3S15I

Rna polymerase ii initiation complex with a 7-nt rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s15I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s15I02
1X3ZA 3VB9A 1YUAA 4NBHA 1PFTA 3I07A 2K5RA 3H0GI 4A3DI 1Y1WI 1K83I 1N2FA 4NBAA 2E2JI 4NBDA 3LUSA 2JA7I 4XX2A 4A3JI 1TWCI 2E2HI 2B63I 1SFOI 3GTKI 2NVXI 2AKLA 3VMHA 3HOUI 1L1OC 3GKQA 4A3II 4A3GI 5CM2M 1RO4A 3EERA 2R92I 1USPA 2JNYA 3GTJI 2PK7A 3ESWA 3S1MI 1TWAI 4A3LI 1ZB9A 3S2DI 4NBFA 4QTTA 3U50C 2JS4A 3HOXI 3S1NI 3K7AI 4A3KI 4Y7NI 4BY1I 3VMIA 4NBCA 4BY7I 3RZDI 4NBBA 1WCMI 4A3CI 3CQZI 2E2II 3S16I 1I6HI 2JA6I 2F4MA 4MH4A 1TWHI 3GTGI 4QTUA 2YU9I 3HOYI 1Y1VS 2JA5I 4A3MI 2F4OA 4A3FI 3D6WA 1TWFI 1NUIA 2J6AA 1I3QI 5C4XI 4A3EI 5FLMI 2KPIA 3PO2I 1I50I 1ZB8A 1TFIA 4NOZA 2BJOA 3M3YI 3RZOI 3M4OI 4X6AI 3GTPI 1X3WA 3S1RI 4A3BI 3Q87A 1USPB 5IP9I 3GTMS 4BXXI 1Y1VI 3H3VJ 4A93I 2NVTI 2HF1A 3S17I 3PO3S 5C44I 3I4NI 4NB9A 3VMGA 3S14I 1TWGI 3I4MI 5IP7I 4NBEA 3S15I 2P3YA 4NBGA 3HOZI 1R9TI 3GTQI 2R93I 2NVQI 3GTLI 2R7ZI 4NB8A 1RLYA 3FKII 1QYPA 1VLAA 3GTMI 5C4JI 3PO3I 3GTOI 3HOVI 3GCFA 4BBSI 2DE6A 2DE5A 4Y52I 3S1QI 3HOWI 5C3EI 1ML8A 1DL6A 2JR6A 2DE7A 2JA8I 3S2HI 2RBLA 1WW9A 2NVYI 4BBRI 2VUMI 1LQLA
chains in the Genus database with same CATH superfamily
1X3ZA 2Y0SA 1SIWA 3CCVZ 3NDJA 1Y1WI 3KIFA 3CME1 1VQK1 2E2JI 1VQNZ 2OOXB 3CCM1 2OTL1 2JA7I 1SFOI 2VUGA 2AKLA 2VPXA 3VMHA 1L1OC 3GKQA 3EERA 2JIQA 3CCE1 4E33A 2RHBA 2JIRA 3J81b 4A3LI 1ZB9A 3G6E1 1KQSZ 1YI2Z 1YJWZ 2JS4A 3FQMA 3HOXI 3S1NI 4Y7NI 1WZNA 3CCQ1 2VF1A 1YJNZ 1Q811 2JA6I 4DQYB 1QXFA 1Q16A 2F4MA 4RV9A 2M48A 4RVGA 5AN9F 1Z03A 2Q51A 3VTNA 4HGYA 4A3FI 1VQ61 1NUIA 1I3QI 5C4XI 1WIIA 4MXUA 1I50I 2BJOA 1YUKA 3M3YI 3CC41 1NP6A 1VQ41 2O4HA 4E32A 1USPB 1Y1VI 5A2Qb 4A93I 2NVTI 2HF1A 2V3VA 3FQQA 4NB9A 3CC21 3VMGA 1KRLA 1TWGI 3CMAZ 3NH4A 4NBEA 5IP7I 5LL6f 1Q7Y2 3CCJ1 3J81f 1R9TI 2GTIA 2V8JA 2NVQI 1QVGY 1S721 1K8A2 1X0TA 1YIT1 1VQKZ 3MONA 3I551 1K731 3GTMI 3CCMZ 2OTLZ 1Z01A 4BBSI 2DE6A 1VQ5Z 3HOWI 1ML8A 1FDIA 4NH1C 2DE7A 4BBRI 3CCEZ 4E30A 3P5JB 3CPWZ 4NBHA 2JIPA 3G711 3BG0B 4A3DI 1K83I 2I3CA 4DGLA 2OTJ1 2OOYB 5D1OA 3CCQZ 3TDHB 3LUSA 3G4S1 2VPZA 2B63I 1K9M1 2NVXI 2P28A 4NFRA 