3S1QI

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with atp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1qI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1qI02
3S15I 2NVQI 2KPIA 2E2II 4A3CI 1RLYA 4NBEA 1ZB8A 1K83I 2DE7A 2JR6A 4XX2A 3M4OI 4A3BI 2JA7I 4NBHA 1TFIA 4A3JI 4A3EI 1X3WA 5C4XI 3FKII 1I3QI 2J6AA 3S1NI 3S2HI 1SFOI 2YU9I 2VUMI 2JNYA 2K5RA 4NB8A 4A3II 3GTOI 3HOYI 1LQLA 3VMIA 1TWCI 4QTUA 4A3KI 5IP9I 2BJOA 2PK7A 4QTTA 4A3MI 3PO3I 4Y52I 3PO3S 1ML8A 1TWAI 3EERA 5FLMI 3HOVI 3I4NI 3HOXI 4NBCA 3M3YI 4X6AI 3S1RI 2R92I 3ESWA 4Y7NI 4BBSI 5C4JI 4MH4A 4A3FI 1N2FA 3U50C 3RZOI 2HF1A 2NVXI 5IP7I 1TWFI 3VMGA 4NBBA 5C3EI 3GTQI 1USPB 1I6HI 3H0GI 3H3VJ 1Y1VI 2DE5A 4NBFA 1Y1VS 2R7ZI 2E2JI 1R9TI 1NUIA 4BY1I 3GTGI 3GTLI 3HOUI 3VB9A 1QYPA 4A93I 3GTKI 1L1OC 2RBLA 2R93I 1Y1WI 2DE6A 1YUAA 2NVYI 3S1QI 3HOWI 2NVTI 2F4MA 1TWGI 4BBRI 3Q87A 2JA8I 3HOZI 1VLAA 3VMHA 1ZB9A 2P3YA 2JA6I 3S1MI 4NBGA 1TWHI 2JS4A 3CQZI 3GTMI 3GCFA 3GTMS 1WW9A 1PFTA 3S2DI 5CM2M 1USPA 3LUSA 2F4OA 3GKQA 3GTJI 4A3LI 1I50I 3D6WA 1RO4A 5C44I 3S16I 4A3DI 4NOZA 4NBAA 3PO2I 3I07A 2E2HI 4NB9A 3GTPI 1DL6A 1X3ZA 2JA5I 2B63I 4A3GI 3S17I 4BXXI 2AKLA 3S14I 4BY7I 1WCMI 4NBDA 3I4MI 3K7AI 3RZDI
chains in the Genus database with same CATH superfamily
3S15I 4E2YA 2KPIA 2ZAEB 4NBEA 1WZNA 2IV2X 1K83I 2DE7A 5D1OB 2Y0SA 4A3BI 2OTJ1 3CXCY 4A3EI 1X3WA 2VPZA 3J80f 1VQ6Z 1RO2A 1W2BY 1I3QI 2J6AA 4DGLA 4E31A 2YU9I 3I55Z 1YJW1 4NB8A 3GTOI 4A3KI 1TWCI 4QTUA 1YHQZ 2VUGA 3CCEZ 2BJOA 4EWCA 2OTL1 1VQ71 3CCLZ 3EERA 2QKDA 4MD9A 4NH1C 4MD7A 1VQ41 2QEXZ 3J81f 1VQ81 1K8A1 1WJ2A 3HOXI 3VTNA 2VPWA 4NBCA 4X6AI 3CC4Z 2QRCB 3S1RI 3T4NB 3ESWA 1FDOA 2GTIA 2LFUA 1YIT1 3VMGA 2H85A 4NBBA 3CPWY 1I6HI 3H0GI 1Y1VI 1Y1VS 2R7ZI 3FQMA 2E2JI 1NUIA 1VQ91 3HOUI 2I3CA 3CCJ1 3GTKI 1K8A2 2RBLA 1KC81 3S1QI 2W04A 5FLXf 4RVDA 1TWGI 3HOZI 1QF8A 5AN9F 1ZB9A 2JA6I 2JS4A 3CQZI 1VQOZ 1VQP1 2QA4Z 1WW9A 4E2ZA 1PFTA 2V8IA 3G71Z 3NDJA 3CC7Z 3OW2Y 1QVFY 2F4OA 3GKQA 1I50I 2VPYA 5A2Qf 2RT9A 2K3RA 4E30A 3PO2I 1KC82 3CCQZ 3HKZA 2HU9A 3CXCZ 4BXXI 2AKLA 3S14I 3CME1 1W2BZ 1NJI2 2LIYA 3K7AI 3IFUA 3RZDI 1YUKA 2OOXB 2OTJZ 4E2WA 3I561 3J7A4 2JR6A 3J81b 3M4OI 2JA7I 1Z02A 