3S15I

Rna polymerase ii initiation complex with a 7-nt rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s15I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s15I02
3S2HI 3GTOI 3I07A 3PO3I 4A3KI 2R7ZI 3S15I 3M4OI 1I3QI 4A3BI 2JNYA 2DE5A 3HOXI 2KPIA 5CM2M 4A3FI 2PK7A 1PFTA 4A3MI 2E2JI 4NOZA 3I4NI 4X6AI 4NBHA 2HF1A 1TWFI 1X3WA 4A3JI 2K5RA 1DL6A 2JA5I 3Q87A 3S17I 4BY7I 1ML8A 1TWGI 3GKQA 4A3CI 1N2FA 4NBDA 1Y1VI 2RBLA 1TWAI 3FKII 3H3VJ 1QYPA 3D6WA 3S1RI 3HOYI 3I4MI 3PO3S 3HOWI 3VMIA 1SFOI 5IP9I 4A3DI 4NB9A 3HOVI 4BXXI 5C44I 3RZOI 3S16I 4Y7NI 4A3EI 2R92I 3GTPI 2B63I 3GCFA 4BBRI 4A93I 1ZB8A 1RO4A 3GTKI 3ESWA 4A3LI 1USPB 4MH4A 3S1NI 2YU9I 1L1OC 2F4MA 3VMHA 2JA7I 5C3EI 3H0GI 2AKLA 5C4JI 4NB8A 5IP7I 1RLYA 4A3GI 4QTUA 3VB9A 1Y1WI 4A3II 4NBAA 1LQLA 2JR6A 1Y1VS 2P3YA 3GTGI 1I6HI 3PO2I 5FLMI 3GTQI 2VUMI 3VMGA 4Y52I 3GTMI 2J6AA 3K7AI 4BY1I 3S14I 4NBBA 3HOUI 3HOZI 1YUAA 1WCMI 2JA6I 3EERA 3S2DI 4QTTA 2NVTI 2DE6A 4BBSI 3GTLI 2R93I 2E2II 5C4XI 1ZB9A 2NVYI 1TWCI 3U50C 1WW9A 1X3ZA 4XX2A 3M3YI 3LUSA 4NBEA 2JS4A 3S1MI 3CQZI 3RZDI 2BJOA 1K83I 1TWHI 1VLAA 4NBGA 1USPA 2JA8I 1NUIA 2DE7A 4NBFA 2E2HI 3GTJI 3GTMS 2NVXI 1I50I 1TFIA 4NBCA 3S1QI 2NVQI 2F4OA 1R9TI
chains in the Genus database with same CATH superfamily
3CCRZ 4AYBA 2R7ZI 3S15I 1FDIA 3M4OI 1QVFY 1ZH1A 4RVFA 3HOXI 2EGTA 3I4NI 4NOZA 4NBHA 1YHQ1 3G6EZ 2OOXB 1YJ91 1S721 2K5RA 1K8A2 1Q821 2VF1A 3P5JB 2RBLA 4A3GI 3FKII 3HOYI 1YI2Z 2IZ3A 5IP9I 4E2ZA 1RQFA 4MONA 1AA6A 2QLVB 3RZOI 3S16I 2E7ZA 3GTPI 4E33A 3J7A4 3CCR1 1KQSY 1RO4A 4MD7A 1VQLZ 3NFZA 4RS4A 1NJI1 3H0GI 4NB8A 1Q811 3MZKB 4QTUA 1WIIA 1W2BZ 4A3II 3G6E1 1Y1VS 2Y0SA 1VQ8Z 3GTGI 3KIHA 5FLMI 3JAMb 3GTQI 1P9NA 4CL1A 2J6AA 5LL6f 1YUAA 1YI21 2WAQA 3S2DI 1QF8A 2I3CA 1VQ7Z 1M1K2 2E2II 1TWCI 1WW9A 2OOYB 3CCS1 3JAMf 4XX2A 2RIQA 1Q7Y1 1VQL1 2QA4Z 1VLAA 3CPWY 4MD9A 3CCQZ 4NBGA 5T67A 2IZ4A 4NBFA 3CCV1 2O4HA 3CCLZ 4DK1A 4NBCA 2NVQI 2V45A 2JUBA 1VQ5Z 3IFUA 4E2WA 1K731 3CCMZ 1YJ9Z 1YIT1 3MZLB 3QWUA 3I561 3F3PC 3CMAZ 1VQ41 4A3JI 4NFRA 2JA5I 3CCE1 1YJN1 3S17I 1Q822 1ML8A 3GKQA 2K3RA 1N8R2 4NBDA 1TWAI 3H3VJ 3S1RI 3PO3S 4RVDA 4TNUA 3VMIA 1SFOI 1FDOA 3IR7A 3CCL1 1YUKA 4HGZA 3G71Z 5C44I 