3S1QI

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with atp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1qI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1qI02
3S1RI 4BBSI 5IP7I 3GTLI 3RZDI 4NOZA 2NVXI 2NVYI 4A3KI 1K83I 4BBRI 1LQLA 1ML8A 1Y1VI 2PK7A 5C44I 4NBAA 3GTKI 3I4MI 2E2II 3K7AI 1RO4A 1PFTA 1Y1VS 4NBHA 3M3YI 1ZB9A 2YU9I 3HOZI 3HOYI 3GTOI 3HOWI 3S1QI 2K5RA 2R93I 4XX2A 4X6AI 3M4OI 4QTUA 2NVQI 3GCFA 3HOXI 4NB8A 3GTJI 4A3II 3S2DI 3VMHA 3S16I 4A3DI 1SFOI 2NVTI 4Y7NI 4BY1I 2F4OA 5IP9I 3S1NI 4A3JI 5C4JI 3U50C 2E2HI 2VUMI 3Q87A 1TWHI 3HOUI 3I4NI 4NBCA 3H3VJ 2J6AA 3EERA 3VMGA 3LUSA 3GTGI 1X3ZA 2AKLA 3S17I 1X3WA 3VB9A 4NBBA 2RBLA 3GKQA 1DL6A 1TWCI 4A93I 4NBEA 2R92I 3D6WA 3GTMI 5C4XI 4MH4A 3RZOI 2E2JI 3GTMS 2JA5I 3S14I 4QTTA 3GTQI 2R7ZI 4A3FI 1TWFI 3I07A 3ESWA 4A3EI 2B63I 3PO2I 4A3MI 3HOVI 1I50I 2BJOA 4A3BI 4BXXI 1RLYA 2P3YA 3CQZI 1Y1WI 5C3EI 3PO3I 1I6HI 4NBFA 4A3GI 1N2FA 4NBDA 3PO3S 1TFIA 2DE5A 3S1MI 3H0GI 1R9TI 1TWAI 4A3CI 2JA7I 3S15I 2HF1A 3S2HI 1TWGI 3VMIA 3GTPI 4NBGA 1L1OC 1NUIA 1USPA 4BY7I 1QYPA 1YUAA 2JNYA 1WW9A 2JA8I 2F4MA 1WCMI 3FKII 2KPIA 5CM2M 1VLAA 1ZB8A 2DE7A 1I3QI 2JA6I 4Y52I 4A3LI 5FLMI 2DE6A 4NB9A 2JR6A 2JS4A 1USPB
chains in the Genus database with same CATH superfamily
3NH5A 3S1RI 4BBSI 5IP7I 3CCE1 2OTL1 5A2Qf 1FDOA 2V8JA 1K83I 1Y1VI 1KC81 3D2LA 1Y1VS 1Z02A 1ZB9A 3F3PC 1RO2A 3G4SZ 3S1QI 2R93I 1YJW1 2V3VA 2QEXZ 4X6AI 3MONA 1Q7Y2 1VQN1 2NVQI 4NB8A 2W03A 4TNUA 3CCQZ 2VPZA 4Y7NI 2E9HA 3CME1 1KD11 5C4JI 2R6MA 2E2HI 3CD6Z 3JAMf 1YHQ1 3CCJZ 2WB1A 5A2Qb 3LUSA 4RV9A 3GTGI 2GTIA 2V45A 3CCL1 1X3WA 3VTNA 2IZ3A 3GTMI 5C4XI 1K8A1 3RZOI 2K3RA 5FLXf 3GTMS 3IFUA 2JA5I 2PMZA 1QVGY 1Z03A 2WAQA 4RVHA 4A3MI 3HOVI 1Q821 1VQ4Z 2O53A 3IR7A 1K731 3G4S1 3TDHB 4HH4A 2O4HA 1Y1WI 1M902 1I6HI 2QEX1 4MD8A 3BG1B 3I55Z 1R9TI 3CCQ1 3HKZA 3S2HI 1TWGI 2AYDA 1NUIA 2QA4Z 1NJI1 2F4MA 3FQMA 3CD61 2LIYA 5CM2M 2DE7A 3CCJ1 2QKDA 2JA6I 4DGLA 4Y52I 2OTJZ 2JIRA 1P9NA 3GTLI 2QRDB 4NOZA 2VF1A 3QWUA 4A3KI 2M48A 4BBRI 3NH4A 1LQLA 2YADA 4NBHA 1VQLZ 3M3YI 2YU9I 3HOYI 5T6BA 3GTOI 3HOWI 2K5RA 2QRCB 4DQYB 2JIQA 3G71Z 3G6EZ 1SFOI 4AYBA 1JJ2Z 5T67A 2NVTI 1Q7Y1 3I551 1S72Z 3Q87A 