2G2KA 3IX0A 2IZ4A 1YJNZ 2PM9A 3MZLB 1Y8CA 2JUBA 3FKII 3S1NI 1K9M1 1YJWZ 1SFOI 4RVGA 2VUMI 2GU2A 1QXFA 4CL1A 2K5RA 1K732 2OTLZ 1VQ7Z 1LQLA 3HOYI 5IP9I 4QTTA 3CCR1 1KQSY 4Y52I 1VQ8Z 1TWAI 1ML8A 3I4NI 3EEDA 3M3YI 3BG0B 4BBSI 4MH4A 3CCU1 4A3FI 2QLVB 5D1OA 1YITZ 2JIPA 4MRIA 3CC21 1RNIA 1M901 2AYDA 1K9M2 1USPB 3CCV1 1YJ91 2V3VA 2QRDB 1VQ9Z 1R9TI 3CCJZ 3F3PC 3GTLI 3VB9A 2QR1B 3G6E1 1VQN1 2JIQA 4HGZA 4A93I 2Q4ZA 1YUAA 5A2Qb 3OW2Z 2NVTI 3F3FC 4BBRI 2JA8I 2P28A 3CD61 1VLAA 3VMHA 1M902 1VQPZ 1KD11 3S1MI 2V8JA 2V45A 2E9HA 3D2LA 1RQFA 1KRLA 3S2DI 3NH4A 5CM2M 2M48A 2Q51A 1S721 1JJ2Y 5C44I 5D1PA 4NBAA 1VQ51 2E2HI 3GTPI 1DL6A 2B63I 4A3GI 2JMOA 3CMEZ 1NJI1 4BY7I 1KD12 1WCMI 3I56Z 2E2II 1QVGY 2OOYB 4RVHA 3NFZA 2RHBA 4HGYA 1Q7Y2 3MONA 3CCS1 1YI21 1NP6A 1TFIA 4DQYB 4A3JI 1KQSZ 3J80b 3NH8A 2EGTA 3S2HI 1K731 2NAPA 2VF1A 3CCRZ 2PMZA 3PO3I 1YIJ1 3PO3S 5FLMI 3HOVI 1AA6A 3IF8A 4RV9A 3CCUZ 2R92I 3FQQA 5C4JI 1VQK1 3U50C 3RZOI 2HF1A 5IP7I 1TWFI 4HH4A 3KIFA 5C3EI 3GTQI 1Q861 5T6BA 4NBFA 5IT9f 1VQO1 1VQNZ 3G6EZ 1VQM1 1VQ4Z 4MXUA 2M6NA 1VQL1 3GTGI 3CPWZ 2QREB 2R93I 1Y1WI 1Q821 2DE6A 2F4MA 5FLXb 3CMA1 1JJ2Z 1M1K1 2P3YA 3BG1B 4NBGA 4MONA 1TWHI 3GTMI 3GCFA 3GTMS 2OZKA 4TNUA 1Q862 1USPA 1S72Z 1SIWA 3LUSA 3TDHB 2E7ZA 4A3LI 3S16I 1X0TA 1VQ5Z 3P5JB 2O4HA 2GTHA 4DK1A 1Q822 1QVGZ 1YJN1 1QVFZ 2LEXA 3CCM1 2JA5I 1RO0A 1Q16A 1M1K2 3G4S1 4NBDA 3JAMf 2NVQI 3CCSZ 1RLYA 4A3CI 2R6MA 1ZB8A 1YI2Z 1Q7Y1 4RS4A 1N8R1 1FDIA 4XX2A 2O53A 3NH5A 4NBHA 2W03A 5C4XI 1VQ61 2WB1A 2JNYA 4A3II 1YIJZ 3VMIA 3I551 3D9XA 4A3MI 2PK7A 5IT9b 1YHQ1 3CCE1 2YADA 2IZ3A 3CCL1 1Z01A 1N8R2 2QEX1 1VQKZ 4Y7NI 4E2XA 3CC41 3NDIA 1Q811 1N2FA 1JWHC 2RIQA 2NVXI 1ZH1A 1S7MA 3H3VJ 2DE5A 2V8KA 1VQMZ 4S1TA 1VQLZ 4MD8A 4BY1I 2JIMA 1QYPA 3MZKB 3TE5B 1L1OC 3IR7A 2VPXA 5T64A 2NVYI 3HOWI 4RVFA 3CC2Z 3CMAZ 2RPRA 3Q87A 1Q812 5LL6f 3CCVZ 1YJ9Z 5T67A 1P9NA 4E32A 2KI7B 2WAQA 3JAMb 2QA41 3G711 3CC71 3GTJI 3D6WA 1RO4A 1WIIA 4AYBA 4A3DI 4NOZA 3CCMZ 3I07A 4E33A 4NB9A 3QWUA 3CD6Z 2JIOA 1X3ZA 3S17I 3CCQ1 3G4SZ 1Z03A 3KIHA 2JIRA 3I4MI 4NFRA
chains in the Genus database with same CATH topology
