3S1QI

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with atp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1qI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1qI02
1TWCI 2DE6A 1TWAI 1N2FA 1Y1VS 2E2II 2NVXI 1USPA 3HOXI 5FLMI 3GTQI 1WW9A 3RZOI 1USPB 3S1QI 1ZB9A 3VMIA 3M4OI 2R92I 2DE7A 2PK7A 2RBLA 4A3FI 4BY7I 3VMHA 5C3EI 3Q87A 3S2DI 3GTLI 2R93I 1VLAA 3S1MI 4NB8A 1ZB8A 3VMGA 2KPIA 5C44I 4A93I 4A3LI 3S14I 2JS4A 2J6AA 3RZDI 3U50C 3H0GI 1TWGI 3I07A 2AKLA 2JA5I 4A3DI 2F4OA 3GTMS 1YUAA 4NBBA 2NVQI 1TWFI 4A3MI 3GTPI 4A3CI 3H3VJ 4BXXI 2JA6I 1ML8A 3GTGI 3HOVI 3I4MI 3ESWA 3PO3I 3S17I 3FKII 4NBHA 2E2HI 3S15I 4NOZA 1TFIA 4NBAA 3GTOI 3HOUI 3LUSA 4QTUA 4A3GI 4BY1I 2K5RA 2B63I 1Y1VI 4XX2A 1L1OC 4NBEA 3VB9A 2NVYI 5IP7I 2JA7I 1I50I 2DE5A 2HF1A 1RLYA 4NBGA 4NBDA 1X3WA 3GCFA 4Y52I 3HOZI 3M3YI 2R7ZI 2YU9I 2NVTI 1RO4A 1Y1WI 3GTJI 2BJOA 3CQZI 3HOYI 4A3II 2JR6A 1TWHI 3EERA 4MH4A 3GKQA 1QYPA 4NBFA 3GTMI 2F4MA 4NBCA 4BBSI 3I4NI 2JNYA 4A3JI 2E2JI 3K7AI 4BBRI 3GTKI 1DL6A 3S1RI 4NB9A 3S2HI 4A3EI 3PO2I 4A3BI 2P3YA 2VUMI 5C4XI 1K83I 1LQLA 3S16I 1I3QI 3PO3S 5CM2M 1R9TI 3D6WA 4QTTA 1SFOI 3HOWI 1NUIA 1PFTA 3S1NI 5IP9I 1I6HI 4A3KI 5C4JI 1X3ZA 4X6AI 4Y7NI 1WCMI 2JA8I
chains in the Genus database with same CATH superfamily
3CC21 3CCJ1 1VQ41 2ZAEB 1RQFA 4DGLA 2Q51A 1VQLZ 1Y1VS 1Q7Y1 3CCL1 3J81b 2NVXI 3RZOI 1WW9A 1VQP1 3S1QI 4E2WA 3M4OI 5T67A 2DE7A 1VQ9Z 1KC82 2JIRA 3VMHA 1JJ2Y 3Q87A 3S2DI 3GTLI 2R93I 2Y0SA 3S1MI 1YIJ1 1VQMZ 3CMA1 4A93I 4E2ZA 1W2BY 1Q811 2J6AA 3D9XA 1TWGI 2AYDA 5IT9f 2AKLA 1TWFI 4MXUA 4BXXI 1M901 3I4MI 1KD12 3S17I 2E2HI 1N8R1 3FQMA 1TFIA 1QVGZ 3CPWZ 1RNIA 4A3GI 1P9NA 2K5RA 2QRCB 3CME1 1VQK1 3CPWY 3EEDA 3CD61 1YJW1 2DE5A 2HF1A 1RLYA 3CMEZ 1X3WA 2O53A 1M1K2 2JIOA 2VPYA 2NAPA 2R7ZI 3F3PC 3J80b 1Y1WI 2BJOA 1YITZ 2F4MA 1RO2A 2YADA 5T64A 1Y8CA 1YI21 2OTLZ 1VQ5Z 1DL6A 1YJ9Z 3CCU1 2P3YA 2RIQA 1VQ7Z 3J81f 1I3QI 3TDHB 5LL6f 3JAMb 2QEXZ 3PO3S 3IX0A 4MONA 3KIHA 3S1NI 2LEXA 3OW2Y 4S1TA 3G711 3CCV1 1N2FA 1QF8A 2VPXA 3CC7Z 4DQYB 1VQ4Z 1USPA 1YIJZ 4RVGA 2VPWA 1YJWZ 3NDJA 2GU2A 3MONA 1S721 3CCQ1 5D1PA 3BG0B 1M1K1 1ZB8A 4NB8A 2LIYA 2KPIA 4RVHA 5A2Qb 3RZDI 2R6MA 4A3DI 2NVQI 3GTPI 