1Y8CA 4A3EI 4HGYA 1VQ51 2B63I 2O53A 1KRLA 1Q861 3CCM1 4DGLA 2VPYA 1VQK1 3VMHA 1NJI2 3CC21 5C3EI 2AKLA 2PMZA 1Q812 1JWHC 5IP7I 2OTL1 2QEXZ 1Z03A 2VPZA 3CMA1 1LQLA 2JR6A 3CC71 3MONA 2OTJZ 2JIOA 2Q51A 3CXCY 1WJ2A 3NH5A 2VUMI 1K9M1 4DQYB 4S1TA 3CCSZ 2RT9A 1KC81 2E9HA 2JIMA 3HOUI 2NAPA 4QTTA 2NVTI 2DE6A 4BBSI 1JJ2Y 1NP6A 3OW2Y 3CD61 3G711 1ZB9A 3U50C 3IF8A 3CCVZ 1Q7Y2 3M3YI 1VQP1 3RZDI 3FQQA 3T4NB 2YADA 2V8JA 2JMOA 2JA8I 1NUIA 2DE7A 2QEX1 2E2HI 5IT9b 3GTMS 1YITZ 1TFIA 3S1QI 2OTJ1 4MD8A 2GTHA 2HU9A 3G4S1 1QVGZ 3IX0A 3I56Z 1R9TI 1K732 3S2HI 3GTOI 4A3KI 1VQ4Z 2GTIA 2DE5A 2RHBA 2KPIA 3CCEZ 4A3FI 1YJNZ 5IT9f 4A3MI 2E2JI 4X6AI 4RVGA 3BG1B 2HF1A 1X3WA 2R6MA 1DL6A 3Q87A 3TDHB 1Z02A 1QXFA 4RV9A 1M901 1TWGI 1Y1VI 1VQ91 3I4MI 1QYPA 1QVFZ 1W2BY 2OZKA 3HOWI 4A3DI 1VQKZ 1WZNA 3CC2Z 5A2Qb 4Y7NI 1YIJ1 2OTLZ 3GCFA 4BBRI 1Q862 3CC7Z 2VPXA 1USPB 4MH4A 2YU9I 2F4MA 2JA7I 2H85A 1RLYA 5AN9F 5A2Qf 5T64A 4EWCA 1I6HI 3CXCZ 5D1OA 3CD6Z 3CMEZ 1K9M2 4E30A 3I551 1KC82 1KD11 2QKDA 3K7AI 3S14I 4NBBA 1KQSZ 1WCMI 2LFUA 3EERA 1VQPZ 2JA6I 1JJ2Z 3OW2Z 2AYDA 4E2YA 2NVYI 3NH8A 1VQ6Z 2LEXA 1VQOZ 3CCUZ 3CC4Z 3S1MI 3CQZI 3G4SZ 1K83I 2PM9A 4E2XA 3D2LA 1USPA 3D9XA 2VPWA 1RNIA 3GTJI 2NVXI 2QRDB 2Q4ZA 3CME1 3PO3I 3I07A 1N8R1 4HH4A 1I3QI 4MRIA 2ZAEB 4A3BI 2JNYA 2M6NA 2LIYA 5CM2M 1Z01A 3CPWZ 3NDJA 2PK7A 2WB1A 1PFTA 1VQ9Z 1YJWZ 1VQ61 1X0TA 5T6BA 2QR1B 1TWFI 1Q16A 2V3VA 4NH1C 3CC41 3CCU1 1VQO1 1YIJZ 1M902 2V8KA 1K8A1 4BY7I 2QREB 4A3CI 1N2FA 1RO2A 3J80b 3D6WA 3NDIA 2W04A 3HKZA 4NB9A 3HOVI 4BXXI 1VQNZ 3NH4A 2R92I 3KIFA 5D1PA 4A93I 3F3FC 4MXUA 1ZB8A 2VUGA 5D1OB 1RO0A 3GTKI 3ESWA 4A3LI 3S1NI 1L1OC 3J80f 3CCJZ 5C4JI 3EEDA 3I55Z 2GU2A 2G2KA 3TE5B 1VQMZ 3VB9A 1Y1WI 3J81b 4NBAA 1YJW1 2P3YA 4E31A 2JIRA 3PO2I 2JIQA 3BG0B 1KD12 3VMGA 4Y52I 3GTMI 3VTNA 4BY1I 3HOZI 5FLXb 1VQ81 3GTLI 3FQMA 2R93I 3J81f 1S7MA 2KI7B 2P28A 1QVGY 5C4XI 1VQN1 1M1K1 1YHQZ 2V8IA 1X3ZA 1S72Z 2W03A 3LUSA 4NBEA 2JS4A 4E32A 2BJOA 1TWHI 1VQ71 2IV2X 5FLXf 3CCJ1 4RVHA 2JIPA 1VQM1 1SIWA 2QRCB 1I50I 2QA41 2RPRA 2F4OA 2M48A 3CCQ1
chains in the Genus database with same CATH topology
