3S15I

Rna polymerase ii initiation complex with a 7-nt rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s15I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s15I02
4NOZA 2NVXI 4MH4A 1Y1VS 3HOXI 3H3VJ 1TFIA 4A3GI 5IP7I 1VLAA 3GCFA 2KPIA 3VB9A 1I3QI 3EERA 1I50I 4NB9A 1I6HI 3S1RI 1TWCI 3S2DI 3GKQA 3HOVI 3S1QI 1DL6A 2R92I 5C4JI 4BBSI 3VMGA 3S1MI 3GTMS 3M3YI 3I07A 4BY1I 1NUIA 2F4OA 2JS4A 3S17I 5C3EI 4QTTA 2PK7A 3GTMI 4BY7I 4NBBA 2JA7I 1WW9A 3M4OI 3GTQI 4NBCA 4NBDA 4A3KI 1RLYA 1USPA 3CQZI 5IP9I 2BJOA 1R9TI 3GTOI 2R7ZI 3RZOI 2E2JI 3PO2I 4A3LI 3VMHA 4NBHA 2HF1A 4A3CI 1RO4A 2DE7A 1X3WA 3FKII 3HOUI 3K7AI 1PFTA 2P3YA 4A3BI 2YU9I 3VMIA 1YUAA 1ZB9A 2JNYA 1K83I 4A3JI 4NBGA 3Q87A 3U50C 1TWGI 2JA6I 2K5RA 1ZB8A 4QTUA 3I4NI 5CM2M 2VUMI 4A3DI 1TWAI 5C44I 3PO3I 4Y52I 2JA5I 4Y7NI 3GTPI 2DE6A 2AKLA 2NVTI 2NVQI 3S14I 4A3FI 1N2FA 4A3MI 4A3EI 4NBEA 1TWFI 3RZDI 2JA8I 3GTGI 2F4MA 3LUSA 3HOZI 1L1OC 5C4XI 3D6WA 4NBAA 2E2II 1X3ZA 2B63I 3I4MI 1TWHI 3HOYI 3S1NI 3PO3S 3S15I 4XX2A 3GTKI 3S16I 3GTLI 3H0GI 1USPB 1SFOI 5FLMI 1Y1VI 2JR6A 4NBFA 3S2HI 1QYPA 1Y1WI 1WCMI 3ESWA 4BXXI 4X6AI 2RBLA 3GTJI 2E2HI 3HOWI 4A93I 1ML8A 2J6AA 2NVYI 2R93I 4BBRI 4A3II 2DE5A 1LQLA 4NB8A
chains in the Genus database with same CATH superfamily
2QRCB 4NOZA 2PM9A 3HOXI 1YIJZ 5D1OA 3D9XA 3CCQZ 1YJN1 2KPIA 1I3QI 3EERA 5A2Qb 2QR1B 1KQSZ 1YUKA 1K731 3CD61 1W2BZ 3S1QI 2R92I 3IF8A 3S1MI 1K9M2 3FQMA 3I07A 1YI21 4BY1I 3J81b 2OTL1 3KIFA 2PK7A 2RIQA 3CPWZ 1VQ61 1VQP1 1WW9A 3M4OI 1NP6A 2E9HA 2OOYB 3NDIA 1N8R1 1YIT1 3TE5B 3CCV1 3RZOI 2JIRA 1Q861 1JJ2Y 1VQ41 3EEDA 2HF1A 2E7ZA 4A3CI 2AYDA 3OW2Y 3CCM1 3CCRZ 3CMEZ 1Z01A 2YU9I 5T6BA 3G4SZ 2Q4ZA 3I56Z 5D1OB 1KQSY 2LEXA 4MD9A 2ZAEB 4Y52I 2JA5I 2Y0SA 3GTPI 1W2BY 2AKLA 1M902 3S14I 5FLXf 1VQL1 1YJW1 2LIYA 3F3FC 3HOZI 3G6E1 1L1OC 3P5JB 1X3ZA 3CPWY 2M6NA 1KC82 2GU2A 4E2YA 4NH1C 3BG0B 2G2KA 1QVFZ 1Z03A 3CC4Z 3CCUZ 3GTJI 2R6MA 3HOWI 1YIJ1 3CCQ1 3CCL1 4A3II 4E2XA 1VQ91 1Q822 1VQMZ 3J7A4 4HGYA 1TFIA 4A3GI 3CMAZ 4DQYB 1VLAA 1YHQZ 4NB9A 1I6HI 3S2DI 4RVGA 2V8KA 3GKQA 1Q811 3GTMS 3CC71 3KIHA 2JIMA 2F4OA 2JS4A 3JAMf 3CC21 4QTTA 1YJ9Z 2I3CA 3CCS1 3GTQI 1VQO1 1VQ5Z 3CQZI 2R7ZI 1QVFY 3NH8A 