3S15I

Rna polymerase ii initiation complex with a 7-nt rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s15I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s15I02
1TWAI 1TWCI 3S16I 1ZB8A 3GTMI 3S15I 3H0GI 2NVXI 2NVQI 5C3EI 3S2DI 1R9TI 4A93I 2F4MA 4NBEA 1QYPA 4BBSI 1N2FA 1YUAA 4NBCA 3S1QI 1PFTA 2JA7I 4A3LI 3HOWI 2J6AA 4A3FI 2JR6A 2R93I 2R7ZI 1RO4A 4NBHA 3GTKI 1DL6A 2PK7A 1VLAA 2B63I 3Q87A 2E2HI 1I50I 3RZOI 1ZB9A 1X3ZA 3GTPI 3GCFA 3HOVI 2K5RA 3PO3S 1USPA 4BXXI 4A3JI 4BBRI 3S1RI 2E2JI 1WCMI 3PO3I 2DE7A 1SFOI 2P3YA 4A3GI 2NVTI 3S14I 1K83I 1RLYA 3HOXI 2JA6I 3GTGI 4QTUA 4NB8A 1Y1WI 3GTOI 4A3BI 3VMIA 3HOZI 1I6HI 3LUSA 4BY7I 3VMHA 3K7AI 1LQLA 4NBAA 3CQZI 3D6WA 3M4OI 4NBDA 2DE6A 2E2II 3U50C 3GTMS 2BJOA 3S17I 3VB9A 2RBLA 5IP9I 3H3VJ 4NBBA 1TWGI 3S2HI 2R92I 1Y1VI 4Y52I 2HF1A 4A3CI 3RZDI 1I3QI 4NBFA 4MH4A 5C44I 3FKII 4NBGA 4A3KI 5CM2M 3GTLI 3I4MI 2JA5I 5IP7I 1X3WA 2AKLA 1TFIA 1USPB 2VUMI 3S1MI 2DE5A 3HOUI 4X6AI 1L1OC 4A3EI 4XX2A 5C4XI 3GTJI 4A3DI 2JA8I 2JNYA 1WW9A 3ESWA 3M3YI 4BY1I 3EERA 1TWHI 3PO2I 3HOYI 3I4NI 5C4JI 2JS4A 2NVYI 3GKQA 4A3II 3S1NI 2KPIA 4NB9A 2F4OA 3VMGA 5FLMI 4A3MI 2YU9I 1NUIA 3I07A 1ML8A 4NOZA 4Y7NI 1TWFI 3GTQI 1Y1VS 4QTTA
chains in the Genus database with same CATH superfamily
1KD11 1TWAI 1VQOZ 3S16I 3S15I 2RPRA 3CCV1 1M1K2 3CCVZ 4NBEA 1QYPA 4BBSI 1N2FA 3S1QI 1YI2Z 1VQ91 1VQ41 2JR6A 3NFZA 2R93I 2OOYB 3TE5B 4NBHA 4E30A 4HH4A 2PK7A 1NJI1 1VLAA 2VPYA 3BG0B 2B63I 2K3RA 1Y8CA 1X3ZA 1VQLZ 5T64A 3GCFA 3PO3S 1KQSY 2G2KA 2E2JI 3MONA 3CCJ1 3J81f 1Q7Y2 2DE7A 4NH1C 3G6EZ 4E33A 1KC81 5LL6f 2GU2A 5FLXb 2R6MA 3G711 2OTJZ 3IFUA 1K731 1KRLA 2AYDA 3I551 1QXFA 3I55Z 4TNUA 4NBAA 4NBDA 2DE6A 2VUGA 1WZNA 1YIT1 2H85A 4NBBA 1YITZ 3S2HI 1JJ2Y 2R92I 1Y1VI 1S721 2QEX1 4Y52I 4NBGA 3GTLI 2HU9A 3CXCY 1S7MA 1USPB 2LFUA 1L1OC 1NP6A 2M48A 4A3DI 3KIFA 1YIJ1 1Q821 1WW9A 3EERA 2W04A 2OZKA 1VQ71 1VQ8Z 1SIWA 3FQMA 4HGYA 3BG1B 3S1NI 2F4OA 1VQN1 3CCL1 2WAQA 2LEXA 3I07A 3T4NB 1Z03A 3EEDA 1VQ61 3CC7Z 4MD7A 1VQO1 4QTTA 2OTL1 4MRIA 1P9NA 5C3EI 3S2DI 1KD12 1R9TI 2P28A 2V8KA 1YUAA 1VQ9Z 1PFTA 4RS4A 2JA7I 1RO2A 3FQQA 3CCRZ 3CCSZ 3G4S1 4E2YA 4S1TA 2R7ZI 1RO4A 3CCR1 2VF1A 1DL6A 3CXCZ 