3CCRZ 4AYBA 2R7ZI 3S15I 3M4OI 1QVFY 1ZH1A 4RVFA 3HOXI 2EGTA 3I4NI 4NOZA 4NBHA 1YHQ1 3G6EZ 2OOXB 1YJ91 1S721 2K5RA 1K8A2 1Q821 2VF1A 3P5JB 2RBLA 4A3GI 3FKII 3HOYI 1YI2Z 2IZ3A 5IP9I 4E2ZA 1RQFA 4MONA 3RZOI 2QLVB 3S16I 3GTPI 4E33A 3J7A4 3CCR1 1KQSY 1RO4A 4MD7A 1VQLZ 3NFZA 4RS4A 1NJI1 3H0GI 4NB8A 1Q811 3MZKB 4QTUA 1WIIA 1W2BZ 4A3II 3G6E1 1Y1VS 2Y0SA 1VQ8Z 3GTGI 3KIHA 5FLMI 3JAMb 3GTQI 1P9NA 4CL1A 2J6AA 5LL6f 1YUAA 1YI21 2WAQA 3S2DI 1QF8A 2I3CA 1VQ7Z 1M1K2 2E2II 1TWCI 1WW9A 2OOYB 3CCS1 3JAMf 4XX2A 2RIQA 1Q7Y1 1VQL1 2QA4Z 1VLAA 3CPWY 4MD9A 3CCQZ 4NBGA 5T67A 2IZ4A 4NBFA 3CCV1 2O4HA 3CCLZ 4DK1A 4NBCA 2NVQI 2JUBA 1VQ5Z 3IFUA 4E2WA 1K731 3CCMZ 1YJ9Z 1YIT1 3MZLB 3QWUA 3I561 3F3PC 3CMAZ 1VQ41 4A3JI 4NFRA 2JA5I 3CCE1 1YJN1 3S17I 1Q822 1ML8A 3GKQA 2K3RA 1N8R2 4NBDA 1TWAI 3H3VJ 3S1RI 3PO3S 4RVDA 4TNUA 3VMIA 1SFOI 3CCL1 1YUKA 4HGZA 3G71Z 5C44I 4A3EI 4HGYA 1VQ51 2B63I 2O53A 1KRLA 1Q861 3CCM1 4DGLA 1VQK1 3VMHA 1NJI2 3CC21 5C3EI 2AKLA 2PMZA 1Q812 1JWHC 5IP7I 2OTL1 2QEXZ 1Z03A 3CMA1 1LQLA 2JR6A 3CC71 3MONA 2OTJZ 2Q51A 3CXCY 3NH5A 2VUMI 1K9M1 4DQYB 4S1TA 3CCSZ 2RT9A 1KC81 2E9HA 3HOUI 4QTTA 2NVTI 2DE6A 4BBSI 1JJ2Y 1NP6A 3OW2Y 3CD61 3G711 1ZB9A 3U50C 3IF8A 3CCVZ 1Q7Y2 3M3YI 1VQP1 3RZDI 3FQQA 3T4NB 2YADA 2V8JA 2JMOA 2JA8I 1NUIA 2DE7A 2QEX1 2E2HI 5IT9b 3GTMS 1YITZ 1TFIA 3S1QI 2OTJ1 4MD8A 2GTHA 2HU9A 3G4S1 1QVGZ 3IX0A 3I56Z 1R9TI 1K732 3S2HI 3GTOI 4A3KI 1VQ4Z 2GTIA 2DE5A 2RHBA 2KPIA 3CCEZ 4A3FI 1YJNZ 5IT9f 4A3MI 2E2JI 4X6AI 4RVGA 3BG1B 2HF1A 1X3WA 2R6MA 1DL6A 3Q87A 3TDHB 1Z02A 4RV9A 1M901 1TWGI 1Y1VI 1VQ91 3I4MI 1QYPA 1QVFZ 1W2BY 2OZKA 3HOWI 4A3DI 1VQKZ 3CC2Z 5A2Qb 4Y7NI 1YIJ1 2OTLZ 3GCFA 4BBRI 1Q862 3CC7Z 1USPB 4MH4A 2YU9I 2F4MA 2JA7I 2H85A 1RLYA 5AN9F 5A2Qf 5T64A 4EWCA 1I6HI 3CXCZ 5D1OA 3CD6Z 3CMEZ 1K9M2 4E30A 3I551 1KC82 1KD11 2QKDA 3K7AI 3S14I 4NBBA 1KQSZ 1WCMI 2LFUA 3EERA 1VQPZ 2JA6I 1JJ2Z 3OW2Z 4E2YA 2NVYI 3NH8A 1VQ6Z 1VQOZ 3CCUZ 3CC4Z 3S1MI 3CQZI 3G4SZ 1K83I 2PM9A 4E2XA 1USPA 3D9XA 1RNIA 3GTJI 2NVXI 2QRDB 2Q4ZA 3CME1 3PO3I 3I07A 1N8R1 4HH4A 1I3QI 4MRIA 2ZAEB 4A3BI 2JNYA 2M6NA 2LIYA 5CM2M 1Z01A 3CPWZ 3NDJA 2PK7A 2WB1A 1PFTA 1VQ9Z 1YJWZ 1VQ61 1X0TA 5T6BA 2QR1B 1TWFI 4NH1C 3CC41 3CCU1 1VQO1 1YIJZ 1M902 2V8KA 1K8A1 4BY7I 2QREB 4A3CI 1N2FA 1RO2A 3J80b 3D6WA 