3S1QI

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with atp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1qI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1qI02
2NVTI 3S16I 3S2HI 2DE6A 4NBFA 2JA5I 5C44I 4NBEA 3VB9A 1RO4A 4NBAA 4BY1I 2AKLA 3S17I 3HOYI 3VMHA 1WCMI 1ZB8A 5CM2M 3PO2I 3M3YI 4NBDA 2E2II 4A3GI 4Y7NI 2DE7A 3RZDI 3GCFA 2F4OA 2JA6I 1I50I 4A3DI 4BXXI 3H3VJ 2PK7A 2JA7I 1LQLA 4NBHA 3GTQI 3GTKI 3I4MI 1USPB 2F4MA 3EERA 3M4OI 3ESWA 4XX2A 3S14I 1TFIA 2DE5A 4A3EI 3RZOI 1WW9A 3HOZI 1K83I 5IP7I 3Q87A 1TWCI 5FLMI 3HOVI 4A3II 4A3JI 3GTJI 3I4NI 4QTUA 2BJOA 3GKQA 4NOZA 3S1NI 1TWHI 1ML8A 4A93I 4BBRI 4BBSI 4MH4A 3K7AI 4NBBA 5C4XI 3I07A 2E2HI 1X3WA 4NB9A 2YU9I 2R92I 4A3CI 1DL6A 1R9TI 3PO3I 4BY7I 3S1RI 3S1QI 2B63I 1Y1VI 1TWGI 4A3KI 1TWAI 1NUIA 1N2FA 1RLYA 3H0GI 1L1OC 4A3BI 1ZB9A 2NVYI 3LUSA 2JS4A 3VMIA 3S15I 3GTGI 1I6HI 1PFTA 2P3YA 3GTPI 3S2DI 2JNYA 3FKII 3U50C 1YUAA 2VUMI 4NB8A 4A3MI 3HOXI 3VMGA 2R7ZI 1Y1VS 1TWFI 4NBGA 1Y1WI 3GTLI 4A3FI 4X6AI 2J6AA 2E2JI 3PO3S 2KPIA 3GTOI 3S1MI 5C4JI 2NVQI 3GTMS 4Y52I 2RBLA 2R93I 3HOWI 2JA8I 1X3ZA 2NVXI 4A3LI 1QYPA 3D6WA 4QTTA 2JR6A 2K5RA 1SFOI 3HOUI 3GTMI 1USPA 5C3EI 1I3QI 2HF1A 1VLAA 3CQZI 5IP9I 4NBCA
chains in the Genus database with same CATH superfamily
3S2HI 1S72Z 4NBFA 4E2ZA 3G71Z 3NH4A 1YITZ 2JA5I 4E2WA 5IT9b 3CCJZ 3FQQA 4NBAA 3CC41 1WJ2A 2AKLA 3S17I 3VMHA 1WCMI 4MRIA 5A2Qf 2JMOA 3IF8A 4AYBA 1QVGZ 1VQM1 4A3DI 4BXXI 2OZKA 3MONA 3GTKI 3ESWA 3S14I 1QVGY 2DE5A 1VQO1 3I551 1K731 3HOVI 4DGLA 4A3II 3CCL1 3F3FC 3I4NI 5T64A 2R6MA 4NOZA 2O4HA 1TWHI 1ML8A 1K732 3J81b 3CCE1 1VQ7Z 5C4XI 3I07A 3CXCZ 2YU9I 1RO0A 2PMZA 1VQMZ 1NJI1 3CC2Z 2JIQA 4EWCA 1TWAI 1NUIA 5FLXb 1VQ4Z 1RLYA 2JIOA 1VQ6Z 1VQK1 2NVYI 1Y8CA 2OTJ1 3I55Z 2VPWA 2P3YA 2OOXB 2JNYA 5T67A 4A3MI 3VMGA 1Y1VS 4X6AI 5D1PA 3CCUZ 2W03A 1VQ71 2KPIA 3TE5B 3IX0A 3CME1 1YHQ1 3CC21 2QA41 1YJ9Z 4MD9A 2JA8I 2NVXI 4A3LI 3G6EZ 2JR6A 3BG1B 3HOUI 1VQ61 2OTLZ 1VQ5Z 2QR1B 4CL1A 3GTMI 1NP6A 5T6BA 2NVTI 3S16I 2OTJZ 3CXCY 2LFUA 5C44I 4NBEA 4E33A 1Q822 1KC81 3CCQ1 1M1K2 2QRCB 1VQ8Z 1VQN1 2PM9A 1ZB8A 5CM2M 3J7A4 4MD8A 1KC82 3GCFA 2JA6I 1I50I 1ZH1A 2EGTA 3H3VJ 5A2Qb 4DQYB 4S1TA 2V8KA 