4A3MI 1KQSY 5T6BA 3CMAZ 2V45A 1ML8A 3CCMZ 3GTGI 2IV2X 5D1OA 1KD11 3FKII 4NBHA 1YJ91 2GTHA 2W03A 3GTOI 5D1OB 4RVDA 1VQ91 1FDIA 2B63I 1Y1VI 2OTJ1 4E33A 2PM9A 3MZLB 1Q16A 2QR1B 1Q812 3I55Z 3IFUA 2JA7I 1ZH1A 4NBGA 2RPRA 1VQNZ 1Q822 4Y52I 3HOZI 3M3YI 2V8JA 1RO4A 1KQSZ 4E2YA 4A3II 3CD6Z 1K8A2 1TWHI 2GTIA 3JAMf 4NBFA 1VQOZ 4NBCA 2QEX1 2G2KA 4E31A 4A3JI 3K7AI 3QWUA 2IZ4A 1AA6A 3I561 3NH8A 3S1RI 5FLXb 3S2HI 3PO2I 2OTL1 1KC81 3G6EZ 3MZKB 1K83I 3NFZA 5C4XI 1VQ81 1K9M1 3S16I 1FDOA 4RV9A 4A3KI 2JIPA 4NFRA 4E32A 4DK1A 1WCMI 2M6NA 4HH4A 5IT9b 1NP6A 1TWAI 3P5JB 1W2BZ 2QREB 2RT9A 3HOXI 2H85A 3CCEZ 3GTQI 1USPB 1ZB9A 2VUGA 2Q4ZA 3VMIA 2R92I 1Z02A 4E30A 1RO0A 4A3FI 3I551 2QA41 2VPZA 1VLAA 1Q821 2JUBA 3CCM1 1NJI1 1WIIA 1K8A1 5FLXf 3F3FC 1YI2Z 3GTMS 1YUAA 2QLVB 3CCS1 3G71Z 3J7A4 2V8IA 1Z03A 3BG1B 3I56Z 3IF8A 4NBAA 4AYBA 4BY1I 1VQ71 4XX2A 4NBEA 3VB9A 1VQO1 1SIWA 1KRLA 2NVYI 2QA4Z 5IP7I 2V8KA 3GCFA 2YU9I 2OZKA 2NVTI 3CC71 1YHQ1 3NH4A 3T4NB 1VQL1 3CCVZ 3HOYI 2QKDA 2JR6A 1QVFZ 3EERA 4MH4A 3GTMI 4BBSI 3I4NI 3CCSZ 2JNYA 1VQ8Z 2E2JI 2KI7B 2IZ3A 3OW2Z 1Q861 2O4HA 3CCQZ 1S72Z 1WJ2A 3G4SZ 4A3BI 2VF1A 1LQLA 4TNUA 5CM2M 2RHBA 1SFOI 5A2Qf 3HOWI 2JIQA 2PMZA 5IP9I 3TE5B 5C4JI 1X3ZA 3CC41 1Z01A 1YJNZ 1VQPZ 3CCE1 4EWCA 3CCLZ 2OOXB 1TWCI 2DE6A 1Q862 4HGYA 4MD9A 1NJI2 1N8R2 1VQM1 2E2II 4MD7A 2LFUA 3CCJZ 5FLMI 3CCR1 2W04A 5AN9F 3IR7A 2PK7A 2RBLA 4BY7I 5C3EI 2EGTA 3VMGA 3NDIA 3FQQA 5C44I 4A3LI 2E9HA 1JWHC 3S14I 2JS4A 1QXFA 2I3CA 3U50C 3H0GI 3I07A 1WZNA 2JA5I 2F4OA 4A3CI 4NBBA 4RVFA 1QVFY 4RS4A 2K3RA 3H3VJ 1YUKA 2JA6I 3HOVI 3ESWA 2P28A 3PO3I 2E7ZA 4MRIA 1Q7Y2 4NOZA 3S15I 3HOUI 3LUSA 4QTUA 1VQKZ 3J80f 1L1OC 3CCRZ 2JIMA 1YIT1 4HGZA 1I50I 4E2XA 1YHQZ 4NBDA 2OTJZ 1VQ61 1X0TA 1M902 3KIFA 3CC2Z 3CXCZ 1YJN1 4MD8A 1S7MA 1K731 2V3VA 2HU9A 3GTJI 1K732 3CQZI 2M48A 4CL1A 3GKQA 1QYPA 4NH1C 1VQ6Z 1VQN1 3CC4Z 3G6E1 2WAQA 2OOYB 4BBRI 3CCUZ 3GTKI 1QVGY 3D2LA 3NH5A 4NB9A 4A3EI 2QRDB 2VUMI 1JJ2Z 2JMOA 1R9TI 3G4S1 3D6WA 4QTTA 1NUIA 1PFTA 3VTNA 1VQ51 1I6HI 2WB1A 3CXCY 1K9M2 4X6AI 4Y7NI 3HKZA 2JA8I
chains in the Genus database with same CATH topology