1VQL1 3D9XA 3Q87A 1Q7Y1 4BBRI 3S1RI 1JWHC 4RVDA 1W2BY 2JUBA 2P3YA 2NVTI 1K83I 1RLYA 1VQ51 4QTUA 4NB8A 1Y1WI 3GTOI 2OTJ1 1QVFZ 3CCQ1 3VMIA 2PMZA 1I6HI 1VQK1 2E9HA 1WJ2A 3CQZI 2GTIA 3D6WA 2IZ3A 2E2II 4E2XA 2BJOA 4E2ZA 2RBLA 2VPXA 1TWGI 2LIYA 1N8R2 3F3FC 3CCM1 1YJWZ 1AA6A 3CCMZ 4MH4A 4MD8A 5C44I 3IR7A 1QVFY 1Q16A 1VQ4Z 2QRDB 5AN9F 5IT9b 2AKLA 2QRCB 1YUKA 5IT9f 4DQYB 3NH5A 2JNYA 5A2Qf 2IV2X 3CCJZ 1K732 4EWCA 4BY1I 3NDJA 3D2LA 1ZH1A 1RNIA 2JS4A 1VQ7Z 3F3PC 2JIOA 2JIRA 1QVGY 4DGLA 3CD61 2KPIA 4NB9A 5T6BA 2ZAEB 2WB1A 4NOZA 4Y7NI 5FLXf 1Q812 3LUSA 2W03A 2GTHA 2NAPA 3GTMI 2QA4Z 3H0GI 2NVQI 3IX0A 2F4MA 2QEXZ 4NBCA 3CMAZ 2J6AA 3IF8A 2JIMA 2RHBA 4MD9A 3TDHB 2I3CA 2E2HI 1I50I 2QKDA 3JAMb 1USPA 4A3JI 3P5JB 1WCMI 3PO3I 2O53A 1X0TA 2JA6I 3HOXI 1VQ81 3CCQZ 3GTGI 1NJI2 4A3BI 3CCU1 3HOZI 1VQKZ 1YJ9Z 4E2WA 3I561 1FDIA 3VMHA 1Q822 3K7AI 3I56Z 1K8A1 2Q4ZA 4RV9A 1VQ6Z 1M901 3QWUA 4NFRA 3U50C 3NH4A 3VB9A 1M1K1 3CC71 1N8R1 3NH8A 3H3VJ 1YHQ1 1RO0A 1K9M1 2RIQA 1YJW1 1YI21 1JJ2Z 3RZDI 3J7A4 1M902 3FKII 2OOXB 2VPWA 3G4SZ 5CM2M 4E32A 3HOUI 4X6AI 4XX2A 5C4XI 3OW2Z 2JA8I 1K9M2 5D1OB 1RQFA 1YJN1 3ESWA 2JMOA 2V3VA 2RT9A 4CL1A 3KIHA 1TWHI 3HOYI 4RVGA 1VQPZ 1Q861 3G6E1 3HKZA 3CD6Z 1VQM1 3G71Z 3VMGA 5FLMI 4A3MI 2Y0SA 4RVFA 3MZKB 3VTNA 2PM9A 2QA41 1TWCI 3J81b 1ZB8A 4MONA 2NVXI 2V45A 5T67A 4A93I 3CMA1 4MXUA 3JAMf 3MZLB 3CC21 4A3LI 3HOWI 3CC2Z 4A3FI 3GTKI 4AYBA 1W2BZ 1YIJZ 3RZOI 1ZB9A 1K8A2 4E31A 3GTPI 3HOVI 2K5RA 4BXXI 3OW2Y 4RVHA 2KI7B 2JIQA 3CME1 3J80f 1Q811 1SFOI 3CMEZ 1QVGZ 2QR1B 3CPWZ 4A3GI 3CCUZ 3S14I 4DK1A 2JIPA 5D1OA 1VQNZ 3CCEZ 3CPWY 4BY7I 3CCE1 3CC4Z 1LQLA 3CC41 3M4OI 3GTMS 2V8JA 3S17I 2OTLZ 5IP9I 3J80b 2O4HA 2E7ZA 2HF1A 4A3CI 1S72Z 1Z02A 1I3QI 4NBFA 4A3KI 3I4MI 2YADA 2JA5I 5IP7I 1X3WA 5D1PA 2V8IA 1TFIA 2VUMI 3CCS1 3S1MI 2DE5A 2Q51A 1QF8A 4A3EI 1FDOA 3GTJI 2QREB 1YJNZ 1WIIA 5A2Qb 3M3YI 2IZ4A 3PO2I 1VQP1 3I4NI 5C4JI 2M6NA 1KQSZ 2NVYI 3GKQA 1VQMZ 1VQ5Z 3NDIA 4A3II 2QLVB 1Q862 1YJ91 2EGTA 1KC82 2VPZA 4HGZA 2YU9I 1NUIA 3CCLZ 1ML8A 1TWFI 3GTQI 1Y1VS 1Z01A 1YHQZ
chains in the Genus database with same CATH topology
