3S1QI

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with atp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1qI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1qI02
1TWFI 3PO3S 4BBRI 1TWCI 4QTUA 3S1QI 3S15I 4NB8A 4NBDA 3EERA 3I07A 3GTPI 2E2JI 4BBSI 2DE7A 2K5RA 2DE6A 3S1RI 3M3YI 3H3VJ 1SFOI 1I50I 2BJOA 3VMIA 1USPB 1N2FA 2E2II 2NVQI 3HOXI 4X6AI 1VLAA 3S1NI 3GTJI 3GTGI 4A3MI 1I6HI 3I4MI 4NBAA 1X3WA 4QTTA 4A3JI 3D6WA 5C4JI 1K83I 3K7AI 4A3KI 3GTQI 1YUAA 3GKQA 4MH4A 4A3LI 3VMGA 1RLYA 3HOWI 2RBLA 5IP7I 3GTKI 1TFIA 1X3ZA 3GTLI 2VUMI 5FLMI 1Y1WI 4NBFA 2HF1A 3S14I 1PFTA 1ZB9A 3I4NI 4A3EI 1L1OC 3VB9A 1DL6A 2B63I 2R92I 4NB9A 1LQLA 4Y52I 4A3GI 1ZB8A 3GTOI 1USPA 2R7ZI 1TWHI 4A93I 2JR6A 3S2DI 2PK7A 2P3YA 4BY1I 2JA5I 1Y1VI 3GCFA 2NVTI 1R9TI 3RZOI 1Y1VS 5IP9I 3U50C 4A3FI 3S2HI 4BXXI 2E2HI 4NOZA 1I3QI 4A3DI 2R93I 3M4OI 1RO4A 3HOVI 1WW9A 3HOZI 2YU9I 5C3EI 4NBHA 2AKLA 2KPIA 4BY7I 3PO3I 3Q87A 1TWGI 4A3II 3S17I 1WCMI 3PO2I 2JS4A 3GTMI 2JNYA 4NBBA 3VMHA 3HOYI 3GTMS 3HOUI 2J6AA 3FKII 4Y7NI 4XX2A 4NBEA 4A3CI 5C4XI 2JA6I 3ESWA 3S16I 3LUSA 2JA7I 2NVYI 4NBCA 5C44I 2JA8I 5CM2M 2F4MA 2NVXI 1ML8A 1QYPA 3H0GI 4NBGA 2DE5A 3S1MI 4A3BI 1NUIA 1TWAI 2F4OA 3CQZI 3RZDI
chains in the Genus database with same CATH superfamily
3NDIA 4BBRI 3CD61 2JUBA 2V45A 3CXCZ 4BBSI 3M3YI 3H3VJ 2M48A 3CCL1 1N2FA 2E2II 2NVQI 3GTJI 1KD11 4NBAA 1X3WA 4QTTA 3CCLZ 1Q812 4RVHA 1Z03A 3CCQZ 1YUAA 1ZH1A 2E7ZA 1Q822 1X3ZA 2QRDB 3MZLB 3CCR1 1WZNA 1Y1WI 1RO2A 4HGYA 2VPXA 1ZB9A 3I4NI 4A3EI 1L1OC 1NJI1 2V8JA 1KC82 4NB9A 1LQLA 1VQ41 4A3GI 4E2WA 3GTOI 1TWHI 3IF8A 2PK7A 3CCUZ 2VPZA 1Y1VI 2RPRA 3GCFA 5IP9I 1K731 3J7A4 1N8R2 3TDHB 5T67A 3CC7Z 1I3QI 2R93I 1RO4A 2R6MA 1YJWZ 4HH4A 3FQMA 1YHQ1 4BY7I 1YHQZ 1TWGI 1QVGY 1WCMI 1YUKA 3CPWY 4E32A 4Y7NI 1M1K2 1VQ61 5FLXb 4NBEA 2GTHA 1YIJ1 3TE5B 3CPWZ 3BG0B 2F4OA 2QREB 1YIJZ 1TWFI 4MD7A 4QTUA 1Q821 3S15I 3NFZA 1JJ2Y 2ZAEB 3GTPI 1VQ91 2QR1B 2M6NA 1Q862 1SFOI 1I50I 4X6AI 3CC41 1VLAA 3NH8A 1KRLA 1Q7Y2 1KC81 4MD8A 5IT9b 1JJ2Z 3CC4Z 1K83I 3K7AI 3GTQI 3GKQA 3HOWI 2K3RA 2RBLA 3GTLI 5FLMI 3EEDA 2OOXB 1N8R1 3CD6Z 2OZKA 1M902 5LL6f 2Q51A 4Y52I 3VTNA 4E2ZA 2LIYA 3J81b 2V8IA 3CCJ1 1YJN1 