2IZ3A 2QEXZ 1K8A1 3VTNA 3CCR1 3CME1 4S1TA 4DK1A 1VQNZ 1M1K2 1RO4A 2DE7A 3G4S1 3HOUI 3I561 5IT9f 2VPYA 1YUAA 1Q821 2QA4Z 2JNYA 4A3JI 4TNUA 3Q87A 3U50C 3I4NI 5AN9F 1ZH1A 4A3DI 2QKDA 5C44I 3I551 2VPZA 1Z02A 1FDIA 2WAQA 4A3FI 4A3EI 2GTIA 1TWFI 2JA8I 1KRLA 3NDJA 5C4XI 1VQ71 1VQ8Z 2B63I 3I4MI 1TWHI 2YADA 3CCEZ 3IR7A 4E32A 3J81f 3CC41 3CCU1 1S72Z 4XX2A 3GTKI 1SFOI 5FLMI 2W04A 2JR6A 3HKZA 5T64A 1SIWA 1QYPA 1QXFA 1YJNZ 3ESWA 1Y1WI 3BG1B 4BXXI 4X6AI 4A93I 1KD12 3CD6Z 2R93I 3D2LA 1K9M1 1Q7Y2 4Y7NI 1LQLA 1NJI2 1YI2Z 2K3RA 1JWHC 2H85A 4MH4A 4MD7A 3H3VJ 1RO0A 3CCJ1 1WIIA 1I50I 1VQ6Z 1VQPZ 3S1RI 1TWCI 2IZ4A 2VUGA 3J80f 1YITZ 3HOVI 1DL6A 5C4JI 1YJ91 2OTJ1 4RS4A 3CCVZ 3M3YI 1NUIA 2JMOA 4RVDA 1VQ4Z 5C3EI 4NBBA 3NH4A 2QEX1 4NBDA 1RNIA 1RLYA 1QVGZ 2V8IA 3G71Z 3IFUA 2O53A 5T67A 3NH5A 3VMHA 1FDOA 1M901 3MZLB 3K7AI 4E2ZA 1N8R2 2JUBA 1YJWZ 1K83I 4NBGA 1TWGI 1Q862 2JA6I 2K5RA 4QTUA 1TWAI 1Y8CA 1KC81 2QRDB 2NVQI 1VQ81 4A3MI 2PMZA 4NBEA 3RZDI 4MXUA 2F4MA 2Q51A 4MRIA 3D6WA 3CXCZ 2EGTA 2M48A 3T4NB 3MZKB 1VQKZ 1S7MA 4RV9A 2VPXA 3HOYI 3CCLZ 1VQ9Z 3PO3S 2JIQA 4RVHA 5LL6f 3S15I 3S16I 4E2WA 3H0GI 3GTLI 1QVGY 2P28A 4MD8A 3S2HI 2O4HA 1WCMI 2QREB 5A2Qf 2NAPA 2OOXB 2J6AA 2RT9A 4RVFA 2NVYI 2JIPA 2DE5A 4DGLA 4E30A 4NB8A 2WB1A 3CC7Z 2NVXI 1Y1VS 2HU9A 2GTHA 5IP7I 3GCFA 4HGZA 1WJ2A 3CC2Z 3VB9A 5FLXb 3CCSZ 1VQOZ 3TDHB 4CL1A 4BBSI 3VMGA 1VQM1 1Q16A 3CMA1 3S17I 1M1K1 3CXCY 5D1PA 3GTMI 4BY7I 2V45A 2JA7I 3G711 3J80b 1QF8A 1YHQ1 2VPWA 4NBCA 4A3KI 2OTLZ 1USPA 5IP9I 2LFUA 2BJOA 1R9TI 1Q812 3GTOI 3NFZA 2RPRA 1RQFA 2E2JI 3PO2I 4A3LI 2V8JA 1AA6A 4NBHA 3I55Z 1X3WA 3FKII 1PFTA 1VQ51 2P3YA 3F3PC 4A3BI 2VF1A 3FQQA 2W03A 3VMIA 1ZB9A 4NFRA 3CCMZ 1VQ7Z 1K732 2KI7B 1K8A2 1ZB8A 1VQN1 3QWUA 5CM2M 2VUMI 3PO3I 3JAMb 2DE6A 2QLVB 2NVTI 2RHBA 1N2FA 1VQK1 2IV2X 4E31A 2JIOA 2QA41 4E33A 3GTGI 3LUSA 1RO2A 2V3VA 4NBAA 1KD11 2E2II 3IX0A 4HH4A 1VQLZ 4EWCA 3S1NI 1Q7Y1 1NJI1 3MONA 3G6EZ 1USPB 1Y1VI 4AYBA 4NBFA 1X0TA 1JJ2Z 3CCJZ 2RBLA 2E2HI 5IT9b 4MONA 3OW2Z 1ML8A 1WZNA 3CCE1 1P9NA 4BBRI 2OZKA 1S721 2OTJZ
chains in the Genus database with same CATH topology