1KD11 1TWAI 1VQOZ 3S16I 3S15I 2RPRA 3CCV1 1M1K2 3CCVZ 4NBEA 1QYPA 4BBSI 1N2FA 3S1QI 1YI2Z 1VQ91 1VQ41 2JR6A 3NFZA 2R93I 2OOYB 3TE5B 4NBHA 4E30A 4HH4A 2PK7A 1NJI1 1VLAA 3BG0B 2B63I 2K3RA 1X3ZA 1VQLZ 5T64A 3GCFA 3PO3S 1KQSY 2G2KA 2E2JI 3MONA 3CCJ1 3J81f 1Q7Y2 2DE7A 4NH1C 3G6EZ 4E33A 1KC81 5LL6f 2GU2A 5FLXb 2R6MA 3G711 2OTJZ 3IFUA 1K731 1KRLA 3I551 3I55Z 4TNUA 4NBAA 4NBDA 2DE6A 2VUGA 1YIT1 2H85A 4NBBA 1YITZ 3S2HI 1JJ2Y 2R92I 1Y1VI 1S721 2QEX1 4Y52I 4NBGA 3GTLI 2HU9A 3CXCY 1S7MA 1USPB 2LFUA 1L1OC 1NP6A 2M48A 4A3DI 3KIFA 1YIJ1 1Q821 1WW9A 3EERA 2W04A 2OZKA 1VQ71 1VQ8Z 3FQMA 4HGYA 3BG1B 3S1NI 2F4OA 1VQN1 3CCL1 2WAQA 3I07A 3T4NB 1Z03A 3EEDA 1VQ61 3CC7Z 4MD7A 1VQO1 4QTTA 2OTL1 4MRIA 1P9NA 5C3EI 3S2DI 1KD12 1R9TI 2P28A 2V8KA 1YUAA 1VQ9Z 1PFTA 4RS4A 2JA7I 1RO2A 3FQQA 3CCRZ 3CCSZ 3G4S1 4E2YA 4S1TA 2R7ZI 1RO4A 3CCR1 2VF1A 1DL6A 3CXCZ 1VQL1 3D9XA 3Q87A 1Q7Y1 4BBRI 3S1RI 1JWHC 4RVDA 1W2BY 2JUBA 2P3YA 2NVTI 1K83I 1RLYA 1VQ51 4QTUA 4NB8A 1Y1WI 3GTOI 2OTJ1 1QVFZ 3CCQ1 3VMIA 2PMZA 1I6HI 1VQK1 2E9HA 3CQZI 2GTIA 3D6WA 2IZ3A 2E2II 4E2XA 2BJOA 4E2ZA 2RBLA 1TWGI 2LIYA 1N8R2 3F3FC 3CCM1 1YJWZ 3CCMZ 4MH4A 4MD8A 5C44I 1QVFY 1VQ4Z 2QRDB 5AN9F 5IT9b 2AKLA 2QRCB 1YUKA 5IT9f 4DQYB 3NH5A 2JNYA 5A2Qf 3CCJZ 1K732 4EWCA 4BY1I 3NDJA 1ZH1A 1RNIA 2JS4A 1VQ7Z 3F3PC 1QVGY 4DGLA 3CD61 2KPIA 4NB9A 5T6BA 2ZAEB 2WB1A 4NOZA 4Y7NI 5FLXf 1Q812 3LUSA 2W03A 2GTHA 3GTMI 2QA4Z 3H0GI 2NVQI 3IX0A 2F4MA 2QEXZ 4NBCA 3CMAZ 2J6AA 3IF8A 2RHBA 4MD9A 3TDHB 2I3CA 2E2HI 1I50I 2QKDA 3JAMb 1USPA 4A3JI 3P5JB 1WCMI 3PO3I 2O53A 1X0TA 2JA6I 3HOXI 1VQ81 3CCQZ 3GTGI 1NJI2 4A3BI 3CCU1 3HOZI 1VQKZ 1YJ9Z 4E2WA 3I561 3VMHA 1Q822 3K7AI 3I56Z 1K8A1 2Q4ZA 4RV9A 1VQ6Z 1M901 3QWUA 4NFRA 3U50C 3NH4A 3VB9A 1M1K1 3CC71 1N8R1 3NH8A 3H3VJ 1YHQ1 1RO0A 1K9M1 2RIQA 1YJW1 1YI21 1JJ2Z 3RZDI 3J7A4 1M902 3FKII 2OOXB 3G4SZ 5CM2M 4E32A 3HOUI 4X6AI 4XX2A 5C4XI 3OW2Z 2JA8I 1K9M2 5D1OB 1RQFA 1YJN1 3ESWA 2JMOA 2RT9A 4CL1A 3KIHA 1TWHI 3HOYI 4RVGA 1VQPZ 1Q861 3G6E1 3HKZA 3CD6Z 1VQM1 3G71Z 3VMGA 5FLMI 4A3MI 2Y0SA 4RVFA 3MZKB 3VTNA 2PM9A 2QA41 1TWCI 3J81b 1ZB8A 4MONA 2NVXI 5T67A 4A93I 3CMA1 4MXUA 3JAMf 3MZLB 3CC21 4A3LI 3HOWI 3CC2Z 4A3FI 3GTKI 4AYBA 1W2BZ 1YIJZ 3RZOI 1ZB9A 1K8A2 4E31A 3GTPI 3HOVI 2K5RA 4BXXI 3OW2Y 4RVHA 2KI7B 3CME1 