1TWHI 2QA41 1Q16A 4NBCA 2OZKA 4MD7A 4HGZA 3CCRZ 1VQKZ 3VB9A 4NBBA 2RBLA 1Q861 2OTJ1 1TWCI 1RO0A 3F3FC 2ZAEB 3CCSZ 1Z01A 3CC7Z 3MZLB 2RT9A 2E2JI 4EWCA 4QTTA 1VQ7Z 1TWFI 1S7MA 4A3EI 3PO2I 3CC4Z 1VQPZ 4E2YA 1VQL1 1WJ2A 3CQZI 4MD9A 1KQSZ 2RIQA 4NBFA 2IZ4A 4A3GI 3FQQA 5IT9f 1VQ9Z 2RPRA 2OOYB 1W2BZ 3H0GI 1M901 3G711 1RNIA 3G6E1 1YIJZ 2JUBA 1SIWA 2G2KA 1YJNZ 1S721 1YUKA 4E2WA 3J81f 1JJ2Y 1N8R2 2V8IA 1I3QI 1VQ6Z 4A3LI 2DE6A 2M6NA 2JR6A 3CCMZ 2P28A 3CCR1 1VQK1 2NVYI 2IV2X 3CCS1 3CC71 3GTKI 3IF8A 3I4MI 2E2II 1VQOZ 1RO4A 1PFTA 3P5JB 1VQ71 4MRIA 5IT9b 3CC41 1VQP1 3HOXI 2Y0SA 3GTJI 3S2DI 2V8KA 2Q51A 3CCUZ 3S16I 4A3DI 1QF8A 1VQ91 3S1NI 3J81b 3U50C 2VUMI 3NDJA 1YIJ1 3HOUI 2RHBA 1W2BY 1YJN1 3I4NI 1K9M2 2VPXA 1QXFA 2Q4ZA 3EERA 4RVDA 1VQ41 4E2ZA 2AKLA 1VQ61 3S17I 4HGYA 1NP6A 3EEDA 2JIMA 2PM9A 4A93I 4NBEA 3CCM1 2R92I 3KIHA 3J80f 1Q812 1QVFZ 3S14I 2QR1B 3CCVZ 2R7ZI 3ESWA 1AA6A 1VQO1 4BXXI 2BJOA 4A3BI 3OW2Z 2E7ZA 5C3EI 1M1K2 2JIOA 1VQ5Z 1N2FA 4E2XA 4NFRA 3CPWZ 4E30A 1TFIA 4E33A 3S1MI 3NDIA 1TWAI 2JA7I 3CCU1 3BG0B 3VMIA 1L1OC 4BY7I 2JNYA 1WW9A 4RS4A 3CMAZ 1YJ9Z 2KPIA 5D1PA 2OOXB 3T4NB 2I3CA 3J80b 4RVGA 3I56Z 1KC82 1YITZ 3CXCZ 2VUGA 2LFUA 1N8R1 3RZDI 1ZH1A 2NVXI 1ML8A 2PK7A 5C44I 4NBAA 3K7AI 4NH1C 4MXUA 3CCV1 1Q862 3HOZI 4DK1A 5T64A 4XX2A 1QVFY 3M4OI 4QTUA 3GCFA 2LEXA 1WZNA 1KD12 4A3II 1VQ8Z 4RVFA 2H85A 2VPYA 3VMHA 1VQ51 2VPWA 3OW2Y 4BY1I 2F4OA 1JWHC 5IP9I 4A3JI 1FDIA 1YI2Z 4E32A 1VQMZ 3CPWY 1KRLA 2GTHA 3CC2Z 5AN9F 3H3VJ 3CMA1 2J6AA 4E31A 2GU2A 1YJ91 3VMGA 3CCEZ 2QREB 1X3ZA 2QLVB 1K8A2 2OTLZ 1K9M1 5D1OA 3GKQA 1DL6A 3JAMb 3I561 3IX0A 1YIT1 2JMOA 3D6WA 4MH4A 1Q822 1K732 1KQSY 3CXCY 2KI7B 3GTQI 4A3FI 3I07A 2B63I 5D1OB 1YJWZ 2HU9A 1Q811 1I50I 2NAPA 1VQNZ 1RLYA 2P3YA 1X0TA 3PO3I 2W04A 3NFZA 5LL6f 5FLXb 4NBDA 3CMEZ 1WIIA 3PO3S 2DE5A 1NJI2 4MONA 1VQ81 1M1K1 4A3CI 3S15I 2HF1A 3D9XA 3MZKB 4S1TA 3GTPI 4NBGA 2EGTA 1USPA 1YHQZ 1QYPA 1YUAA 2JA8I 2JIPA 1WCMI 1Y8CA 3FKII 4CL1A 1RQFA 1VQM1 1YI21 3NH8A 1VLAA 1ZB8A 3CCLZ 3J7A4 3CC21 3KIFA 5FLMI 3TE5B 4NB9A 2JS4A 1USPB 1QVGZ
chains in the Genus database with same CATH topology