2QRCB 4NOZA 2PM9A 3HOXI 1YIJZ 5D1OA 3D9XA 3CCQZ 1YJN1 2KPIA 1I3QI 3EERA 5A2Qb 2QR1B 1KQSZ 1YUKA 1K731 3CD61 1W2BZ 3S1QI 2R92I 3IF8A 3S1MI 1K9M2 3FQMA 3I07A 1YI21 4BY1I 3J81b 2OTL1 3KIFA 2PK7A 2RIQA 3CPWZ 1VQ61 1VQP1 1WW9A 3M4OI 1NP6A 2E9HA 2OOYB 3NDIA 1N8R1 1YIT1 3TE5B 3CCV1 3RZOI 1Q861 1JJ2Y 1VQ41 3EEDA 2HF1A 4A3CI 3OW2Y 3CCM1 3CCRZ 3CMEZ 1Z01A 2YU9I 5T6BA 3G4SZ 2Q4ZA 3I56Z 5D1OB 1KQSY 4MD9A 2ZAEB 4Y52I 2JA5I 2Y0SA 3GTPI 1W2BY 2AKLA 1M902 3S14I 5FLXf 1VQL1 1YJW1 2LIYA 3F3FC 3HOZI 3G6E1 1L1OC 3P5JB 1X3ZA 3CPWY 2M6NA 1KC82 2GU2A 4E2YA 4NH1C 3BG0B 2G2KA 1QVFZ 1Z03A 3CC4Z 3CCUZ 3GTJI 2R6MA 3HOWI 1YIJ1 3CCQ1 3CCL1 4A3II 4E2XA 1VQ91 1Q822 1VQMZ 3J7A4 4HGYA 1TFIA 4A3GI 3CMAZ 4DQYB 1VLAA 1YHQZ 4NB9A 1I6HI 3S2DI 4RVGA 2V8KA 3GKQA 1Q811 3GTMS 3CC71 3KIHA 2F4OA 2JS4A 3JAMf 3CC21 4QTTA 1YJ9Z 2I3CA 3CCS1 3GTQI 1VQO1 1VQ5Z 3CQZI 2R7ZI 1QVFY 3NH8A 2IZ3A 2QEXZ 1K8A1 3VTNA 3CCR1 3CME1 4S1TA 4DK1A 1VQNZ 1M1K2 1RO4A 2DE7A 3G4S1 3HOUI 3I561 5IT9f 1YUAA 1Q821 2QA4Z 2JNYA 4A3JI 4TNUA 3Q87A 3U50C 3I4NI 5AN9F 1ZH1A 4A3DI 2QKDA 5C44I 3I551 1Z02A 2WAQA 4A3FI 4A3EI 2GTIA 1TWFI 2JA8I 1KRLA 3NDJA 5C4XI 1VQ71 1VQ8Z 2B63I 3I4MI 1TWHI 2YADA 3CCEZ 4E32A 3J81f 3CC41 3CCU1 1S72Z 4XX2A 3GTKI 1SFOI 5FLMI 2W04A 2JR6A 3HKZA 5T64A 1QYPA 1YJNZ 3ESWA 1Y1WI 3BG1B 4BXXI 4X6AI 4A93I 1KD12 3CD6Z 2R93I 1K9M1 1Q7Y2 4Y7NI 1LQLA 1NJI2 1YI2Z 2K3RA 1JWHC 2H85A 4MH4A 4MD7A 3H3VJ 1RO0A 3CCJ1 1WIIA 1I50I 1VQ6Z 1VQPZ 3S1RI 1TWCI 2IZ4A 2VUGA 3J80f 1YITZ 3HOVI 1DL6A 5C4JI 1YJ91 2OTJ1 4RS4A 3CCVZ 3M3YI 1NUIA 2JMOA 4RVDA 1VQ4Z 5C3EI 4NBBA 3NH4A 2QEX1 4NBDA 1RNIA 1RLYA 1QVGZ 2V8IA 3G71Z 3IFUA 2O53A 5T67A 3NH5A 3VMHA 1M901 3MZLB 3K7AI 4E2ZA 1N8R2 2JUBA 1YJWZ 1K83I 4NBGA 1TWGI 1Q862 2JA6I 2K5RA 4QTUA 1TWAI 1KC81 2QRDB 2NVQI 1VQ81 4A3MI 2PMZA 4NBEA 3RZDI 4MXUA 2F4MA 2Q51A 4MRIA 3D6WA 3CXCZ 2EGTA 2M48A 3T4NB 3MZKB 1VQKZ 1S7MA 4RV9A 3HOYI 3CCLZ 1VQ9Z 3PO3S 3S15I 4RVHA 5LL6f 3S16I 4E2WA 3H0GI 3GTLI 1QVGY 2P28A 4MD8A 3S2HI 2O4HA 1WCMI 2QREB 5A2Qf 2OOXB 2J6AA 2RT9A 4RVFA 2NVYI 2DE5A 4DGLA 4E30A 4NB8A 2WB1A 3CC7Z 2NVXI 1Y1VS 2HU9A 2GTHA 5IP7I 3GCFA 4HGZA 3CC2Z 3VB9A 5FLXb 3CCSZ 1VQOZ 3TDHB 4CL1A 4BBSI 3VMGA 1VQM1 3CMA1 3S17I 1M1K1 3CXCY 5D1PA 3GTMI 4BY7I 2JA7I 3G711 3J80b 1QF8A 1YHQ1 4NBCA 4A3KI 2OTLZ 