3S15I

Rna polymerase ii initiation complex with a 7-nt rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s15I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s15I02
2KPIA 3GTOI 5C4XI 2R93I 1ZB8A 1X3ZA 4Y7NI 2J6AA 3PO2I 4A3LI 3HOUI 3GTKI 4NBBA 3ESWA 4BY1I 2JA8I 4A3FI 1SFOI 3HOVI 3M4OI 3GTMS 2R92I 2HF1A 1R9TI 2VUMI 4BY7I 5C44I 1DL6A 3S16I 4NOZA 1PFTA 5C3EI 1TWCI 4NB9A 2JA5I 3GTJI 3HOWI 3K7AI 2P3YA 3M3YI 4BBSI 1WW9A 2K5RA 3GKQA 3S2DI 2BJOA 3VMHA 4A3CI 2PK7A 3VB9A 2E2HI 4BBRI 2R7ZI 3S15I 1USPA 2B63I 2F4MA 4A93I 2E2II 3U50C 2JA7I 1X3WA 2NVXI 1VLAA 1YUAA 4NBHA 3S1NI 4NBCA 3GTPI 1K83I 2JR6A 1WCMI 2AKLA 3S2HI 4A3DI 1L1OC 2JA6I 3H0GI 3VMGA 1I3QI 4NBEA 5CM2M 1Y1WI 1TWHI 3RZDI 4XX2A 4QTTA 1I50I 4NBFA 2JNYA 3H3VJ 3I07A 3GTGI 4A3JI 1TFIA 3HOZI 2DE7A 5IP7I 3Q87A 2DE6A 4A3KI 3VMIA 2JS4A 3LUSA 2DE5A 3FKII 2F4OA 1ZB9A 5IP9I 4X6AI 2NVTI 1USPB 4A3MI 3PO3I 4MH4A 1TWGI 4A3BI 4NBAA 4NB8A 3S14I 3GTMI 3GTLI 1NUIA 5FLMI 2RBLA 4Y52I 3PO3S 4NBDA 3I4NI 3RZOI 2E2JI 1Y1VI 1QYPA 1N2FA 2YU9I 3GTQI 3D6WA 1LQLA 4A3EI 3S1QI 3S1MI 3CQZI 3S17I 4A3II 3S1RI 1I6HI 1RLYA 1RO4A 4QTUA 4BXXI 1ML8A 4A3GI 3HOXI 1Y1VS 5C4JI 3HOYI 1TWAI 4NBGA 2NVQI 3I4MI 3EERA 3GCFA 1TWFI 2NVYI
chains in the Genus database with same CATH superfamily
3NDJA 1YITZ 2R93I 4HH4A 1NJI1 2Q4ZA 1QVFY 4A3FI 3HOVI 1Z01A 5T64A 1K732 2HF1A 3CC2Z 3CCVZ 1VQM1 4AYBA 1VQKZ 3HKZA 3NFZA 4NOZA 2IZ3A 4RV9A 4HGZA 2WB1A 5A2Qb 2Y0SA 3OW2Y 2OZKA 2GTIA 1P9NA 3HOWI 3CCM1 3K7AI 2P3YA 2K5RA 3GKQA 1KRLA 1RO2A 3VMHA 1YJW1 2E2HI 4E2ZA 2R7ZI 3NH8A 2B63I 2ZAEB 1Y8CA 1X3WA 1YUAA 3NH4A 3S2HI 2JIPA 2M48A 3H0GI 2QA41 1I3QI 1Q862 4NBEA 2H85A 5LL6f 1TWHI 4XX2A 1KC81 3H3VJ 3GTGI 3P5JB 3HOZI 3CCJ1 2DE6A 2OOXB 3VMIA 2DE5A 2W04A 3CMEZ 1VQ8Z 5IP9I 3CCEZ 1QVGZ 1USPB 1YIT1 2NVTI 3CCS1 1AA6A 3CD6Z 4NH1C 4A3BI 3GTMI 1NUIA 2NAPA 1Q16A 3GTQI 4MD7A 4A3EI 3S1QI 3S1MI 4E2WA 3VTNA 3CQZI 3CCQ1 1VQLZ 2VF1A 1X0TA 3BG1B 1VQ9Z 1I6HI 1YHQZ 1Q861 1YJNZ 2NVQI 2QRCB 3CCQZ 2NVYI 5T6BA 2V3VA 5C4XI 2JMOA 1M902 1ZB8A 4CL1A 1VQ81 3KIFA 4A3LI 3HOUI 4NBBA 3ESWA 1M1K1 1QF8A 3KIHA 3GTMS 2E9HA 4E32A 5C44I 2W03A 3IFUA 1DL6A 1Q811 3J81b 2YADA 1K8A1 1VQL1 2O53A 3CCJZ 5C3EI 1TWCI 2JA5I 