3NDIA 2W04A 3HKZA 4NB9A 3HOVI 4BXXI 1VQNZ 3NH4A 2R92I 3KIFA 5D1PA 4A93I 3F3FC 4MXUA 1ZB8A 2VUGA 5D1OB 1RO0A 3GTKI 3ESWA 4A3LI 3S1NI 1L1OC 3J80f 3CCJZ 5C4JI 3EEDA 3I55Z 2GU2A 2G2KA 3TE5B 1VQMZ 3VB9A 1Y1WI 3J81b 4NBAA 1YJW1 2P3YA 4E31A 3PO2I 3BG0B 1KD12 3VMGA 4Y52I 3GTMI 3VTNA 4BY1I 3HOZI 5FLXb 1VQ81 3GTLI 3FQMA 2R93I 3J81f 1S7MA 2KI7B 2P28A 1QVGY 5C4XI 1VQN1 1M1K1 1YHQZ 2V8IA 1X3ZA 1S72Z 2W03A 3LUSA 4NBEA 2JS4A 4E32A 2BJOA 1TWHI 1VQ71 5FLXf 3CCJ1 4RVHA 1VQM1 2QRCB 1I50I 2QA41 2RPRA 2F4OA 2M48A 3CCQ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2H I;  3GTO I;  3I07 A;  3PO3 I;  4A3K I;  2R7Z I;  3S15 I;  3M4O I;  1I3Q I;  4A3B I;  2JNY A;  2DE5 A;  3HOX I;  2KPI A;  5CM2 M;  4A3F I;  2PK7 A;  1PFT A;  4A3M I;  2E2J I;  4NOZ A;  3I4N I;  4X6A I;  4NBH A;  2HF1 A;  1TWF I;  1X3W A;  4A3J I;  2K5R A;  1DL6 A;  2JA5 I;  3Q87 A;  3S17 I;  4BY7 I;  1ML8 A;  1TWG I;  3GKQ A;  4A3C I;  1N2F A;  4NBD A;  1Y1V I;  2RBL A;  1TWA I;  3FKI I;  3H3V J;  1QYP A;  3D6W A;  3S1R I;  3HOY I;  3I4M I;  3PO3 S;  3HOW I;  3VMI A;  1SFO I;  5IP9 I;  4A3D I;  4NB9 A;  3HOV I;  4BXX I;  5C44 I;  3RZO I;  3S16 I;  4Y7N I;  4A3E I;  2R92 I;  3GTP I;  2B63 I;  3GCF A;  4BBR I;  4A93 I;  1ZB8 A;  1RO4 A;  3GTK I;  3ESW A;  4A3L I;  1USP B;  4MH4 A;  3S1N I;  2YU9 I;  1L1O C;  2F4M A;  3VMH A;  2JA7 I;  5C3E I;  3H0G I;  2AKL A;  5C4J I;  4NB8 A;  5IP7 I;  1RLY A;  4A3G I;  4QTU A;  3VB9 A;  1Y1W I;  4A3I I;  4NBA A;  1LQL A;  2JR6 A;  1Y1V S;  2P3Y A;  3GTG I;  1I6H I;  3PO2 I;  5FLM I;  3GTQ I;  2VUM I;  3VMG A;  4Y52 I;  3GTM I;  2J6A A;  3K7A I;  4BY1 I;  3S14 I;  4NBB A;  3HOU I;  3HOZ I;  1YUA A;  1WCM I;  2JA6 I;  3EER A;  3S2D I;  4QTT A;  2NVT I;  2DE6 A;  4BBS I;  3GTL I;  2R93 I;  2E2I I;  5C4X I;  1ZB9 A;  2NVY I;  1TWC I;  3U50 C;  1WW9 A;  1X3Z A;  4XX2 A;  3M3Y I;  3LUS A;  4NBE A;  2JS4 A;  3S1M I;  3CQZ I;  3RZD I;  2BJO A;  1K83 I;  1TWH I;  1VLA A;  4NBG A;  1USP A;  2JA8 I;  1NUI A;  2DE7 A;  4NBF A;  2E2H I;  3GTJ I;  3GTM S;  2NVX I;  1I50 I;  1TFI A;  4NBC A;  3S1Q I;  2NVQ I;  2F4O A;  1R9T I; 
#chains in the Genus database with same CATH topology