1USPA 5IP9I 2LFUA 2BJOA 1R9TI 1Q812 3GTOI 3NFZA 2RPRA 1RQFA 2E2JI 3PO2I 4A3LI 2V8JA 4NBHA 3I55Z 1X3WA 3FKII 1PFTA 1VQ51 2P3YA 3F3PC 4A3BI 2VF1A 3FQQA 2W03A 3VMIA 1ZB9A 4NFRA 3CCMZ 1VQ7Z 1K732 2KI7B 1K8A2 1ZB8A 1VQN1 3QWUA 5CM2M 2VUMI 3PO3I 3JAMb 2DE6A 2QLVB 2NVTI 2RHBA 1N2FA 1VQK1 4E31A 2QA41 4E33A 3GTGI 3LUSA 1RO2A 4NBAA 1KD11 2E2II 3IX0A 4HH4A 1VQLZ 4EWCA 3S1NI 1Q7Y1 1NJI1 3MONA 3G6EZ 1USPB 1Y1VI 4AYBA 4NBFA 1X0TA 1JJ2Z 3CCJZ 2RBLA 2E2HI 5IT9b 4MONA 3OW2Z 1ML8A 3CCE1 1P9NA 4BBRI 2OZKA 1S721 2OTJZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NOZ A;  2NVX I;  4MH4 A;  1Y1V S;  3HOX I;  3H3V J;  1TFI A;  4A3G I;  5IP7 I;  1VLA A;  3GCF A;  2KPI A;  3VB9 A;  1I3Q I;  3EER A;  1I50 I;  4NB9 A;  1I6H I;  3S1R I;  1TWC I;  3S2D I;  3GKQ A;  3HOV I;  3S1Q I;  1DL6 A;  2R92 I;  5C4J I;  4BBS I;  3VMG A;  3S1M I;  3GTM S;  3M3Y I;  3I07 A;  4BY1 I;  1NUI A;  2F4O A;  2JS4 A;  3S17 I;  5C3E I;  4QTT A;  2PK7 A;  3GTM I;  4BY7 I;  4NBB A;  2JA7 I;  1WW9 A;  3M4O I;  3GTQ I;  4NBC A;  4NBD A;  4A3K I;  1RLY A;  1USP A;  3CQZ I;  5IP9 I;  2BJO A;  1R9T I;  3GTO I;  2R7Z I;  3RZO I;  2E2J I;  3PO2 I;  4A3L I;  3VMH A;  4NBH A;  2HF1 A;  4A3C I;  1RO4 A;  2DE7 A;  1X3W A;  3FKI I;  3HOU I;  3K7A I;  1PFT A;  2P3Y A;  4A3B I;  2YU9 I;  3VMI A;  1YUA A;  1ZB9 A;  2JNY A;  1K83 I;  4A3J I;  4NBG A;  3Q87 A;  3U50 C;  1TWG I;  2JA6 I;  2K5R A;  1ZB8 A;  4QTU A;  3I4N I;  5CM2 M;  2VUM I;  4A3D I;  1TWA I;  5C44 I;  3PO3 I;  4Y52 I;  2JA5 I;  4Y7N I;  3GTP I;  2DE6 A;  2AKL A;  2NVT I;  2NVQ I;  3S14 I;  4A3F I;  1N2F A;  4A3M I;  4A3E I;  4NBE A;  1TWF I;  3RZD I;  2JA8 I;  3GTG I;  2F4M A;  3LUS A;  3HOZ I;  1L1O C;  5C4X I;  3D6W A;  4NBA A;  2E2I I;  1X3Z A;  2B63 I;  3I4M I;  1TWH I;  3HOY I;  3S1N I;  3PO3 S;  3S15 I;  4XX2 A;  3GTK I;  3S16 I;  3GTL I;  3H0G I;  1USP B;  1SFO I;  5FLM I;  1Y1V I;  2JR6 A;  4NBF A;  3S2H I;  1QYP A;  1Y1W I;  1WCM I;  3ESW A;  4BXX I;  4X6A I;  2RBL A;  3GTJ I;  2E2H I;  3HOW I;  4A93 I;  1ML8 A;  2J6A A;  2NVY I;  2R93 I;  4BBR I;  4A3I I;  2DE5 A;  1LQL A;  4NB8 A; 
#chains in the Genus database with same CATH topology