2QKDA 2P3YA 2JA5I 3CCJZ 1YJ91 4NH1C 2JIRA 4RVDA 3U50C 2AYDA 2V8KA 4NOZA 1M1K1 3CCRZ 1W2BY 2Q4ZA 1VQL1 2LFUA 1RO0A 2G2KA 2AKLA 3KIHA 1VQLZ 3CCV1 3G6E1 1VQ4Z 3NH5A 1W2BZ 3Q87A 1VQP1 3S17I 3MZKB 3G6EZ 3CME1 3GTMI 3HOYI 4CL1A 3FQQA 1VQK1 2WB1A 3F3PC 1VQPZ 1Q861 3CCE1 4E2YA 3CMEZ 5T64A 4A3CI 2JA6I 3ESWA 4MXUA 1VQKZ 1Q7Y1 3J80b 2NVYI 2JA8I 1Q16A 3CCEZ 1K9M2 2DE5A 4A3BI 1NUIA 1VQO1 5C4XI 3CQZI 2EGTA 5FLXf 1VQOZ 1VQN1 3EERA 2VUGA 2E2JI 3S1RI 2K5RA 1WIIA 3VMIA 2BJOA 2PMZA 1USPB 4TNUA 2GU2A 1Z01A 1M901 4E31A 1QVGZ 1VQ6Z 3D6WA 5D1OB 3CCM1 2JIQA 1KQSY 2PM9A 2KI7B 2W04A 1Q811 2QLVB 4A3KI 2RHBA 4MH4A 2V3VA 3IFUA 3CCMZ 1RLYA 2QEX1 5IP7I 1TFIA 1KQSZ 5IT9f 2WAQA 1K8A2 4NBFA 4RV9A 3S14I 4EWCA 2JIOA 5A2Qb 2R92I 1VQ9Z 1ZB8A 2QA41 1USPA 2R7ZI 2JR6A 2JMOA 3D9XA 2QA4Z 3S2DI 5D1OA 4BY1I 2P28A 3JAMb 2VF1A 3RZOI 1Y1VS 1RNIA 4A3FI 3S2HI 2IV2X 2E2HI 1VQ81 4A3DI 3J81f 3M4OI 4RVFA 5AN9F 1WW9A 2JIPA 1VQ8Z 3HOZI 4HGZA 3OW2Y 2YU9I 1K9M1 5C3EI 2H85A 4RS4A 3F3FC 4NFRA 3OW2Z 2W03A 2QRCB 1X0TA 2JNYA 3BG1B 1YJNZ 1JWHC 2J6AA 3FKII 1P9NA 1VQM1 3HKZA 1YJ9Z 1S721 3CCQ1 1NP6A 3QWUA 5CM2M 1YIT1 1VQMZ 2NVXI 1VQ51 3H0GI 1S72Z 1YI21 1S7MA 1RQFA 1YITZ 3RZDI 2RT9A 2VPWA 1VQ5Z 5T6BA 3PO3S 2VPYA 1TWCI 3S1QI 2RIQA 1Y8CA 4NB8A 2GTIA 1YI2Z 4NBDA 3J80f 3I07A 3CCVZ 1SIWA 1K8A1 2DE7A 2DE6A 3IX0A 4E33A 3HOXI 3S1NI 3GTGI 4A3MI 1I6HI 3I4MI 4A3JI 3MONA 3CCU1 5C4JI 1QVFY 3I561 3I551 4A3LI 3VMGA 2LEXA 2OTL1 3GTKI 2IZ4A 3CC71 3I56Z 3CC21 3I55Z 2VUMI 1QVFZ 3KIFA 1Z02A 2OTLZ 2HF1A 1YJW1 1PFTA 3CC2Z 1WJ2A 1KD12 1VQNZ 4AYBA 2JIMA 3VB9A 2E9HA 2B63I 1DL6A 3T4NB 1QF8A 4DK1A 4A93I 4S1TA 3NH4A 1FDIA 2HU9A 4DGLA 3CMA1 5A2Qf 4MRIA 3IR7A 4DQYB 3CCS1 1QXFA 2NVTI 1AA6A 3G711 1R9TI 4BXXI 2QEXZ 3CMAZ 2IZ3A 1NJI2 2OTJ1 3CCSZ 3G71Z 3HOVI 3D2LA 3NDJA 3P5JB 2OTJZ 3G4S1 3JAMf 4NBHA 2KPIA 3PO3I 4E2XA 3G4SZ 2YADA 4A3II 4MONA 1FDOA 3PO2I 1VQ71 2JS4A 2I3CA 4NBBA 3VMHA 3GTMS 1K732 2OOYB 3HOUI 4XX2A 1VQ7Z 4RVGA 3S16I 3LUSA 2JA7I 4MD9A 4NBCA 2NAPA 5C44I 2F4MA 2O53A 2Y0SA 3CXCY 1ML8A 1QYPA 5D1PA 4NBGA 3S1MI 1TWAI 2O4HA 4E30A
chains in the Genus database with same CATH topology