3S15I 4E2YA 2KPIA 2ZAEB 4NBEA 1K83I 2DE7A 5D1OB 2Y0SA 4A3BI 2OTJ1 3CXCY 4A3EI 1X3WA 3J80f 1VQ6Z 1RO2A 1W2BY 1I3QI 2J6AA 4DGLA 4E31A 2YU9I 3I55Z 1YJW1 4NB8A 3GTOI 4A3KI 1TWCI 4QTUA 1YHQZ 2VUGA 3CCEZ 2BJOA 4EWCA 2OTL1 1VQ71 3CCLZ 3EERA 2QKDA 4MD9A 4NH1C 4MD7A 1VQ41 2QEXZ 3J81f 1VQ81 1K8A1 3HOXI 3VTNA 4NBCA 4X6AI 3CC4Z 2QRCB 3S1RI 3T4NB 3ESWA 2GTIA 2LFUA 1YIT1 3VMGA 2H85A 4NBBA 3CPWY 1I6HI 3H0GI 1Y1VI 1Y1VS 2R7ZI 3FQMA 2E2JI 1NUIA 1VQ91 3HOUI 2I3CA 3CCJ1 3GTKI 1K8A2 2RBLA 1KC81 3S1QI 2W04A 5FLXf 4RVDA 1TWGI 3HOZI 1QF8A 5AN9F 1ZB9A 2JA6I 2JS4A 3CQZI 1VQOZ 1VQP1 2QA4Z 1WW9A 4E2ZA 1PFTA 2V8IA 3G71Z 3NDJA 3CC7Z 3OW2Y 1QVFY 2F4OA 3GKQA 1I50I 5A2Qf 2RT9A 2K3RA 4E30A 3PO2I 1KC82 3CCQZ 3HKZA 2HU9A 3CXCZ 4BXXI 2AKLA 3S14I 3CME1 1W2BZ 1NJI2 2LIYA 3K7AI 3IFUA 3RZDI 1YUKA 2OOXB 2OTJZ 4E2WA 3I561 3J7A4 2JR6A 3J81b 3M4OI 2JA7I 1Z02A 2G2KA 3IX0A 2IZ4A 1YJNZ 2PM9A 3MZLB 2JUBA 3FKII 3S1NI 1K9M1 1YJWZ 1SFOI 4RVGA 2VUMI 2GU2A 4CL1A 2K5RA 1K732 2OTLZ 1VQ7Z 1LQLA 3HOYI 5IP9I 4QTTA 3CCR1 1KQSY 4Y52I 1VQ8Z 1TWAI 1ML8A 3I4NI 3EEDA 3M3YI 3BG0B 4BBSI 4MH4A 3CCU1 4A3FI 2QLVB 5D1OA 1YITZ 3CC21 4MRIA 1RNIA 1M901 1K9M2 1USPB 3CCV1 1YJ91 2QRDB 1VQ9Z 1R9TI 3CCJZ 3F3PC 3GTLI 3VB9A 2QR1B 3G6E1 1VQN1 4HGZA 4A93I 2Q4ZA 1YUAA 5A2Qb 3OW2Z 2NVTI 3F3FC 4BBRI 2JA8I 2P28A 3CD61 1VLAA 3VMHA 1M902 1VQPZ 1KD11 3S1MI 2V8JA 2E9HA 1RQFA 1KRLA 3S2DI 3NH4A 5CM2M 2M48A 2Q51A 1S721 1JJ2Y 5C44I 5D1PA 4NBAA 1VQ51 2E2HI 3GTPI 1DL6A 2B63I 4A3GI 2JMOA 3CMEZ 1NJI1 4BY7I 1KD12 1WCMI 3I56Z 2E2II 1QVGY 2OOYB 4RVHA 3NFZA 2RHBA 4HGYA 1Q7Y2 3MONA 3CCS1 1YI21 1NP6A 1TFIA 4DQYB 4A3JI 1KQSZ 3J80b 3NH8A 2EGTA 3S2HI 1K731 2VF1A 3CCRZ 2PMZA 3PO3I 1YIJ1 3PO3S 5FLMI 3HOVI 3IF8A 4RV9A 3CCUZ 2R92I 3FQQA 5C4JI 1VQK1 3U50C 3RZOI 2HF1A 5IP7I 1TWFI 4HH4A 3KIFA 5C3EI 3GTQI 1Q861 5T6BA 4NBFA 5IT9f 1VQO1 1VQNZ 3G6EZ 1VQM1 1VQ4Z 4MXUA 2M6NA 1VQL1 3GTGI 3CPWZ 2QREB 2R93I 1Y1WI 1Q821 2DE6A 2F4MA 5FLXb 3CMA1 1JJ2Z 1M1K1 2P3YA 3BG1B 4NBGA 4MONA 1TWHI 3GTMI 3GCFA 3GTMS 2OZKA 4TNUA 1Q862 1USPA 1S72Z 3LUSA 3TDHB 4A3LI 3S16I 1X0TA 1VQ5Z 3P5JB 2O4HA 2GTHA 4DK1A 1Q822 1QVGZ 1YJN1 1QVFZ 3CCM1 2JA5I 1RO0A 1M1K2 3G4S1 4NBDA 3JAMf 2NVQI 3CCSZ 1RLYA 4A3CI 2R6MA 1ZB8A 1YI2Z 1Q7Y1 4RS4A 1N8R1 4XX2A 2O53A 3NH5A 4NBHA 2W03A 5C4XI 