 2QRC B;  4NOZ A;  2PM9 A;  3HOX I;  1YIJ Z;  5D1O A;  3D9X A;  3CCQ Z;  1YJN 1;  2KPI A;  1I3Q I;  3EER A;  5A2Q b;  2QR1 B;  1KQS Z;  1YUK A;  1K73 1;  3CD6 1;  1W2B Z;  3S1Q I;  2R92 I;  3IF8 A;  3S1M I;  1K9M 2;  3FQM A;  3I07 A;  1YI2 1;  4BY1 I;  3J81 b;  2OTL 1;  3KIF A;  2PK7 A;  2RIQ A;  3CPW Z;  1VQ6 1;  1VQP 1;  1WW9 A;  3M4O I;  1NP6 A;  2E9H A;  2OOY B;  3NDI A;  1N8R 1;  1YIT 1;  3TE5 B;  3CCV 1;  3RZO I;  2JIR A;  1Q86 1;  1JJ2 Y;  1VQ4 1;  3EED A;  2HF1 A;  2E7Z A;  4A3C I;  2AYD A;  3OW2 Y;  3CCM 1;  3CCR Z;  3CME Z;  1Z01 A;  2YU9 I;  5T6B A;  3G4S Z;  2Q4Z A;  3I56 Z;  5D1O B;  1KQS Y;  2LEX A;  4MD9 A;  2ZAE B;  4Y52 I;  2JA5 I;  2Y0S A;  3GTP I;  1W2B Y;  2AKL A;  1M90 2;  3S14 I;  5FLX f;  1VQL 1;  1YJW 1;  2LIY A;  3F3F C;  3HOZ I;  3G6E 1;  1L1O C;  3P5J B;  1X3Z A;  3CPW Y;  2M6N A;  1KC8 2;  2GU2 A;  4E2Y A;  4NH1 C;  3BG0 B;  2G2K A;  1QVF Z;  1Z03 A;  3CC4 Z;  3CCU Z;  3GTJ I;  2R6M A;  3HOW I;  1YIJ 1;  3CCQ 1;  3CCL 1;  4A3I I;  4E2X A;  1VQ9 1;  1Q82 2;  1VQM Z;  3J7A 4;  4HGY A;  1TFI A;  4A3G I;  3CMA Z;  4DQY B;  1VLA A;  1YHQ Z;  4NB9 A;  1I6H I;  3S2D I;  4RVG A;  2V8K A;  3GKQ A;  1Q81 1;  3GTM S;  3CC7 1;  3KIH A;  2JIM A;  2F4O A;  2JS4 A;  3JAM f;  3CC2 1;  4QTT A;  1YJ9 Z;  2I3C A;  3CCS 1;  3GTQ I;  1VQO 1;  1VQ5 Z;  3CQZ I;  2R7Z I;  1QVF Y;  3NH8 A;  2IZ3 A;  2QEX Z;  1K8A 1;  3VTN A;  3CCR 1;  3CME 1;  4S1T A;  4DK1 A;  1VQN Z;  1M1K 2;  1RO4 A;  2DE7 A;  3G4S 1;  3HOU I;  3I56 1;  5IT9 f;  2VPY A;  1YUA A;  1Q82 1;  2QA4 Z;  2JNY A;  4A3J I;  4TNU A;  3Q87 A;  3U50 C;  3I4N I;  5AN9 F;  1ZH1 A;  4A3D I;  2QKD A;  5C44 I;  3I55 1;  2VPZ A;  1Z02 A;  1FDI A;  2WAQ A;  4A3F I;  4A3E I;  2GTI A;  1TWF I;  2JA8 I;  1KRL A;  3NDJ A;  5C4X I;  1VQ7 1;  1VQ8 Z;  2B63 I;  3I4M I;  1TWH I;  2YAD A;  3CCE Z;  3IR7 A;  4E32 A;  3J81 f;  3CC4 1;  3CCU 1;  1S72 Z;  4XX2 A;  3GTK I;  1SFO I;  5FLM I;  2W04 A;  2JR6 A;  3HKZ A;  5T64 A;  1SIW A;  1QYP A;  1QXF A;  1YJN Z;  3ESW A;  1Y1W I;  3BG1 B;  4BXX I;  4X6A I;  4A93 I;  1KD1 2;  3CD6 Z;  2R93 I;  3D2L A;  1K9M 1;  1Q7Y 2;  4Y7N I;  1LQL A;  1NJI 2;  1YI2 Z;  2K3R A;  1JWH C;  