3CC21 3CCJ1 1VQ41 2ZAEB 1RQFA 4DGLA 2Q51A 1VQLZ 1Y1VS 1Q7Y1 3CCL1 3J81b 2NVXI 3RZOI 1WW9A 1VQP1 3S1QI 4E2WA 3M4OI 5T67A 2DE7A 1VQ9Z 1KC82 3VMHA 1JJ2Y 3Q87A 3S2DI 3GTLI 2R93I 2Y0SA 3S1MI 1YIJ1 1VQMZ 3CMA1 4A93I 4E2ZA 1W2BY 1Q811 2J6AA 3D9XA 1TWGI 5IT9f 2AKLA 1TWFI 4MXUA 4BXXI 1M901 3I4MI 1KD12 3S17I 2E2HI 1N8R1 3FQMA 1TFIA 1QVGZ 3CPWZ 1RNIA 4A3GI 1P9NA 2K5RA 2QRCB 3CME1 1VQK1 3CPWY 3EEDA 3CD61 1YJW1 2DE5A 2HF1A 1RLYA 3CMEZ 1X3WA 2O53A 1M1K2 2R7ZI 3F3PC 3J80b 1Y1WI 2BJOA 1YITZ 2F4MA 1RO2A 2YADA 5T64A 1YI21 2OTLZ 1VQ5Z 1DL6A 1YJ9Z 3CCU1 2P3YA 2RIQA 1VQ7Z 3J81f 1I3QI 3TDHB 5LL6f 3JAMb 2QEXZ 3PO3S 3IX0A 4MONA 3KIHA 3S1NI 3OW2Y 4S1TA 3G711 3CCV1 1N2FA 1QF8A 3CC7Z 4DQYB 1VQ4Z 1USPA 1YIJZ 4RVGA 1YJWZ 3NDJA 2GU2A 3MONA 1S721 3CCQ1 5D1PA 3BG0B 1M1K1 1ZB8A 4NB8A 2LIYA 2KPIA 4RVHA 5A2Qb 3RZDI 2R6MA 4A3DI 2NVQI 3GTPI 4A3MI 1KQSY 5T6BA 3CMAZ 1ML8A 3CCMZ 3GTGI 5D1OA 1KD11 3FKII 4NBHA 1YJ91 2GTHA 2W03A 3GTOI 5D1OB 4RVDA 1VQ91 2B63I 1Y1VI 2OTJ1 4E33A 2PM9A 3MZLB 1Q812 2QR1B 3I55Z 3IFUA 2JA7I 1ZH1A 4NBGA 2RPRA 1VQNZ 1Q822 4Y52I 3HOZI 3M3YI 2V8JA 1RO4A 1KQSZ 4E2YA 4A3II 3CD6Z 1K8A2 1TWHI 2GTIA 3JAMf 4NBFA 1VQOZ 4NBCA 2QEX1 2G2KA 4E31A 4A3JI 3K7AI 3QWUA 2IZ4A 3I561 3NH8A 3S1RI 5FLXb 3S2HI 3PO2I 2OTL1 1KC81 3G6EZ 3MZKB 1K83I 3NFZA 5C4XI 1VQ81 1K9M1 3S16I 4RV9A 4A3KI 4NFRA 4E32A 4DK1A 1WCMI 2M6NA 4HH4A 5IT9b 1NP6A 1TWAI 3P5JB 1W2BZ 2QREB 2RT9A 3HOXI 2H85A 3CCEZ 3GTQI 1USPB 1ZB9A 2VUGA 2Q4ZA 3VMIA 2R92I 1Z02A 4E30A 1RO0A 4A3FI 3I551 2QA41 1VLAA 1Q821 2JUBA 3CCM1 1NJI1 1WIIA 1K8A1 5FLXf 3F3FC 1YI2Z 3GTMS 1YUAA 2QLVB 3CCS1 3G71Z 3J7A4 2V8IA 1Z03A 3BG1B 3I56Z 3IF8A 4NBAA 4AYBA 4BY1I 1VQ71 4XX2A 4NBEA 3VB9A 1VQO1 1KRLA 2NVYI 2QA4Z 5IP7I 2V8KA 3GCFA 2YU9I 2OZKA 2NVTI 3CC71 1YHQ1 3NH4A 3T4NB 1VQL1 3CCVZ 3HOYI 2QKDA 2JR6A 1QVFZ 3EERA 4MH4A 3GTMI 4BBSI 3I4NI 3CCSZ 2JNYA 1VQ8Z 2E2JI 2KI7B 2IZ3A 3OW2Z 1Q861 2O4HA 3CCQZ 1S72Z 3G4SZ 4A3BI 2VF1A 1LQLA 4TNUA 5CM2M 2RHBA 1SFOI 5A2Qf 3HOWI 2PMZA 5IP9I 3TE5B 5C4JI 1X3ZA 3CC41 1Z01A 1YJNZ 1VQPZ 3CCE1 4EWCA 3CCLZ 2OOXB 1TWCI 2DE6A 1Q862 4HGYA 4MD9A 1NJI2 1N8R2 1VQM1 2E2II 4MD7A 2LFUA 3CCJZ 5FLMI 3CCR1 2W04A 5AN9F 2PK7A 2RBLA 4BY7I 5C3EI 2EGTA 3VMGA 3NDIA 3FQQA 5C44I 4A3LI 2E9HA 1JWHC 3S14I 2JS4A 2I3CA 3U50C 3H0GI 3I07A 