3NDIA 4BBRI 3CD61 2JUBA 3CXCZ 4BBSI 3M3YI 3H3VJ 2M48A 3CCL1 1N2FA 2E2II 2NVQI 3GTJI 1KD11 4NBAA 1X3WA 4QTTA 3CCLZ 1Q812 4RVHA 1Z03A 3CCQZ 1YUAA 1ZH1A 1Q822 1X3ZA 2QRDB 3MZLB 3CCR1 1Y1WI 1RO2A 4HGYA 1ZB9A 3I4NI 4A3EI 1L1OC 1NJI1 2V8JA 1KC82 4NB9A 1LQLA 1VQ41 4A3GI 4E2WA 3GTOI 1TWHI 3IF8A 2PK7A 3CCUZ 1Y1VI 2RPRA 3GCFA 5IP9I 1K731 3J7A4 1N8R2 3TDHB 5T67A 3CC7Z 1I3QI 2R93I 1RO4A 2R6MA 1YJWZ 4HH4A 3FQMA 1YHQ1 4BY7I 1YHQZ 1TWGI 1QVGY 1WCMI 1YUKA 3CPWY 4E32A 4Y7NI 1M1K2 1VQ61 5FLXb 4NBEA 2GTHA 1YIJ1 3TE5B 3CPWZ 3BG0B 2F4OA 2QREB 1YIJZ 1TWFI 4MD7A 4QTUA 1Q821 3S15I 3NFZA 1JJ2Y 2ZAEB 3GTPI 1VQ91 2QR1B 2M6NA 1Q862 1SFOI 1I50I 4X6AI 3CC41 1VLAA 3NH8A 1KRLA 1Q7Y2 1KC81 4MD8A 5IT9b 1JJ2Z 3CC4Z 1K83I 3K7AI 3GTQI 3GKQA 3HOWI 2K3RA 2RBLA 3GTLI 5FLMI 3EEDA 2OOXB 1N8R1 3CD6Z 2OZKA 1M902 5LL6f 2Q51A 4Y52I 3VTNA 4E2ZA 2LIYA 3J81b 2V8IA 3CCJ1 1YJN1 2QKDA 2P3YA 2JA5I 3CCJZ 1YJ91 4NH1C 4RVDA 3U50C 2V8KA 4NOZA 1M1K1 3CCRZ 1W2BY 2Q4ZA 1VQL1 2LFUA 1RO0A 2G2KA 2AKLA 3KIHA 1VQLZ 3CCV1 3G6E1 1VQ4Z 3NH5A 1W2BZ 3Q87A 1VQP1 3S17I 3MZKB 3G6EZ 3CME1 3GTMI 3HOYI 4CL1A 3FQQA 1VQK1 2WB1A 3F3PC 1VQPZ 1Q861 3CCE1 4E2YA 3CMEZ 5T64A 4A3CI 2JA6I 3ESWA 4MXUA 1VQKZ 1Q7Y1 3J80b 2NVYI 2JA8I 3CCEZ 1K9M2 2DE5A 4A3BI 1NUIA 1VQO1 5C4XI 3CQZI 2EGTA 5FLXf 1VQOZ 1VQN1 3EERA 2VUGA 2E2JI 3S1RI 2K5RA 1WIIA 3VMIA 2BJOA 2PMZA 1USPB 4TNUA 2GU2A 1Z01A 1M901 4E31A 1QVGZ 1VQ6Z 3D6WA 5D1OB 3CCM1 1KQSY 2PM9A 2KI7B 2W04A 1Q811 2QLVB 4A3KI 2RHBA 4MH4A 3IFUA 3CCMZ 1RLYA 2QEX1 5IP7I 1TFIA 1KQSZ 5IT9f 2WAQA 1K8A2 4NBFA 4RV9A 3S14I 4EWCA 5A2Qb 2R92I 1VQ9Z 1ZB8A 2QA41 1USPA 2R7ZI 2JR6A 2JMOA 3D9XA 2QA4Z 3S2DI 5D1OA 4BY1I 2P28A 3JAMb 2VF1A 3RZOI 1Y1VS 1RNIA 4A3FI 3S2HI 2E2HI 1VQ81 4A3DI 3J81f 3M4OI 4RVFA 5AN9F 1WW9A 1VQ8Z 3HOZI 4HGZA 3OW2Y 2YU9I 1K9M1 5C3EI 2H85A 4RS4A 3F3FC 4NFRA 3OW2Z 2W03A 2QRCB 1X0TA 2JNYA 3BG1B 1YJNZ 1JWHC 2J6AA 3FKII 1P9NA 1VQM1 3HKZA 1YJ9Z 1S721 3CCQ1 1NP6A 3QWUA 5CM2M 1YIT1 1VQMZ 2NVXI 1VQ51 3H0GI 1S72Z 1YI21 1S7MA 1RQFA 1YITZ 3RZDI 2RT9A 1VQ5Z 5T6BA 3PO3S 1TWCI 3S1QI 2RIQA 4NB8A 2GTIA 1YI2Z 4NBDA 3J80f 3I07A 3CCVZ 1K8A1 2DE7A 2DE6A 3IX0A 4E33A 3HOXI 3S1NI 3GTGI 4A3MI 1I6HI 3I4MI 4A3JI 3MONA 3CCU1 5C4JI 1QVFY 3I561 3I551 4A3LI 3VMGA 2OTL1 3GTKI 2IZ4A 3CC71 3I56Z 3CC21 3I55Z 