3NH5A 3S1RI 4BBSI 5IP7I 3CCE1 2OTL1 5A2Qf 2V8JA 1K83I 1Y1VI 1KC81 1Y1VS 1Z02A 1ZB9A 3F3PC 1RO2A 3G4SZ 3S1QI 2R93I 1YJW1 2QEXZ 4X6AI 3MONA 1Q7Y2 1VQN1 2NVQI 4NB8A 2W03A 4TNUA 3CCQZ 4Y7NI 2E9HA 3CME1 1KD11 5C4JI 2R6MA 2E2HI 3CD6Z 3JAMf 1YHQ1 3CCJZ 2WB1A 5A2Qb 3LUSA 4RV9A 3GTGI 2GTIA 3CCL1 1X3WA 3VTNA 2IZ3A 3GTMI 5C4XI 1K8A1 3RZOI 2K3RA 5FLXf 3GTMS 3IFUA 2JA5I 2PMZA 1QVGY 1Z03A 2WAQA 4RVHA 4A3MI 3HOVI 1Q821 1VQ4Z 2O53A 1K731 3G4S1 3TDHB 4HH4A 2O4HA 1Y1WI 1M902 1I6HI 2QEX1 4MD8A 3BG1B 3I55Z 1R9TI 3CCQ1 3HKZA 3S2HI 1TWGI 1NUIA 2QA4Z 1NJI1 2F4MA 3FQMA 3CD61 2LIYA 5CM2M 2DE7A 3CCJ1 2QKDA 2JA6I 4DGLA 4Y52I 2OTJZ 1P9NA 3GTLI 2QRDB 4NOZA 2VF1A 3QWUA 4A3KI 2M48A 4BBRI 3NH4A 1LQLA 2YADA 4NBHA 1VQLZ 3M3YI 2YU9I 3HOYI 5T6BA 3GTOI 3HOWI 2K5RA 2QRCB 4DQYB 3G71Z 3G6EZ 1SFOI 4AYBA 1JJ2Z 5T67A 2NVTI 1Q7Y1 3I551 1S72Z 3Q87A 1TWHI 2QA41 4NBCA 2OZKA 4MD7A 4HGZA 3CCRZ 1VQKZ 3VB9A 4NBBA 2RBLA 1Q861 2OTJ1 1TWCI 1RO0A 3F3FC 2ZAEB 3CCSZ 1Z01A 3CC7Z 3MZLB 2RT9A 2E2JI 4EWCA 4QTTA 1VQ7Z 1TWFI 1S7MA 4A3EI 3PO2I 3CC4Z 1VQPZ 4E2YA 1VQL1 3CQZI 4MD9A 1KQSZ 2RIQA 4NBFA 2IZ4A 4A3GI 3FQQA 5IT9f 1VQ9Z 2RPRA 2OOYB 1W2BZ 3H0GI 1M901 3G711 1RNIA 3G6E1 1YIJZ 2JUBA 2G2KA 1YJNZ 1S721 1YUKA 4E2WA 3J81f 1JJ2Y 1N8R2 2V8IA 1I3QI 1VQ6Z 4A3LI 2DE6A 2M6NA 2JR6A 3CCMZ 2P28A 3CCR1 1VQK1 2NVYI 3CCS1 3CC71 3GTKI 3IF8A 3I4MI 2E2II 1VQOZ 1RO4A 1PFTA 3P5JB 1VQ71 4MRIA 5IT9b 3CC41 1VQP1 3HOXI 2Y0SA 3GTJI 3S2DI 2V8KA 2Q51A 3CCUZ 3S16I 4A3DI 1QF8A 1VQ91 3S1NI 3J81b 3U50C 2VUMI 3NDJA 1YIJ1 3HOUI 2RHBA 1W2BY 1YJN1 3I4NI 1K9M2 2Q4ZA 3EERA 4RVDA 1VQ41 4E2ZA 2AKLA 1VQ61 3S17I 4HGYA 1NP6A 3EEDA 2PM9A 4A93I 4NBEA 3CCM1 2R92I 3KIHA 3J80f 1Q812 1QVFZ 3S14I 2QR1B 3CCVZ 2R7ZI 3ESWA 1VQO1 4BXXI 2BJOA 4A3BI 3OW2Z 5C3EI 1M1K2 1VQ5Z 1N2FA 4E2XA 4NFRA 3CPWZ 4E30A 1TFIA 4E33A 3S1MI 3NDIA 1TWAI 2JA7I 3CCU1 3BG0B 3VMIA 1L1OC 4BY7I 2JNYA 1WW9A 4RS4A 3CMAZ 1YJ9Z 2KPIA 5D1PA 2OOXB 3T4NB 2I3CA 3J80b 4RVGA 3I56Z 1KC82 1YITZ 3CXCZ 2VUGA 2LFUA 1N8R1 3RZDI 1ZH1A 2NVXI 1ML8A 2PK7A 5C44I 4NBAA 3K7AI 4NH1C 4MXUA 3CCV1 1Q862 3HOZI 4DK1A 5T64A 4XX2A 1QVFY 3M4OI 4QTUA 3GCFA 1KD12 4A3II 1VQ8Z 4RVFA 2H85A 3VMHA 1VQ51 3OW2Y 4BY1I 2F4OA 1JWHC 5IP9I 4A3JI 1YI2Z 4E32A 1VQMZ 3CPWY 1KRLA 2GTHA 3CC2Z 5AN9F 3H3VJ 3CMA1 2J6AA 4E31A 