2JA5I 2F4OA 4A3CI 4NBBA 4RVFA 1QVFY 4RS4A 2K3RA 3H3VJ 1YUKA 2JA6I 3HOVI 3ESWA 2P28A 3PO3I 4MRIA 1Q7Y2 4NOZA 3S15I 3HOUI 3LUSA 4QTUA 1VQKZ 3J80f 1L1OC 3CCRZ 1YIT1 4HGZA 1I50I 4E2XA 1YHQZ 4NBDA 2OTJZ 1VQ61 1X0TA 1M902 3KIFA 3CC2Z 3CXCZ 1YJN1 4MD8A 1S7MA 1K731 2HU9A 3GTJI 1K732 3CQZI 2M48A 4CL1A 3GKQA 1QYPA 4NH1C 1VQ6Z 1VQN1 3CC4Z 3G6E1 2WAQA 2OOYB 4BBRI 3CCUZ 3GTKI 1QVGY 3NH5A 4NB9A 4A3EI 2QRDB 2VUMI 1JJ2Z 2JMOA 1R9TI 3G4S1 3D6WA 4QTTA 1NUIA 1PFTA 3VTNA 1VQ51 1I6HI 2WB1A 3CXCY 1K9M2 4X6AI 4Y7NI 3HKZA 2JA8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWC I;  2DE6 A;  1TWA I;  1N2F A;  1Y1V S;  2E2I I;  2NVX I;  1USP A;  3HOX I;  5FLM I;  3GTQ I;  1WW9 A;  3RZO I;  1USP B;  3S1Q I;  1ZB9 A;  3VMI A;  3M4O I;  2R92 I;  2DE7 A;  2PK7 A;  2RBL A;  4A3F I;  4BY7 I;  3VMH A;  5C3E I;  3Q87 A;  3S2D I;  3GTL I;  2R93 I;  1VLA A;  3S1M I;  4NB8 A;  1ZB8 A;  3VMG A;  2KPI A;  5C44 I;  4A93 I;  4A3L I;  3S14 I;  2JS4 A;  2J6A A;  3RZD I;  3U50 C;  3H0G I;  1TWG I;  3I07 A;  2AKL A;  2JA5 I;  4A3D I;  2F4O A;  3GTM S;  1YUA A;  4NBB A;  2NVQ I;  1TWF I;  4A3M I;  3GTP I;  4A3C I;  3H3V J;  4BXX I;  2JA6 I;  1ML8 A;  3GTG I;  3HOV I;  3I4M I;  3ESW A;  3PO3 I;  3S17 I;  3FKI I;  4NBH A;  2E2H I;  3S15 I;  4NOZ A;  1TFI A;  4NBA A;  3GTO I;  3HOU I;  3LUS A;  4QTU A;  4A3G I;  4BY1 I;  2K5R A;  2B63 I;  1Y1V I;  4XX2 A;  1L1O C;  4NBE A;  3VB9 A;  2NVY I;  5IP7 I;  2JA7 I;  1I50 I;  2DE5 A;  2HF1 A;  1RLY A;  4NBG A;  4NBD A;  1X3W A;  3GCF A;  4Y52 I;  3HOZ I;  3M3Y I;  2R7Z I;  2YU9 I;  2NVT I;  1RO4 A;  1Y1W I;  3GTJ I;  2BJO A;  3CQZ I;  3HOY I;  4A3I I;  2JR6 A;  1TWH I;  3EER A;  4MH4 A;  3GKQ A;  1QYP A;  4NBF A;  3GTM I;  2F4M A;  4NBC A;  4BBS I;  3I4N I;  2JNY A;  4A3J I;  2E2J I;  3K7A I;  4BBR I;  3GTK I;  1DL6 A;  3S1R I;  4NB9 A;  3S2H I;  4A3E I;  3PO2 I;  4A3B I;  2P3Y A;  2VUM I;  5C4X I;  1K83 I;  1LQL A;  3S16 I;  1I3Q I;  3PO3 S;  5CM2 M;  1R9T I;  3D6W A;  4QTT A;  1SFO I;  3HOW I;  1NUI A;  1PFT A;  3S1N I;  5IP9 I;  1I6H I;  4A3K I;  5C4J I;  1X3Z A;  4X6A I;  4Y7N I;  1WCM I;  2JA8 I; 
#chains in the Genus database with same CATH topology