2VUMI 1QVFZ 3KIFA 1Z02A 2OTLZ 2HF1A 1YJW1 1PFTA 3CC2Z 1KD12 1VQNZ 4AYBA 3VB9A 1DL6A 2E9HA 2B63I 3T4NB 1QF8A 4DK1A 4A93I 4S1TA 3NH4A 2HU9A 4DGLA 3CMA1 5A2Qf 4MRIA 4DQYB 3CCS1 2NVTI 3G711 1R9TI 4BXXI 2QEXZ 3CMAZ 2IZ3A 1NJI2 2OTJ1 3CCSZ 3G71Z 3HOVI 3NDJA 3P5JB 2OTJZ 3G4S1 3JAMf 4NBHA 2KPIA 3PO3I 4E2XA 3G4SZ 2YADA 4A3II 4MONA 3PO2I 1VQ71 2JS4A 2I3CA 4NBBA 3VMHA 3GTMS 1K732 2OOYB 3HOUI 4XX2A 1VQ7Z 4RVGA 3S16I 3LUSA 2JA7I 4MD9A 4NBCA 5C44I 2F4MA 2O53A 2Y0SA 3CXCY 1ML8A 1QYPA 5D1PA 4NBGA 3S1MI 1TWAI 2O4HA 4E30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF I;  3PO3 S;  4BBR I;  1TWC I;  4QTU A;  3S1Q I;  3S15 I;  4NB8 A;  4NBD A;  3EER A;  3I07 A;  3GTP I;  2E2J I;  4BBS I;  2DE7 A;  2K5R A;  2DE6 A;  3S1R I;  3M3Y I;  3H3V J;  1SFO I;  1I50 I;  2BJO A;  3VMI A;  1USP B;  1N2F A;  2E2I I;  2NVQ I;  3HOX I;  4X6A I;  1VLA A;  3S1N I;  3GTJ I;  3GTG I;  4A3M I;  1I6H I;  3I4M I;  4NBA A;  1X3W A;  4QTT A;  4A3J I;  3D6W A;  5C4J I;  1K83 I;  3K7A I;  4A3K I;  3GTQ I;  1YUA A;  3GKQ A;  4MH4 A;  4A3L I;  3VMG A;  1RLY A;  3HOW I;  2RBL A;  5IP7 I;  3GTK I;  1TFI A;  1X3Z A;  3GTL I;  2VUM I;  5FLM I;  1Y1W I;  4NBF A;  2HF1 A;  3S14 I;  1PFT A;  1ZB9 A;  3I4N I;  4A3E I;  1L1O C;  3VB9 A;  1DL6 A;  2B63 I;  2R92 I;  4NB9 A;  1LQL A;  4Y52 I;  4A3G I;  1ZB8 A;  3GTO I;  1USP A;  2R7Z I;  1TWH I;  4A93 I;  2JR6 A;  3S2D I;  2PK7 A;  2P3Y A;  4BY1 I;  2JA5 I;  1Y1V I;  3GCF A;  2NVT I;  1R9T I;  3RZO I;  1Y1V S;  5IP9 I;  3U50 C;  4A3F I;  3S2H I;  4BXX I;  2E2H I;  4NOZ A;  1I3Q I;  4A3D I;  2R93 I;  3M4O I;  1RO4 A;  3HOV I;  1WW9 A;  3HOZ I;  2YU9 I;  5C3E I;  4NBH A;  2AKL A;  2KPI A;  4BY7 I;  3PO3 I;  3Q87 A;  1TWG I;  4A3I I;  3S17 I;  1WCM I;  3PO2 I;  2JS4 A;  3GTM I;  2JNY A;  4NBB A;  3VMH A;  3HOY I;  3GTM S;  3HOU I;  2J6A A;  3FKI I;  4Y7N I;  4XX2 A;  4NBE A;  4A3C I;  5C4X I;  2JA6 I;  3ESW A;  3S16 I;  3LUS A;  2JA7 I;  2NVY I;  4NBC A;  5C44 I;  2JA8 I;  5CM2 M;  2F4M A;  2NVX I;  1ML8 A;  1QYP A;  3H0G I;  4NBG A;  2DE5 A;  3S1M I;  4A3B I;  1NUI A;  1TWA I;  2F4O A;  3CQZ I;  3RZD I; 
#chains in the Genus database with same CATH topology