1YIJ1 3M4OI 3NDJA 3JAMf 3CC4Z 4TNUA 4XX2A 1TFIA 4A3EI 3CCM1 1YJNZ 3RZOI 2OOYB 1Q811 3HOZI 1K9M1 1K83I 4RVDA 4A3JI 1KD12 3GTJI 5D1OB 2WAQA 1N8R1 2V8JA 1Q812 1K9M2 4A93I 4BBSI 1Z03A 4MH4A 3K7AI 4RVGA 1KD11 2E2HI 4NB9A 2R92I 4A3CI 3PO3I 2IZ4A 1S7MA 3S1RI 1VQOZ 2B63I 1Y1VI 3CCR1 4RVHA 1YIJZ 2GU2A 2YADA 2LEXA 1KRLA 1L1OC 2JS4A 1VQL1 1VQP1 1RNIA 2JIRA 1JJ2Y 3GTPI 3J80f 1TWFI 4NBGA 3GTLI 4A3FI 2J6AA 2E2JI 2QRDB 1QVFY 3S1MI 3CPWZ 1VQKZ 4Y52I 2RBLA 2JIPA 3CCRZ 3NH8A 3KIFA 3D6WA 1FDIA 1KQSZ 3BG0B 1JWHC 2VF1A 1I3QI 2HF1A 4NFRA 4NBCA 3CCU1 3VB9A 4BY1I 3CMEZ 1VQ91 1RO2A 1YJ91 2E9HA 2M48A 3P5JB 3CPWY 2VPXA 3M3YI 3G6E1 4NBDA 1YI21 4Y7NI 2DE7A 3RZDI 3J81f 1VQ51 4E32A 2AYDA 1KQSY 1Q7Y1 3GTQI 3I4MI 1AA6A 2GTHA 3IR7A 1K8A1 3I561 1VQ81 5IT9f 1Q7Y2 2JUBA 1Z02A 2QLVB 5IP7I 4MONA 5FLMI 3CCS1 2Q51A 1K8A2 3MZLB 2BJOA 4MXUA 1NJI2 1WIIA 3S1NI 1YI2Z 1X0TA 3CD6Z 3FQMA 1DL6A 1M901 1R9TI 1SIWA 3D2LA 3G4S1 1TWGI 3CCMZ 1YJN1 2H85A 4A3KI 2ZAEB 1N2FA 1M902 2Y0SA 3NH5A 3H0GI 1ZB9A 4MD7A 2GTIA 3I56Z 3VMIA 3IFUA 1I6HI 3S2DI 2RIQA 3FKII 5D1OA 4NB8A 3HOXI 1S721 1Y1WI 3CD61 3G711 3PO3S 2V45A 3CCJ1 1YJW1 4HGYA 3D9XA 2NVQI 3EEDA 3CCV1 5AN9F 3HOWI 2QREB 1VQLZ 1QYPA 1VQPZ 3HKZA 1SFOI 3T4NB 3NFZA 1Z01A 4E2XA 3TDHB 1VLAA 1QF8A 3GTOI 3QWUA 3KIHA 2DE6A 3VTNA 4RVFA 2G2KA 2RPRA 2RT9A 1RO4A 2VUGA 3HOYI 3NDIA 2QEX1 2KI7B 3PO2I 1Q821 2E2II 4A3GI 1YJWZ 3CCLZ 1Q862 4NH1C 2F4OA 1M1K1 3CCVZ 2Q4ZA 1JJ2Z 2V3VA 2M6NA 3F3PC 2PK7A 2JA7I 1LQLA 3MZKB 4NBHA 3OW2Y 3CCEZ 2IZ3A 1USPB 2WB1A 1Q861 2F4MA 3EERA 1VQ9Z 4RV9A 2VPZA 4RS4A 1WZNA 2HU9A 1N8R2 1YUKA 3Q87A 1TWCI 1VQ41 2O53A 2LIYA 4QTUA 5LL6f 3GKQA 4E2YA 2QEXZ 2V8IA 2P28A 3J80b 4BBRI 1FDOA 4NBBA 1X3WA 5FLXf 1Q16A 3CC71 1QVFZ 2W04A 4BY7I 3S1QI 4DK1A 2RHBA 3CMA1 3JAMb 4HH4A 3CCSZ 2K3RA 1YHQZ 4A3BI 2QA4Z 4HGZA 3G4SZ 3LUSA 3S15I 3GTGI 1YIT1 2OTL1 1RQFA 1PFTA 4E30A 2VPYA 3U50C 1YUAA 2VUMI 2R7ZI 1QXFA 4E31A 2E7ZA 3CCQZ 1W2BZ 5C4JI 3CC7Z 2I3CA 3GTMS 2R93I 2IV2X 1VQNZ 3OW2Z 1X3ZA 2NAPA 3CMAZ 1P9NA 4QTTA 2K5RA 1W2BY 2JIMA 2QKDA 1USPA 5C3EI 3CQZI 5IP9I 1WW9A
chains in the Genus database with same CATH topology