1WW9A 4RVDA 3IX0A 2LIYA 2PK7A 3VB9A 4BBRI 3S15I 3J80f 3U50C 2JA7I 3S1NI 4NBCA 1VQ5Z 1K83I 2JR6A 3JAMf 5FLXf 1M901 1S721 2OTL1 1W2BZ 3CXCY 4HGYA 1VQNZ 1M1K2 2G2KA 2IZ4A 2JIMA 2QLVB 5CM2M 1Y1WI 1I50I 3CCR1 2QEXZ 3MZLB 1VQ71 5IP7I 3Q87A 4E30A 4RS4A 3CC71 3TDHB 1ZB9A 2JUBA 3CC21 3F3PC 3CCRZ 1JJ2Y 1TWGI 2QR1B 4DQYB 4NBAA 3CCL1 2OTJZ 3G4S1 2I3CA 2RBLA 3G71Z 3PO3S 1S72Z 3I4NI 1N2FA 3D6WA 1LQLA 4EWCA 5AN9F 3J80b 2OOYB 3IF8A 4NFRA 3G6EZ 3S17I 4A3II 3CMAZ 3IR7A 1ML8A 3FQMA 1YIJ1 3J81f 3HOXI 2QEX1 3HOYI 1TWAI 4NBGA 2QA4Z 1YIJZ 3EERA 1TWFI 5IT9b 4RVFA 1VQN1 2V45A 4RVHA 4Y7NI 3PO2I 2JIRA 3GTKI 2AYDA 1NJI2 1VQ51 1YJ9Z 4DK1A 1SFOI 2JA8I 3M4OI 1VQOZ 3CCUZ 2R92I 3TE5B 1R9TI 4BY7I 1K731 2R6MA 5T67A 3S16I 2JIQA 2GTHA 1PFTA 1NP6A 4NB9A 3CC7Z 1WZNA 1VQ4Z 1VQ7Z 3J7A4 4MONA 4A3CI 1VQP1 1USPA 1VQ61 2VUGA 2F4MA 2VPYA 2E2II 1VQPZ 1KD12 1VLAA 3GTPI 1QVGY 5D1OA 1WCMI 5FLXb 4E2YA 3JAMb 4A3DI 2JA6I 3MONA 1FDOA 1KC82 3CPWZ 4QTTA 4NBFA 3CXCZ 3CCSZ 2EGTA 3I55Z 1TFIA 2JIOA 3CCE1 2DE7A 2V8KA 2JS4A 3LUSA 1RO0A 1Z02A 2F4OA 4A3MI 1N8R1 2K3RA 1VQMZ 3CCV1 1VQ91 4S1TA 3S14I 3GTLI 1N8R2 2IV2X 5FLMI 1KD11 2LEXA 3RZOI 1W2BY 2YU9I 2WAQA 3G4SZ 4RVGA 1KQSY 2OTJ1 3S1RI 3CC4Z 3D2LA 1RO4A 2HU9A 5A2Qf 4A3GI 1Y1VS 3CC41 1QXFA 4E31A 1JJ2Z 1VQO1 3FQQA 1VQ6Z 3CME1 3OW2Z 5D1PA 1WJ2A 1KQSZ 2KPIA 3GTOI 4MXUA 1X3ZA 2J6AA 2E7ZA 4BY1I 2RPRA 3T4NB 3D9XA 1S7MA 3QWUA 2QREB 3F3FC 2KI7B 4MD8A 3CPWY 1QVFZ 1RNIA 2VUMI 4TNUA 1YJWZ 3BG0B 1Q812 3G6E1 4MRIA 3GTJI 3M3YI 4BBSI 3S2DI 1ZH1A 3I56Z 2GU2A 1Q7Y1 2BJOA 2RT9A 1YJN1 2RIQA 1SIWA 1VQK1 1YHQ1 4A93I 2O4HA 2PM9A 3CCMZ 2NVXI 4NBHA 1VQ41 1JWHC 2AKLA 3CMA1 1L1OC 1YUKA 3NDIA 4DGLA 3I551 2M6NA 1FDIA 3VMGA 1Q822 2PMZA 3RZDI 1RQFA 3EEDA 1Q821 2JNYA 2Q51A 2LFUA 3I07A 4A3JI 2VPZA 4E2XA 3I561 1K8A2 1K9M2 4A3KI 3FKII 1K9M1 4X6AI 2QKDA 3PO3I 3CCLZ 1Q7Y2 4MH4A 1YJ91 4MD9A 2V8IA 2RHBA 2VPWA 3NH5A 1YI21 4NB8A 5IT9f 3MZKB 2QRDB 4Y52I 4NBDA 2E2JI 1Y1VI 1QYPA 1Z03A 2OTLZ 5D1OB 1YI2Z 3G711 1RLYA 4QTUA 4BXXI 3CD61 1WIIA 5C4JI 2P28A 2V8JA 3CCU1 3I4MI 3GCFA 4E33A 2VPXA
chains in the Genus database with same CATH topology