 3NDI A;  4BBR I;  3CD6 1;  2JUB A;  2V45 A;  3CXC Z;  4BBS I;  3M3Y I;  3H3V J;  2M48 A;  3CCL 1;  1N2F A;  2E2I I;  2NVQ I;  3GTJ I;  1KD1 1;  4NBA A;  1X3W A;  4QTT A;  3CCL Z;  1Q81 2;  4RVH A;  1Z03 A;  3CCQ Z;  1YUA A;  1ZH1 A;  2E7Z A;  1Q82 2;  1X3Z A;  2QRD B;  3MZL B;  3CCR 1;  1WZN A;  1Y1W I;  1RO2 A;  4HGY A;  2VPX A;  1ZB9 A;  3I4N I;  4A3E I;  1L1O C;  1NJI 1;  2V8J A;  1KC8 2;  4NB9 A;  1LQL A;  1VQ4 1;  4A3G I;  4E2W A;  3GTO I;  1TWH I;  3IF8 A;  2PK7 A;  3CCU Z;  2VPZ A;  1Y1V I;  2RPR A;  3GCF A;  5IP9 I;  1K73 1;  3J7A 4;  1N8R 2;  3TDH B;  5T67 A;  3CC7 Z;  1I3Q I;  2R93 I;  1RO4 A;  2R6M A;  1YJW Z;  4HH4 A;  3FQM A;  1YHQ 1;  4BY7 I;  1YHQ Z;  1TWG I;  1QVG Y;  1WCM I;  1YUK A;  3CPW Y;  4E32 A;  4Y7N I;  1M1K 2;  1VQ6 1;  5FLX b;  4NBE A;  2GTH A;  1YIJ 1;  3TE5 B;  3CPW Z;  3BG0 B;  2F4O A;  2QRE B;  1YIJ Z;  1TWF I;  4MD7 A;  4QTU A;  1Q82 1;  3S15 I;  3NFZ A;  1JJ2 Y;  2ZAE B;  3GTP I;  1VQ9 1;  2QR1 B;  2M6N A;  1Q86 2;  1SFO I;  1I50 I;  4X6A I;  3CC4 1;  1VLA A;  3NH8 A;  1KRL A;  1Q7Y 2;  1KC8 1;  4MD8 A;  5IT9 b;  1JJ2 Z;  3CC4 Z;  1K83 I;  3K7A I;  3GTQ I;  3GKQ A;  3HOW I;  2K3R A;  2RBL A;  3GTL I;  5FLM I;  3EED A;  2OOX B;  1N8R 1;  3CD6 Z;  2OZK A;  1M90 2;  5LL6 f;  2Q51 A;  4Y52 I;  3VTN A;  4E2Z A;  2LIY A;  3J81 b;  2V8I A;  3CCJ 1;  1YJN 1;  2QKD A;  2P3Y A;  2JA5 I;  3CCJ Z;  1YJ9 1;  4NH1 C;  2JIR A;  4RVD A;  3U50 C;  2AYD A;  2V8K A;  4NOZ A;  1M1K 1;  3CCR Z;  1W2B Y;  2Q4Z A;  1VQL 1;  2LFU A;  1RO0 A;  2G2K A;  2AKL A;  3KIH A;  1VQL Z;  3CCV 1;  3G6E 1;  1VQ4 Z;  3NH5 A;  1W2B Z;  3Q87 A;  1VQP 1;  3S17 I;  3MZK B;  3G6E Z;  3CME 1;  3GTM I;  3HOY I;  4CL1 A;  3FQQ A;  1VQK 1;  2WB1 A;  3F3P C;  1VQP Z;  1Q86 1;  3CCE 1;  4E2Y A;  3CME Z;  5T64 A;  4A3C I;  2JA6 I;  3ESW A;  4MXU A;  1VQK Z;  1Q7Y 1;  3J80 b;  2NVY I;  2JA8 I;  1Q16 A;  3CCE Z;  1K9M 2;  2DE5 A;  4A3B I;  1NUI A;  1VQO 1;  5C4X I;  3CQZ I;  2EGT A;  5FLX f;  1VQO Z;  1VQN 1;  3EER A;  2VUG A;  2E2J I;  3S1R I;  2K5R A;  1WII A;  3VMI A;  2BJO A;  2PMZ A;  1USP B;  4TNU A;  2GU2 A;  1Z01 A;  1M90 1;  4E31 A;  1QVG Z;  1VQ6 Z;  3D6W A;  5D1O B;  