3S2HI 1S72Z 4NBFA 4E2ZA 3G71Z 3NH4A 1YITZ 2JA5I 4E2WA 5IT9b 3CCJZ 3FQQA 4NBAA 3CC41 2AKLA 3S17I 3VMHA 1WCMI 4MRIA 5A2Qf 2JMOA 3IF8A 4AYBA 1QVGZ 1VQM1 4A3DI 4BXXI 2OZKA 3MONA 3GTKI 3ESWA 3S14I 1QVGY 2DE5A 1VQO1 3I551 1K731 3HOVI 4DGLA 4A3II 3CCL1 3F3FC 3I4NI 5T64A 2R6MA 4NOZA 2O4HA 1TWHI 1ML8A 1K732 3J81b 3CCE1 1VQ7Z 5C4XI 3I07A 3CXCZ 2YU9I 1RO0A 2PMZA 1VQMZ 1NJI1 3CC2Z 4EWCA 1TWAI 1NUIA 5FLXb 1VQ4Z 1RLYA 1VQ6Z 1VQK1 2NVYI 2OTJ1 3I55Z 2P3YA 2OOXB 2JNYA 5T67A 4A3MI 3VMGA 1Y1VS 4X6AI 5D1PA 3CCUZ 2W03A 1VQ71 2KPIA 3TE5B 3IX0A 3CME1 1YHQ1 3CC21 2QA41 1YJ9Z 4MD9A 2JA8I 2NVXI 4A3LI 3G6EZ 2JR6A 3BG1B 3HOUI 1VQ61 2OTLZ 1VQ5Z 2QR1B 4CL1A 3GTMI 1NP6A 5T6BA 2NVTI 3S16I 2OTJZ 3CXCY 2LFUA 5C44I 4NBEA 4E33A 1Q822 1KC81 3CCQ1 1M1K2 2QRCB 1VQ8Z 1VQN1 2PM9A 1ZB8A 5CM2M 3J7A4 4MD8A 1KC82 3GCFA 2JA6I 1I50I 1ZH1A 2EGTA 3H3VJ 5A2Qb 4DQYB 4S1TA 2V8KA 1YIJ1 3M4OI 3NDJA 3JAMf 3CC4Z 4TNUA 4XX2A 1TFIA 4A3EI 3CCM1 1YJNZ 3RZOI 2OOYB 1Q811 3HOZI 1K9M1 1K83I 4RVDA 4A3JI 1KD12 3GTJI 5D1OB 2WAQA 1N8R1 2V8JA 1Q812 1K9M2 4A93I 4BBSI 1Z03A 4MH4A 3K7AI 4RVGA 1KD11 2E2HI 4NB9A 2R92I 4A3CI 3PO3I 2IZ4A 1S7MA 3S1RI 1VQOZ 2B63I 1Y1VI 3CCR1 4RVHA 1YIJZ 2GU2A 2YADA 1KRLA 1L1OC 2JS4A 1VQL1 1VQP1 1RNIA 1JJ2Y 3GTPI 3J80f 1TWFI 4NBGA 3GTLI 4A3FI 2J6AA 2E2JI 2QRDB 1QVFY 3S1MI 3CPWZ 1VQKZ 4Y52I 2RBLA 3CCRZ 3NH8A 3KIFA 3D6WA 1KQSZ 3BG0B 1JWHC 2VF1A 1I3QI 2HF1A 4NFRA 4NBCA 3CCU1 3VB9A 4BY1I 3CMEZ 1VQ91 1RO2A 1YJ91 2E9HA 2M48A 3P5JB 3CPWY 3M3YI 3G6E1 4NBDA 1YI21 4Y7NI 2DE7A 3RZDI 3J81f 1VQ51 4E32A 1KQSY 1Q7Y1 3GTQI 3I4MI 2GTHA 1K8A1 3I561 1VQ81 5IT9f 1Q7Y2 2JUBA 1Z02A 2QLVB 5IP7I 4MONA 5FLMI 3CCS1 2Q51A 1K8A2 3MZLB 2BJOA 4MXUA 1NJI2 1WIIA 3S1NI 1YI2Z 1X0TA 3CD6Z 3FQMA 1DL6A 1M901 1R9TI 3G4S1 1TWGI 3CCMZ 1YJN1 2H85A 4A3KI 2ZAEB 1N2FA 1M902 2Y0SA 3NH5A 3H0GI 1ZB9A 4MD7A 2GTIA 3I56Z 3VMIA 3IFUA 1I6HI 3S2DI 2RIQA 3FKII 5D1OA 4NB8A 3HOXI 1S721 1Y1WI 3CD61 3G711 3PO3S 3CCJ1 1YJW1 4HGYA 3D9XA 2NVQI 3EEDA 3CCV1 5AN9F 3HOWI 2QREB 1VQLZ 1QYPA 1VQPZ 3HKZA 1SFOI 3T4NB 3NFZA 1Z01A 4E2XA 3TDHB 1VLAA 1QF8A 3GTOI 3QWUA 3KIHA 2DE6A 3VTNA 4RVFA 2G2KA 2RPRA 2RT9A 1RO4A 2VUGA 3HOYI 3NDIA 2QEX1 2KI7B 3PO2I 1Q821 2E2II 4A3GI 1YJWZ 3CCLZ 1Q862 4NH1C 2F4OA 1M1K1 3CCVZ 2Q4ZA 1JJ2Z 2M6NA 3F3PC 2PK7A 2JA7I 