3NDJA 1YITZ 2R93I 4HH4A 1NJI1 2Q4ZA 1QVFY 4A3FI 3HOVI 1Z01A 5T64A 1K732 2HF1A 3CC2Z 3CCVZ 1VQM1 4AYBA 1VQKZ 3HKZA 3NFZA 4NOZA 2IZ3A 4RV9A 4HGZA 2WB1A 5A2Qb 2Y0SA 3OW2Y 2OZKA 2GTIA 1P9NA 3HOWI 3CCM1 3K7AI 2P3YA 2K5RA 3GKQA 1KRLA 1RO2A 3VMHA 1YJW1 2E2HI 4E2ZA 2R7ZI 3NH8A 2B63I 2ZAEB 1X3WA 1YUAA 3NH4A 3S2HI 2M48A 3H0GI 2QA41 1I3QI 1Q862 4NBEA 2H85A 5LL6f 1TWHI 4XX2A 1KC81 3H3VJ 3GTGI 3P5JB 3HOZI 3CCJ1 2DE6A 2OOXB 3VMIA 2DE5A 2W04A 3CMEZ 1VQ8Z 5IP9I 3CCEZ 1QVGZ 1USPB 1YIT1 2NVTI 3CCS1 3CD6Z 4NH1C 4A3BI 3GTMI 1NUIA 3GTQI 4MD7A 4A3EI 3S1QI 3S1MI 4E2WA 3VTNA 3CQZI 3CCQ1 1VQLZ 2VF1A 1X0TA 3BG1B 1VQ9Z 1I6HI 1YHQZ 1Q861 1YJNZ 2NVQI 2QRCB 3CCQZ 2NVYI 5T6BA 5C4XI 2JMOA 1M902 1ZB8A 4CL1A 1VQ81 3KIFA 4A3LI 3HOUI 4NBBA 3ESWA 1M1K1 1QF8A 3KIHA 3GTMS 2E9HA 4E32A 5C44I 2W03A 3IFUA 1DL6A 1Q811 3J81b 2YADA 1K8A1 1VQL1 2O53A 3CCJZ 5C3EI 1TWCI 2JA5I 1WW9A 4RVDA 3IX0A 2LIYA 2PK7A 3VB9A 4BBRI 3S15I 3J80f 3U50C 2JA7I 3S1NI 4NBCA 1VQ5Z 1K83I 2JR6A 3JAMf 5FLXf 1M901 1S721 2OTL1 1W2BZ 3CXCY 4HGYA 1VQNZ 1M1K2 2G2KA 2IZ4A 2QLVB 5CM2M 1Y1WI 1I50I 3CCR1 2QEXZ 3MZLB 1VQ71 5IP7I 3Q87A 4E30A 4RS4A 3CC71 3TDHB 1ZB9A 2JUBA 3CC21 3F3PC 3CCRZ 1JJ2Y 1TWGI 2QR1B 4NBAA 3CCL1 4DQYB 2OTJZ 3G4S1 2I3CA 2RBLA 3G71Z 3PO3S 1S72Z 3I4NI 1N2FA 3D6WA 1LQLA 4EWCA 5AN9F 3J80b 2OOYB 3IF8A 4NFRA 3G6EZ 3S17I 4A3II 3CMAZ 1ML8A 3FQMA 1YIJ1 3J81f 3HOXI 2QEX1 3HOYI 1TWAI 4NBGA 2QA4Z 1YIJZ 3EERA 1TWFI 5IT9b 4RVFA 1VQN1 4Y7NI 4RVHA 3PO2I 3GTKI 1NJI2 1VQ51 1YJ9Z 4DK1A 1SFOI 2JA8I 3M4OI 1VQOZ 3CCUZ 2R92I 3TE5B 1R9TI 4BY7I 1K731 2R6MA 5T67A 3S16I 2GTHA 1PFTA 1NP6A 4NB9A 3CC7Z 1VQ4Z 1VQ7Z 3J7A4 4MONA 4A3CI 1VQP1 1USPA 1VQ61 2VUGA 2F4MA 2E2II 1VQPZ 1KD12 1VLAA 3GTPI 1QVGY 5D1OA 1WCMI 5FLXb 4E2YA 3JAMb 4A3DI 2JA6I 3MONA 1KC82 3CPWZ 4QTTA 4NBFA 3CXCZ 3CCSZ 2EGTA 3I55Z 1TFIA 3CCE1 2DE7A 2V8KA 2JS4A 3LUSA 1RO0A 1Z02A 2F4OA 4A3MI 1N8R1 2K3RA 1VQMZ 3CCV1 1VQ91 4S1TA 3S14I 3GTLI 1N8R2 5FLMI 1KD11 3RZOI 1W2BY 2YU9I 2WAQA 3G4SZ 4RVGA 1KQSY 2OTJ1 3S1RI 3CC4Z 1RO4A 2HU9A 5A2Qf 4A3GI 1Y1VS 3CC41 4E31A 1JJ2Z 1VQO1 3FQQA 1VQ6Z 3CME1 3OW2Z 5D1PA 1KQSZ 2KPIA 3GTOI 4MXUA 1X3ZA 2J6AA 4BY1I 2RPRA 3T4NB 3D9XA 1S7MA 3QWUA 2QREB 3F3FC 2KI7B 4MD8A 3CPWY 1QVFZ 1RNIA 2VUMI 4TNUA 1YJWZ 3BG0B 1Q812 3G6E1 4MRIA 3GTJI 3M3YI 4BBSI 