2H85 A;  4MH4 A;  4MD7 A;  3H3V J;  1RO0 A;  3CCJ 1;  1WII A;  1I50 I;  1VQ6 Z;  1VQP Z;  3S1R I;  1TWC I;  2IZ4 A;  2VUG A;  3J80 f;  1YIT Z;  3HOV I;  1DL6 A;  5C4J I;  1YJ9 1;  2OTJ 1;  4RS4 A;  3CCV Z;  3M3Y I;  1NUI A;  2JMO A;  4RVD A;  1VQ4 Z;  5C3E I;  4NBB A;  3NH4 A;  2QEX 1;  4NBD A;  1RNI A;  1RLY A;  1QVG Z;  2V8I A;  3G71 Z;  3IFU A;  2O53 A;  5T67 A;  3NH5 A;  3VMH A;  1FDO A;  1M90 1;  3MZL B;  3K7A I;  4E2Z A;  1N8R 2;  2JUB A;  1YJW Z;  1K83 I;  4NBG A;  1TWG I;  1Q86 2;  2JA6 I;  2K5R A;  4QTU A;  1TWA I;  1Y8C A;  1KC8 1;  2QRD B;  2NVQ I;  1VQ8 1;  4A3M I;  2PMZ A;  4NBE A;  3RZD I;  4MXU A;  2F4M A;  2Q51 A;  4MRI A;  3D6W A;  3CXC Z;  2EGT A;  2M48 A;  3T4N B;  3MZK B;  1VQK Z;  1S7M A;  4RV9 A;  2VPX A;  3HOY I;  3CCL Z;  1VQ9 Z;  3PO3 S;  2JIQ A;  4RVH A;  5LL6 f;  3S15 I;  3S16 I;  4E2W A;  3H0G I;  3GTL I;  1QVG Y;  2P28 A;  4MD8 A;  3S2H I;  2O4H A;  1WCM I;  2QRE B;  5A2Q f;  2NAP A;  2OOX B;  2J6A A;  2RT9 A;  4RVF A;  2NVY I;  2JIP A;  2DE5 A;  4DGL A;  4E30 A;  4NB8 A;  2WB1 A;  3CC7 Z;  2NVX I;  1Y1V S;  2HU9 A;  2GTH A;  5IP7 I;  3GCF A;  4HGZ A;  1WJ2 A;  3CC2 Z;  3VB9 A;  5FLX b;  3CCS Z;  1VQO Z;  3TDH B;  4CL1 A;  4BBS I;  3VMG A;  1VQM 1;  1Q16 A;  3CMA 1;  3S17 I;  1M1K 1;  3CXC Y;  5D1P A;  3GTM I;  4BY7 I;  2V45 A;  2JA7 I;  3G71 1;  3J80 b;  1QF8 A;  1YHQ 1;  2VPW A;  4NBC A;  4A3K I;  2OTL Z;  1USP A;  5IP9 I;  2LFU A;  2BJO A;  1R9T I;  1Q81 2;  3GTO I;  3NFZ A;  2RPR A;  1RQF A;  2E2J I;  3PO2 I;  4A3L I;  2V8J A;  1AA6 A;  4NBH A;  3I55 Z;  1X3W A;  3FKI I;  1PFT A;  1VQ5 1;  2P3Y A;  3F3P C;  4A3B I;  2VF1 A;  3FQQ A;  2W03 A;  3VMI A;  1ZB9 A;  4NFR A;  3CCM Z;  1VQ7 Z;  1K73 2;  2KI7 B;  1K8A 2;  1ZB8 A;  1VQN 1;  3QWU A;  5CM2 M;  2VUM I;  3PO3 I;  3JAM b;  2DE6 A;  2QLV B;  2NVT I;  2RHB A;  1N2F A;  1VQK 1;  2IV2 X;  4E31 A;  2JIO A;  2QA4 1;  4E33 A;  3GTG I;  3LUS A;  1RO2 A;  2V3V A;  4NBA A;  1KD1 1;  2E2I I;  3IX0 A;  4HH4 A;  1VQL Z;  4EWC A;  3S1N I;  1Q7Y 1;  1NJI 1;  3MON A;  3G6E Z;  1USP B;  1Y1V I;  4AYB A;  4NBF A;  1X0T A;  1JJ2 Z;  3CCJ Z;  2RBL A;  2E2H I;  5IT9 b;  4MON A;  3OW2 Z;  1ML8 A;  1WZN A;  3CCE 1;  1P9N A;  4BBR I;  2OZK A;  1S72 1;  2OTJ Z; 