3CCM 1;  2JIQ A;  1KQS Y;  2PM9 A;  2KI7 B;  2W04 A;  1Q81 1;  2QLV B;  4A3K I;  2RHB A;  4MH4 A;  2V3V A;  3IFU A;  3CCM Z;  1RLY A;  2QEX 1;  5IP7 I;  1TFI A;  1KQS Z;  5IT9 f;  2WAQ A;  1K8A 2;  4NBF A;  4RV9 A;  3S14 I;  4EWC A;  2JIO A;  5A2Q b;  2R92 I;  1VQ9 Z;  1ZB8 A;  2QA4 1;  1USP A;  2R7Z I;  2JR6 A;  2JMO A;  3D9X A;  2QA4 Z;  3S2D I;  5D1O A;  4BY1 I;  2P28 A;  3JAM b;  2VF1 A;  3RZO I;  1Y1V S;  1RNI A;  4A3F I;  3S2H I;  2IV2 X;  2E2H I;  1VQ8 1;  4A3D I;  3J81 f;  3M4O I;  4RVF A;  5AN9 F;  1WW9 A;  2JIP A;  1VQ8 Z;  3HOZ I;  4HGZ A;  3OW2 Y;  2YU9 I;  1K9M 1;  5C3E I;  2H85 A;  4RS4 A;  3F3F C;  4NFR A;  3OW2 Z;  2W03 A;  2QRC B;  1X0T A;  2JNY A;  3BG1 B;  1YJN Z;  1JWH C;  2J6A A;  3FKI I;  1P9N A;  1VQM 1;  3HKZ A;  1YJ9 Z;  1S72 1;  3CCQ 1;  1NP6 A;  3QWU A;  5CM2 M;  1YIT 1;  1VQM Z;  2NVX I;  1VQ5 1;  3H0G I;  1S72 Z;  1YI2 1;  1S7M A;  1RQF A;  1YIT Z;  3RZD I;  2RT9 A;  2VPW A;  1VQ5 Z;  5T6B A;  3PO3 S;  2VPY A;  1TWC I;  3S1Q I;  2RIQ A;  1Y8C A;  4NB8 A;  2GTI A;  1YI2 Z;  4NBD A;  3J80 f;  3I07 A;  3CCV Z;  1SIW A;  1K8A 1;  2DE7 A;  2DE6 A;  3IX0 A;  4E33 A;  3HOX I;  3S1N I;  3GTG I;  4A3M I;  1I6H I;  3I4M I;  4A3J I;  3MON A;  3CCU 1;  5C4J I;  1QVF Y;  3I56 1;  3I55 1;  4A3L I;  3VMG A;  2LEX A;  2OTL 1;  3GTK I;  2IZ4 A;  3CC7 1;  3I56 Z;  3CC2 1;  3I55 Z;  2VUM I;  1QVF Z;  3KIF A;  1Z02 A;  2OTL Z;  2HF1 A;  1YJW 1;  1PFT A;  3CC2 Z;  1WJ2 A;  1KD1 2;  1VQN Z;  4AYB A;  2JIM A;  3VB9 A;  2E9H A;  2B63 I;  1DL6 A;  3T4N B;  1QF8 A;  4DK1 A;  4A93 I;  4S1T A;  3NH4 A;  1FDI A;  2HU9 A;  4DGL A;  3CMA 1;  5A2Q f;  4MRI A;  3IR7 A;  4DQY B;  3CCS 1;  1QXF A;  2NVT I;  1AA6 A;  3G71 1;  1R9T I;  4BXX I;  2QEX Z;  3CMA Z;  2IZ3 A;  1NJI 2;  2OTJ 1;  3CCS Z;  3G71 Z;  3HOV I;  3D2L A;  3NDJ A;  3P5J B;  2OTJ Z;  3G4S 1;  3JAM f;  4NBH A;  2KPI A;  3PO3 I;  4E2X A;  3G4S Z;  2YAD A;  4A3I I;  4MON A;  1FDO A;  3PO2 I;  1VQ7 1;  2JS4 A;  2I3C A;  4NBB A;  3VMH A;  3GTM S;  1K73 2;  2OOY B;  3HOU I;  4XX2 A;  1VQ7 Z;  4RVG A;  3S16 I;  3LUS A;  2JA7 I;  4MD9 A;  4NBC A;  2NAP A;  5C44 I;  2F4M A;  2O53 A;  2Y0S A;  3CXC Y;  1ML8 A;  1QYP A;  5D1P A;  4NBG A;  3S1M I;  1TWA I;  2O4H A;  4E30 A; 