1VQ61 2WB1A 2JNYA 4A3II 1YIJZ 3VMIA 3I551 3D9XA 4A3MI 2PK7A 5IT9b 1YHQ1 3CCE1 2YADA 2IZ3A 3CCL1 1Z01A 1N8R2 2QEX1 1VQKZ 4Y7NI 4E2XA 3CC41 3NDIA 1Q811 1N2FA 1JWHC 2RIQA 2NVXI 1ZH1A 1S7MA 3H3VJ 2DE5A 2V8KA 1VQMZ 4S1TA 1VQLZ 4MD8A 4BY1I 1QYPA 3MZKB 3TE5B 1L1OC 5T64A 2NVYI 3HOWI 4RVFA 3CC2Z 3CMAZ 2RPRA 3Q87A 1Q812 5LL6f 3CCVZ 1YJ9Z 5T67A 1P9NA 4E32A 2KI7B 2WAQA 3JAMb 2QA41 3G711 3CC71 3GTJI 3D6WA 1RO4A 1WIIA 4AYBA 4A3DI 4NOZA 3CCMZ 3I07A 4E33A 4NB9A 3QWUA 3CD6Z 1X3ZA 3S17I 3CCQ1 3G4SZ 1Z03A 3KIHA 3I4MI 4NFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S15 I;  2NVQ I;  2KPI A;  2E2I I;  4A3C I;  1RLY A;  4NBE A;  1ZB8 A;  1K83 I;  2DE7 A;  2JR6 A;  4XX2 A;  3M4O I;  4A3B I;  2JA7 I;  4NBH A;  1TFI A;  4A3J I;  4A3E I;  1X3W A;  5C4X I;  3FKI I;  1I3Q I;  2J6A A;  3S1N I;  3S2H I;  1SFO I;  2YU9 I;  2VUM I;  2JNY A;  2K5R A;  4NB8 A;  4A3I I;  3GTO I;  3HOY I;  1LQL A;  3VMI A;  1TWC I;  4QTU A;  4A3K I;  5IP9 I;  2BJO A;  2PK7 A;  4QTT A;  4A3M I;  3PO3 I;  4Y52 I;  3PO3 S;  1ML8 A;  1TWA I;  3EER A;  5FLM I;  3HOV I;  3I4N I;  3HOX I;  4NBC A;  3M3Y I;  4X6A I;  3S1R I;  2R92 I;  3ESW A;  4Y7N I;  4BBS I;  5C4J I;  4MH4 A;  4A3F I;  1N2F A;  3U50 C;  3RZO I;  2HF1 A;  2NVX I;  5IP7 I;  1TWF I;  3VMG A;  4NBB A;  5C3E I;  3GTQ I;  1USP B;  1I6H I;  3H0G I;  3H3V J;  1Y1V I;  2DE5 A;  4NBF A;  1Y1V S;  2R7Z I;  2E2J I;  1R9T I;  1NUI A;  4BY1 I;  3GTG I;  3GTL I;  3HOU I;  3VB9 A;  1QYP A;  4A93 I;  3GTK I;  1L1O C;  2RBL A;  2R93 I;  1Y1W I;  2DE6 A;  1YUA A;  2NVY I;  3S1Q I;  3HOW I;  2NVT I;  2F4M A;  1TWG I;  4BBR I;  3Q87 A;  2JA8 I;  3HOZ I;  1VLA A;  3VMH A;  1ZB9 A;  2P3Y A;  2JA6 I;  3S1M I;  4NBG A;  1TWH I;  2JS4 A;  3CQZ I;  3GTM I;  3GCF A;  3GTM S;  1WW9 A;  1PFT A;  3S2D I;  5CM2 M;  1USP A;  3LUS A;  2F4O A;  3GKQ A;  3GTJ I;  4A3L I;  1I50 I;  3D6W A;  1RO4 A;  5C44 I;  3S16 I;  4A3D I;  4NOZ A;  4NBA A;  3PO2 I;  3I07 A;  2E2H I;  4NB9 A;  3GTP I;  1DL6 A;  1X3Z A;  2JA5 I;  2B63 I;  4A3G I;  3S17 I;  4BXX I;  2AKL A;  3S14 I;  4BY7 I;  1WCM I;  4NBD A;  3I4M I;  3K7A I;  3RZD I; 
#chains in the Genus database with same CATH topology