 3CCR Z;  4AYB A;  2R7Z I;  3S15 I;  1FDI A;  3M4O I;  1QVF Y;  1ZH1 A;  4RVF A;  3HOX I;  2EGT A;  3I4N I;  4NOZ A;  4NBH A;  1YHQ 1;  3G6E Z;  2OOX B;  1YJ9 1;  1S72 1;  2K5R A;  1K8A 2;  1Q82 1;  2VF1 A;  3P5J B;  2RBL A;  4A3G I;  3FKI I;  3HOY I;  1YI2 Z;  2IZ3 A;  5IP9 I;  4E2Z A;  1RQF A;  4MON A;  1AA6 A;  2QLV B;  3RZO I;  3S16 I;  2E7Z A;  3GTP I;  4E33 A;  3J7A 4;  3CCR 1;  1KQS Y;  1RO4 A;  4MD7 A;  1VQL Z;  3NFZ A;  4RS4 A;  1NJI 1;  3H0G I;  4NB8 A;  1Q81 1;  3MZK B;  4QTU A;  1WII A;  1W2B Z;  4A3I I;  3G6E 1;  1Y1V S;  2Y0S A;  1VQ8 Z;  3GTG I;  3KIH A;  5FLM I;  3JAM b;  3GTQ I;  1P9N A;  4CL1 A;  2J6A A;  5LL6 f;  1YUA A;  1YI2 1;  2WAQ A;  3S2D I;  1QF8 A;  2I3C A;  1VQ7 Z;  1M1K 2;  2E2I I;  1TWC I;  1WW9 A;  2OOY B;  3CCS 1;  3JAM f;  4XX2 A;  2RIQ A;  1Q7Y 1;  1VQL 1;  2QA4 Z;  1VLA A;  3CPW Y;  4MD9 A;  3CCQ Z;  4NBG A;  5T67 A;  2IZ4 A;  4NBF A;  3CCV 1;  2O4H A;  3CCL Z;  4DK1 A;  4NBC A;  2NVQ I;  2V45 A;  2JUB A;  1VQ5 Z;  3IFU A;  4E2W A;  1K73 1;  3CCM Z;  1YJ9 Z;  1YIT 1;  3MZL B;  3QWU A;  3I56 1;  3F3P C;  3CMA Z;  1VQ4 1;  4A3J I;  4NFR A;  2JA5 I;  3CCE 1;  1YJN 1;  3S17 I;  1Q82 2;  1ML8 A;  3GKQ A;  2K3R A;  1N8R 2;  4NBD A;  1TWA I;  3H3V J;  3S1R I;  3PO3 S;  4RVD A;  4TNU A;  3VMI A;  1SFO I;  1FDO A;  3IR7 A;  3CCL 1;  1YUK A;  4HGZ A;  3G71 Z;  5C44 I;  1Y8C A;  4A3E I;  4HGY A;  1VQ5 1;  2B63 I;  2O53 A;  1KRL A;  1Q86 1;  3CCM 1;  4DGL A;  2VPY A;  1VQK 1;  3VMH A;  1NJI 2;  3CC2 1;  5C3E I;  2AKL A;  2PMZ A;  1Q81 2;  1JWH C;  5IP7 I;  2OTL 1;  2QEX Z;  1Z03 A;  2VPZ A;  3CMA 1;  1LQL A;  2JR6 A;  3CC7 1;  3MON A;  2OTJ Z;  2JIO A;  2Q51 A;  3CXC Y;  1WJ2 A;  3NH5 A;  2VUM I;  1K9M 1;  4DQY B;  4S1T A;  3CCS Z;  2RT9 A;  1KC8 1;  2E9H A;  2JIM A;  3HOU I;  2NAP A;  4QTT A;  2NVT I;  2DE6 A;  4BBS I;  1JJ2 Y;  1NP6 A;  3OW2 Y;  3CD6 1;  3G71 1;  1ZB9 A;  3U50 C;  3IF8 A;  3CCV Z;  1Q7Y 2;  3M3Y I;  1VQP 1;  3RZD I;  3FQQ A;  3T4N B;  2YAD A;  2V8J A;  2JMO A;  2JA8 I;  1NUI A;  2DE7 A;  2QEX 1;  2E2H I;  5IT9 b;  3GTM S;  1YIT Z;  1TFI A;  3S1Q I;  2OTJ 1;  4MD8 A;  2GTH A;  2HU9 A;  3G4S 1;  1QVG Z;  3IX0 A;  3I56 Z;  1R9T