3S2DI 1ZH1A 3I56Z 2GU2A 1Q7Y1 2BJOA 2RT9A 1YJN1 2RIQA 1VQK1 1YHQ1 4A93I 2O4HA 2PM9A 3CCMZ 2NVXI 4NBHA 1VQ41 1JWHC 2AKLA 3CMA1 1L1OC 1YUKA 3NDIA 4DGLA 3I551 2M6NA 3VMGA 1Q822 2PMZA 3RZDI 1RQFA 3EEDA 1Q821 2JNYA 2Q51A 2LFUA 3I07A 4A3JI 4E2XA 3I561 1K8A2 1K9M2 4A3KI 3FKII 1K9M1 4X6AI 2QKDA 3PO3I 3CCLZ 1Q7Y2 4MH4A 1YJ91 4MD9A 2V8IA 2RHBA 1YI21 3NH5A 4NB8A 5IT9f 3MZKB 2QRDB 4Y52I 4NBDA 2E2JI 1Y1VI 1QYPA 1Z03A 2OTLZ 5D1OB 1YI2Z 3G711 1RLYA 4QTUA 4BXXI 3CD61 1WIIA 5C4JI 2P28A 2V8JA 3CCU1 3I4MI 3GCFA 4E33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPI A;  3GTO I;  5C4X I;  2R93 I;  1ZB8 A;  1X3Z A;  4Y7N I;  2J6A A;  3PO2 I;  4A3L I;  3HOU I;  3GTK I;  4NBB A;  3ESW A;  4BY1 I;  2JA8 I;  4A3F I;  1SFO I;  3HOV I;  3M4O I;  3GTM S;  2R92 I;  2HF1 A;  1R9T I;  2VUM I;  4BY7 I;  5C44 I;  1DL6 A;  3S16 I;  4NOZ A;  1PFT A;  5C3E I;  1TWC I;  4NB9 A;  2JA5 I;  3GTJ I;  3HOW I;  3K7A I;  2P3Y A;  3M3Y I;  4BBS I;  1WW9 A;  2K5R A;  3GKQ A;  3S2D I;  2BJO A;  3VMH A;  4A3C I;  2PK7 A;  3VB9 A;  2E2H I;  4BBR I;  2R7Z I;  3S15 I;  1USP A;  2B63 I;  2F4M A;  4A93 I;  2E2I I;  3U50 C;  2JA7 I;  1X3W A;  2NVX I;  1VLA A;  1YUA A;  4NBH A;  3S1N I;  4NBC A;  3GTP I;  1K83 I;  2JR6 A;  1WCM I;  2AKL A;  3S2H I;  4A3D I;  1L1O C;  2JA6 I;  3H0G I;  3VMG A;  1I3Q I;  4NBE A;  5CM2 M;  1Y1W I;  1TWH I;  3RZD I;  4XX2 A;  4QTT A;  1I50 I;  4NBF A;  2JNY A;  3H3V J;  3I07 A;  3GTG I;  4A3J I;  1TFI A;  3HOZ I;  2DE7 A;  5IP7 I;  3Q87 A;  2DE6 A;  4A3K I;  3VMI A;  2JS4 A;  3LUS A;  2DE5 A;  3FKI I;  2F4O A;  1ZB9 A;  5IP9 I;  4X6A I;  2NVT I;  1USP B;  4A3M I;  3PO3 I;  4MH4 A;  1TWG I;  4A3B I;  4NBA A;  4NB8 A;  3S14 I;  3GTM I;  3GTL I;  1NUI A;  5FLM I;  2RBL A;  4Y52 I;  3PO3 S;  4NBD A;  3I4N I;  3RZO I;  2E2J I;  1Y1V I;  1QYP A;  1N2F A;  2YU9 I;  3GTQ I;  3D6W A;  1LQL A;  4A3E I;  3S1Q I;  3S1M I;  3CQZ I;  3S17 I;  4A3I I;  3S1R I;  1I6H I;  1RLY A;  1RO4 A;  4QTU A;  4BXX I;  1ML8 A;  4A3G I;  3HOX I;  1Y1V S;  5C4J I;  3HOY I;  1TWA I;  4NBG A;  2NVQ I;  3I4M I;  3EER A;  3GCF A;  1TWF I;  2NVY I; 
#chains in the Genus database with same CATH topology