1Q862 4AYBA 3CCU1 5D1OB 1VQ6Z 2PK7A 1TWAI 4E31A 1N8R2 4TNUA 1KD12 3NH8A 2QREB 4MD9A 3VMIA 3CC4Z 4BY7I 1VQ4Z 3TE5B 1Q822 1W2BY 1JJ2Y 4MH4A 3CC2Z 3NDIA 2JIMA 3J80f 2M6NA 2YU9I 2H85A 1Y1VS 3CCJZ 2O53A 1TWFI 1M1K2 1S72Z 2J6AA 3CCR1 4A3EI 2W04A 2K3RA 1ZB8A 3I55Z 1RQFA 4X6AI 1FDOA 3S1RI 1VQ71 4MRIA 3GTMS 3I4MI 1KQSY 3S15I 2P3YA 4MONA 2RT9A 1KC82 1VQP1 3GTLI 1VQ81 3FKII 2OTJZ 4CL1A 3G4SZ 1YJ91 4MD7A 2EGTA 3GCFA 2QRDB 3BG1B 1VQ91 1DL6A 2IV2X 2R6MA 2NVYI 1Q7Y1 2LEXA 2G2KA 1VQL1 1YUAA 1K8A1 4E2ZA 3HKZA 3CMEZ 3NH5A 1WJ2A 3JAMb 4E2WA 3MZLB 4NBDA 5D1PA 2PMZA 1M902 4XX2A 3IFUA 4A3JI 2IZ3A 2WAQA 1VQO1 3HOUI 1QVFZ 4A3GI 3CCL1 3CCRZ 3S1MI 3CXCZ 1S7MA 3S2DI 3G6EZ 2IZ4A 3CD61 4A3KI 4BY1I 2HU9A 4NBCA 4NBBA 2KI7B 1VQ7Z 4A3CI 3EEDA 1YJN1 1NJI2 1I6HI 2RIQA 5A2Qf 3CPWY 5IT9b 1Q861 1TWHI 3GTGI 4QTUA 2F4OA 4RVDA 3D6WA 1YIJ1 2V45A 1AA6A 1VQPZ 1VQ8Z 2QA41 2KPIA 2QLVB 3T4NB 4RVFA 1YJ9Z 3GTPI 1X3WA 1Q821 3OW2Y 4S1TA 4A3BI 3Q87A 5IP9I 1VQ9Z 3H3VJ 1YHQ1 5C44I 3I4NI 1QF8A 4EWCA 3S14I 3CMA1 2GTHA 1VQLZ 1JJ2Z 4NBGA 1M1K1 2W03A 4NB8A 1RLYA 1YITZ 1VLAA 2YADA 1VQM1 5C4JI 4MD8A 3PO3I 3GTOI 3HOVI 4HGZA 5IT9f 2DE5A 1VQ51 1VQOZ 1RO0A 3CC71 5C3EI 2JR6A 2WB1A 3S2HI 3QWUA 2RBLA 3CCLZ 2OZKA 1KC81 3VB9A 4RVHA 3D2LA 5FLXb 1PFTA 3NFZA 3I07A 2K5RA 3H0GI 3G71Z 5T67A 3F3PC 3CD6Z 1N2FA 4NBAA 3I561 1RO2A 3CCS1 1TWCI 2E2HI 3MZKB 3GTKI 1Q812 2QR1B 2JIOA 2PM9A 4A3II 5CM2M 1RO4A 2R92I 2QEX1 1USPA 3CCUZ 2JNYA 2NAPA 3GTJI 1YIJZ 3ESWA 2V8IA 2QA4Z 3CCV1 2VPYA 4E2XA 4NBFA 3J7A4 4QTTA 3U50C 2ZAEB 4RS4A 3K7AI 5T6BA 1VQN1 1M901 3RZDI 2RPRA 1QVGZ 1WCMI 2JMOA 3CQZI 2E2II 3S16I 1YHQZ 3D9XA 3IF8A 5FLXf 3HOYI 2JA5I 4A3MI 5FLMI 3PO2I 2VPWA 3F3FC 1YI21 1TFIA 4NOZA 1VQMZ 1YJW1 3RZOI 3M4OI 1K732 5T64A 4DK1A 2LFUA 1NJI1 1QVFY 1Z02A 4BXXI 3CC7Z 1JWHC 3S17I 3PO3S 3CXCY 2V8KA 4E2YA 2QKDA 1Y8CA 3J80b 2Q4ZA 2E7ZA 2LIYA 3HOZI 3GTQI 2R93I 2R7ZI 3IR7A 1QYPA 4HH4A 3IX0A 1N8R1 3JAMf 1KD11 1P9NA 2QRCB 3I56Z 3CCSZ 1RNIA 1ZH1A 2GU2A 3KIHA 4Y52I 2JUBA 3S1QI 1K9M2 3OW2Z 2JA8I 2AYDA 1WW9A 2QEXZ 2E9HA 2VUMI 1W2BZ 1LQLA
chains in the Genus database with same CATH topology