#chains in the Genus database with same CATH homology
 3NDI A;  4BBR I;  3CD6 1;  2JUB A;  3CXC Z;  4BBS I;  3M3Y I;  3H3V J;  2M48 A;  3CCL 1;  1N2F A;  2E2I I;  2NVQ I;  3GTJ I;  1KD1 1;  4NBA A;  1X3W A;  4QTT A;  3CCL Z;  1Q81 2;  4RVH A;  1Z03 A;  3CCQ Z;  1YUA A;  1ZH1 A;  1Q82 2;  1X3Z A;  2QRD B;  3MZL B;  3CCR 1;  1Y1W I;  1RO2 A;  4HGY A;  1ZB9 A;  3I4N I;  4A3E I;  1L1O C;  1NJI 1;  2V8J A;  1KC8 2;  4NB9 A;  1LQL A;  1VQ4 1;  4A3G I;  4E2W A;  3GTO I;  1TWH I;  3IF8 A;  2PK7 A;  3CCU Z;  1Y1V I;  2RPR A;  3GCF A;  5IP9 I;  1K73 1;  3J7A 4;  1N8R 2;  3TDH B;  5T67 A;  3CC7 Z;  1I3Q I;  2R93 I;  1RO4 A;  2R6M A;  1YJW Z;  4HH4 A;  3FQM A;  1YHQ 1;  4BY7 I;  1YHQ Z;  1TWG I;  1QVG Y;  1WCM I;  1YUK A;  3CPW Y;  4E32 A;  4Y7N I;  1M1K 2;  1VQ6 1;  5FLX b;  4NBE A;  2GTH A;  1YIJ 1;  3TE5 B;  3CPW Z;  3BG0 B;  2F4O A;  2QRE B;  1YIJ Z;  1TWF I;  4MD7 A;  4QTU A;  1Q82 1;  3S15 I;  3NFZ A;  1JJ2 Y;  2ZAE B;  3GTP I;  1VQ9 1;  2QR1 B;  2M6N A;  1Q86 2;  1SFO I;  1I50 I;  4X6A I;  3CC4 1;  1VLA A;  3NH8 A;  1KRL A;  1Q7Y 2;  1KC8 1;  4MD8 A;  5IT9 b;  1JJ2 Z;  3CC4 Z;  1K83 I;  3K7A I;  3GTQ I;  3GKQ A;  3HOW I;  2K3R A;  2RBL A;  3GTL I;  5FLM I;  3EED A;  2OOX B;  1N8R 1;  3CD6 Z;  2OZK A;  1M90 2;  5LL6 f;  2Q51 A;  4Y52 I;  3VTN A;  4E2Z A;  2LIY A;  3J81 b;  2V8I A;  3CCJ 1;  1YJN 1;  2QKD A;  2P3Y A;  2JA5 I;  3CCJ Z;  1YJ9 1;  4NH1 C;  4RVD A;  3U50 C;  2V8K A;  4NOZ A;  1M1K 1;  3CCR Z;  1W2B Y;  2Q4Z A;  1VQL 1;  2LFU A;  1RO0 A;  2G2K A;  2AKL A;  3KIH A;  1VQL Z;  3CCV 1;  3G6E 1;  1VQ4 Z;  3NH5 A;  1W2B Z;  3Q87 A;  1VQP 1;  3S17 I;  3MZK B;  3G6E Z;  3CME 1;  3GTM I;  3HOY I;  4CL1 A;  3FQQ A;  1VQK 1;  2WB1 A;  3F3P C;  1VQP Z;  1Q86 1;  3CCE 1;  4E2Y A;  3CME Z;  5T64 A;  4A3C I;  2JA6 I;  3ESW A;  4MXU A;  1VQK Z;  1Q7Y 1;  3J80 b;  2NVY I;  2JA8 I;  3CCE Z;  1K9M 2;  2DE5 A;  4A3B I;  1NUI A;  1VQO 1;  5C4X I;  3CQZ I;  2EGT A;  5FLX f;  1VQO Z;  1VQN 1;  3EER A;  2VUG A;  2E2J I;  3S1R I;  2K5R A;  1WII A;  3VMI A;  2BJO A;  2PMZ A;  1USP B;  4TNU A;  2GU2 A;  1Z01 A;  