3HOYI

Complete rna polymerase ii elongation complex vi
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hoyI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hoyI02
3S14I 4NBDA 4XX2A 1USPA 2R7ZI 1QYPA 1L1OC 1TFIA 2VUMI 1TWGI 5FLMI 1Y1WI 2HF1A 3S1NI 4A3MI 2PK7A 3GTLI 4NBHA 1I50I 2E2HI 4BBSI 4A3DI 5C4JI 2AKLA 3M3YI 3S1MI 1Y1VI 4NBFA 2DE5A 1RO4A 2JR6A 3GTGI 3H3VJ 4NOZA 2JA7I 2E2JI 2F4MA 3HOWI 3S17I 3GTMI 3EERA 3LUSA 3GTOI 3HOZI 3S1QI 4A3GI 2RBLA 2JNYA 3VMHA 3GTJI 3VB9A 3S2HI 3D6WA 3Q87A 5CM2M 2B63I 5C44I 4A3BI 2DE6A 2DE7A 3S16I 1X3ZA 3CQZI 4BY1I 4A3EI 2R92I 2NVTI 2NVXI 1RLYA 1X3WA 1YUAA 4Y7NI 1ZB8A 2NVYI 3PO3S 1TWCI 3GKQA 2J6AA 2JA6I 3GTKI 4X6AI 3GTPI 3I07A 4NBGA 5IP9I 4NBEA 3RZOI 1R9TI 3I4NI 4A3JI 1SFOI 4NBCA 3HOVI 3GCFA 2YU9I 2P3YA 3S2DI 2E2II 3U50C 2JA5I 5C4XI 1WCMI 1NUIA 1K83I 4Y52I 1N2FA 4A3CI 3H0GI 4NB9A 3K7AI 4A93I 2NVQI 4BY7I 3HOYI 1USPB 1WW9A 4NB8A 3PO2I 4A3II 5C3EI 4A3LI 4BXXI 3I4MI 1ZB9A 2JA8I 3RZDI 1VLAA 1DL6A 3VMIA 1Y1VS 4QTUA 1PFTA 3M4OI 3PO3I 3HOXI 2KPIA 1I3QI 4A3KI 1LQLA 4NBAA 3VMGA 3S15I 4A3FI 3S1RI 2F4OA 3GTMS 2JS4A 1TWAI 1ML8A 3GTQI 4MH4A 2BJOA 3FKII 4QTTA 1TWFI 4BBRI 3HOUI 2K5RA 1TWHI 3ESWA 5IP7I 1I6HI 2R93I 4NBBA
chains in the Genus database with same CATH superfamily
1X0TA 4XX2A 1USPA 1TFIA 2VUMI 3NH4A 4AYBA 3CME1 1Y1WI 2K3RA 2V3VA 3J7A4 2HF1A 1NJI2 2PK7A 3GTLI 1W2BZ 1VQN1 2I3CA 3GTMI 3LUSA 3HOZI 2EGTA 3VMHA 3VB9A 3S2HI 3Q87A 5CM2M 1Q822 5C44I 4HGZA 5IT9f 1RO0A 3CXCY 4A3EI 3IF8A 2KI7B 1RLYA 2JIMA 3G6E1 1ZB8A 1Q7Y1 3PO3S 5T64A 3J81b 3OW2Z 3GTKI 3CD61 1JWHC 4NBEA 3RZOI 4E32A 1VQ91 3CCJ1 4NBCA 3CCU1 3HOVI 1QVFY 2JA5I 4RV9A 4E2WA 3CCS1 1VQ51 3CC4Z 3IR7A 4BY7I 1M1K2 2M48A 3CCL1 4A3LI 5D1OA 1Z01A 3D9XA 4HH4A 4E2YA 1DL6A 5T67A 3VMIA 3QWUA 3MONA 2KPIA 2IZ4A 4A3KI 2RIQA 3I55Z 3S15I 1K731 2F4OA 2OTJ1 2VPZA 3GTMS 4DQYB 1VQPZ 3F3PC 3J80b 1WIIA 2JIQA 3CCVZ 2R93I 4NBBA 4NBDA 1YUKA 1YI21 1Q811 1TWGI 4NFRA 3G71Z 1W2BY 1VQ61 2PMZA 2VPWA 5FLXf 4A3MI 3D2LA 4NBHA 4E31A 2PM9A 3S1MI 2AKLA 3CC21 3EEDA 1QVGZ 2DE5A 1VQNZ 4DK1A 3IX0A 1RO4A 3NH8A 4NOZA 