#chains in the Genus database with same CATH homology
 2QRC B;  4NOZ A;  2PM9 A;  3HOX I;  1YIJ Z;  5D1O A;  3D9X A;  3CCQ Z;  1YJN 1;  2KPI A;  1I3Q I;  3EER A;  5A2Q b;  2QR1 B;  1KQS Z;  1YUK A;  1K73 1;  3CD6 1;  1W2B Z;  3S1Q I;  2R92 I;  3IF8 A;  3S1M I;  1K9M 2;  3FQM A;  3I07 A;  1YI2 1;  4BY1 I;  3J81 b;  2OTL 1;  3KIF A;  2PK7 A;  2RIQ A;  3CPW Z;  1VQ6 1;  1VQP 1;  1WW9 A;  3M4O I;  1NP6 A;  2E9H A;  2OOY B;  3NDI A;  1N8R 1;  1YIT 1;  3TE5 B;  3CCV 1;  3RZO I;  1Q86 1;  1JJ2 Y;  1VQ4 1;  3EED A;  2HF1 A;  4A3C I;  3OW2 Y;  3CCM 1;  3CCR Z;  3CME Z;  1Z01 A;  2YU9 I;  5T6B A;  3G4S Z;  2Q4Z A;  3I56 Z;  5D1O B;  1KQS Y;  4MD9 A;  2ZAE B;  4Y52 I;  2JA5 I;  2Y0S A;  3GTP I;  1W2B Y;  2AKL A;  1M90 2;  3S14 I;  5FLX f;  1VQL 1;  1YJW 1;  2LIY A;  3F3F C;  3HOZ I;  3G6E 1;  1L1O C;  3P5J B;  1X3Z A;  3CPW Y;  2M6N A;  1KC8 2;  2GU2 A;  4E2Y A;  4NH1 C;  3BG0 B;  2G2K A;  1QVF Z;  1Z03 A;  3CC4 Z;  3CCU Z;  3GTJ I;  2R6M A;  3HOW I;  1YIJ 1;  3CCQ 1;  3CCL 1;  4A3I I;  4E2X A;  1VQ9 1;  1Q82 2;  1VQM Z;  3J7A 4;  4HGY A;  1TFI A;  4A3G I;  3CMA Z;  4DQY B;  1VLA A;  1YHQ Z;  4NB9 A;  1I6H I;  3S2D I;  4RVG A;  2V8K A;  3GKQ A;  1Q81 1;  3GTM S;  3CC7 1;  3KIH A;  2F4O A;  2JS4 A;  3JAM f;  3CC2 1;  4QTT A;  1YJ9 Z;  2I3C A;  3CCS 1;  3GTQ I;  1VQO 1;  1VQ5 Z;  3CQZ I;  2R7Z I;  1QVF Y;  3NH8 A;  2IZ3 A;  2QEX Z;  1K8A 1;  3VTN A;  3CCR 1;  3CME 1;  4S1T A;  4DK1 A;  1VQN Z;  1M1K 2;  1RO4 A;  2DE7 A;  3G4S 1;  3HOU I;  3I56 1;  5IT9 f;  1YUA A;  1Q82 1;  2QA4 Z;  2JNY A;  4A3J I;  4TNU A;  3Q87 A;  3U50 C;  3I4N I;  5AN9 F;  1ZH1 A;  4A3D I;  2QKD A;  5C44 I;  3I55 1;  1Z02 A;  2WAQ A;  4A3F I;  4A3E I;  2GTI A;  1TWF I;  2JA8 I;  1KRL A;  3NDJ A;  5C4X I;  1VQ7 1;  1VQ8 Z;  2B63 I;  3I4M I;  1TWH I;  2YAD A;  3CCE Z;  4E32 A;  3J81 f;  3CC4 1;  3CCU 1;  1S72 Z;  4XX2 A;  3GTK I;  1SFO I;  5FLM I;  2W04 A;  2JR6 A;  3HKZ A;  5T64 A;  1QYP A;  1YJN Z;  3ESW A;  1Y1W I;  3BG1 B;  4BXX I;  4X6A I;  4A93 I;  1KD1 2;  3CD6 Z;  2R93 I;  1K9M 1;  1Q7Y 2;  4Y7N I;  1LQL A;  1NJI 2;  1YI2 Z;  