 3S15 I;  4E2Y A;  2KPI A;  2ZAE B;  4NBE A;  1WZN A;  2IV2 X;  1K83 I;  2DE7 A;  5D1O B;  2Y0S A;  4A3B I;  2OTJ 1;  3CXC Y;  4A3E I;  1X3W A;  2VPZ A;  3J80 f;  1VQ6 Z;  1RO2 A;  1W2B Y;  1I3Q I;  2J6A A;  4DGL A;  4E31 A;  2YU9 I;  3I55 Z;  1YJW 1;  4NB8 A;  3GTO I;  4A3K I;  1TWC I;  4QTU A;  1YHQ Z;  2VUG A;  3CCE Z;  2BJO A;  4EWC A;  2OTL 1;  1VQ7 1;  3CCL Z;  3EER A;  2QKD A;  4MD9 A;  4NH1 C;  4MD7 A;  1VQ4 1;  2QEX Z;  3J81 f;  1VQ8 1;  1K8A 1;  1WJ2 A;  3HOX I;  3VTN A;  2VPW A;  4NBC A;  4X6A I;  3CC4 Z;  2QRC B;  3S1R I;  3T4N B;  3ESW A;  1FDO A;  2GTI A;  2LFU A;  1YIT 1;  3VMG A;  2H85 A;  4NBB A;  3CPW Y;  1I6H I;  3H0G I;  1Y1V I;  1Y1V S;  2R7Z I;  3FQM A;  2E2J I;  1NUI A;  1VQ9 1;  3HOU I;  2I3C A;  3CCJ 1;  3GTK I;  1K8A 2;  2RBL A;  1KC8 1;  3S1Q I;  2W04 A;  5FLX f;  4RVD A;  1TWG I;  3HOZ I;  1QF8 A;  5AN9 F;  1ZB9 A;  2JA6 I;  2JS4 A;  3CQZ I;  1VQO Z;  1VQP 1;  2QA4 Z;  1WW9 A;  4E2Z A;  1PFT A;  2V8I A;  3G71 Z;  3NDJ A;  3CC7 Z;  3OW2 Y;  1QVF Y;  2F4O A;  3GKQ A;  1I50 I;  2VPY A;  5A2Q f;  2RT9 A;  2K3R A;  4E30 A;  3PO2 I;  1KC8 2;  3CCQ Z;  3HKZ A;  2HU9 A;  3CXC Z;  4BXX I;  2AKL A;  3S14 I;  3CME 1;  1W2B Z;  1NJI 2;  2LIY A;  3K7A I;  3IFU A;  3RZD I;  1YUK A;  2OOX B;  2OTJ Z;  4E2W A;  3I56 1;  3J7A 4;  2JR6 A;  3J81 b;  3M4O I;  2JA7 I;  1Z02 A;  2G2K A;  3IX0 A;  2IZ4 A;  1YJN Z;  2PM9 A;  3MZL B;  1Y8C A;  2JUB A;  3FKI I;  3S1N I;  1K9M 1;  1YJW Z;  1SFO I;  4RVG A;  2VUM I;  2GU2 A;  1QXF A;  4CL1 A;  2K5R A;  1K73 2;  2OTL Z;  1VQ7 Z;  1LQL A;  3HOY I;  5IP9 I;  4QTT A;  3CCR 1;  1KQS Y;  4Y52 I;  1VQ8 Z;  1TWA I;  1ML8 A;  3I4N I;  3EED A;  3M3Y I;  3BG0 B;  4BBS I;  4MH4 A;  3CCU 1;  4A3F I;  2QLV B;  5D1O A;  1YIT Z;  2JIP A;  4MRI A;  3CC2 1;  1RNI A;  1M90 1;  2AYD A;  1K9M 2;  1USP B;  3CCV 1;  1YJ9 1;  2V3V A;  2QRD B;  1VQ9 Z;  1R9T I;  3CCJ Z;  3F3P C;  3GTL I;  3VB9 A;  2QR1 B;  3G6E 1;  1VQN 1;  2JIQ A;  4HGZ A;  4A93 I;  2Q4Z A;  1YUA A;  5A2Q b;  3OW2 Z;  2NVT I;  3F3F C;  4BBR I;  2JA8 I;  2P28 A;  3CD6 1;  1VLA A;  3VMH A;  1M90 2;  1VQP Z;  1KD1 1;  3S1M I;  2V8J A;  2V45 A;  2E9H A;  3D2L A;  1RQF A;  