3J80f 1Q811 1SFOI 3CMEZ 1QVGZ 2QR1B 3CPWZ 4A3GI 3CCUZ 3S14I 4DK1A 5D1OA 1VQNZ 3CCEZ 3CPWY 4BY7I 3CCE1 3CC4Z 1LQLA 3CC41 3M4OI 3GTMS 2V8JA 3S17I 2OTLZ 5IP9I 3J80b 2O4HA 2HF1A 4A3CI 1S72Z 1Z02A 1I3QI 4NBFA 4A3KI 3I4MI 2YADA 2JA5I 5IP7I 1X3WA 5D1PA 2V8IA 1TFIA 2VUMI 3CCS1 3S1MI 2DE5A 2Q51A 1QF8A 4A3EI 3GTJI 2QREB 1YJNZ 1WIIA 5A2Qb 3M3YI 2IZ4A 3PO2I 1VQP1 3I4NI 5C4JI 2M6NA 1KQSZ 2NVYI 3GKQA 1VQMZ 1VQ5Z 3NDIA 4A3II 2QLVB 1Q862 1YJ91 2EGTA 1KC82 4HGZA 2YU9I 1NUIA 3CCLZ 1ML8A 1TWFI 3GTQI 1Y1VS 1Z01A 1YHQZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWA I;  1TWC I;  3S16 I;  1ZB8 A;  3GTM I;  3S15 I;  3H0G I;  2NVX I;  2NVQ I;  5C3E I;  3S2D I;  1R9T I;  4A93 I;  2F4M A;  4NBE A;  1QYP A;  4BBS I;  1N2F A;  1YUA A;  4NBC A;  3S1Q I;  1PFT A;  2JA7 I;  4A3L I;  3HOW I;  2J6A A;  4A3F I;  2JR6 A;  2R93 I;  2R7Z I;  1RO4 A;  4NBH A;  3GTK I;  1DL6 A;  2PK7 A;  1VLA A;  2B63 I;  3Q87 A;  2E2H I;  1I50 I;  3RZO I;  1ZB9 A;  1X3Z A;  3GTP I;  3GCF A;  3HOV I;  2K5R A;  3PO3 S;  1USP A;  4BXX I;  4A3J I;  4BBR I;  3S1R I;  2E2J I;  1WCM I;  3PO3 I;  2DE7 A;  1SFO I;  2P3Y A;  4A3G I;  2NVT I;  3S14 I;  1K83 I;  1RLY A;  3HOX I;  2JA6 I;  3GTG I;  4QTU A;  4NB8 A;  1Y1W I;  3GTO I;  4A3B I;  3VMI A;  3HOZ I;  1I6H I;  3LUS A;  4BY7 I;  3VMH A;  3K7A I;  1LQL A;  4NBA A;  3CQZ I;  3D6W A;  3M4O I;  4NBD A;  2DE6 A;  2E2I I;  3U50 C;  3GTM S;  2BJO A;  3S17 I;  3VB9 A;  2RBL A;  5IP9 I;  3H3V J;  4NBB A;  1TWG I;  3S2H I;  2R92 I;  1Y1V I;  4Y52 I;  2HF1 A;  4A3C I;  3RZD I;  1I3Q I;  4NBF A;  4MH4 A;  5C44 I;  3FKI I;  4NBG A;  4A3K I;  5CM2 M;  3GTL I;  3I4M I;  2JA5 I;  5IP7 I;  1X3W A;  2AKL A;  1TFI A;  1USP B;  2VUM I;  3S1M I;  2DE5 A;  3HOU I;  4X6A I;  1L1O C;  4A3E I;  4XX2 A;  5C4X I;  3GTJ I;  4A3D I;  2JA8 I;  2JNY A;  1WW9 A;  3ESW A;  3M3Y I;  4BY1 I;  3EER A;  1TWH I;  3PO2 I;  3HOY I;  3I4N I;  5C4J I;  2JS4 A;  2NVY I;  3GKQ A;  4A3I I;  3S1N I;  2KPI A;  4NB9 A;  2F4O A;  3VMG A;  5FLM I;  4A3M I;  2YU9 I;  1NUI A;  3I07 A;  1ML8 A;  4NOZ A;  4Y7N I;  1TWF I;  3GTQ I;  1Y1V S;  4QTT A; 
#chains in the Genus database with same CATH topology