2GU2A 1YJ91 3VMGA 3CCEZ 2QREB 1X3ZA 2QLVB 1K8A2 2OTLZ 1K9M1 5D1OA 3GKQA 1DL6A 3JAMb 3I561 3IX0A 1YIT1 2JMOA 3D6WA 4MH4A 1Q822 1K732 1KQSY 3CXCY 2KI7B 3GTQI 4A3FI 3I07A 2B63I 5D1OB 1YJWZ 2HU9A 1Q811 1I50I 1VQNZ 1RLYA 2P3YA 1X0TA 3PO3I 2W04A 3NFZA 5LL6f 5FLXb 4NBDA 3CMEZ 1WIIA 3PO3S 2DE5A 1NJI2 4MONA 1VQ81 1M1K1 4A3CI 3S15I 2HF1A 3D9XA 3MZKB 4S1TA 3GTPI 4NBGA 2EGTA 1USPA 1YHQZ 1QYPA 1YUAA 2JA8I 1WCMI 3FKII 4CL1A 1RQFA 1VQM1 1YI21 3NH8A 1VLAA 1ZB8A 3CCLZ 3J7A4 3CC21 3KIFA 5FLMI 3TE5B 4NB9A 2JS4A 1USPB 1QVGZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1R I;  4BBS I;  5IP7 I;  3GTL I;  3RZD I;  4NOZ A;  2NVX I;  2NVY I;  4A3K I;  1K83 I;  4BBR I;  1LQL A;  1ML8 A;  1Y1V I;  2PK7 A;  5C44 I;  4NBA A;  3GTK I;  3I4M I;  2E2I I;  3K7A I;  1RO4 A;  1PFT A;  1Y1V S;  4NBH A;  3M3Y I;  1ZB9 A;  2YU9 I;  3HOZ I;  3HOY I;  3GTO I;  3HOW I;  3S1Q I;  2K5R A;  2R93 I;  4XX2 A;  4X6A I;  3M4O I;  4QTU A;  2NVQ I;  3GCF A;  3HOX I;  4NB8 A;  3GTJ I;  4A3I I;  3S2D I;  3VMH A;  3S16 I;  4A3D I;  1SFO I;  2NVT I;  4Y7N I;  4BY1 I;  2F4O A;  5IP9 I;  3S1N I;  4A3J I;  5C4J I;  3U50 C;  2E2H I;  2VUM I;  3Q87 A;  1TWH I;  3HOU I;  3I4N I;  4NBC A;  3H3V J;  2J6A A;  3EER A;  3VMG A;  3LUS A;  3GTG I;  1X3Z A;  2AKL A;  3S17 I;  1X3W A;  3VB9 A;  4NBB A;  2RBL A;  3GKQ A;  1DL6 A;  1TWC I;  4A93 I;  4NBE A;  2R92 I;  3D6W A;  3GTM I;  5C4X I;  4MH4 A;  3RZO I;  2E2J I;  3GTM S;  2JA5 I;  3S14 I;  4QTT A;  3GTQ I;  2R7Z I;  4A3F I;  1TWF I;  3I07 A;  3ESW A;  4A3E I;  2B63 I;  3PO2 I;  4A3M I;  3HOV I;  1I50 I;  2BJO A;  4A3B I;  4BXX I;  1RLY A;  2P3Y A;  3CQZ I;  1Y1W I;  5C3E I;  3PO3 I;  1I6H I;  4NBF A;  4A3G I;  1N2F A;  4NBD A;  3PO3 S;  1TFI A;  2DE5 A;  3S1M I;  3H0G I;  1R9T I;  1TWA I;  4A3C I;  2JA7 I;  3S15 I;  2HF1 A;  3S2H I;  1TWG I;  3VMI A;  3GTP I;  4NBG A;  1L1O C;  1NUI A;  1USP A;  4BY7 I;  1QYP A;  1YUA A;  2JNY A;  1WW9 A;  2JA8 I;  2F4M A;  1WCM I;  3FKI I;  2KPI A;  5CM2 M;  1VLA A;  1ZB8 A;  2DE7 A;  1I3Q I;  2JA6 I;  4Y52 I;  4A3L I;  5FLM I;  2DE6 A;  4NB9 A;  2JR6 A;  2JS4 A;  1USP B; 
#chains in the Genus database with same CATH topology