1LQLA 3MZKB 4NBHA 3OW2Y 1Q861 2IZ3A 1USPB 2WB1A 3CCEZ 2F4MA 3EERA 1VQ9Z 4RV9A 4RS4A 2HU9A 1N8R2 1YUKA 3Q87A 1TWCI 1VQ41 2O53A 2LIYA 4QTUA 5LL6f 3GKQA 4E2YA 2QEXZ 2V8IA 2P28A 3J80b 4BBRI 4NBBA 1X3WA 5FLXf 3CC71 1QVFZ 2W04A 4BY7I 3S1QI 4DK1A 2RHBA 3CMA1 3JAMb 4HH4A 3CCSZ 2K3RA 1YHQZ 4A3BI 2QA4Z 4HGZA 3G4SZ 3LUSA 3S15I 3GTGI 1YIT1 2OTL1 1RQFA 1PFTA 4E30A 3U50C 1YUAA 2VUMI 2R7ZI 4E31A 3CCQZ 1W2BZ 5C4JI 3CC7Z 2I3CA 3GTMS 2R93I 1VQNZ 3OW2Z 1X3ZA 3CMAZ 1P9NA 4QTTA 2K5RA 1W2BY 2QKDA 1USPA 5C3EI 3CQZI 5IP9I 1WW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVT I;  3S16 I;  3S2H I;  2DE6 A;  4NBF A;  2JA5 I;  5C44 I;  4NBE A;  3VB9 A;  1RO4 A;  4NBA A;  4BY1 I;  2AKL A;  3S17 I;  3HOY I;  3VMH A;  1WCM I;  1ZB8 A;  5CM2 M;  3PO2 I;  3M3Y I;  4NBD A;  2E2I I;  4A3G I;  4Y7N I;  2DE7 A;  3RZD I;  3GCF A;  2F4O A;  2JA6 I;  1I50 I;  4A3D I;  4BXX I;  3H3V J;  2PK7 A;  2JA7 I;  1LQL A;  4NBH A;  3GTQ I;  3GTK I;  3I4M I;  1USP B;  2F4M A;  3EER A;  3M4O I;  3ESW A;  4XX2 A;  3S14 I;  1TFI A;  2DE5 A;  4A3E I;  3RZO I;  1WW9 A;  3HOZ I;  1K83 I;  5IP7 I;  3Q87 A;  1TWC I;  5FLM I;  3HOV I;  4A3I I;  4A3J I;  3GTJ I;  3I4N I;  4QTU A;  2BJO A;  3GKQ A;  4NOZ A;  3S1N I;  1TWH I;  1ML8 A;  4A93 I;  4BBR I;  4BBS I;  4MH4 A;  3K7A I;  4NBB A;  5C4X I;  3I07 A;  2E2H I;  1X3W A;  4NB9 A;  2YU9 I;  2R92 I;  4A3C I;  1DL6 A;  1R9T I;  3PO3 I;  4BY7 I;  3S1R I;  3S1Q I;  2B63 I;  1Y1V I;  1TWG I;  4A3K I;  1TWA I;  1NUI A;  1N2F A;  1RLY A;  3H0G I;  1L1O C;  4A3B I;  1ZB9 A;  2NVY I;  3LUS A;  2JS4 A;  3VMI A;  3S15 I;  3GTG I;  1I6H I;  1PFT A;  2P3Y A;  3GTP I;  3S2D I;  2JNY A;  3FKI I;  3U50 C;  1YUA A;  2VUM I;  4NB8 A;  4A3M I;  3HOX I;  3VMG A;  2R7Z I;  1Y1V S;  1TWF I;  4NBG A;  1Y1W I;  3GTL I;  4A3F I;  4X6A I;  2J6A A;  2E2J I;  3PO3 S;  2KPI A;  3GTO I;  3S1M I;  5C4J I;  2NVQ I;  3GTM S;  4Y52 I;  2RBL A;  2R93 I;  3HOW I;  2JA8 I;  1X3Z A;  2NVX I;  4A3L I;  1QYP A;  3D6W A;  4QTT A;  2JR6 A;  2K5R A;  1SFO I;  3HOU I;  3GTM I;  1USP A;  5C3E I;  1I3Q I;  2HF1 A;  1VLA A;  3CQZ I;  5IP9 I;  4NBC A; 
#chains in the Genus database with same CATH topology