 3CC2 1;  3CCJ 1;  1VQ4 1;  2ZAE B;  1RQF A;  4DGL A;  2Q51 A;  1VQL Z;  1Y1V S;  1Q7Y 1;  3CCL 1;  3J81 b;  2NVX I;  3RZO I;  1WW9 A;  1VQP 1;  3S1Q I;  4E2W A;  3M4O I;  5T67 A;  2DE7 A;  1VQ9 Z;  1KC8 2;  2JIR A;  3VMH A;  1JJ2 Y;  3Q87 A;  3S2D I;  3GTL I;  2R93 I;  2Y0S A;  3S1M I;  1YIJ 1;  1VQM Z;  3CMA 1;  4A93 I;  4E2Z A;  1W2B Y;  1Q81 1;  2J6A A;  3D9X A;  1TWG I;  2AYD A;  5IT9 f;  2AKL A;  1TWF I;  4MXU A;  4BXX I;  1M90 1;  3I4M I;  1KD1 2;  3S17 I;  2E2H I;  1N8R 1;  3FQM A;  1TFI A;  1QVG Z;  3CPW Z;  1RNI A;  4A3G I;  1P9N A;  2K5R A;  2QRC B;  3CME 1;  1VQK 1;  3CPW Y;  3EED A;  3CD6 1;  1YJW 1;  2DE5 A;  2HF1 A;  1RLY A;  3CME Z;  1X3W A;  2O53 A;  1M1K 2;  2JIO A;  2VPY A;  2NAP A;  2R7Z I;  3F3P C;  3J80 b;  1Y1W I;  2BJO A;  1YIT Z;  2F4M A;  1RO2 A;  2YAD A;  5T64 A;  1Y8C A;  1YI2 1;  2OTL Z;  1VQ5 Z;  1DL6 A;  1YJ9 Z;  3CCU 1;  2P3Y A;  2RIQ A;  1VQ7 Z;  3J81 f;  1I3Q I;  3TDH B;  5LL6 f;  3JAM b;  2QEX Z;  3PO3 S;  3IX0 A;  4MON A;  3KIH A;  3S1N I;  2LEX A;  3OW2 Y;  4S1T A;  3G71 1;  3CCV 1;  1N2F A;  1QF8 A;  2VPX A;  3CC7 Z;  4DQY B;  1VQ4 Z;  1USP A;  1YIJ Z;  4RVG A;  2VPW A;  1YJW Z;  3NDJ A;  2GU2 A;  3MON A;  1S72 1;  3CCQ 1;  5D1P A;  3BG0 B;  1M1K 1;  1ZB8 A;  4NB8 A;  2LIY A;  2KPI A;  4RVH A;  5A2Q b;  3RZD I;  2R6M A;  4A3D I;  2NVQ I;  3GTP I;  4A3M I;  1KQS Y;  5T6B A;  3CMA Z;  2V45 A;  1ML8 A;  3CCM Z;  3GTG I;  2IV2 X;  5D1O A;  1KD1 1;  3FKI I;  4NBH A;  1YJ9 1;  2GTH A;  2W03 A;  3GTO I;  5D1O B;  4RVD A;  1VQ9 1;  1FDI A;  2B63 I;  1Y1V I;  2OTJ 1;  4E33 A;  2PM9 A;  3MZL B;  1Q16 A;  2QR1 B;  1Q81 2;  3I55 Z;  3IFU A;  2JA7 I;  1ZH1 A;  4NBG A;  2RPR A;  1VQN Z;  1Q82 2;  4Y52 I;  3HOZ I;  3M3Y I;  2V8J A;  1RO4 A;  1KQS Z;  4E2Y A;  4A3I I;  3CD6 Z;  1K8A 2;  1TWH I;  2GTI A;  3JAM f;  4NBF A;  1VQO Z;  4NBC A;  2QEX 1;  2G2K A;  4E31 A;  4A3J I;  3K7A I;  3QWU A;  2IZ4 A;  1AA6 A;  3I56 1;  3NH8 A;  3S1R I;  5FLX b;  3S2H I;  3PO2 I;  2OTL 1;  1KC8 1;  3G6E Z;  3MZK B;  1K83 I;  3NFZ A;  5C4X I;  1VQ8 1;  1K9M 1;  3S16 I;  1FDO A;  4RV9 A;  4A3K I;  2JIP A;  4NFR A;  4E32 A;  4DK1 A;  1WCM I;  2M6N A;  4HH4 A;  