 3NH5 A;  3S1R I;  4BBS I;  5IP7 I;  3CCE 1;  2OTL 1;  5A2Q f;  1FDO A;  2V8J A;  1K83 I;  1Y1V I;  1KC8 1;  3D2L A;  1Y1V S;  1Z02 A;  1ZB9 A;  3F3P C;  1RO2 A;  3G4S Z;  3S1Q I;  2R93 I;  1YJW 1;  2V3V A;  2QEX Z;  4X6A I;  3MON A;  1Q7Y 2;  1VQN 1;  2NVQ I;  4NB8 A;  2W03 A;  4TNU A;  3CCQ Z;  2VPZ A;  4Y7N I;  2E9H A;  3CME 1;  1KD1 1;  5C4J I;  2R6M A;  2E2H I;  3CD6 Z;  3JAM f;  1YHQ 1;  3CCJ Z;  2WB1 A;  5A2Q b;  3LUS A;  4RV9 A;  3GTG I;  2GTI A;  2V45 A;  3CCL 1;  1X3W A;  3VTN A;  2IZ3 A;  3GTM I;  5C4X I;  1K8A 1;  3RZO I;  2K3R A;  5FLX f;  3GTM S;  3IFU A;  2JA5 I;  2PMZ A;  1QVG Y;  1Z03 A;  2WAQ A;  4RVH A;  4A3M I;  3HOV I;  1Q82 1;  1VQ4 Z;  2O53 A;  3IR7 A;  1K73 1;  3G4S 1;  3TDH B;  4HH4 A;  2O4H A;  1Y1W I;  1M90 2;  1I6H I;  2QEX 1;  4MD8 A;  3BG1 B;  3I55 Z;  1R9T I;  3CCQ 1;  3HKZ A;  3S2H I;  1TWG I;  2AYD A;  1NUI A;  2QA4 Z;  1NJI 1;  2F4M A;  3FQM A;  3CD6 1;  2LIY A;  5CM2 M;  2DE7 A;  3CCJ 1;  2QKD A;  2JA6 I;  4DGL A;  4Y52 I;  2OTJ Z;  2JIR A;  1P9N A;  3GTL I;  2QRD B;  4NOZ A;  2VF1 A;  3QWU A;  4A3K I;  2M48 A;  4BBR I;  3NH4 A;  1LQL A;  2YAD A;  4NBH A;  1VQL Z;  3M3Y I;  2YU9 I;  3HOY I;  5T6B A;  3GTO I;  3HOW I;  2K5R A;  2QRC B;  4DQY B;  2JIQ A;  3G71 Z;  3G6E Z;  1SFO I;  4AYB A;  1JJ2 Z;  5T67 A;  2NVT I;  1Q7Y 1;  3I55 1;  1S72 Z;  3Q87 A;  1TWH I;  2QA4 1;  1Q16 A;  4NBC A;  2OZK A;  4MD7 A;  4HGZ A;  3CCR Z;  1VQK Z;  3VB9 A;  4NBB A;  2RBL A;  1Q86 1;  2OTJ 1;  1TWC I;  1RO0 A;  3F3F C;  2ZAE B;  3CCS Z;  1Z01 A;  3CC7 Z;  3MZL B;  2RT9 A;  2E2J I;  4EWC A;  4QTT A;  1VQ7 Z;  1TWF I;  1S7M A;  4A3E I;  3PO2 I;  3CC4 Z;  1VQP Z;  4E2Y A;  1VQL 1;  1WJ2 A;  3CQZ I;  4MD9 A;  1KQS Z;  2RIQ A;  4NBF A;  2IZ4 A;  4A3G I;  3FQQ A;  5IT9 f;  1VQ9 Z;  2RPR A;  2OOY B;  1W2B Z;  3H0G I;  1M90 1;  3G71 1;  1RNI A;  3G6E 1;  1YIJ Z;  2JUB A;  1SIW A;  2G2K A;  1YJN Z;  1S72 1;  1YUK A;  4E2W A;  3J81 f;  1JJ2 Y;  1N8R 2;  2V8I A;  1I3Q I;  1VQ6 Z;  4A3L I;  2DE6 A;  2M6N A;  2JR6 A;  3CCM Z;  2P28 A;  3CCR 1;  1VQK 1;  2NVY I;  2IV2 X;  3CCS 1;  3CC7 1;  3GTK I;  3IF8 A;  3I4M I;  2E2I I;  1VQO Z;  1RO4 A;  1PFT A;  3P5J B;  