1KRL A;  3S2D I;  3NH4 A;  5CM2 M;  2M48 A;  2Q51 A;  1S72 1;  1JJ2 Y;  5C44 I;  5D1P A;  4NBA A;  1VQ5 1;  2E2H I;  3GTP I;  1DL6 A;  2B63 I;  4A3G I;  2JMO A;  3CME Z;  1NJI 1;  4BY7 I;  1KD1 2;  1WCM I;  3I56 Z;  2E2I I;  1QVG Y;  2OOY B;  4RVH A;  3NFZ A;  2RHB A;  4HGY A;  1Q7Y 2;  3MON A;  3CCS 1;  1YI2 1;  1NP6 A;  1TFI A;  4DQY B;  4A3J I;  1KQS Z;  3J80 b;  3NH8 A;  2EGT A;  3S2H I;  1K73 1;  2NAP A;  2VF1 A;  3CCR Z;  2PMZ A;  3PO3 I;  1YIJ 1;  3PO3 S;  5FLM I;  3HOV I;  1AA6 A;  3IF8 A;  4RV9 A;  3CCU Z;  2R92 I;  3FQQ A;  5C4J I;  1VQK 1;  3U50 C;  3RZO I;  2HF1 A;  5IP7 I;  1TWF I;  4HH4 A;  3KIF A;  5C3E I;  3GTQ I;  1Q86 1;  5T6B A;  4NBF A;  5IT9 f;  1VQO 1;  1VQN Z;  3G6E Z;  1VQM 1;  1VQ4 Z;  4MXU A;  2M6N A;  1VQL 1;  3GTG I;  3CPW Z;  2QRE B;  2R93 I;  1Y1W I;  1Q82 1;  2DE6 A;  2F4M A;  5FLX b;  3CMA 1;  1JJ2 Z;  1M1K 1;  2P3Y A;  3BG1 B;  4NBG A;  4MON A;  1TWH I;  3GTM I;  3GCF A;  3GTM S;  2OZK A;  4TNU A;  1Q86 2;  1USP A;  1S72 Z;  1SIW A;  3LUS A;  3TDH B;  2E7Z A;  4A3L I;  3S16 I;  1X0T A;  1VQ5 Z;  3P5J B;  2O4H A;  2GTH A;  4DK1 A;  1Q82 2;  1QVG Z;  1YJN 1;  1QVF Z;  2LEX A;  3CCM 1;  2JA5 I;  1RO0 A;  1Q16 A;  1M1K 2;  3G4S 1;  4NBD A;  3JAM f;  2NVQ I;  3CCS Z;  1RLY A;  4A3C I;  2R6M A;  1ZB8 A;  1YI2 Z;  1Q7Y 1;  4RS4 A;  1N8R 1;  1FDI A;  4XX2 A;  2O53 A;  3NH5 A;  4NBH A;  2W03 A;  5C4X I;  1VQ6 1;  2WB1 A;  2JNY A;  4A3I I;  1YIJ Z;  3VMI A;  3I55 1;  3D9X A;  4A3M I;  2PK7 A;  5IT9 b;  1YHQ 1;  3CCE 1;  2YAD A;  2IZ3 A;  3CCL 1;  1Z01 A;  1N8R 2;  2QEX 1;  1VQK Z;  4Y7N I;  4E2X A;  3CC4 1;  3NDI A;  1Q81 1;  1N2F A;  1JWH C;  2RIQ A;  2NVX I;  1ZH1 A;  1S7M A;  3H3V J;  2DE5 A;  2V8K A;  1VQM Z;  4S1T A;  1VQL Z;  4MD8 A;  4BY1 I;  2JIM A;  1QYP A;  3MZK B;  3TE5 B;  1L1O C;  3IR7 A;  2VPX A;  5T64 A;  2NVY I;  3HOW I;  4RVF A;  3CC2 Z;  3CMA Z;  2RPR A;  3Q87 A;  1Q81 2;  5LL6 f;  3CCV Z;  1YJ9 Z;  5T67 A;  1P9N A;  4E32 A;  2KI7 B;  2WAQ A;  3JAM b;  2QA4 1;  3G71 1;  3CC7 1;  3GTJ I;  3D6W A;  1RO4 A;  1WII A;  4AYB A;  4A3D I;  4NOZ A;  3CCM Z;  3I07 A;  4E33 A;  4NB9 A;  3QWU A;  3CD6 Z;  2JIO A;  1X3Z A;  3S17 I;  3CCQ 1;  3G4S Z;  1Z03 A;  3KIH A;  2JIR A;  3I4M I;  4NFR A; 