1X3ZA 2Y0SA 3CCVZ 3NDJA 1Y1WI 3KIFA 3CME1 1VQK1 2E2JI 1VQNZ 2OOXB 3CCM1 2OTL1 2JA7I 1SFOI 2VUGA 2AKLA 3VMHA 1L1OC 3GKQA 3EERA 3CCE1 4E33A 2RHBA 3J81b 4A3LI 1ZB9A 3G6E1 1KQSZ 1YI2Z 1YJWZ 2JS4A 3FQMA 3HOXI 3S1NI 4Y7NI 3CCQ1 2VF1A 1YJNZ 1Q811 2JA6I 4DQYB 4RV9A 2F4MA 2M48A 4RVGA 5AN9F 1Z03A 2Q51A 3VTNA 4HGYA 4A3FI 1VQ61 1NUIA 1I3QI 5C4XI 1WIIA 4MXUA 1I50I 2BJOA 1YUKA 3M3YI 3CC41 1NP6A 1VQ41 2O4HA 4E32A 1USPB 1Y1VI 5A2Qb 4A93I 2NVTI 2HF1A 3FQQA 4NB9A 3CC21 3VMGA 1KRLA 1TWGI 3CMAZ 3NH4A 4NBEA 5IP7I 5LL6f 1Q7Y2 3CCJ1 3J81f 1R9TI 2GTIA 2V8JA 2NVQI 1QVGY 1S721 1K8A2 1X0TA 1YIT1 1VQKZ 3MONA 3I551 1K731 3GTMI 3CCMZ 2OTLZ 1Z01A 4BBSI 2DE6A 1VQ5Z 3HOWI 1ML8A 4NH1C 2DE7A 4BBRI 3CCEZ 4E30A 3P5JB 3CPWZ 4NBHA 3G711 3BG0B 4A3DI 1K83I 2I3CA 4DGLA 2OTJ1 2OOYB 5D1OA 3CCQZ 3TDHB 3LUSA 3G4S1 2B63I 1K9M1 2NVXI 2P28A 4NFRA 1Q862 4AYBA 3CCU1 5D1OB 1VQ6Z 2PK7A 1TWAI 4E31A 1N8R2 4TNUA 1KD12 3NH8A 2QREB 4MD9A 3VMIA 3CC4Z 4BY7I 1VQ4Z 3TE5B 1Q822 1W2BY 1JJ2Y 4MH4A 3CC2Z 3NDIA 3J80f 2M6NA 2YU9I 2H85A 1Y1VS 3CCJZ 2O53A 1TWFI 1M1K2 1S72Z 2J6AA 3CCR1 4A3EI 2W04A 2K3RA 1ZB8A 3I55Z 1RQFA 4X6AI 3S1RI 1VQ71 4MRIA 3GTMS 3I4MI 1KQSY 3S15I 2P3YA 4MONA 2RT9A 1KC82 1VQP1 3GTLI 1VQ81 3FKII 2OTJZ 4CL1A 3G4SZ 1YJ91 4MD7A 2EGTA 3GCFA 2QRDB 3BG1B 1VQ91 1DL6A 2R6MA 2NVYI 1Q7Y1 2G2KA 1VQL1 1YUAA 1K8A1 4E2ZA 3HKZA 3CMEZ 3NH5A 3JAMb 4E2WA 3MZLB 4NBDA 5D1PA 2PMZA 1M902 4XX2A 3IFUA 4A3JI 2IZ3A 2WAQA 1VQO1 3HOUI 1QVFZ 4A3GI 3CCL1 3CCRZ 3S1MI 3CXCZ 1S7MA 3S2DI 3G6EZ 2IZ4A 3CD61 4A3KI 4BY1I 2HU9A 4NBCA 4NBBA 2KI7B 1VQ7Z 4A3CI 3EEDA 1YJN1 1NJI2 1I6HI 2RIQA 5A2Qf 3CPWY 5IT9b 1Q861 1TWHI 3GTGI 4QTUA 2F4OA 4RVDA 3D6WA 1YIJ1 1VQPZ 1VQ8Z 2QA41 2KPIA 2QLVB 3T4NB 4RVFA 1YJ9Z 3GTPI 1X3WA 1Q821 3OW2Y 4S1TA 4A3BI 3Q87A 5IP9I 1VQ9Z 3H3VJ 1YHQ1 5C44I 3I4NI 1QF8A 4EWCA 3S14I 3CMA1 2GTHA 1VQLZ 1JJ2Z 4NBGA 1M1K1 2W03A 4NB8A 1RLYA 1YITZ 1VLAA 2YADA 1VQM1 5C4JI 4MD8A 3PO3I 3GTOI 3HOVI 4HGZA 5IT9f 2DE5A 1VQ51 1VQOZ 1RO0A 3CC71 5C3EI 2JR6A 2WB1A 3S2HI 3QWUA 2RBLA 3CCLZ 2OZKA 1KC81 3VB9A 4RVHA 5FLXb 1PFTA 3NFZA 3I07A 2K5RA 3H0GI 3G71Z 5T67A 3F3PC 3CD6Z 1N2FA 4NBAA 3I561 1RO2A 3CCS1 1TWCI 2E2HI 3MZKB 3GTKI 1Q812 2QR1B 2PM9A 4A3II 5CM2M 1RO4A 2R92I 2QEX1 1USPA 3CCUZ 2JNYA 3GTJI 1YIJZ 3ESWA 2V8IA 2QA4Z 3CCV1 4E2XA 