 3NDJ A;  1YIT Z;  2R93 I;  4HH4 A;  1NJI 1;  2Q4Z A;  1QVF Y;  4A3F I;  3HOV I;  1Z01 A;  5T64 A;  1K73 2;  2HF1 A;  3CC2 Z;  3CCV Z;  1VQM 1;  4AYB A;  1VQK Z;  3HKZ A;  3NFZ A;  4NOZ A;  2IZ3 A;  4RV9 A;  4HGZ A;  2WB1 A;  5A2Q b;  2Y0S A;  3OW2 Y;  2OZK A;  2GTI A;  1P9N A;  3HOW I;  3CCM 1;  3K7A I;  2P3Y A;  2K5R A;  3GKQ A;  1KRL A;  1RO2 A;  3VMH A;  1YJW 1;  2E2H I;  4E2Z A;  2R7Z I;  3NH8 A;  2B63 I;  2ZAE B;  1Y8C A;  1X3W A;  1YUA A;  3NH4 A;  3S2H I;  2JIP A;  2M48 A;  3H0G I;  2QA4 1;  1I3Q I;  1Q86 2;  4NBE A;  2H85 A;  5LL6 f;  1TWH I;  4XX2 A;  1KC8 1;  3H3V J;  3GTG I;  3P5J B;  3HOZ I;  3CCJ 1;  2DE6 A;  2OOX B;  3VMI A;  2DE5 A;  2W04 A;  3CME Z;  1VQ8 Z;  5IP9 I;  3CCE Z;  1QVG Z;  1USP B;  1YIT 1;  2NVT I;  3CCS 1;  1AA6 A;  3CD6 Z;  4NH1 C;  4A3B I;  3GTM I;  1NUI A;  2NAP A;  1Q16 A;  3GTQ I;  4MD7 A;  4A3E I;  3S1Q I;  3S1M I;  4E2W A;  3VTN A;  3CQZ I;  3CCQ 1;  1VQL Z;  2VF1 A;  1X0T A;  3BG1 B;  1VQ9 Z;  1I6H I;  1YHQ Z;  1Q86 1;  1YJN Z;  2NVQ I;  2QRC B;  3CCQ Z;  2NVY I;  5T6B A;  2V3V A;  5C4X I;  2JMO A;  1M90 2;  1ZB8 A;  4CL1 A;  1VQ8 1;  3KIF A;  4A3L I;  3HOU I;  4NBB A;  3ESW A;  1M1K 1;  1QF8 A;  3KIH A;  3GTM S;  2E9H A;  4E32 A;  5C44 I;  2W03 A;  3IFU A;  1DL6 A;  1Q81 1;  3J81 b;  2YAD A;  1K8A 1;  1VQL 1;  2O53 A;  3CCJ Z;  5C3E I;  1TWC I;  2JA5 I;  1WW9 A;  4RVD A;  3IX0 A;  2LIY A;  2PK7 A;  3VB9 A;  4BBR I;  3S15 I;  3J80 f;  3U50 C;  2JA7 I;  3S1N I;  4NBC A;  1VQ5 Z;  1K83 I;  2JR6 A;  3JAM f;  5FLX f;  1M90 1;  1S72 1;  2OTL 1;  1W2B Z;  3CXC Y;  4HGY A;  1VQN Z;  1M1K 2;  2G2K A;  2IZ4 A;  2JIM A;  2QLV B;  5CM2 M;  1Y1W I;  1I50 I;  3CCR 1;  2QEX Z;  3MZL B;  1VQ7 1;  5IP7 I;  3Q87 A;  4E30 A;  4RS4 A;  3CC7 1;  3TDH B;  1ZB9 A;  2JUB A;  3CC2 1;  3F3P C;  3CCR Z;  1JJ2 Y;  1TWG I;  2QR1 B;  4DQY B;  4NBA A;  3CCL 1;  2OTJ Z;  3G4S 1;  2I3C A;  2RBL A;  3G71 Z;  3PO3 S;  1S72 Z;  3I4N I;  1N2F A;  3D6W A;  1LQL A;  4EWC A;  5AN9 F;  3J80 b;  2OOY B;  3IF8 A;  4NFR A;  3G6E Z;  3S17 I;  4A3I I;  3CMA Z;  3IR7 A;  1ML8 A;  3FQM A;  1YIJ 1;  3J81 f;  3HOX I;  2QEX 1;  3HOY I;  1TWA I;  4NBG A;  2QA4 Z;  1YIJ Z;  3EER