 3S2H I;  1S72 Z;  4NBF A;  4E2Z A;  3G71 Z;  3NH4 A;  1YIT Z;  2JA5 I;  4E2W A;  5IT9 b;  3CCJ Z;  3FQQ A;  4NBA A;  3CC4 1;  1WJ2 A;  2AKL A;  3S17 I;  3VMH A;  1WCM I;  4MRI A;  5A2Q f;  2JMO A;  3IF8 A;  4AYB A;  1QVG Z;  1VQM 1;  4A3D I;  4BXX I;  2OZK A;  3MON A;  3GTK I;  3ESW A;  3S14 I;  1QVG Y;  2DE5 A;  1VQO 1;  3I55 1;  1K73 1;  3HOV I;  4DGL A;  4A3I I;  3CCL 1;  3F3F C;  3I4N I;  5T64 A;  2R6M A;  4NOZ A;  2O4H A;  1TWH I;  1ML8 A;  1K73 2;  3J81 b;  3CCE 1;  1VQ7 Z;  5C4X I;  3I07 A;  3CXC Z;  2YU9 I;  1RO0 A;  2PMZ A;  1VQM Z;  1NJI 1;  3CC2 Z;  2JIQ A;  4EWC A;  1TWA I;  1NUI A;  5FLX b;  1VQ4 Z;  1RLY A;  2JIO A;  1VQ6 Z;  1VQK 1;  2NVY I;  1Y8C A;  2OTJ 1;  3I55 Z;  2VPW A;  2P3Y A;  2OOX B;  2JNY A;  5T67 A;  4A3M I;  3VMG A;  1Y1V S;  4X6A I;  5D1P A;  3CCU Z;  2W03 A;  1VQ7 1;  2KPI A;  3TE5 B;  3IX0 A;  3CME 1;  1YHQ 1;  3CC2 1;  2QA4 1;  1YJ9 Z;  4MD9 A;  2JA8 I;  2NVX I;  4A3L I;  3G6E Z;  2JR6 A;  3BG1 B;  3HOU I;  1VQ6 1;  2OTL Z;  1VQ5 Z;  2QR1 B;  4CL1 A;  3GTM I;  1NP6 A;  5T6B A;  2NVT I;  3S16 I;  2OTJ Z;  3CXC Y;  2LFU A;  5C44 I;  4NBE A;  4E33 A;  1Q82 2;  1KC8 1;  3CCQ 1;  1M1K 2;  2QRC B;  1VQ8 Z;  1VQN 1;  2PM9 A;  1ZB8 A;  5CM2 M;  3J7A 4;  4MD8 A;  1KC8 2;  3GCF A;  2JA6 I;  1I50 I;  1ZH1 A;  2EGT A;  3H3V J;  5A2Q b;  4DQY B;  4S1T A;  2V8K A;  1YIJ 1;  3M4O I;  3NDJ A;  3JAM f;  3CC4 Z;  4TNU A;  4XX2 A;  1TFI A;  4A3E I;  3CCM 1;  1YJN Z;  3RZO I;  2OOY B;  1Q81 1;  3HOZ I;  1K9M 1;  1K83 I;  4RVD A;  4A3J I;  1KD1 2;  3GTJ I;  5D1O B;  2WAQ A;  1N8R 1;  2V8J A;  1Q81 2;  1K9M 2;  4A93 I;  4BBS I;  1Z03 A;  4MH4 A;  3K7A I;  4RVG A;  1KD1 1;  2E2H I;  4NB9 A;  2R92 I;  4A3C I;  3PO3 I;  2IZ4 A;  1S7M A;  3S1R I;  1VQO Z;  2B63 I;  1Y1V I;  3CCR 1;  4RVH A;  1YIJ Z;  2GU2 A;  2YAD A;  2LEX A;  1KRL A;  1L1O C;  2JS4 A;  1VQL 1;  1VQP 1;  1RNI A;  2JIR A;  1JJ2 Y;  3GTP I;  3J80 f;  1TWF I;  4NBG A;  3GTL I;  4A3F I;  2J6A A;  2E2J I;  2QRD B;  1QVF Y;  3S1M I;  3CPW Z;  1VQK Z;  4Y52 I;  2RBL A;  2JIP A;  3CCR Z;  3NH8 A;  3KIF A;  3D6W A;  1FDI A;  1KQS Z;  3BG0 B;  1JWH C;  2VF1 A;  1I3Q I;  2HF1 A;  4NFR A;  4NBC A;  