4NBFA 3J7A4 4QTTA 3U50C 2ZAEB 4RS4A 3K7AI 5T6BA 1VQN1 1M901 3RZDI 2RPRA 1QVGZ 1WCMI 2JMOA 3CQZI 2E2II 3S16I 1YHQZ 3D9XA 3IF8A 5FLXf 3HOYI 2JA5I 4A3MI 5FLMI 3PO2I 3F3FC 1YI21 1TFIA 4NOZA 1VQMZ 1YJW1 3RZOI 3M4OI 1K732 5T64A 4DK1A 2LFUA 1NJI1 1QVFY 1Z02A 4BXXI 3CC7Z 1JWHC 3S17I 3PO3S 3CXCY 2V8KA 4E2YA 2QKDA 3J80b 2Q4ZA 2LIYA 3HOZI 3GTQI 2R93I 2R7ZI 1QYPA 4HH4A 3IX0A 1N8R1 3JAMf 1KD11 1P9NA 2QRCB 3I56Z 3CCSZ 1RNIA 1ZH1A 2GU2A 3KIHA 4Y52I 2JUBA 3S1QI 1K9M2 3OW2Z 2JA8I 1WW9A 2QEXZ 2E9HA 2VUMI 1W2BZ 1LQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3Z A;  3VB9 A;  1YUA A;  4NBH A;  1PFT A;  3I07 A;  2K5R A;  3H0G I;  4A3D I;  1Y1W I;  1K83 I;  1N2F A;  4NBA A;  2E2J I;  4NBD A;  3LUS A;  2JA7 I;  4XX2 A;  4A3J I;  1TWC I;  2E2H I;  2B63 I;  1SFO I;  3GTK I;  2NVX I;  2AKL A;  3VMH A;  3HOU I;  1L1O C;  3GKQ A;  4A3I I;  4A3G I;  5CM2 M;  1RO4 A;  3EER A;  2R92 I;  1USP A;  2JNY A;  3GTJ I;  2PK7 A;  3ESW A;  3S1M I;  1TWA I;  4A3L I;  1ZB9 A;  3S2D I;  4NBF A;  4QTT A;  3U50 C;  2JS4 A;  3HOX I;  3S1N I;  3K7A I;  4A3K I;  4Y7N I;  4BY1 I;  3VMI A;  4NBC A;  4BY7 I;  3RZD I;  4NBB A;  1WCM I;  4A3C I;  3CQZ I;  2E2I I;  3S16 I;  1I6H I;  2JA6 I;  2F4M A;  4MH4 A;  1TWH I;  3GTG I;  4QTU A;  2YU9 I;  3HOY I;  1Y1V S;  2JA5 I;  4A3M I;  2F4O A;  4A3F I;  3D6W A;  1TWF I;  1NUI A;  2J6A A;  1I3Q I;  5C4X I;  4A3E I;  5FLM I;  2KPI A;  3PO2 I;  1I50 I;  1ZB8 A;  1TFI A;  4NOZ A;  2BJO A;  3M3Y I;  3RZO I;  3M4O I;  4X6A I;  3GTP I;  1X3W A;  3S1R I;  4A3B I;  3Q87 A;  1USP B;  5IP9 I;  3GTM S;  4BXX I;  1Y1V I;  3H3V J;  4A93 I;  2NVT I;  2HF1 A;  3S17 I;  3PO3 S;  5C44 I;  3I4N I;  4NB9 A;  3VMG A;  3S14 I;  1TWG I;  3I4M I;  5IP7 I;  4NBE A;  3S15 I;  2P3Y A;  4NBG A;  3HOZ I;  1R9T I;  3GTQ I;  2R93 I;  2NVQ I;  3GTL I;  2R7Z I;  4NB8 A;  1RLY A;  3FKI I;  1QYP A;  1VLA A;  3GTM I;  5C4J I;  3PO3 I;  3GTO I;  3HOV I;  3GCF A;  4BBS I;  2DE6 A;  2DE5 A;  4Y52 I;  3S1Q I;  3HOW I;  5C3E I;  1ML8 A;  1DL6 A;  2JR6 A;  2DE7 A;  2JA8 I;  3S2H I;  2RBL A;  1WW9 A;  2NVY I;  4BBR I;  2VUM I;  1LQL A; 
#chains in the Genus database with same CATH topology