A;  1TWF I;  5IT9 b;  4RVF A;  1VQN 1;  2V45 A;  4RVH A;  4Y7N I;  3PO2 I;  2JIR A;  3GTK I;  2AYD A;  1NJI 2;  1VQ5 1;  1YJ9 Z;  4DK1 A;  1SFO I;  2JA8 I;  3M4O I;  1VQO Z;  3CCU Z;  2R92 I;  3TE5 B;  1R9T I;  4BY7 I;  1K73 1;  2R6M A;  5T67 A;  3S16 I;  2JIQ A;  2GTH A;  1PFT A;  1NP6 A;  4NB9 A;  3CC7 Z;  1WZN A;  1VQ4 Z;  1VQ7 Z;  3J7A 4;  4MON A;  4A3C I;  1VQP 1;  1USP A;  1VQ6 1;  2VUG A;  2F4M A;  2VPY A;  2E2I I;  1VQP Z;  1KD1 2;  1VLA A;  3GTP I;  1QVG Y;  5D1O A;  1WCM I;  5FLX b;  4E2Y A;  3JAM b;  4A3D I;  2JA6 I;  3MON A;  1FDO A;  1KC8 2;  3CPW Z;  4QTT A;  4NBF A;  3CXC Z;  3CCS Z;  2EGT A;  3I55 Z;  1TFI A;  2JIO A;  3CCE 1;  2DE7 A;  2V8K A;  2JS4 A;  3LUS A;  1RO0 A;  1Z02 A;  2F4O A;  4A3M I;  1N8R 1;  2K3R A;  1VQM Z;  3CCV 1;  1VQ9 1;  4S1T A;  3S14 I;  3GTL I;  1N8R 2;  2IV2 X;  5FLM I;  1KD1 1;  2LEX A;  3RZO I;  1W2B Y;  2YU9 I;  2WAQ A;  3G4S Z;  4RVG A;  1KQS Y;  2OTJ 1;  3S1R I;  3CC4 Z;  3D2L A;  1RO4 A;  2HU9 A;  5A2Q f;  4A3G I;  1Y1V S;  3CC4 1;  1QXF A;  4E31 A;  1JJ2 Z;  1VQO 1;  3FQQ A;  1VQ6 Z;  3CME 1;  3OW2 Z;  5D1P A;  1WJ2 A;  1KQS Z;  2KPI A;  3GTO I;  4MXU A;  1X3Z A;  2J6A A;  2E7Z A;  4BY1 I;  2RPR A;  3T4N B;  3D9X A;  1S7M A;  3QWU A;  2QRE B;  3F3F C;  2KI7 B;  4MD8 A;  3CPW Y;  1QVF Z;  1RNI A;  2VUM I;  4TNU A;  1YJW Z;  3BG0 B;  1Q81 2;  3G6E 1;  4MRI A;  3GTJ I;  3M3Y I;  4BBS I;  3S2D I;  1ZH1 A;  3I56 Z;  2GU2 A;  1Q7Y 1;  2BJO A;  2RT9 A;  1YJN 1;  2RIQ A;  1SIW A;  1VQK 1;  1YHQ 1;  4A93 I;  2O4H A;  2PM9 A;  3CCM Z;  2NVX I;  4NBH A;  1VQ4 1;  1JWH C;  2AKL A;  3CMA 1;  1L1O C;  1YUK A;  3NDI A;  4DGL A;  3I55 1;  2M6N A;  1FDI A;  3VMG A;  1Q82 2;  2PMZ A;  3RZD I;  1RQF A;  3EED A;  1Q82 1;  2JNY A;  2Q51 A;  2LFU A;  3I07 A;  4A3J I;  2VPZ A;  4E2X A;  3I56 1;  1K8A 2;  1K9M 2;  4A3K I;  3FKI I;  1K9M 1;  4X6A I;  2QKD A;  3PO3 I;  3CCL Z;  1Q7Y 2;  4MH4 A;  1YJ9 1;  4MD9 A;  2V8I A;  2RHB A;  2VPW A;  3NH5 A;  1YI2 1;  4NB8 A;  5IT9 f;  3MZK B;  2QRD B;  4Y52 I;  4NBD A;  2E2J I;  1Y1V I;  1QYP A;  1Z03 A;  2OTL Z;  5D1O B;  1YI2 Z;  3G71 1;  1RLY A;  4QTU A;  4BXX I;  3CD6 1;  1WII A;  5C4J I;  2P28 A;  2V8J A;  3CCU 1;  3I4M I;  3GCF A;  4E33 A;  2VPX A; 