1VQ7 1;  4MRI A;  5IT9 b;  3CC4 1;  1VQP 1;  3HOX I;  2Y0S A;  3GTJ I;  3S2D I;  2V8K A;  2Q51 A;  3CCU Z;  3S16 I;  4A3D I;  1QF8 A;  1VQ9 1;  3S1N I;  3J81 b;  3U50 C;  2VUM I;  3NDJ A;  1YIJ 1;  3HOU I;  2RHB A;  1W2B Y;  1YJN 1;  3I4N I;  1K9M 2;  2VPX A;  1QXF A;  2Q4Z A;  3EER A;  4RVD A;  1VQ4 1;  4E2Z A;  2AKL A;  1VQ6 1;  3S17 I;  4HGY A;  1NP6 A;  3EED A;  2JIM A;  2PM9 A;  4A93 I;  4NBE A;  3CCM 1;  2R92 I;  3KIH A;  3J80 f;  1Q81 2;  1QVF Z;  3S14 I;  2QR1 B;  3CCV Z;  2R7Z I;  3ESW A;  1AA6 A;  1VQO 1;  4BXX I;  2BJO A;  4A3B I;  3OW2 Z;  2E7Z A;  5C3E I;  1M1K 2;  2JIO A;  1VQ5 Z;  1N2F A;  4E2X A;  4NFR A;  3CPW Z;  4E30 A;  1TFI A;  4E33 A;  3S1M I;  3NDI A;  1TWA I;  2JA7 I;  3CCU 1;  3BG0 B;  3VMI A;  1L1O C;  4BY7 I;  2JNY A;  1WW9 A;  4RS4 A;  3CMA Z;  1YJ9 Z;  2KPI A;  5D1P A;  2OOX B;  3T4N B;  2I3C A;  3J80 b;  4RVG A;  3I56 Z;  1KC8 2;  1YIT Z;  3CXC Z;  2VUG A;  2LFU A;  1N8R 1;  3RZD I;  1ZH1 A;  2NVX I;  1ML8 A;  2PK7 A;  5C44 I;  4NBA A;  3K7A I;  4NH1 C;  4MXU A;  3CCV 1;  1Q86 2;  3HOZ I;  4DK1 A;  5T64 A;  4XX2 A;  1QVF Y;  3M4O I;  4QTU A;  3GCF A;  2LEX A;  1WZN A;  1KD1 2;  4A3I I;  1VQ8 Z;  4RVF A;  2H85 A;  2VPY A;  3VMH A;  1VQ5 1;  2VPW A;  3OW2 Y;  4BY1 I;  2F4O A;  1JWH C;  5IP9 I;  4A3J I;  1FDI A;  1YI2 Z;  4E32 A;  1VQM Z;  3CPW Y;  1KRL A;  2GTH A;  3CC2 Z;  5AN9 F;  3H3V J;  3CMA 1;  2J6A A;  4E31 A;  2GU2 A;  1YJ9 1;  3VMG A;  3CCE Z;  2QRE B;  1X3Z A;  2QLV B;  1K8A 2;  2OTL Z;  1K9M 1;  5D1O A;  3GKQ A;  1DL6 A;  3JAM b;  3I56 1;  3IX0 A;  1YIT 1;  2JMO A;  3D6W A;  4MH4 A;  1Q82 2;  1K73 2;  1KQS Y;  3CXC Y;  2KI7 B;  3GTQ I;  4A3F I;  3I07 A;  2B63 I;  5D1O B;  1YJW Z;  2HU9 A;  1Q81 1;  1I50 I;  2NAP A;  1VQN Z;  1RLY A;  2P3Y A;  1X0T A;  3PO3 I;  2W04 A;  3NFZ A;  5LL6 f;  5FLX b;  4NBD A;  3CME Z;  1WII A;  3PO3 S;  2DE5 A;  1NJI 2;  4MON A;  1VQ8 1;  1M1K 1;  4A3C I;  3S15 I;  2HF1 A;  3D9X A;  3MZK B;  4S1T A;  3GTP I;  4NBG A;  2EGT A;  1USP A;  1YHQ Z;  1QYP A;  1YUA A;  2JA8 I;  2JIP A;  1WCM I;  1Y8C A;  3FKI I;  4CL1 A;  1RQF A;  1VQM 1;  1YI2 1;  3NH8 A;  1VLA A;  1ZB8 A;  3CCL Z;  3J7A 4;  3CC2 1;  3KIF A;  5FLM I;  3TE5 B;  4NB9 A;  2JS4 A;  1USP B;  1QVG Z; 