I;  1K73 2;  3S2H I;  3GTO I;  4A3K I;  1VQ4 Z;  2GTI A;  2DE5 A;  2RHB A;  2KPI A;  3CCE Z;  4A3F I;  1YJN Z;  5IT9 f;  4A3M I;  2E2J I;  4X6A I;  4RVG A;  3BG1 B;  2HF1 A;  1X3W A;  2R6M A;  1DL6 A;  3Q87 A;  3TDH B;  1Z02 A;  1QXF A;  4RV9 A;  1M90 1;  1TWG I;  1Y1V I;  1VQ9 1;  3I4M I;  1QYP A;  1QVF Z;  1W2B Y;  2OZK A;  3HOW I;  4A3D I;  1VQK Z;  1WZN A;  3CC2 Z;  5A2Q b;  4Y7N I;  1YIJ 1;  2OTL Z;  3GCF A;  4BBR I;  1Q86 2;  3CC7 Z;  2VPX A;  1USP B;  4MH4 A;  2YU9 I;  2F4M A;  2JA7 I;  2H85 A;  1RLY A;  5AN9 F;  5A2Q f;  5T64 A;  4EWC A;  1I6H I;  3CXC Z;  5D1O A;  3CD6 Z;  3CME Z;  1K9M 2;  4E30 A;  3I55 1;  1KC8 2;  1KD1 1;  2QKD A;  3K7A I;  3S14 I;  4NBB A;  1KQS Z;  1WCM I;  2LFU A;  3EER A;  1VQP Z;  2JA6 I;  1JJ2 Z;  3OW2 Z;  2AYD A;  4E2Y A;  2NVY I;  3NH8 A;  1VQ6 Z;  2LEX A;  1VQO Z;  3CCU Z;  3CC4 Z;  3S1M I;  3CQZ I;  3G4S Z;  1K83 I;  2PM9 A;  4E2X A;  3D2L A;  1USP A;  3D9X A;  2VPW A;  1RNI A;  3GTJ I;  2NVX I;  2QRD B;  2Q4Z A;  3CME 1;  3PO3 I;  3I07 A;  1N8R 1;  4HH4 A;  1I3Q I;  4MRI A;  2ZAE B;  4A3B I;  2JNY A;  2M6N A;  2LIY A;  5CM2 M;  1Z01 A;  3CPW Z;  3NDJ A;  2PK7 A;  2WB1 A;  1PFT A;  1VQ9 Z;  1YJW Z;  1VQ6 1;  1X0T A;  5T6B A;  2QR1 B;  1TWF I;  1Q16 A;  2V3V A;  4NH1 C;  3CC4 1;  3CCU 1;  1VQO 1;  1YIJ Z;  1M90 2;  2V8K A;  1K8A 1;  4BY7 I;  2QRE B;  4A3C I;  1N2F A;  1RO2 A;  3J80 b;  3D6W A;  3NDI A;  2W04 A;  3HKZ A;  4NB9 A;  3HOV I;  4BXX I;  1VQN Z;  3NH4 A;  2R92 I;  3KIF A;  5D1P A;  4A93 I;  3F3F C;  4MXU A;  1ZB8 A;  2VUG A;  5D1O B;  1RO0 A;  3GTK I;  3ESW A;  4A3L I;  3S1N I;  1L1O C;  3J80 f;  3CCJ Z;  5C4J I;  3EED A;  3I55 Z;  2GU2 A;  2G2K A;  3TE5 B;  1VQM Z;  3VB9 A;  1Y1W I;  3J81 b;  4NBA A;  1YJW 1;  2P3Y A;  4E31 A;  2JIR A;  3PO2 I;  2JIQ A;  3BG0 B;  1KD1 2;  3VMG A;  4Y52 I;  3GTM I;  3VTN A;  4BY1 I;  3HOZ I;  5FLX b;  1VQ8 1;  3GTL I;  3FQM A;  2R93 I;  3J81 f;  1S7M A;  2KI7 B;  2P28 A;  1QVG Y;  5C4X I;  1VQN 1;  1M1K 1;  1YHQ Z;  2V8I A;  1X3Z A;  1S72 Z;  2W03 A;  3LUS A;  4NBE A;  2JS4 A;  4E32 A;  2BJO A;  1TWH I;  1VQ7 1;  2IV2 X;  5FLX f;  3CCJ 1;  4RVH A;  2JIP A;  1VQM 1;  1SIW A;  2QRC B;  1I50 I;  2QA4 1;  2RPR A;  2F4O A;  2M48 A;  3CCQ 1; 