2K3R A;  1JWH C;  2H85 A;  4MH4 A;  4MD7 A;  3H3V J;  1RO0 A;  3CCJ 1;  1WII A;  1I50 I;  1VQ6 Z;  1VQP Z;  3S1R I;  1TWC I;  2IZ4 A;  2VUG A;  3J80 f;  1YIT Z;  3HOV I;  1DL6 A;  5C4J I;  1YJ9 1;  2OTJ 1;  4RS4 A;  3CCV Z;  3M3Y I;  1NUI A;  2JMO A;  4RVD A;  1VQ4 Z;  5C3E I;  4NBB A;  3NH4 A;  2QEX 1;  4NBD A;  1RNI A;  1RLY A;  1QVG Z;  2V8I A;  3G71 Z;  3IFU A;  2O53 A;  5T67 A;  3NH5 A;  3VMH A;  1M90 1;  3MZL B;  3K7A I;  4E2Z A;  1N8R 2;  2JUB A;  1YJW Z;  1K83 I;  4NBG A;  1TWG I;  1Q86 2;  2JA6 I;  2K5R A;  4QTU A;  1TWA I;  1KC8 1;  2QRD B;  2NVQ I;  1VQ8 1;  4A3M I;  2PMZ A;  4NBE A;  3RZD I;  4MXU A;  2F4M A;  2Q51 A;  4MRI A;  3D6W A;  3CXC Z;  2EGT A;  2M48 A;  3T4N B;  3MZK B;  1VQK Z;  1S7M A;  4RV9 A;  3HOY I;  3CCL Z;  1VQ9 Z;  3PO3 S;  3S15 I;  4RVH A;  5LL6 f;  3S16 I;  4E2W A;  3H0G I;  3GTL I;  1QVG Y;  2P28 A;  4MD8 A;  3S2H I;  2O4H A;  1WCM I;  2QRE B;  5A2Q f;  2OOX B;  2J6A A;  2RT9 A;  4RVF A;  2NVY I;  2DE5 A;  4DGL A;  4E30 A;  4NB8 A;  2WB1 A;  3CC7 Z;  2NVX I;  1Y1V S;  2HU9 A;  2GTH A;  5IP7 I;  3GCF A;  4HGZ A;  3CC2 Z;  3VB9 A;  5FLX b;  3CCS Z;  1VQO Z;  3TDH B;  4CL1 A;  4BBS I;  3VMG A;  1VQM 1;  3CMA 1;  3S17 I;  1M1K 1;  3CXC Y;  5D1P A;  3GTM I;  4BY7 I;  2JA7 I;  3G71 1;  3J80 b;  1QF8 A;  1YHQ 1;  4NBC A;  4A3K I;  2OTL Z;  1USP A;  5IP9 I;  2LFU A;  2BJO A;  1R9T I;  1Q81 2;  3GTO I;  3NFZ A;  2RPR A;  1RQF A;  2E2J I;  3PO2 I;  4A3L I;  2V8J A;  4NBH A;  3I55 Z;  1X3W A;  3FKI I;  1PFT A;  1VQ5 1;  2P3Y A;  3F3P C;  4A3B I;  2VF1 A;  3FQQ A;  2W03 A;  3VMI A;  1ZB9 A;  4NFR A;  3CCM Z;  1VQ7 Z;  1K73 2;  2KI7 B;  1K8A 2;  1ZB8 A;  1VQN 1;  3QWU A;  5CM2 M;  2VUM I;  3PO3 I;  3JAM b;  2DE6 A;  2QLV B;  2NVT I;  2RHB A;  1N2F A;  1VQK 1;  4E31 A;  2QA4 1;  4E33 A;  3GTG I;  3LUS A;  1RO2 A;  4NBA A;  1KD1 1;  2E2I I;  3IX0 A;  4HH4 A;  1VQL Z;  4EWC A;  3S1N I;  1Q7Y 1;  1NJI 1;  3MON A;  3G6E Z;  1USP B;  1Y1V I;  4AYB A;  4NBF A;  1X0T A;  1JJ2 Z;  3CCJ Z;  2RBL A;  2E2H I;  5IT9 b;  4MON A;  3OW2 Z;  1ML8 A;  3CCE 1;  1P9N A;  4BBR I;  2OZK A;  1S72 1;  2OTJ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...