3CCU 1;  3VB9 A;  4BY1 I;  3CME Z;  1VQ9 1;  1RO2 A;  1YJ9 1;  2E9H A;  2M48 A;  3P5J B;  3CPW Y;  2VPX A;  3M3Y I;  3G6E 1;  4NBD A;  1YI2 1;  4Y7N I;  2DE7 A;  3RZD I;  3J81 f;  1VQ5 1;  4E32 A;  2AYD A;  1KQS Y;  1Q7Y 1;  3GTQ I;  3I4M I;  1AA6 A;  2GTH A;  3IR7 A;  1K8A 1;  3I56 1;  1VQ8 1;  5IT9 f;  1Q7Y 2;  2JUB A;  1Z02 A;  2QLV B;  5IP7 I;  4MON A;  5FLM I;  3CCS 1;  2Q51 A;  1K8A 2;  3MZL B;  2BJO A;  4MXU A;  1NJI 2;  1WII A;  3S1N I;  1YI2 Z;  1X0T A;  3CD6 Z;  3FQM A;  1DL6 A;  1M90 1;  1R9T I;  1SIW A;  3D2L A;  3G4S 1;  1TWG I;  3CCM Z;  1YJN 1;  2H85 A;  4A3K I;  2ZAE B;  1N2F A;  1M90 2;  2Y0S A;  3NH5 A;  3H0G I;  1ZB9 A;  4MD7 A;  2GTI A;  3I56 Z;  3VMI A;  3IFU A;  1I6H I;  3S2D I;  2RIQ A;  3FKI I;  5D1O A;  4NB8 A;  3HOX I;  1S72 1;  1Y1W I;  3CD6 1;  3G71 1;  3PO3 S;  2V45 A;  3CCJ 1;  1YJW 1;  4HGY A;  3D9X A;  2NVQ I;  3EED A;  3CCV 1;  5AN9 F;  3HOW I;  2QRE B;  1VQL Z;  1QYP A;  1VQP Z;  3HKZ A;  1SFO I;  3T4N B;  3NFZ A;  1Z01 A;  4E2X A;  3TDH B;  1VLA A;  1QF8 A;  3GTO I;  3QWU A;  3KIH A;  2DE6 A;  3VTN A;  4RVF A;  2G2K A;  2RPR A;  2RT9 A;  1RO4 A;  2VUG A;  3HOY I;  3NDI A;  2QEX 1;  2KI7 B;  3PO2 I;  1Q82 1;  2E2I I;  4A3G I;  1YJW Z;  3CCL Z;  1Q86 2;  4NH1 C;  2F4O A;  1M1K 1;  3CCV Z;  2Q4Z A;  1JJ2 Z;  2V3V A;  2M6N A;  3F3P C;  2PK7 A;  2JA7 I;  1LQL A;  3MZK B;  4NBH A;  3OW2 Y;  3CCE Z;  2IZ3 A;  1USP B;  2WB1 A;  1Q86 1;  2F4M A;  3EER A;  1VQ9 Z;  4RV9 A;  2VPZ A;  4RS4 A;  1WZN A;  2HU9 A;  1N8R 2;  1YUK A;  3Q87 A;  1TWC I;  1VQ4 1;  2O53 A;  2LIY A;  4QTU A;  5LL6 f;  3GKQ A;  4E2Y A;  2QEX Z;  2V8I A;  2P28 A;  3J80 b;  4BBR I;  1FDO A;  4NBB A;  1X3W A;  5FLX f;  1Q16 A;  3CC7 1;  1QVF Z;  2W04 A;  4BY7 I;  3S1Q I;  4DK1 A;  2RHB A;  3CMA 1;  3JAM b;  4HH4 A;  3CCS Z;  2K3R A;  1YHQ Z;  4A3B I;  2QA4 Z;  4HGZ A;  3G4S Z;  3LUS A;  3S15 I;  3GTG I;  1YIT 1;  2OTL 1;  1RQF A;  1PFT A;  4E30 A;  2VPY A;  3U50 C;  1YUA A;  2VUM I;  2R7Z I;  1QXF A;  4E31 A;  2E7Z A;  3CCQ Z;  1W2B Z;  5C4J I;  3CC7 Z;  2I3C A;  3GTM S;  2R93 I;  2IV2 X;  1VQN Z;  3OW2 Z;  1X3Z A;  2NAP A;  3CMA Z;  1P9N A;  4QTT A;  2K5R A;  1W2B Y;  2JIM A;  2QKD A;  1USP A;  5C3E I;  3CQZ I;  5IP9 I;  1WW9 A; 