#chains in the Genus database with same CATH homology
 3CCR Z;  4AYB A;  2R7Z I;  3S15 I;  3M4O I;  1QVF Y;  1ZH1 A;  4RVF A;  3HOX I;  2EGT A;  3I4N I;  4NOZ A;  4NBH A;  1YHQ 1;  3G6E Z;  2OOX B;  1YJ9 1;  1S72 1;  2K5R A;  1K8A 2;  1Q82 1;  2VF1 A;  3P5J B;  2RBL A;  4A3G I;  3FKI I;  3HOY I;  1YI2 Z;  2IZ3 A;  5IP9 I;  4E2Z A;  1RQF A;  4MON A;  3RZO I;  2QLV B;  3S16 I;  3GTP I;  4E33 A;  3J7A 4;  3CCR 1;  1KQS Y;  1RO4 A;  4MD7 A;  1VQL Z;  3NFZ A;  4RS4 A;  1NJI 1;  3H0G I;  4NB8 A;  1Q81 1;  3MZK B;  4QTU A;  1WII A;  1W2B Z;  4A3I I;  3G6E 1;  1Y1V S;  2Y0S A;  1VQ8 Z;  3GTG I;  3KIH A;  5FLM I;  3JAM b;  3GTQ I;  1P9N A;  4CL1 A;  2J6A A;  5LL6 f;  1YUA A;  1YI2 1;  2WAQ A;  3S2D I;  1QF8 A;  2I3C A;  1VQ7 Z;  1M1K 2;  2E2I I;  1TWC I;  1WW9 A;  2OOY B;  3CCS 1;  3JAM f;  4XX2 A;  2RIQ A;  1Q7Y 1;  1VQL 1;  2QA4 Z;  1VLA A;  3CPW Y;  4MD9 A;  3CCQ Z;  4NBG A;  5T67 A;  2IZ4 A;  4NBF A;  3CCV 1;  2O4H A;  3CCL Z;  4DK1 A;  4NBC A;  2NVQ I;  2JUB A;  1VQ5 Z;  3IFU A;  4E2W A;  1K73 1;  3CCM Z;  1YJ9 Z;  1YIT 1;  3MZL B;  3QWU A;  3I56 1;  3F3P C;  3CMA Z;  1VQ4 1;  4A3J I;  4NFR A;  2JA5 I;  3CCE 1;  1YJN 1;  3S17 I;  1Q82 2;  1ML8 A;  3GKQ A;  2K3R A;  1N8R 2;  4NBD A;  1TWA I;  3H3V J;  3S1R I;  3PO3 S;  4RVD A;  4TNU A;  3VMI A;  1SFO I;  3CCL 1;  1YUK A;  4HGZ A;  3G71 Z;  5C44 I;  4A3E I;  4HGY A;  1VQ5 1;  2B63 I;  2O53 A;  1KRL A;  1Q86 1;  3CCM 1;  4DGL A;  1VQK 1;  3VMH A;  1NJI 2;  3CC2 1;  5C3E I;  2AKL A;  2PMZ A;  1Q81 2;  1JWH C;  5IP7 I;  2OTL 1;  2QEX Z;  1Z03 A;  3CMA 1;  1LQL A;  2JR6 A;  3CC7 1;  3MON A;  2OTJ Z;  2Q51 A;  3CXC Y;  3NH5 A;  2VUM I;  1K9M 1;  4DQY B;  4S1T A;  3CCS Z;  2RT9 A;  1KC8 1;  2E9H A;  3HOU I;  4QTT A;  2NVT I;  2DE6 A;  4BBS I;  1JJ2 Y;  1NP6 A;  3OW2 Y;  3CD6 1;  3G71 1;  1ZB9 A;  3U50 C;  3IF8 A;  3CCV Z;  1Q7Y 2;  3M3Y I;  1VQP 1;  3RZD I;  3FQQ A;  3T4N B;  2YAD A;  2V8J A;  2JMO A;  2JA8 I;  1NUI A;  2DE7 A;  2QEX 1;  2E2H I;  5IT9 b;  3GTM S;  1YIT Z;  1TFI A;  3S1Q I;  2OTJ 1;  4MD8 A;  2GTH A;  2HU9 A;  3G4S 1;  1QVG Z;  3IX0 A;  