 1X3Z A;  2Y0S A;  1SIW A;  3CCV Z;  3NDJ A;  1Y1W I;  3KIF A;  3CME 1;  1VQK 1;  2E2J I;  1VQN Z;  2OOX B;  3CCM 1;  2OTL 1;  2JA7 I;  1SFO I;  2VUG A;  2AKL A;  2VPX A;  3VMH A;  1L1O C;  3GKQ A;  3EER A;  2JIQ A;  3CCE 1;  4E33 A;  2RHB A;  2JIR A;  3J81 b;  4A3L I;  1ZB9 A;  3G6E 1;  1KQS Z;  1YI2 Z;  1YJW Z;  2JS4 A;  3FQM A;  3HOX I;  3S1N I;  4Y7N I;  1WZN A;  3CCQ 1;  2VF1 A;  1YJN Z;  1Q81 1;  2JA6 I;  4DQY B;  1QXF A;  1Q16 A;  2F4M A;  4RV9 A;  2M48 A;  4RVG A;  5AN9 F;  1Z03 A;  2Q51 A;  3VTN A;  4HGY A;  4A3F I;  1VQ6 1;  1NUI A;  1I3Q I;  5C4X I;  1WII A;  4MXU A;  1I50 I;  2BJO A;  1YUK A;  3M3Y I;  3CC4 1;  1NP6 A;  1VQ4 1;  2O4H A;  4E32 A;  1USP B;  1Y1V I;  5A2Q b;  4A93 I;  2NVT I;  2HF1 A;  2V3V A;  3FQQ A;  4NB9 A;  3CC2 1;  3VMG A;  1KRL A;  1TWG I;  3CMA Z;  3NH4 A;  4NBE A;  5IP7 I;  5LL6 f;  1Q7Y 2;  3CCJ 1;  3J81 f;  1R9T I;  2GTI A;  2V8J A;  2NVQ I;  1QVG Y;  1S72 1;  1K8A 2;  1X0T A;  1YIT 1;  1VQK Z;  3MON A;  3I55 1;  1K73 1;  3GTM I;  3CCM Z;  2OTL Z;  1Z01 A;  4BBS I;  2DE6 A;  1VQ5 Z;  3HOW I;  1ML8 A;  1FDI A;  4NH1 C;  2DE7 A;  4BBR I;  3CCE Z;  4E30 A;  3P5J B;  3CPW Z;  4NBH A;  2JIP A;  3G71 1;  3BG0 B;  4A3D I;  1K83 I;  2I3C A;  4DGL A;  2OTJ 1;  2OOY B;  5D1O A;  3CCQ Z;  3TDH B;  3LUS A;  3G4S 1;  2VPZ A;  2B63 I;  1K9M 1;  2NVX I;  2P28 A;  4NFR A;  1Q86 2;  4AYB A;  3CCU 1;  5D1O B;  1VQ6 Z;  2PK7 A;  1TWA I;  4E31 A;  1N8R 2;  4TNU A;  1KD1 2;  3NH8 A;  2QRE B;  4MD9 A;  3VMI A;  3CC4 Z;  4BY7 I;  1VQ4 Z;  3TE5 B;  1Q82 2;  1W2B Y;  1JJ2 Y;  4MH4 A;  3CC2 Z;  3NDI A;  2JIM A;  3J80 f;  2M6N A;  2YU9 I;  2H85 A;  1Y1V S;  3CCJ Z;  2O53 A;  1TWF I;  1M1K 2;  1S72 Z;  2J6A A;  3CCR 1;  4A3E I;  2W04 A;  2K3R A;  1ZB8 A;  3I55 Z;  1RQF A;  4X6A I;  1FDO A;  3S1R I;  1VQ7 1;  4MRI A;  3GTM S;  3I4M I;  1KQS Y;  3S15 I;  2P3Y A;  4MON A;  2RT9 A;  1KC8 2;  1VQP 1;  3GTL I;  1VQ8 1;  3FKI I;  2OTJ Z;  4CL1 A;  3G4S Z;  1YJ9 1;  4MD7 A;  2EGT A;  3GCF A;  2QRD B;  3BG1 B;  1VQ9 1;  1DL6 A;  2IV2 X;  2R6M A;  2NVY I;  1Q7Y 1;  2LEX A;  2G2K A;  1VQL 1;  1YUA A;  1K8A 1;  4E2Z A;  3HKZ A;  3CME Z;  3NH5 A;  1WJ2 A;  3JAM b;  4E2W