5IT9 b;  1NP6 A;  1TWA I;  3P5J B;  1W2B Z;  2QRE B;  2RT9 A;  3HOX I;  2H85 A;  3CCE Z;  3GTQ I;  1USP B;  1ZB9 A;  2VUG A;  2Q4Z A;  3VMI A;  2R92 I;  1Z02 A;  4E30 A;  1RO0 A;  4A3F I;  3I55 1;  2QA4 1;  2VPZ A;  1VLA A;  1Q82 1;  2JUB A;  3CCM 1;  1NJI 1;  1WII A;  1K8A 1;  5FLX f;  3F3F C;  1YI2 Z;  3GTM S;  1YUA A;  2QLV B;  3CCS 1;  3G71 Z;  3J7A 4;  2V8I A;  1Z03 A;  3BG1 B;  3I56 Z;  3IF8 A;  4NBA A;  4AYB A;  4BY1 I;  1VQ7 1;  4XX2 A;  4NBE A;  3VB9 A;  1VQO 1;  1SIW A;  1KRL A;  2NVY I;  2QA4 Z;  5IP7 I;  2V8K A;  3GCF A;  2YU9 I;  2OZK A;  2NVT I;  3CC7 1;  1YHQ 1;  3NH4 A;  3T4N B;  1VQL 1;  3CCV Z;  3HOY I;  2QKD A;  2JR6 A;  1QVF Z;  3EER A;  4MH4 A;  3GTM I;  4BBS I;  3I4N I;  3CCS Z;  2JNY A;  1VQ8 Z;  2E2J I;  2KI7 B;  2IZ3 A;  3OW2 Z;  1Q86 1;  2O4H A;  3CCQ Z;  1S72 Z;  1WJ2 A;  3G4S Z;  4A3B I;  2VF1 A;  1LQL A;  4TNU A;  5CM2 M;  2RHB A;  1SFO I;  5A2Q f;  3HOW I;  2JIQ A;  2PMZ A;  5IP9 I;  3TE5 B;  5C4J I;  1X3Z A;  3CC4 1;  1Z01 A;  1YJN Z;  1VQP Z;  3CCE 1;  4EWC A;  3CCL Z;  2OOX B;  1TWC I;  2DE6 A;  1Q86 2;  4HGY A;  4MD9 A;  1NJI 2;  1N8R 2;  1VQM 1;  2E2I I;  4MD7 A;  2LFU A;  3CCJ Z;  5FLM I;  3CCR 1;  2W04 A;  5AN9 F;  3IR7 A;  2PK7 A;  2RBL A;  4BY7 I;  5C3E I;  2EGT A;  3VMG A;  3NDI A;  3FQQ A;  5C44 I;  4A3L I;  2E9H A;  1JWH C;  3S14 I;  2JS4 A;  1QXF A;  2I3C A;  3U50 C;  3H0G I;  3I07 A;  1WZN A;  2JA5 I;  2F4O A;  4A3C I;  4NBB A;  4RVF A;  1QVF Y;  4RS4 A;  2K3R A;  3H3V J;  1YUK A;  2JA6 I;  3HOV I;  3ESW A;  2P28 A;  3PO3 I;  2E7Z A;  4MRI A;  1Q7Y 2;  4NOZ A;  3S15 I;  3HOU I;  3LUS A;  4QTU A;  1VQK Z;  3J80 f;  1L1O C;  3CCR Z;  2JIM A;  1YIT 1;  4HGZ A;  1I50 I;  4E2X A;  1YHQ Z;  4NBD A;  2OTJ Z;  1VQ6 1;  1X0T A;  1M90 2;  3KIF A;  3CC2 Z;  3CXC Z;  1YJN 1;  4MD8 A;  1S7M A;  1K73 1;  2V3V A;  2HU9 A;  3GTJ I;  1K73 2;  3CQZ I;  2M48 A;  4CL1 A;  3GKQ A;  1QYP A;  4NH1 C;  1VQ6 Z;  1VQN 1;  3CC4 Z;  3G6E 1;  2WAQ A;  2OOY B;  4BBR I;  3CCU Z;  3GTK I;  1QVG Y;  3D2L A;  3NH5 A;  4NB9 A;  4A3E I;  2QRD B;  2VUM I;  1JJ2 Z;  2JMO A;  1R9T I;  3G4S 1;  3D6W A;  4QTT A;  1NUI A;  1PFT A;  3VTN A;  1VQ5 1;  1I6H I;  2WB1 A;  3CXC Y;  1K9M 2;  4X6A I;  4Y7N I;  3HKZ A;  2JA8 I; 