#chains in the Genus database with same CATH homology
 3S2H I;  1S72 Z;  4NBF A;  4E2Z A;  3G71 Z;  3NH4 A;  1YIT Z;  2JA5 I;  4E2W A;  5IT9 b;  3CCJ Z;  3FQQ A;  4NBA A;  3CC4 1;  2AKL A;  3S17 I;  3VMH A;  1WCM I;  4MRI A;  5A2Q f;  2JMO A;  3IF8 A;  4AYB A;  1QVG Z;  1VQM 1;  4A3D I;  4BXX I;  2OZK A;  3MON A;  3GTK I;  3ESW A;  3S14 I;  1QVG Y;  2DE5 A;  1VQO 1;  3I55 1;  1K73 1;  3HOV I;  4DGL A;  4A3I I;  3CCL 1;  3F3F C;  3I4N I;  5T64 A;  2R6M A;  4NOZ A;  2O4H A;  1TWH I;  1ML8 A;  1K73 2;  3J81 b;  3CCE 1;  1VQ7 Z;  5C4X I;  3I07 A;  3CXC Z;  2YU9 I;  1RO0 A;  2PMZ A;  1VQM Z;  1NJI 1;  3CC2 Z;  4EWC A;  1TWA I;  1NUI A;  5FLX b;  1VQ4 Z;  1RLY A;  1VQ6 Z;  1VQK 1;  2NVY I;  2OTJ 1;  3I55 Z;  2P3Y A;  2OOX B;  2JNY A;  5T67 A;  4A3M I;  3VMG A;  1Y1V S;  4X6A I;  5D1P A;  3CCU Z;  2W03 A;  1VQ7 1;  2KPI A;  3TE5 B;  3IX0 A;  3CME 1;  1YHQ 1;  3CC2 1;  2QA4 1;  1YJ9 Z;  4MD9 A;  2JA8 I;  2NVX I;  4A3L I;  3G6E Z;  2JR6 A;  3BG1 B;  3HOU I;  1VQ6 1;  2OTL Z;  1VQ5 Z;  2QR1 B;  4CL1 A;  3GTM I;  1NP6 A;  5T6B A;  2NVT I;  3S16 I;  2OTJ Z;  3CXC Y;  2LFU A;  5C44 I;  4NBE A;  4E33 A;  1Q82 2;  1KC8 1;  3CCQ 1;  1M1K 2;  2QRC B;  1VQ8 Z;  1VQN 1;  2PM9 A;  1ZB8 A;  5CM2 M;  3J7A 4;  4MD8 A;  1KC8 2;  3GCF A;  2JA6 I;  1I50 I;  1ZH1 A;  2EGT A;  3H3V J;  5A2Q b;  4DQY B;  4S1T A;  2V8K A;  1YIJ 1;  3M4O I;  3NDJ A;  3JAM f;  3CC4 Z;  4TNU A;  4XX2 A;  1TFI A;  4A3E I;  3CCM 1;  1YJN Z;  3RZO I;  2OOY B;  1Q81 1;  3HOZ I;  1K9M 1;  1K83 I;  4RVD A;  4A3J I;  1KD1 2;  3GTJ I;  5D1O B;  2WAQ A;  1N8R 1;  2V8J A;  1Q81 2;  1K9M 2;  4A93 I;  4BBS I;  1Z03 A;  4MH4 A;  3K7A I;  4RVG A;  1KD1 1;  2E2H I;  4NB9 A;  2R92 I;  4A3C I;  3PO3 I;  2IZ4 A;  1S7M A;  3S1R I;  1VQO Z;  2B63 I;  1Y1V I;  3CCR 1;  4RVH A;  1YIJ Z;  2GU2 A;  2YAD A;  1KRL A;  1L1O C;  2JS4 A;  1VQL 1;  1VQP 1;  1RNI A;  1JJ2 Y;  3GTP I;  3J80 f;  1TWF I;  4NBG A;  3GTL I;  4A3F I;  2J6A A;  2E2J I;  2QRD B;  1QVF Y;  3S1M I;  3CPW Z;  1VQK Z;  4Y52 I;  2RBL A;  3CCR Z;  3NH8 A;  3KIF A;  3D6W A;  1KQS Z;  3BG0 B;  1JWH C;  