A;  3MZL B;  4NBD A;  5D1P A;  2PMZ A;  1M90 2;  4XX2 A;  3IFU A;  4A3J I;  2IZ3 A;  2WAQ A;  1VQO 1;  3HOU I;  1QVF Z;  4A3G I;  3CCL 1;  3CCR Z;  3S1M I;  3CXC Z;  1S7M A;  3S2D I;  3G6E Z;  2IZ4 A;  3CD6 1;  4A3K I;  4BY1 I;  2HU9 A;  4NBC A;  4NBB A;  2KI7 B;  1VQ7 Z;  4A3C I;  3EED A;  1YJN 1;  1NJI 2;  1I6H I;  2RIQ A;  5A2Q f;  3CPW Y;  5IT9 b;  1Q86 1;  1TWH I;  3GTG I;  4QTU A;  2F4O A;  4RVD A;  3D6W A;  1YIJ 1;  2V45 A;  1AA6 A;  1VQP Z;  1VQ8 Z;  2QA4 1;  2KPI A;  2QLV B;  3T4N B;  4RVF A;  1YJ9 Z;  3GTP I;  1X3W A;  1Q82 1;  3OW2 Y;  4S1T A;  4A3B I;  3Q87 A;  5IP9 I;  1VQ9 Z;  3H3V J;  1YHQ 1;  5C44 I;  3I4N I;  1QF8 A;  4EWC A;  3S14 I;  3CMA 1;  2GTH A;  1VQL Z;  1JJ2 Z;  4NBG A;  1M1K 1;  2W03 A;  4NB8 A;  1RLY A;  1YIT Z;  1VLA A;  2YAD A;  1VQM 1;  5C4J I;  4MD8 A;  3PO3 I;  3GTO I;  3HOV I;  4HGZ A;  5IT9 f;  2DE5 A;  1VQ5 1;  1VQO Z;  1RO0 A;  3CC7 1;  5C3E I;  2JR6 A;  2WB1 A;  3S2H I;  3QWU A;  2RBL A;  3CCL Z;  2OZK A;  1KC8 1;  3VB9 A;  4RVH A;  3D2L A;  5FLX b;  1PFT A;  3NFZ A;  3I07 A;  2K5R A;  3H0G I;  3G71 Z;  5T67 A;  3F3P C;  3CD6 Z;  1N2F A;  4NBA A;  3I56 1;  1RO2 A;  3CCS 1;  1TWC I;  2E2H I;  3MZK B;  3GTK I;  1Q81 2;  2QR1 B;  2JIO A;  2PM9 A;  4A3I I;  5CM2 M;  1RO4 A;  2R92 I;  2QEX 1;  1USP A;  3CCU Z;  2JNY A;  2NAP A;  3GTJ I;  1YIJ Z;  3ESW A;  2V8I A;  2QA4 Z;  3CCV 1;  2VPY A;  4E2X A;  4NBF A;  3J7A 4;  4QTT A;  3U50 C;  2ZAE B;  4RS4 A;  3K7A I;  5T6B A;  1VQN 1;  1M90 1;  3RZD I;  2RPR A;  1QVG Z;  1WCM I;  2JMO A;  3CQZ I;  2E2I I;  3S16 I;  1YHQ Z;  3D9X A;  3IF8 A;  5FLX f;  3HOY I;  2JA5 I;  4A3M I;  5FLM I;  3PO2 I;  2VPW A;  3F3F C;  1YI2 1;  1TFI A;  4NOZ A;  1VQM Z;  1YJW 1;  3RZO I;  3M4O I;  1K73 2;  5T64 A;  4DK1 A;  2LFU A;  1NJI 1;  1QVF Y;  1Z02 A;  4BXX I;  3CC7 Z;  1JWH C;  3S17 I;  3PO3 S;  3CXC Y;  2V8K A;  4E2Y A;  2QKD A;  1Y8C A;  3J80 b;  2Q4Z A;  2E7Z A;  2LIY A;  3HOZ I;  3GTQ I;  2R93 I;  2R7Z I;  3IR7 A;  1QYP A;  4HH4 A;  3IX0 A;  1N8R 1;  3JAM f;  1KD1 1;  1P9N A;  2QRC B;  3I56 Z;  3CCS Z;  1RNI A;  1ZH1 A;  2GU2 A;  3KIH A;  4Y52 I;  2JUB A;  3S1Q I;  1K9M 2;  3OW2 Z;  2JA8 I;  2AYD A;  1WW9 A;  2QEX Z;  2E9H A;  2VUM I;  1W2B Z;  1LQL A; 