1M90 1;  4E31 A;  1QVG Z;  1VQ6 Z;  3D6W A;  5D1O B;  3CCM 1;  1KQS Y;  2PM9 A;  2KI7 B;  2W04 A;  1Q81 1;  2QLV B;  4A3K I;  2RHB A;  4MH4 A;  3IFU A;  3CCM Z;  1RLY A;  2QEX 1;  5IP7 I;  1TFI A;  1KQS Z;  5IT9 f;  2WAQ A;  1K8A 2;  4NBF A;  4RV9 A;  3S14 I;  4EWC A;  5A2Q b;  2R92 I;  1VQ9 Z;  1ZB8 A;  2QA4 1;  1USP A;  2R7Z I;  2JR6 A;  2JMO A;  3D9X A;  2QA4 Z;  3S2D I;  5D1O A;  4BY1 I;  2P28 A;  3JAM b;  2VF1 A;  3RZO I;  1Y1V S;  1RNI A;  4A3F I;  3S2H I;  2E2H I;  1VQ8 1;  4A3D I;  3J81 f;  3M4O I;  4RVF A;  5AN9 F;  1WW9 A;  1VQ8 Z;  3HOZ I;  4HGZ A;  3OW2 Y;  2YU9 I;  1K9M 1;  5C3E I;  2H85 A;  4RS4 A;  3F3F C;  4NFR A;  3OW2 Z;  2W03 A;  2QRC B;  1X0T A;  2JNY A;  3BG1 B;  1YJN Z;  1JWH C;  2J6A A;  3FKI I;  1P9N A;  1VQM 1;  3HKZ A;  1YJ9 Z;  1S72 1;  3CCQ 1;  1NP6 A;  3QWU A;  5CM2 M;  1YIT 1;  1VQM Z;  2NVX I;  1VQ5 1;  3H0G I;  1S72 Z;  1YI2 1;  1S7M A;  1RQF A;  1YIT Z;  3RZD I;  2RT9 A;  1VQ5 Z;  5T6B A;  3PO3 S;  1TWC I;  3S1Q I;  2RIQ A;  4NB8 A;  2GTI A;  1YI2 Z;  4NBD A;  3J80 f;  3I07 A;  3CCV Z;  1K8A 1;  2DE7 A;  2DE6 A;  3IX0 A;  4E33 A;  3HOX I;  3S1N I;  3GTG I;  4A3M I;  1I6H I;  3I4M I;  4A3J I;  3MON A;  3CCU 1;  5C4J I;  1QVF Y;  3I56 1;  3I55 1;  4A3L I;  3VMG A;  2OTL 1;  3GTK I;  2IZ4 A;  3CC7 1;  3I56 Z;  3CC2 1;  3I55 Z;  2VUM I;  1QVF Z;  3KIF A;  1Z02 A;  2OTL Z;  2HF1 A;  1YJW 1;  1PFT A;  3CC2 Z;  1KD1 2;  1VQN Z;  4AYB A;  3VB9 A;  1DL6 A;  2E9H A;  2B63 I;  3T4N B;  1QF8 A;  4DK1 A;  4A93 I;  4S1T A;  3NH4 A;  2HU9 A;  4DGL A;  3CMA 1;  5A2Q f;  4MRI A;  4DQY B;  3CCS 1;  2NVT I;  3G71 1;  1R9T I;  4BXX I;  2QEX Z;  3CMA Z;  2IZ3 A;  1NJI 2;  2OTJ 1;  3CCS Z;  3G71 Z;  3HOV I;  3NDJ A;  3P5J B;  2OTJ Z;  3G4S 1;  3JAM f;  4NBH A;  2KPI A;  3PO3 I;  4E2X A;  3G4S Z;  2YAD A;  4A3I I;  4MON A;  3PO2 I;  1VQ7 1;  2JS4 A;  2I3C A;  4NBB A;  3VMH A;  3GTM S;  1K73 2;  2OOY B;  3HOU I;  4XX2 A;  1VQ7 Z;  4RVG A;  3S16 I;  3LUS A;  2JA7 I;  4MD9 A;  4NBC A;  5C44 I;  2F4M A;  2O53 A;  2Y0S A;  3CXC Y;  1ML8 A;  1QYP A;  5D1P A;  4NBG A;  3S1M I;  1TWA I;  2O4H A;  4E30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...