#chains in the Genus database with same CATH homology
 3S15 I;  4E2Y A;  2KPI A;  2ZAE B;  4NBE A;  1K83 I;  2DE7 A;  5D1O B;  2Y0S A;  4A3B I;  2OTJ 1;  3CXC Y;  4A3E I;  1X3W A;  3J80 f;  1VQ6 Z;  1RO2 A;  1W2B Y;  1I3Q I;  2J6A A;  4DGL A;  4E31 A;  2YU9 I;  3I55 Z;  1YJW 1;  4NB8 A;  3GTO I;  4A3K I;  1TWC I;  4QTU A;  1YHQ Z;  2VUG A;  3CCE Z;  2BJO A;  4EWC A;  2OTL 1;  1VQ7 1;  3CCL Z;  3EER A;  2QKD A;  4MD9 A;  4NH1 C;  4MD7 A;  1VQ4 1;  2QEX Z;  3J81 f;  1VQ8 1;  1K8A 1;  3HOX I;  3VTN A;  4NBC A;  4X6A I;  3CC4 Z;  2QRC B;  3S1R I;  3T4N B;  3ESW A;  2GTI A;  2LFU A;  1YIT 1;  3VMG A;  2H85 A;  4NBB A;  3CPW Y;  1I6H I;  3H0G I;  1Y1V I;  1Y1V S;  2R7Z I;  3FQM A;  2E2J I;  1NUI A;  1VQ9 1;  3HOU I;  2I3C A;  3CCJ 1;  3GTK I;  1K8A 2;  2RBL A;  1KC8 1;  3S1Q I;  2W04 A;  5FLX f;  4RVD A;  1TWG I;  3HOZ I;  1QF8 A;  5AN9 F;  1ZB9 A;  2JA6 I;  2JS4 A;  3CQZ I;  1VQO Z;  1VQP 1;  2QA4 Z;  1WW9 A;  4E2Z A;  1PFT A;  2V8I A;  3G71 Z;  3NDJ A;  3CC7 Z;  3OW2 Y;  1QVF Y;  2F4O A;  3GKQ A;  1I50 I;  5A2Q f;  2RT9 A;  2K3R A;  4E30 A;  3PO2 I;  1KC8 2;  3CCQ Z;  3HKZ A;  2HU9 A;  3CXC Z;  4BXX I;  2AKL A;  3S14 I;  3CME 1;  1W2B Z;  1NJI 2;  2LIY A;  3K7A I;  3IFU A;  3RZD I;  1YUK A;  2OOX B;  2OTJ Z;  4E2W A;  3I56 1;  3J7A 4;  2JR6 A;  3J81 b;  3M4O I;  2JA7 I;  1Z02 A;  2G2K A;  3IX0 A;  2IZ4 A;  1YJN Z;  2PM9 A;  3MZL B;  2JUB A;  3FKI I;  3S1N I;  1K9M 1;  1YJW Z;  1SFO I;  4RVG A;  2VUM I;  2GU2 A;  4CL1 A;  2K5R A;  1K73 2;  2OTL Z;  1VQ7 Z;  1LQL A;  3HOY I;  5IP9 I;  4QTT A;  3CCR 1;  1KQS Y;  4Y52 I;  1VQ8 Z;  1TWA I;  1ML8 A;  3I4N I;  3EED A;  3M3Y I;  3BG0 B;  4BBS I;  4MH4 A;  3CCU 1;  4A3F I;  2QLV B;  5D1O A;  1YIT Z;  3CC2 1;  4MRI A;  1RNI A;  1M90 1;  1K9M 2;  1USP B;  3CCV 1;  1YJ9 1;  2QRD B;  1VQ9 Z;  1R9T I;  3CCJ Z;  3F3P C;  3GTL I;  3VB9 A;  2QR1 B;  3G6E 1;  1VQN 1;  4HGZ A;  4A93 I;  2Q4Z A;  1YUA A;  5A2Q b;  3OW2 Z;  2NVT I;  3F3F C;  4BBR I;  2JA8 I;  2P28 A;  3CD6 1;  1VLA A;  3VMH A;  1M90 2;  1VQP Z;  1KD1 1;  3S1M I;  2V8J A;  2E9H A;  1RQF A;  1KRL A;  