#chains in the Genus database with same CATH homology
 1X3Z A;  2Y0S A;  3CCV Z;  3NDJ A;  1Y1W I;  3KIF A;  3CME 1;  1VQK 1;  2E2J I;  1VQN Z;  2OOX B;  3CCM 1;  2OTL 1;  2JA7 I;  1SFO I;  2VUG A;  2AKL A;  3VMH A;  1L1O C;  3GKQ A;  3EER A;  3CCE 1;  4E33 A;  2RHB A;  3J81 b;  4A3L I;  1ZB9 A;  3G6E 1;  1KQS Z;  1YI2 Z;  1YJW Z;  2JS4 A;  3FQM A;  3HOX I;  3S1N I;  4Y7N I;  3CCQ 1;  2VF1 A;  1YJN Z;  1Q81 1;  2JA6 I;  4DQY B;  4RV9 A;  2F4M A;  2M48 A;  4RVG A;  5AN9 F;  1Z03 A;  2Q51 A;  3VTN A;  4HGY A;  4A3F I;  1VQ6 1;  1NUI A;  1I3Q I;  5C4X I;  1WII A;  4MXU A;  1I50 I;  2BJO A;  1YUK A;  3M3Y I;  3CC4 1;  1NP6 A;  1VQ4 1;  2O4H A;  4E32 A;  1USP B;  1Y1V I;  5A2Q b;  4A93 I;  2NVT I;  2HF1 A;  3FQQ A;  4NB9 A;  3CC2 1;  3VMG A;  1KRL A;  1TWG I;  3CMA Z;  3NH4 A;  4NBE A;  5IP7 I;  5LL6 f;  1Q7Y 2;  3CCJ 1;  3J81 f;  1R9T I;  2GTI A;  2V8J A;  2NVQ I;  1QVG Y;  1S72 1;  1K8A 2;  1X0T A;  1YIT 1;  1VQK Z;  3MON A;  3I55 1;  1K73 1;  3GTM I;  3CCM Z;  2OTL Z;  1Z01 A;  4BBS I;  2DE6 A;  1VQ5 Z;  3HOW I;  1ML8 A;  4NH1 C;  2DE7 A;  4BBR I;  3CCE Z;  4E30 A;  3P5J B;  3CPW Z;  4NBH A;  3G71 1;  3BG0 B;  4A3D I;  1K83 I;  2I3C A;  4DGL A;  2OTJ 1;  2OOY B;  5D1O A;  3CCQ Z;  3TDH B;  3LUS A;  3G4S 1;  2B63 I;  1K9M 1;  2NVX I;  2P28 A;  4NFR A;  1Q86 2;  4AYB A;  3CCU 1;  5D1O B;  1VQ6 Z;  2PK7 A;  1TWA I;  4E31 A;  1N8R 2;  4TNU A;  1KD1 2;  3NH8 A;  2QRE B;  4MD9 A;  3VMI A;  3CC4 Z;  4BY7 I;  1VQ4 Z;  3TE5 B;  1Q82 2;  1W2B Y;  1JJ2 Y;  4MH4 A;  3CC2 Z;  3NDI A;  3J80 f;  2M6N A;  2YU9 I;  2H85 A;  1Y1V S;  3CCJ Z;  2O53 A;  1TWF I;  1M1K 2;  1S72 Z;  2J6A A;  3CCR 1;  4A3E I;  2W04 A;  2K3R A;  1ZB8 A;  3I55 Z;  1RQF A;  4X6A I;  3S1R I;  1VQ7 1;  4MRI A;  3GTM S;  3I4M I;  1KQS Y;  3S15 I;  2P3Y A;  4MON A;  2RT9 A;  1KC8 2;  1VQP 1;  3GTL I;  1VQ8 1;  3FKI I;  2OTJ Z;  4CL1 A;  3G4S Z;  1YJ9 1;  4MD7 A;  2EGT A;  3GCF A;  2QRD B;  3BG1 B;  1VQ9 1;  1DL6 A;  2R6M A;  2NVY I;  1Q7Y 1;  2G2K A;  1VQL 1;  1YUA A;  1K8A 1;  4E2Z A;  3HKZ A;  3CME Z;  3NH5 A;  3JAM b;  4E2W A;  3MZL B;  