 1KD1 1;  1TWA I;  1VQO Z;  3S16 I;  3S15 I;  2RPR A;  3CCV 1;  1M1K 2;  3CCV Z;  4NBE A;  1QYP A;  4BBS I;  1N2F A;  3S1Q I;  1YI2 Z;  1VQ9 1;  1VQ4 1;  2JR6 A;  3NFZ A;  2R93 I;  2OOY B;  3TE5 B;  4NBH A;  4E30 A;  4HH4 A;  2PK7 A;  1NJI 1;  1VLA A;  2VPY A;  3BG0 B;  2B63 I;  2K3R A;  1Y8C A;  1X3Z A;  1VQL Z;  5T64 A;  3GCF A;  3PO3 S;  1KQS Y;  2G2K A;  2E2J I;  3MON A;  3CCJ 1;  3J81 f;  1Q7Y 2;  2DE7 A;  4NH1 C;  3G6E Z;  4E33 A;  1KC8 1;  5LL6 f;  2GU2 A;  5FLX b;  2R6M A;  3G71 1;  2OTJ Z;  3IFU A;  1K73 1;  1KRL A;  2AYD A;  3I55 1;  1QXF A;  3I55 Z;  4TNU A;  4NBA A;  4NBD A;  2DE6 A;  2VUG A;  1WZN A;  1YIT 1;  2H85 A;  4NBB A;  1YIT Z;  3S2H I;  1JJ2 Y;  2R92 I;  1Y1V I;  1S72 1;  2QEX 1;  4Y52 I;  4NBG A;  3GTL I;  2HU9 A;  3CXC Y;  1S7M A;  1USP B;  2LFU A;  1L1O C;  1NP6 A;  2M48 A;  4A3D I;  3KIF A;  1YIJ 1;  1Q82 1;  1WW9 A;  3EER A;  2W04 A;  2OZK A;  1VQ7 1;  1VQ8 Z;  1SIW A;  3FQM A;  4HGY A;  3BG1 B;  3S1N I;  2F4O A;  1VQN 1;  3CCL 1;  2WAQ A;  2LEX A;  3I07 A;  3T4N B;  1Z03 A;  3EED A;  1VQ6 1;  3CC7 Z;  4MD7 A;  1VQO 1;  4QTT A;  2OTL 1;  4MRI A;  1P9N A;  5C3E I;  3S2D I;  1KD1 2;  1R9T I;  2P28 A;  2V8K A;  1YUA A;  1VQ9 Z;  1PFT A;  4RS4 A;  2JA7 I;  1RO2 A;  3FQQ A;  3CCR Z;  3CCS Z;  3G4S 1;  4E2Y A;  4S1T A;  2R7Z I;  1RO4 A;  3CCR 1;  2VF1 A;  1DL6 A;  3CXC Z;  1VQL 1;  3D9X A;  3Q87 A;  1Q7Y 1;  4BBR I;  3S1R I;  1JWH C;  4RVD A;  1W2B Y;  2JUB A;  2P3Y A;  2NVT I;  1K83 I;  1RLY A;  1VQ5 1;  4QTU A;  4NB8 A;  1Y1W I;  3GTO I;  2OTJ 1;  1QVF Z;  3CCQ 1;  3VMI A;  2PMZ A;  1I6H I;  1VQK 1;  2E9H A;  1WJ2 A;  3CQZ I;  2GTI A;  3D6W A;  2IZ3 A;  2E2I I;  4E2X A;  2BJO A;  4E2Z A;  2RBL A;  2VPX A;  1TWG I;  2LIY A;  1N8R 2;  3F3F C;  3CCM 1;  1YJW Z;  1AA6 A;  3CCM Z;  4MH4 A;  4MD8 A;  5C44 I;  3IR7 A;  1QVF Y;  1Q16 A;  1VQ4 Z;  2QRD B;  5AN9 F;  5IT9 b;  2AKL A;  2QRC B;  1YUK A;  5IT9 f;  4DQY B;  3NH5 A;  2JNY A;  5A2Q f;  2IV2 X;  3CCJ Z;  1K73 2;  4EWC A;  4BY1 I;  3NDJ A;  3D2L A;  1ZH1 A;  1RNI A;  2JS4 A;  1VQ7 Z;  3F3P C;  2JIO A;  2JIR A;  1QVG Y;  4DGL A;  3CD6 1;  2KPI A;  4NB9 A;  5T6B A;  2ZAE B;  2WB1 A;  4NOZ A;  4Y7N