3S2D I;  3NH4 A;  5CM2 M;  2M48 A;  2Q51 A;  1S72 1;  1JJ2 Y;  5C44 I;  5D1P A;  4NBA A;  1VQ5 1;  2E2H I;  3GTP I;  1DL6 A;  2B63 I;  4A3G I;  2JMO A;  3CME Z;  1NJI 1;  4BY7 I;  1KD1 2;  1WCM I;  3I56 Z;  2E2I I;  1QVG Y;  2OOY B;  4RVH A;  3NFZ A;  2RHB A;  4HGY A;  1Q7Y 2;  3MON A;  3CCS 1;  1YI2 1;  1NP6 A;  1TFI A;  4DQY B;  4A3J I;  1KQS Z;  3J80 b;  3NH8 A;  2EGT A;  3S2H I;  1K73 1;  2VF1 A;  3CCR Z;  2PMZ A;  3PO3 I;  1YIJ 1;  3PO3 S;  5FLM I;  3HOV I;  3IF8 A;  4RV9 A;  3CCU Z;  2R92 I;  3FQQ A;  5C4J I;  1VQK 1;  3U50 C;  3RZO I;  2HF1 A;  5IP7 I;  1TWF I;  4HH4 A;  3KIF A;  5C3E I;  3GTQ I;  1Q86 1;  5T6B A;  4NBF A;  5IT9 f;  1VQO 1;  1VQN Z;  3G6E Z;  1VQM 1;  1VQ4 Z;  4MXU A;  2M6N A;  1VQL 1;  3GTG I;  3CPW Z;  2QRE B;  2R93 I;  1Y1W I;  1Q82 1;  2DE6 A;  2F4M A;  5FLX b;  3CMA 1;  1JJ2 Z;  1M1K 1;  2P3Y A;  3BG1 B;  4NBG A;  4MON A;  1TWH I;  3GTM I;  3GCF A;  3GTM S;  2OZK A;  4TNU A;  1Q86 2;  1USP A;  1S72 Z;  3LUS A;  3TDH B;  4A3L I;  3S16 I;  1X0T A;  1VQ5 Z;  3P5J B;  2O4H A;  2GTH A;  4DK1 A;  1Q82 2;  1QVG Z;  1YJN 1;  1QVF Z;  3CCM 1;  2JA5 I;  1RO0 A;  1M1K 2;  3G4S 1;  4NBD A;  3JAM f;  2NVQ I;  3CCS Z;  1RLY A;  4A3C I;  2R6M A;  1ZB8 A;  1YI2 Z;  1Q7Y 1;  4RS4 A;  1N8R 1;  4XX2 A;  2O53 A;  3NH5 A;  4NBH A;  2W03 A;  5C4X I;  1VQ6 1;  2WB1 A;  2JNY A;  4A3I I;  1YIJ Z;  3VMI A;  3I55 1;  3D9X A;  4A3M I;  2PK7 A;  5IT9 b;  1YHQ 1;  3CCE 1;  2YAD A;  2IZ3 A;  3CCL 1;  1Z01 A;  1N8R 2;  2QEX 1;  1VQK Z;  4Y7N I;  4E2X A;  3CC4 1;  3NDI A;  1Q81 1;  1N2F A;  1JWH C;  2RIQ A;  2NVX I;  1ZH1 A;  1S7M A;  3H3V J;  2DE5 A;  2V8K A;  1VQM Z;  4S1T A;  1VQL Z;  4MD8 A;  4BY1 I;  1QYP A;  3MZK B;  3TE5 B;  1L1O C;  5T64 A;  2NVY I;  3HOW I;  4RVF A;  3CC2 Z;  3CMA Z;  2RPR A;  3Q87 A;  1Q81 2;  5LL6 f;  3CCV Z;  1YJ9 Z;  5T67 A;  1P9N A;  4E32 A;  2KI7 B;  2WAQ A;  3JAM b;  2QA4 1;  3G71 1;  3CC7 1;  3GTJ I;  3D6W A;  1RO4 A;  1WII A;  4AYB A;  4A3D I;  4NOZ A;  3CCM Z;  3I07 A;  4E33 A;  4NB9 A;  3QWU A;  3CD6 Z;  1X3Z A;  3S17 I;  3CCQ 1;  3G4S Z;  1Z03 A;  3KIH A;  3I4M I;  4NFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...