4NBD A;  5D1P A;  2PMZ A;  1M90 2;  4XX2 A;  3IFU A;  4A3J I;  2IZ3 A;  2WAQ A;  1VQO 1;  3HOU I;  1QVF Z;  4A3G I;  3CCL 1;  3CCR Z;  3S1M I;  3CXC Z;  1S7M A;  3S2D I;  3G6E Z;  2IZ4 A;  3CD6 1;  4A3K I;  4BY1 I;  2HU9 A;  4NBC A;  4NBB A;  2KI7 B;  1VQ7 Z;  4A3C I;  3EED A;  1YJN 1;  1NJI 2;  1I6H I;  2RIQ A;  5A2Q f;  3CPW Y;  5IT9 b;  1Q86 1;  1TWH I;  3GTG I;  4QTU A;  2F4O A;  4RVD A;  3D6W A;  1YIJ 1;  1VQP Z;  1VQ8 Z;  2QA4 1;  2KPI A;  2QLV B;  3T4N B;  4RVF A;  1YJ9 Z;  3GTP I;  1X3W A;  1Q82 1;  3OW2 Y;  4S1T A;  4A3B I;  3Q87 A;  5IP9 I;  1VQ9 Z;  3H3V J;  1YHQ 1;  5C44 I;  3I4N I;  1QF8 A;  4EWC A;  3S14 I;  3CMA 1;  2GTH A;  1VQL Z;  1JJ2 Z;  4NBG A;  1M1K 1;  2W03 A;  4NB8 A;  1RLY A;  1YIT Z;  1VLA A;  2YAD A;  1VQM 1;  5C4J I;  4MD8 A;  3PO3 I;  3GTO I;  3HOV I;  4HGZ A;  5IT9 f;  2DE5 A;  1VQ5 1;  1VQO Z;  1RO0 A;  3CC7 1;  5C3E I;  2JR6 A;  2WB1 A;  3S2H I;  3QWU A;  2RBL A;  3CCL Z;  2OZK A;  1KC8 1;  3VB9 A;  4RVH A;  5FLX b;  1PFT A;  3NFZ A;  3I07 A;  2K5R A;  3H0G I;  3G71 Z;  5T67 A;  3F3P C;  3CD6 Z;  1N2F A;  4NBA A;  3I56 1;  1RO2 A;  3CCS 1;  1TWC I;  2E2H I;  3MZK B;  3GTK I;  1Q81 2;  2QR1 B;  2PM9 A;  4A3I I;  5CM2 M;  1RO4 A;  2R92 I;  2QEX 1;  1USP A;  3CCU Z;  2JNY A;  3GTJ I;  1YIJ Z;  3ESW A;  2V8I A;  2QA4 Z;  3CCV 1;  4E2X A;  4NBF A;  3J7A 4;  4QTT A;  3U50 C;  2ZAE B;  4RS4 A;  3K7A I;  5T6B A;  1VQN 1;  1M90 1;  3RZD I;  2RPR A;  1QVG Z;  1WCM I;  2JMO A;  3CQZ I;  2E2I I;  3S16 I;  1YHQ Z;  3D9X A;  3IF8 A;  5FLX f;  3HOY I;  2JA5 I;  4A3M I;  5FLM I;  3PO2 I;  3F3F C;  1YI2 1;  1TFI A;  4NOZ A;  1VQM Z;  1YJW 1;  3RZO I;  3M4O I;  1K73 2;  5T64 A;  4DK1 A;  2LFU A;  1NJI 1;  1QVF Y;  1Z02 A;  4BXX I;  3CC7 Z;  1JWH C;  3S17 I;  3PO3 S;  3CXC Y;  2V8K A;  4E2Y A;  2QKD A;  3J80 b;  2Q4Z A;  2LIY A;  3HOZ I;  3GTQ I;  2R93 I;  2R7Z I;  1QYP A;  4HH4 A;  3IX0 A;  1N8R 1;  3JAM f;  1KD1 1;  1P9N A;  2QRC B;  3I56 Z;  3CCS Z;  1RNI A;  1ZH1 A;  2GU2 A;  3KIH A;  4Y52 I;  2JUB A;  3S1Q I;  1K9M 2;  3OW2 Z;  2JA8 I;  1WW9 A;  2QEX Z;  2E9H A;  2VUM I;  1W2B Z;  1LQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...