#chains in the Genus database with same CATH homology
 3NH5 A;  3S1R I;  4BBS I;  5IP7 I;  3CCE 1;  2OTL 1;  5A2Q f;  2V8J A;  1K83 I;  1Y1V I;  1KC8 1;  1Y1V S;  1Z02 A;  1ZB9 A;  3F3P C;  1RO2 A;  3G4S Z;  3S1Q I;  2R93 I;  1YJW 1;  2QEX Z;  4X6A I;  3MON A;  1Q7Y 2;  1VQN 1;  2NVQ I;  4NB8 A;  2W03 A;  4TNU A;  3CCQ Z;  4Y7N I;  2E9H A;  3CME 1;  1KD1 1;  5C4J I;  2R6M A;  2E2H I;  3CD6 Z;  3JAM f;  1YHQ 1;  3CCJ Z;  2WB1 A;  5A2Q b;  3LUS A;  4RV9 A;  3GTG I;  2GTI A;  3CCL 1;  1X3W A;  3VTN A;  2IZ3 A;  3GTM I;  5C4X I;  1K8A 1;  3RZO I;  2K3R A;  5FLX f;  3GTM S;  3IFU A;  2JA5 I;  2PMZ A;  1QVG Y;  1Z03 A;  2WAQ A;  4RVH A;  4A3M I;  3HOV I;  1Q82 1;  1VQ4 Z;  2O53 A;  1K73 1;  3G4S 1;  3TDH B;  4HH4 A;  2O4H A;  1Y1W I;  1M90 2;  1I6H I;  2QEX 1;  4MD8 A;  3BG1 B;  3I55 Z;  1R9T I;  3CCQ 1;  3HKZ A;  3S2H I;  1TWG I;  1NUI A;  2QA4 Z;  1NJI 1;  2F4M A;  3FQM A;  3CD6 1;  2LIY A;  5CM2 M;  2DE7 A;  3CCJ 1;  2QKD A;  2JA6 I;  4DGL A;  4Y52 I;  2OTJ Z;  1P9N A;  3GTL I;  2QRD B;  4NOZ A;  2VF1 A;  3QWU A;  4A3K I;  2M48 A;  4BBR I;  3NH4 A;  1LQL A;  2YAD A;  4NBH A;  1VQL Z;  3M3Y I;  2YU9 I;  3HOY I;  5T6B A;  3GTO I;  3HOW I;  2K5R A;  2QRC B;  4DQY B;  3G71 Z;  3G6E Z;  1SFO I;  4AYB A;  1JJ2 Z;  5T67 A;  2NVT I;  1Q7Y 1;  3I55 1;  1S72 Z;  3Q87 A;  1TWH I;  2QA4 1;  4NBC A;  2OZK A;  4MD7 A;  4HGZ A;  3CCR Z;  1VQK Z;  3VB9 A;  4NBB A;  2RBL A;  1Q86 1;  2OTJ 1;  1TWC I;  1RO0 A;  3F3F C;  2ZAE B;  3CCS Z;  1Z01 A;  3CC7 Z;  3MZL B;  2RT9 A;  2E2J I;  4EWC A;  4QTT A;  1VQ7 Z;  1TWF I;  1S7M A;  4A3E I;  3PO2 I;  3CC4 Z;  1VQP Z;  4E2Y A;  1VQL 1;  3CQZ I;  4MD9 A;  1KQS Z;  2RIQ A;  4NBF A;  2IZ4 A;  4A3G I;  3FQQ A;  5IT9 f;  1VQ9 Z;  2RPR A;  2OOY B;  1W2B Z;  3H0G I;  1M90 1;  3G71 1;  1RNI A;  3G6E 1;  1YIJ Z;  2JUB A;  2G2K A;  1YJN Z;  1S72 1;  1YUK A;  4E2W A;  3J81 f;  1JJ2 Y;  1N8R 2;  2V8I A;  1I3Q I;  1VQ6 Z;  4A3L I;  2DE6 A;  2M6N A;  2JR6 A;  3CCM Z;  2P28 A;  3CCR 1;  1VQK 1;  2NVY I;  3CCS 1;  3CC7 1;  3GTK I;  3IF8 A;  3I4M I;  2E2I I;  1VQO Z;  1RO4 A;  1PFT A;  