#chains in the Genus database with same CATH homology
 3NDJ A;  1YIT Z;  2R93 I;  4HH4 A;  1NJI 1;  2Q4Z A;  1QVF Y;  4A3F I;  3HOV I;  1Z01 A;  5T64 A;  1K73 2;  2HF1 A;  3CC2 Z;  3CCV Z;  1VQM 1;  4AYB A;  1VQK Z;  3HKZ A;  3NFZ A;  4NOZ A;  2IZ3 A;  4RV9 A;  4HGZ A;  2WB1 A;  5A2Q b;  2Y0S A;  3OW2 Y;  2OZK A;  2GTI A;  1P9N A;  3HOW I;  3CCM 1;  3K7A I;  2P3Y A;  2K5R A;  3GKQ A;  1KRL A;  1RO2 A;  3VMH A;  1YJW 1;  2E2H I;  4E2Z A;  2R7Z I;  3NH8 A;  2B63 I;  2ZAE B;  1X3W A;  1YUA A;  3NH4 A;  3S2H I;  2M48 A;  3H0G I;  2QA4 1;  1I3Q I;  1Q86 2;  4NBE A;  2H85 A;  5LL6 f;  1TWH I;  4XX2 A;  1KC8 1;  3H3V J;  3GTG I;  3P5J B;  3HOZ I;  3CCJ 1;  2DE6 A;  2OOX B;  3VMI A;  2DE5 A;  2W04 A;  3CME Z;  1VQ8 Z;  5IP9 I;  3CCE Z;  1QVG Z;  1USP B;  1YIT 1;  2NVT I;  3CCS 1;  3CD6 Z;  4NH1 C;  4A3B I;  3GTM I;  1NUI A;  3GTQ I;  4MD7 A;  4A3E I;  3S1Q I;  3S1M I;  4E2W A;  3VTN A;  3CQZ I;  3CCQ 1;  1VQL Z;  2VF1 A;  1X0T A;  3BG1 B;  1VQ9 Z;  1I6H I;  1YHQ Z;  1Q86 1;  1YJN Z;  2NVQ I;  2QRC B;  3CCQ Z;  2NVY I;  5T6B A;  5C4X I;  2JMO A;  1M90 2;  1ZB8 A;  4CL1 A;  1VQ8 1;  3KIF A;  4A3L I;  3HOU I;  4NBB A;  3ESW A;  1M1K 1;  1QF8 A;  3KIH A;  3GTM S;  2E9H A;  4E32 A;  5C44 I;  2W03 A;  3IFU A;  1DL6 A;  1Q81 1;  3J81 b;  2YAD A;  1K8A 1;  1VQL 1;  2O53 A;  3CCJ Z;  5C3E I;  1TWC I;  2JA5 I;  1WW9 A;  4RVD A;  3IX0 A;  2LIY A;  2PK7 A;  3VB9 A;  4BBR I;  3S15 I;  3J80 f;  3U50 C;  2JA7 I;  3S1N I;  4NBC A;  1VQ5 Z;  1K83 I;  2JR6 A;  3JAM f;  5FLX f;  1M90 1;  1S72 1;  2OTL 1;  1W2B Z;  3CXC Y;  4HGY A;  1VQN Z;  1M1K 2;  2G2K A;  2IZ4 A;  2QLV B;  5CM2 M;  1Y1W I;  1I50 I;  3CCR 1;  2QEX Z;  3MZL B;  1VQ7 1;  5IP7 I;  3Q87 A;  4E30 A;  4RS4 A;  3CC7 1;  3TDH B;  1ZB9 A;  2JUB A;  3CC2 1;  3F3P C;  3CCR Z;  1JJ2 Y;  1TWG I;  2QR1 B;  4NBA A;  3CCL 1;  4DQY B;  2OTJ Z;  3G4S 1;  2I3C A;  2RBL A;  3G71 Z;  3PO3 S;  1S72 Z;  3I4N I;  1N2F A;  3D6W A;  1LQL A;  4EWC A;  5AN9 F;  3J80 b;  2OOY B;  3IF8 A;  4NFR A;  3G6E Z;  3S17 I;  4A3I I;  3CMA Z;  1ML8 A;  3FQM A;  1YIJ 1;  3J81 f;  3HOX I;  