3I56 Z;  1R9T I;  1K73 2;  3S2H I;  3GTO I;  4A3K I;  1VQ4 Z;  2GTI A;  2DE5 A;  2RHB A;  2KPI A;  3CCE Z;  4A3F I;  1YJN Z;  5IT9 f;  4A3M I;  2E2J I;  4X6A I;  4RVG A;  3BG1 B;  2HF1 A;  1X3W A;  2R6M A;  1DL6 A;  3Q87 A;  3TDH B;  1Z02 A;  4RV9 A;  1M90 1;  1TWG I;  1Y1V I;  1VQ9 1;  3I4M I;  1QYP A;  1QVF Z;  1W2B Y;  2OZK A;  3HOW I;  4A3D I;  1VQK Z;  3CC2 Z;  5A2Q b;  4Y7N I;  1YIJ 1;  2OTL Z;  3GCF A;  4BBR I;  1Q86 2;  3CC7 Z;  1USP B;  4MH4 A;  2YU9 I;  2F4M A;  2JA7 I;  2H85 A;  1RLY A;  5AN9 F;  5A2Q f;  5T64 A;  4EWC A;  1I6H I;  3CXC Z;  5D1O A;  3CD6 Z;  3CME Z;  1K9M 2;  4E30 A;  3I55 1;  1KC8 2;  1KD1 1;  2QKD A;  3K7A I;  3S14 I;  4NBB A;  1KQS Z;  1WCM I;  2LFU A;  3EER A;  1VQP Z;  2JA6 I;  1JJ2 Z;  3OW2 Z;  4E2Y A;  2NVY I;  3NH8 A;  1VQ6 Z;  1VQO Z;  3CCU Z;  3CC4 Z;  3S1M I;  3CQZ I;  3G4S Z;  1K83 I;  2PM9 A;  4E2X A;  1USP A;  3D9X A;  1RNI A;  3GTJ I;  2NVX I;  2QRD B;  2Q4Z A;  3CME 1;  3PO3 I;  3I07 A;  1N8R 1;  4HH4 A;  1I3Q I;  4MRI A;  2ZAE B;  4A3B I;  2JNY A;  2M6N A;  2LIY A;  5CM2 M;  1Z01 A;  3CPW Z;  3NDJ A;  2PK7 A;  2WB1 A;  1PFT A;  1VQ9 Z;  1YJW Z;  1VQ6 1;  1X0T A;  5T6B A;  2QR1 B;  1TWF I;  4NH1 C;  3CC4 1;  3CCU 1;  1VQO 1;  1YIJ Z;  1M90 2;  2V8K A;  1K8A 1;  4BY7 I;  2QRE B;  4A3C I;  1N2F A;  1RO2 A;  3J80 b;  3D6W A;  3NDI A;  2W04 A;  3HKZ A;  4NB9 A;  3HOV I;  4BXX I;  1VQN Z;  3NH4 A;  2R92 I;  3KIF A;  5D1P A;  4A93 I;  3F3F C;  4MXU A;  1ZB8 A;  2VUG A;  5D1O B;  1RO0 A;  3GTK I;  3ESW A;  4A3L I;  3S1N I;  1L1O C;  3J80 f;  3CCJ Z;  5C4J I;  3EED A;  3I55 Z;  2GU2 A;  2G2K A;  3TE5 B;  1VQM Z;  3VB9 A;  1Y1W I;  3J81 b;  4NBA A;  1YJW 1;  2P3Y A;  4E31 A;  3PO2 I;  3BG0 B;  1KD1 2;  3VMG A;  4Y52 I;  3GTM I;  3VTN A;  4BY1 I;  3HOZ I;  5FLX b;  1VQ8 1;  3GTL I;  3FQM A;  2R93 I;  3J81 f;  1S7M A;  2KI7 B;  2P28 A;  1QVG Y;  5C4X I;  1VQN 1;  1M1K 1;  1YHQ Z;  2V8I A;  1X3Z A;  1S72 Z;  2W03 A;  3LUS A;  4NBE A;  2JS4 A;  4E32 A;  2BJO A;  1TWH I;  1VQ7 1;  5FLX f;  3CCJ 1;  4RVH A;  1VQM 1;  2QRC B;  1I50 I;  2QA4 1;  2RPR A;  2F4O A;  2M48 A;  3CCQ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...