3P5J B;  1VQ7 1;  4MRI A;  5IT9 b;  3CC4 1;  1VQP 1;  3HOX I;  2Y0S A;  3GTJ I;  3S2D I;  2V8K A;  2Q51 A;  3CCU Z;  3S16 I;  4A3D I;  1QF8 A;  1VQ9 1;  3S1N I;  3J81 b;  3U50 C;  2VUM I;  3NDJ A;  1YIJ 1;  3HOU I;  2RHB A;  1W2B Y;  1YJN 1;  3I4N I;  1K9M 2;  2Q4Z A;  3EER A;  4RVD A;  1VQ4 1;  4E2Z A;  2AKL A;  1VQ6 1;  3S17 I;  4HGY A;  1NP6 A;  3EED A;  2PM9 A;  4A93 I;  4NBE A;  3CCM 1;  2R92 I;  3KIH A;  3J80 f;  1Q81 2;  1QVF Z;  3S14 I;  2QR1 B;  3CCV Z;  2R7Z I;  3ESW A;  1VQO 1;  4BXX I;  2BJO A;  4A3B I;  3OW2 Z;  5C3E I;  1M1K 2;  1VQ5 Z;  1N2F A;  4E2X A;  4NFR A;  3CPW Z;  4E30 A;  1TFI A;  4E33 A;  3S1M I;  3NDI A;  1TWA I;  2JA7 I;  3CCU 1;  3BG0 B;  3VMI A;  1L1O C;  4BY7 I;  2JNY A;  1WW9 A;  4RS4 A;  3CMA Z;  1YJ9 Z;  2KPI A;  5D1P A;  2OOX B;  3T4N B;  2I3C A;  3J80 b;  4RVG A;  3I56 Z;  1KC8 2;  1YIT Z;  3CXC Z;  2VUG A;  2LFU A;  1N8R 1;  3RZD I;  1ZH1 A;  2NVX I;  1ML8 A;  2PK7 A;  5C44 I;  4NBA A;  3K7A I;  4NH1 C;  4MXU A;  3CCV 1;  1Q86 2;  3HOZ I;  4DK1 A;  5T64 A;  4XX2 A;  1QVF Y;  3M4O I;  4QTU A;  3GCF A;  1KD1 2;  4A3I I;  1VQ8 Z;  4RVF A;  2H85 A;  3VMH A;  1VQ5 1;  3OW2 Y;  4BY1 I;  2F4O A;  1JWH C;  5IP9 I;  4A3J I;  1YI2 Z;  4E32 A;  1VQM Z;  3CPW Y;  1KRL A;  2GTH A;  3CC2 Z;  5AN9 F;  3H3V J;  3CMA 1;  2J6A A;  4E31 A;  2GU2 A;  1YJ9 1;  3VMG A;  3CCE Z;  2QRE B;  1X3Z A;  2QLV B;  1K8A 2;  2OTL Z;  1K9M 1;  5D1O A;  3GKQ A;  1DL6 A;  3JAM b;  3I56 1;  3IX0 A;  1YIT 1;  2JMO A;  3D6W A;  4MH4 A;  1Q82 2;  1K73 2;  1KQS Y;  3CXC Y;  2KI7 B;  3GTQ I;  4A3F I;  3I07 A;  2B63 I;  5D1O B;  1YJW Z;  2HU9 A;  1Q81 1;  1I50 I;  1VQN Z;  1RLY A;  2P3Y A;  1X0T A;  3PO3 I;  2W04 A;  3NFZ A;  5LL6 f;  5FLX b;  4NBD A;  3CME Z;  1WII A;  3PO3 S;  2DE5 A;  1NJI 2;  4MON A;  1VQ8 1;  1M1K 1;  4A3C I;  3S15 I;  2HF1 A;  3D9X A;  3MZK B;  4S1T A;  3GTP I;  4NBG A;  2EGT A;  1USP A;  1YHQ Z;  1QYP A;  1YUA A;  2JA8 I;  1WCM I;  3FKI I;  4CL1 A;  1RQF A;  1VQM 1;  1YI2 1;  3NH8 A;  1VLA A;  1ZB8 A;  3CCL Z;  3J7A 4;  3CC2 1;  3KIF A;  5FLM I;  3TE5 B;  4NB9 A;  2JS4 A;  1USP B;  1QVG Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...