4A3C I;  3VMG A;  1DL6 A;  3CCL 1;  1Y1V I;  1TWH I;  1RO2 A;  3TE5 B;  1KC8 1;  1VQN 1;  4MON A;  4A3J I;  1N8R 2;  3PO2 I;  3BG0 B;  2E2J I;  1TWA I;  1KQS Y;  1ML8 A;  1P9N A;  2JNY A;  2QA4 Z;  4BXX I;  2HU9 A;  3IFU A;  3HKZ A;  3FQM A;  1YJW Z;  5LL6 f;  1YIT 1;  4RVG A;  2WB1 A;  1VQ5 Z;  3G71 Z;  4A3M I;  2RT9 A;  3CC4 Z;  3IX0 A;  1ZH1 A;  2R7Z I;  3S14 I;  3GTJ I;  5D1P A;  1Q7Y 1;  3RZO I;  4A3G I;  2OTJ 1;  4A3D I;  5IP9 I;  5C44 I;  3MON A;  2PK7 A;  4NB8 A;  3CCL Z;  3LUS A;  1NJI 1;  1VQK 1;  2JA7 I;  1K83 I;  2I3C A;  3I55 1;  2E2I I;  1WW9 A;  3GTK I;  4RVH A;  2R93 I;  1YUK A;  1M90 2;  3S1M I;  3GCF A;  3KIH A;  1VQO 1;  2JS4 A;  3HOW I;  1KD1 1;  3G6E Z;  2P28 A;  1YIT Z;  2LFU A;  4RV9 A;  2GU2 A;  1USP B;  3VB9 A;  3CCS 1;  3GTQ I;  2OTJ Z;  1I50 I;  1VQP Z;  5AN9 F;  4E2Y A;  4HGZ A;  2E2H I;  4A93 I;  2DE6 A;  4QTT A;  4HH4 A;  2K5R A;  4NFR A;  3ESW A;  4E2X A;  3CCM Z;  3J7A 4;  2OOY B;  2NVX I;  3S1Q I;  3F3P C;  1KC8 2;  4RVF A;  1JWH C;  3OW2 Z;  2Q51 A;  1YJ9 1;  3T4N B;  3OW2 Y;  3FKI I;  3CCJ 1;  3GTO I;  3VMH A;  3CCS Z;  1M1K 1;  1TWG I;  2O4H A;  3GKQ A;  1Y1W I;  1PFT A;  1VQ5 1;  1VQL Z;  3FQQ A;  3CC4 1;  4A3F I;  3EED A;  3J80 f;  1Q7Y 2;  2M48 A;  1RQF A;  2HF1 A;  3BG1 B;  4TNU A;  2QRE B;  3GTP I;  1X3Z A;  3PO3 S;  3HOV I;  3RZD I;  2VF1 A;  1RLY A;  1YJ9 Z;  2RHB A;  2M6N A;  2F4M A;  2OOX B;  4NOZ A;  1Q86 1;  3CCJ Z;  1KD1 2;  2RPR A;  3G6E 1;  4MD9 A;  2PM9 A;  3KIF A;  1RO4 A;  3JAM f;  3S1R I;  1R9T I;  2V8K A;  3CPW Z;  2J6A A;  4MD7 A;  2JA6 I;  5T64 A;  1KRL A;  4E2W A;  1VQP 1;  3CPW Y;  3D9X A;  1TWF I;  5FLM I;  5IP7 I;  3GTM I;  3CMA 1;  1Q81 1;  2LIY A;  4EWC A;  1K9M 1;  2QR1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...