I;  5FLX f;  1Q81 2;  3LUS A;  2W03 A;  2GTH A;  2NAP A;  3GTM I;  2QA4 Z;  3H0G I;  2NVQ I;  3IX0 A;  2F4M A;  2QEX Z;  4NBC A;  3CMA Z;  2J6A A;  3IF8 A;  2JIM A;  2RHB A;  4MD9 A;  3TDH B;  2I3C A;  2E2H I;  1I50 I;  2QKD A;  3JAM b;  1USP A;  4A3J I;  3P5J B;  1WCM I;  3PO3 I;  2O53 A;  1X0T A;  2JA6 I;  3HOX I;  1VQ8 1;  3CCQ Z;  3GTG I;  1NJI 2;  4A3B I;  3CCU 1;  3HOZ I;  1VQK Z;  1YJ9 Z;  4E2W A;  3I56 1;  1FDI A;  3VMH A;  1Q82 2;  3K7A I;  3I56 Z;  1K8A 1;  2Q4Z A;  4RV9 A;  1VQ6 Z;  1M90 1;  3QWU A;  4NFR A;  3U50 C;  3NH4 A;  3VB9 A;  1M1K 1;  3CC7 1;  1N8R 1;  3NH8 A;  3H3V J;  1YHQ 1;  1RO0 A;  1K9M 1;  2RIQ A;  1YJW 1;  1YI2 1;  1JJ2 Z;  3RZD I;  3J7A 4;  1M90 2;  3FKI I;  2OOX B;  2VPW A;  3G4S Z;  5CM2 M;  4E32 A;  3HOU I;  4X6A I;  4XX2 A;  5C4X I;  3OW2 Z;  2JA8 I;  1K9M 2;  5D1O B;  1RQF A;  1YJN 1;  3ESW A;  2JMO A;  2V3V A;  2RT9 A;  4CL1 A;  3KIH A;  1TWH I;  3HOY I;  4RVG A;  1VQP Z;  1Q86 1;  3G6E 1;  3HKZ A;  3CD6 Z;  1VQM 1;  3G71 Z;  3VMG A;  5FLM I;  4A3M I;  2Y0S A;  4RVF A;  3MZK B;  3VTN A;  2PM9 A;  2QA4 1;  1TWC I;  3J81 b;  1ZB8 A;  4MON A;  2NVX I;  2V45 A;  5T67 A;  4A93 I;  3CMA 1;  4MXU A;  3JAM f;  3MZL B;  3CC2 1;  4A3L I;  3HOW I;  3CC2 Z;  4A3F I;  3GTK I;  4AYB A;  1W2B Z;  1YIJ Z;  3RZO I;  1ZB9 A;  1K8A 2;  4E31 A;  3GTP I;  3HOV I;  2K5R A;  4BXX I;  3OW2 Y;  4RVH A;  2KI7 B;  2JIQ A;  3CME 1;  3J80 f;  1Q81 1;  1SFO I;  3CME Z;  1QVG Z;  2QR1 B;  3CPW Z;  4A3G I;  3CCU Z;  3S14 I;  4DK1 A;  2JIP A;  5D1O A;  1VQN Z;  3CCE Z;  3CPW Y;  4BY7 I;  3CCE 1;  3CC4 Z;  1LQL A;  3CC4 1;  3M4O I;  3GTM S;  2V8J A;  3S17 I;  2OTL Z;  5IP9 I;  3J80 b;  2O4H A;  2E7Z A;  2HF1 A;  4A3C I;  1S72 Z;  1Z02 A;  1I3Q I;  4NBF A;  4A3K I;  3I4M I;  2YAD A;  2JA5 I;  5IP7 I;  1X3W A;  5D1P A;  2V8I A;  1TFI A;  2VUM I;  3CCS 1;  3S1M I;  2DE5 A;  2Q51 A;  1QF8 A;  4A3E I;  1FDO A;  3GTJ I;  2QRE B;  1YJN Z;  1WII A;  5A2Q b;  3M3Y I;  2IZ4 A;  3PO2 I;  1VQP 1;  3I4N I;  5C4J I;  2M6N A;  1KQS Z;  2NVY I;  3GKQ A;  1VQM Z;  1VQ5 Z;  3NDI A;  4A3I I;  2QLV B;  1Q86 2;  1YJ9 1;  2EGT A;  1KC8 2;  2VPZ A;  4HGZ A;  2YU9 I;  1NUI A;  3CCL Z;  1ML8 A;  1TWF I;  3GTQ I;  1Y1V S;  1Z01 A;  1YHQ Z; 