2VF1 A;  1I3Q I;  2HF1 A;  4NFR A;  4NBC A;  3CCU 1;  3VB9 A;  4BY1 I;  3CME Z;  1VQ9 1;  1RO2 A;  1YJ9 1;  2E9H A;  2M48 A;  3P5J B;  3CPW Y;  3M3Y I;  3G6E 1;  4NBD A;  1YI2 1;  4Y7N I;  2DE7 A;  3RZD I;  3J81 f;  1VQ5 1;  4E32 A;  1KQS Y;  1Q7Y 1;  3GTQ I;  3I4M I;  2GTH A;  1K8A 1;  3I56 1;  1VQ8 1;  5IT9 f;  1Q7Y 2;  2JUB A;  1Z02 A;  2QLV B;  5IP7 I;  4MON A;  5FLM I;  3CCS 1;  2Q51 A;  1K8A 2;  3MZL B;  2BJO A;  4MXU A;  1NJI 2;  1WII A;  3S1N I;  1YI2 Z;  1X0T A;  3CD6 Z;  3FQM A;  1DL6 A;  1M90 1;  1R9T I;  3G4S 1;  1TWG I;  3CCM Z;  1YJN 1;  2H85 A;  4A3K I;  2ZAE B;  1N2F A;  1M90 2;  2Y0S A;  3NH5 A;  3H0G I;  1ZB9 A;  4MD7 A;  2GTI A;  3I56 Z;  3VMI A;  3IFU A;  1I6H I;  3S2D I;  2RIQ A;  3FKI I;  5D1O A;  4NB8 A;  3HOX I;  1S72 1;  1Y1W I;  3CD6 1;  3G71 1;  3PO3 S;  3CCJ 1;  1YJW 1;  4HGY A;  3D9X A;  2NVQ I;  3EED A;  3CCV 1;  5AN9 F;  3HOW I;  2QRE B;  1VQL Z;  1QYP A;  1VQP Z;  3HKZ A;  1SFO I;  3T4N B;  3NFZ A;  1Z01 A;  4E2X A;  3TDH B;  1VLA A;  1QF8 A;  3GTO I;  3QWU A;  3KIH A;  2DE6 A;  3VTN A;  4RVF A;  2G2K A;  2RPR A;  2RT9 A;  1RO4 A;  2VUG A;  3HOY I;  3NDI A;  2QEX 1;  2KI7 B;  3PO2 I;  1Q82 1;  2E2I I;  4A3G I;  1YJW Z;  3CCL Z;  1Q86 2;  4NH1 C;  2F4O A;  1M1K 1;  3CCV Z;  2Q4Z A;  1JJ2 Z;  2M6N A;  3F3P C;  2PK7 A;  2JA7 I;  1LQL A;  3MZK B;  4NBH A;  3OW2 Y;  1Q86 1;  2IZ3 A;  1USP B;  2WB1 A;  3CCE Z;  2F4M A;  3EER A;  1VQ9 Z;  4RV9 A;  4RS4 A;  2HU9 A;  1N8R 2;  1YUK A;  3Q87 A;  1TWC I;  1VQ4 1;  2O53 A;  2LIY A;  4QTU A;  5LL6 f;  3GKQ A;  4E2Y A;  2QEX Z;  2V8I A;  2P28 A;  3J80 b;  4BBR I;  4NBB A;  1X3W A;  5FLX f;  3CC7 1;  1QVF Z;  2W04 A;  4BY7 I;  3S1Q I;  4DK1 A;  2RHB A;  3CMA 1;  3JAM b;  4HH4 A;  3CCS Z;  2K3R A;  1YHQ Z;  4A3B I;  2QA4 Z;  4HGZ A;  3G4S Z;  3LUS A;  3S15 I;  3GTG I;  1YIT 1;  2OTL 1;  1RQF A;  1PFT A;  4E30 A;  3U50 C;  1YUA A;  2VUM I;  2R7Z I;  4E31 A;  3CCQ Z;  1W2B Z;  5C4J I;  3CC7 Z;  2I3C A;  3GTM S;  2R93 I;  1VQN Z;  3OW2 Z;  1X3Z A;  3CMA Z;  1P9N A;  4QTT A;  2K5R A;  1W2B Y;  2QKD A;  1USP A;  5C3E I;  3CQZ I;  5IP9 I;  1WW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...