2QEX 1;  3HOY I;  1TWA I;  4NBG A;  2QA4 Z;  1YIJ Z;  3EER A;  1TWF I;  5IT9 b;  4RVF A;  1VQN 1;  4Y7N I;  4RVH A;  3PO2 I;  3GTK I;  1NJI 2;  1VQ5 1;  1YJ9 Z;  4DK1 A;  1SFO I;  2JA8 I;  3M4O I;  1VQO Z;  3CCU Z;  2R92 I;  3TE5 B;  1R9T I;  4BY7 I;  1K73 1;  2R6M A;  5T67 A;  3S16 I;  2GTH A;  1PFT A;  1NP6 A;  4NB9 A;  3CC7 Z;  1VQ4 Z;  1VQ7 Z;  3J7A 4;  4MON A;  4A3C I;  1VQP 1;  1USP A;  1VQ6 1;  2VUG A;  2F4M A;  2E2I I;  1VQP Z;  1KD1 2;  1VLA A;  3GTP I;  1QVG Y;  5D1O A;  1WCM I;  5FLX b;  4E2Y A;  3JAM b;  4A3D I;  2JA6 I;  3MON A;  1KC8 2;  3CPW Z;  4QTT A;  4NBF A;  3CXC Z;  3CCS Z;  2EGT A;  3I55 Z;  1TFI A;  3CCE 1;  2DE7 A;  2V8K A;  2JS4 A;  3LUS A;  1RO0 A;  1Z02 A;  2F4O A;  4A3M I;  1N8R 1;  2K3R A;  1VQM Z;  3CCV 1;  1VQ9 1;  4S1T A;  3S14 I;  3GTL I;  1N8R 2;  5FLM I;  1KD1 1;  3RZO I;  1W2B Y;  2YU9 I;  2WAQ A;  3G4S Z;  4RVG A;  1KQS Y;  2OTJ 1;  3S1R I;  3CC4 Z;  1RO4 A;  2HU9 A;  5A2Q f;  4A3G I;  1Y1V S;  3CC4 1;  4E31 A;  1JJ2 Z;  1VQO 1;  3FQQ A;  1VQ6 Z;  3CME 1;  3OW2 Z;  5D1P A;  1KQS Z;  2KPI A;  3GTO I;  4MXU A;  1X3Z A;  2J6A A;  4BY1 I;  2RPR A;  3T4N B;  3D9X A;  1S7M A;  3QWU A;  2QRE B;  3F3F C;  2KI7 B;  4MD8 A;  3CPW Y;  1QVF Z;  1RNI A;  2VUM I;  4TNU A;  1YJW Z;  3BG0 B;  1Q81 2;  3G6E 1;  4MRI A;  3GTJ I;  3M3Y I;  4BBS I;  3S2D I;  1ZH1 A;  3I56 Z;  2GU2 A;  1Q7Y 1;  2BJO A;  2RT9 A;  1YJN 1;  2RIQ A;  1VQK 1;  1YHQ 1;  4A93 I;  2O4H A;  2PM9 A;  3CCM Z;  2NVX I;  4NBH A;  1VQ4 1;  1JWH C;  2AKL A;  3CMA 1;  1L1O C;  1YUK A;  3NDI A;  4DGL A;  3I55 1;  2M6N A;  3VMG A;  1Q82 2;  2PMZ A;  3RZD I;  1RQF A;  3EED A;  1Q82 1;  2JNY A;  2Q51 A;  2LFU A;  3I07 A;  4A3J I;  4E2X A;  3I56 1;  1K8A 2;  1K9M 2;  4A3K I;  3FKI I;  1K9M 1;  4X6A I;  2QKD A;  3PO3 I;  3CCL Z;  1Q7Y 2;  4MH4 A;  1YJ9 1;  4MD9 A;  2V8I A;  2RHB A;  1YI2 1;  3NH5 A;  4NB8 A;  5IT9 f;  3MZK B;  2QRD B;  4Y52 I;  4NBD A;  2E2J I;  1Y1V I;  1QYP A;  1Z03 A;  2OTL Z;  5D1O B;  1YI2 Z;  3G71 1;  1RLY A;  4QTU A;  4BXX I;  3CD6 1;  1WII A;  5C4J I;  2P28 A;  2V8J A;  3CCU 1;  3I4M I;  3GCF A;  4E33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...