#chains in the Genus database with same CATH homology
 3CC2 1;  3CCJ 1;  1VQ4 1;  2ZAE B;  1RQF A;  4DGL A;  2Q51 A;  1VQL Z;  1Y1V S;  1Q7Y 1;  3CCL 1;  3J81 b;  2NVX I;  3RZO I;  1WW9 A;  1VQP 1;  3S1Q I;  4E2W A;  3M4O I;  5T67 A;  2DE7 A;  1VQ9 Z;  1KC8 2;  3VMH A;  1JJ2 Y;  3Q87 A;  3S2D I;  3GTL I;  2R93 I;  2Y0S A;  3S1M I;  1YIJ 1;  1VQM Z;  3CMA 1;  4A93 I;  4E2Z A;  1W2B Y;  1Q81 1;  2J6A A;  3D9X A;  1TWG I;  5IT9 f;  2AKL A;  1TWF I;  4MXU A;  4BXX I;  1M90 1;  3I4M I;  1KD1 2;  3S17 I;  2E2H I;  1N8R 1;  3FQM A;  1TFI A;  1QVG Z;  3CPW Z;  1RNI A;  4A3G I;  1P9N A;  2K5R A;  2QRC B;  3CME 1;  1VQK 1;  3CPW Y;  3EED A;  3CD6 1;  1YJW 1;  2DE5 A;  2HF1 A;  1RLY A;  3CME Z;  1X3W A;  2O53 A;  1M1K 2;  2R7Z I;  3F3P C;  3J80 b;  1Y1W I;  2BJO A;  1YIT Z;  2F4M A;  1RO2 A;  2YAD A;  5T64 A;  1YI2 1;  2OTL Z;  1VQ5 Z;  1DL6 A;  1YJ9 Z;  3CCU 1;  2P3Y A;  2RIQ A;  1VQ7 Z;  3J81 f;  1I3Q I;  3TDH B;  5LL6 f;  3JAM b;  2QEX Z;  3PO3 S;  3IX0 A;  4MON A;  3KIH A;  3S1N I;  3OW2 Y;  4S1T A;  3G71 1;  3CCV 1;  1N2F A;  1QF8 A;  3CC7 Z;  4DQY B;  1VQ4 Z;  1USP A;  1YIJ Z;  4RVG A;  1YJW Z;  3NDJ A;  2GU2 A;  3MON A;  1S72 1;  3CCQ 1;  5D1P A;  3BG0 B;  1M1K 1;  1ZB8 A;  4NB8 A;  2LIY A;  2KPI A;  4RVH A;  5A2Q b;  3RZD I;  2R6M A;  4A3D I;  2NVQ I;  3GTP I;  4A3M I;  1KQS Y;  5T6B A;  3CMA Z;  1ML8 A;  3CCM Z;  3GTG I;  5D1O A;  1KD1 1;  3FKI I;  4NBH A;  1YJ9 1;  2GTH A;  2W03 A;  3GTO I;  5D1O B;  4RVD A;  1VQ9 1;  2B63 I;  1Y1V I;  2OTJ 1;  4E33 A;  2PM9 A;  3MZL B;  1Q81 2;  2QR1 B;  3I55 Z;  3IFU A;  2JA7 I;  1ZH1 A;  4NBG A;  2RPR A;  1VQN Z;  1Q82 2;  4Y52 I;  3HOZ I;  3M3Y I;  2V8J A;  1RO4 A;  1KQS Z;  4E2Y A;  4A3I I;  3CD6 Z;  1K8A 2;  1TWH I;  2GTI A;  3JAM f;  4NBF A;  1VQO Z;  4NBC A;  2QEX 1;  2G2K A;  4E31 A;  4A3J I;  3K7A I;  3QWU A;  2IZ4 A;  3I56 1;  3NH8 A;  3S1R I;  5FLX b;  3S2H I;  3PO2 I;  2OTL 1;  1KC8 1;  3G6E Z;  3MZK B;  1K83 I;  3NFZ A;  5C4X I;  1VQ8 1;  1K9M 1;  3S16 I;  4RV9 A;  4A3K I;  4NFR A;  4E32 A;  4DK1 A;  1WCM I;  2M6N A;  4HH4 A;  5IT9 b;  1NP6 A;  