#chains in the Genus database with same CATH homology
 1KD1 1;  1TWA I;  1VQO Z;  3S16 I;  3S15 I;  2RPR A;  3CCV 1;  1M1K 2;  3CCV Z;  4NBE A;  1QYP A;  4BBS I;  1N2F A;  3S1Q I;  1YI2 Z;  1VQ9 1;  1VQ4 1;  2JR6 A;  3NFZ A;  2R93 I;  2OOY B;  3TE5 B;  4NBH A;  4E30 A;  4HH4 A;  2PK7 A;  1NJI 1;  1VLA A;  3BG0 B;  2B63 I;  2K3R A;  1X3Z A;  1VQL Z;  5T64 A;  3GCF A;  3PO3 S;  1KQS Y;  2G2K A;  2E2J I;  3MON A;  3CCJ 1;  3J81 f;  1Q7Y 2;  2DE7 A;  4NH1 C;  3G6E Z;  4E33 A;  1KC8 1;  5LL6 f;  2GU2 A;  5FLX b;  2R6M A;  3G71 1;  2OTJ Z;  3IFU A;  1K73 1;  1KRL A;  3I55 1;  3I55 Z;  4TNU A;  4NBA A;  4NBD A;  2DE6 A;  2VUG A;  1YIT 1;  2H85 A;  4NBB A;  1YIT Z;  3S2H I;  1JJ2 Y;  2R92 I;  1Y1V I;  1S72 1;  2QEX 1;  4Y52 I;  4NBG A;  3GTL I;  2HU9 A;  3CXC Y;  1S7M A;  1USP B;  2LFU A;  1L1O C;  1NP6 A;  2M48 A;  4A3D I;  3KIF A;  1YIJ 1;  1Q82 1;  1WW9 A;  3EER A;  2W04 A;  2OZK A;  1VQ7 1;  1VQ8 Z;  3FQM A;  4HGY A;  3BG1 B;  3S1N I;  2F4O A;  1VQN 1;  3CCL 1;  2WAQ A;  3I07 A;  3T4N B;  1Z03 A;  3EED A;  1VQ6 1;  3CC7 Z;  4MD7 A;  1VQO 1;  4QTT A;  2OTL 1;  4MRI A;  1P9N A;  5C3E I;  3S2D I;  1KD1 2;  1R9T I;  2P28 A;  2V8K A;  1YUA A;  1VQ9 Z;  1PFT A;  4RS4 A;  2JA7 I;  1RO2 A;  3FQQ A;  3CCR Z;  3CCS Z;  3G4S 1;  4E2Y A;  4S1T A;  2R7Z I;  1RO4 A;  3CCR 1;  2VF1 A;  1DL6 A;  3CXC Z;  1VQL 1;  3D9X A;  3Q87 A;  1Q7Y 1;  4BBR I;  3S1R I;  1JWH C;  4RVD A;  1W2B Y;  2JUB A;  2P3Y A;  2NVT I;  1K83 I;  1RLY A;  1VQ5 1;  4QTU A;  4NB8 A;  1Y1W I;  3GTO I;  2OTJ 1;  1QVF Z;  3CCQ 1;  3VMI A;  2PMZ A;  1I6H I;  1VQK 1;  2E9H A;  3CQZ I;  2GTI A;  3D6W A;  2IZ3 A;  2E2I I;  4E2X A;  2BJO A;  4E2Z A;  2RBL A;  1TWG I;  2LIY A;  1N8R 2;  3F3F C;  3CCM 1;  1YJW Z;  3CCM Z;  4MH4 A;  4MD8 A;  5C44 I;  1QVF Y;  1VQ4 Z;  2QRD B;  5AN9 F;  5IT9 b;  2AKL A;  2QRC B;  1YUK A;  5IT9 f;  4DQY B;  3NH5 A;  2JNY A;  5A2Q f;  3CCJ Z;  1K73 2;  4EWC A;  4BY1 I;  3NDJ A;  1ZH1 A;  1RNI A;  2JS4 A;  1VQ7 Z;  3F3P C;  1QVG Y;  4DGL A;  3CD6 1;  2KPI A;  4NB9 A;  5T6B A;  2ZAE B;  2WB1 A;  4NOZ A;  4Y7N I;  5FLX f;  1Q81 2;  3LUS A;  2W03 A;  2GTH A;  3GTM I;  2QA4 Z;  3H0G I;  2NVQ I;  3IX0 A;  2F4M A;  2QEX Z;  4NBC A;  3CMA Z;  2J6A A;  3IF8 A;  2RHB A;  4MD9 A;  3TDH B;  2I3C A;  2E2H I;  1I50 I;  2QKD A;  3JAM b;  1USP A;  4A3J I;  3P5J B;  1WCM I;  3PO3 I;  2O53 A;  1X0T A;  2JA6 I;  3HOX I;  1VQ8 1;  3CCQ Z;  3GTG I;  1NJI 2;  4A3B I;  3CCU 1;  3HOZ I;  1VQK Z;  1YJ9 Z;  4E2W A;  3I56 1;  3VMH A;  1Q82 2;  3K7A I;  3I56 Z;  1K8A 1;  2Q4Z A;  4RV9 A;  1VQ6 Z;  1M90 1;  3QWU A;  4NFR A;  3U50 C;  3NH4 A;  3VB9 A;  1M1K 1;  3CC7 1;  1N8R 1;  3NH8 A;  3H3V J;  1YHQ 1;  1RO0 A;  1K9M 1;  2RIQ A;  1YJW 1;  1YI2 1;  1JJ2 Z;  3RZD I;  3J7A 4;  1M90 2;  3FKI I;  2OOX B;  3G4S Z;  5CM2 M;  4E32 A;  3HOU I;  4X6A I;  4XX2 A;  5C4X I;  3OW2 Z;  2JA8 I;  1K9M 2;  5D1O B;  1RQF A;  1YJN 1;  3ESW A;  2JMO A;  2RT9 A;  4CL1 A;  3KIH A;  1TWH I;  3HOY I;  4RVG A;  1VQP Z;  1Q86 1;  3G6E 1;  3HKZ A;  3CD6 Z;  1VQM 1;  3G71 Z;  3VMG A;  5FLM I;  4A3M I;  2Y0S A;  4RVF A;  3MZK B;  3VTN A;  2PM9 A;  2QA4 1;  1TWC I;  3J81 b;  1ZB8 A;  4MON A;  2NVX I;  5T67 A;  4A93 I;  3CMA 1;  4MXU A;  3JAM f;  3MZL B;  3CC2 1;  4A3L I;  3HOW I;  3CC2 Z;  4A3F I;  3GTK I;  4AYB A;  1W2B Z;  1YIJ Z;  3RZO I;  1ZB9 A;  1K8A 2;  4E31 A;  3GTP I;  3HOV I;  2K5R A;  4BXX I;  3OW2 Y;  4RVH A;  2KI7 B;  3CME 1;  3J80 f;  1Q81 1;  1SFO I;  3CME Z;  1QVG Z;  2QR1 B;  3CPW Z;  4A3G I;  3CCU Z;  3S14 I;  4DK1 A;  5D1O A;  1VQN Z;  3CCE Z;  3CPW Y;  4BY7 I;  3CCE 1;  3CC4 Z;  1LQL A;  3CC4 1;  3M4O I;  3GTM S;  2V8J A;  3S17 I;  2OTL Z;  5IP9 I;  3J80 b;  2O4H A;  2HF1 A;  4A3C I;  1S72 Z;  1Z02 A;  1I3Q I;  4NBF A;  4A3K I;  3I4M I;  2YAD A;  2JA5 I;  5IP7 I;  1X3W A;  5D1P A;  2V8I A;  1TFI A;  2VUM I;  3CCS 1;  3S1M I;  2DE5 A;  2Q51 A;  1QF8 A;  4A3E I;  3GTJ I;  2QRE B;  1YJN Z;  1WII A;  5A2Q b;  3M3Y I;  2IZ4 A;  3PO2 I;  1VQP 1;  3I4N I;  5C4J I;  2M6N A;  1KQS Z;  2NVY I;  3GKQ A;  1VQM Z;  1VQ5 Z;  3NDI A;  4A3I I;  2QLV B;  1Q86 2;  1YJ9 1;  2EGT A;  1KC8 2;  4HGZ A;  2YU9 I;  1NUI A;  3CCL Z;  1ML8 A;  1TWF I;  3GTQ I;  1Y1V S;  1Z01 A;  1YHQ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...