1TWA I;  3P5J B;  1W2B Z;  2QRE B;  2RT9 A;  3HOX I;  2H85 A;  3CCE Z;  3GTQ I;  1USP B;  1ZB9 A;  2VUG A;  2Q4Z A;  3VMI A;  2R92 I;  1Z02 A;  4E30 A;  1RO0 A;  4A3F I;  3I55 1;  2QA4 1;  1VLA A;  1Q82 1;  2JUB A;  3CCM 1;  1NJI 1;  1WII A;  1K8A 1;  5FLX f;  3F3F C;  1YI2 Z;  3GTM S;  1YUA A;  2QLV B;  3CCS 1;  3G71 Z;  3J7A 4;  2V8I A;  1Z03 A;  3BG1 B;  3I56 Z;  3IF8 A;  4NBA A;  4AYB A;  4BY1 I;  1VQ7 1;  4XX2 A;  4NBE A;  3VB9 A;  1VQO 1;  1KRL A;  2NVY I;  2QA4 Z;  5IP7 I;  2V8K A;  3GCF A;  2YU9 I;  2OZK A;  2NVT I;  3CC7 1;  1YHQ 1;  3NH4 A;  3T4N B;  1VQL 1;  3CCV Z;  3HOY I;  2QKD A;  2JR6 A;  1QVF Z;  3EER A;  4MH4 A;  3GTM I;  4BBS I;  3I4N I;  3CCS Z;  2JNY A;  1VQ8 Z;  2E2J I;  2KI7 B;  2IZ3 A;  3OW2 Z;  1Q86 1;  2O4H A;  3CCQ Z;  1S72 Z;  3G4S Z;  4A3B I;  2VF1 A;  1LQL A;  4TNU A;  5CM2 M;  2RHB A;  1SFO I;  5A2Q f;  3HOW I;  2PMZ A;  5IP9 I;  3TE5 B;  5C4J I;  1X3Z A;  3CC4 1;  1Z01 A;  1YJN Z;  1VQP Z;  3CCE 1;  4EWC A;  3CCL Z;  2OOX B;  1TWC I;  2DE6 A;  1Q86 2;  4HGY A;  4MD9 A;  1NJI 2;  1N8R 2;  1VQM 1;  2E2I I;  4MD7 A;  2LFU A;  3CCJ Z;  5FLM I;  3CCR 1;  2W04 A;  5AN9 F;  2PK7 A;  2RBL A;  4BY7 I;  5C3E I;  2EGT A;  3VMG A;  3NDI A;  3FQQ A;  5C44 I;  4A3L I;  2E9H A;  1JWH C;  3S14 I;  2JS4 A;  2I3C A;  3U50 C;  3H0G I;  3I07 A;  2JA5 I;  2F4O A;  4A3C I;  4NBB A;  4RVF A;  1QVF Y;  4RS4 A;  2K3R A;  3H3V J;  1YUK A;  2JA6 I;  3HOV I;  3ESW A;  2P28 A;  3PO3 I;  4MRI A;  1Q7Y 2;  4NOZ A;  3S15 I;  3HOU I;  3LUS A;  4QTU A;  1VQK Z;  3J80 f;  1L1O C;  3CCR Z;  1YIT 1;  4HGZ A;  1I50 I;  4E2X A;  1YHQ Z;  4NBD A;  2OTJ Z;  1VQ6 1;  1X0T A;  1M90 2;  3KIF A;  3CC2 Z;  3CXC Z;  1YJN 1;  4MD8 A;  1S7M A;  1K73 1;  2HU9 A;  3GTJ I;  1K73 2;  3CQZ I;  2M48 A;  4CL1 A;  3GKQ A;  1QYP A;  4NH1 C;  1VQ6 Z;  1VQN 1;  3CC4 Z;  3G6E 1;  2WAQ A;  2OOY B;  4BBR I;  3CCU Z;  3GTK I;  1QVG Y;  3NH5 A;  4NB9 A;  4A3E I;  2QRD B;  2VUM I;  1JJ2 Z;  2JMO A;  1R9T I;  3G4S 1;  3D6W A;  4QTT A;  1NUI A;  1PFT A;  3VTN A;  1VQ5 1;  1I6H I;  2WB1 A;  3CXC Y;  1K9M 2;  4X6A I;  4Y7N I;  3HKZ A;  2JA8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...