2Q4ZA 2RHBA 2F4MA 3S17I 3T4NB 1KQSZ 3S1QI 3CCM1 1VQO1 4E30A 2RBLA 3GTJI 3D6WA 3NDJA 5IT9b 1X3ZA 4BY1I 3G6EZ 3NH5A 2V8IA 3CCQ1 2O53A 1Q7Y2 1VQ71 1K9M1 3OW2Y 3CD6Z 1TWCI 1YJN1 4CL1A 2IV2X 1ZH1A 4X6AI 3IFUA 3I07A 1VQ9Z 2O4HA 3G4S1 2M6NA 3TDHB 2RPRA 3KIHA 4A3JI 1M901 1KRLA 1VQLZ 2QEXZ 3U50C 3CCSZ 1WCMI 5A2Qb 4NB9A 1S721 4A93I 2NVQI 4HGYA 2JUBA 4S1TA 3CCE1 3CMA1 1WW9A 2JIPA 4MXUA 3KIFA 2V45A 2YADA 1VLAA 1JJ2Z 4QTUA 4RVGA 3M4OI 1K732 1Q861 3MZKB 3CPWZ 2OTJZ 4E2XA 1P9NA 1K8A1 2JS4A 3GTQI 2GTHA 5A2Qf 4QTTA 1YJW1 1TWFI 3HOUI 1RQFA 2QA4Z 1FDIA 3JAMf 4RVDA 1YI2Z 4RS4A 1Q16A 1Q812 2ZAEB 1YIJZ 2R7ZI 1QYPA 1L1OC 1YIT1 5FLMI 3BG1B 3VTNA 5FLXb 1YJ91 2E9HA 1KC81 3CC2Z 4BBSI 1QVGY 1QF8A 2W04A 5C4JI 2V8JA 2R6MA 2QLVB 1VQ81 1Y1VI 4NBFA 5D1OB 1KQSY 3GTGI 2JR6A 2IZ3A 3FQMA 3H3VJ 1YHQ1 3HOWI 1AA6A 3EERA 1Y8CA 3CMEZ 2JNYA 2B63I 1WZNA 2DE6A 2W03A 2DE7A 3CQZI 5LL6f 2Y0SA 3NDIA 2R92I 1K9M2 5T6BA 4RVFA 2NVXI 3BG0B 1X3WA 2GTIA 2QKDA 1VQM1 2NVYI 3CC41 2GU2A 3G4SZ 3GTPI 4NBGA 1M902 1R9TI 1KD11 2H85A 3CC71 3GCFA 2YU9I 2E2II 3I561 3CCR1 2JIRA 1S72Z 1NUIA 3P5JB 1VQK1 1N2FA 4A3CI 3H0GI 3CCEZ 4E2ZA 3K7AI 1N8R1 3CMAZ 2WAQA 4RVHA 1VQP1 3CCV1 1USPB 4NB8A 2OTL1 2VUGA 3PO2I 4A3II 1JJ2Y 3CCJZ 3RZDI 3CCUZ 1Q862 3CPWY 1Y1VS 2VPYA 1VQ41 2LFUA 1K8A2 3G711 4NBAA 4A3FI 1YJWZ 3S1RI 1VQ5Z 2AYDA 1ML8A 2JMOA 2QRDB 2BJOA 3FKII 2VF1A 4BBRI 2V8KA 2K5RA 1TWHI 3CCLZ 1Z03A 3ESWA 3JAMb 1WJ2A 5IP7I 5AN9F 1YITZ 3S14I 4MONA 1SIWA 2RT9A 2WB1A 4NH1C 2P28A 1YJ9Z 1KC82 3S1NI 2Q51A 4EWCA 1VQ8Z 1I50I 2HU9A 2E2HI 2NAPA 1NJI1 4A3DI 3M3YI 1YHQZ 2QRCB 2LEXA 2E7ZA 2JA7I 2E2JI 4MD8A 3GTOI 4A3GI 4MD7A 1VQ6Z 2QREB 5D1PA 3TE5B 4A3BI 2G2KA 3S16I 1S7MA 1Q821 1VQL1 2QEX1 2QR1B 2NVTI 1VQMZ 3CXCZ 1YUAA 4Y7NI 1RO2A 4E33A 3GKQA 2J6AA 2JA6I 3CCMZ 1VQOZ 3J81f 1KD12 5IP9I 3CC7Z 3I4NI 1QXFA 4DGLA 3I56Z 3CCRZ 1SFOI 4MD9A 3S2DI 1VQKZ 2P3YA 4MRIA 5C4XI 1N8R2 2VPXA 3CCQZ 1QVFZ 1K83I 1Z02A 4Y52I 1VQ7Z 3HKZA 2OTLZ 1YJNZ 3HOYI 3F3FC 1M1K1 1NP6A 2QA41 3MZLB 3NFZA 5C3EI 4BXXI 3I4MI 1ZB9A 2JA8I 1VQ4Z 1YIJ1 1PFTA 2OOYB 3PO3I 3HOXI 1I3QI 1LQLA 3VMGA 2LIYA 1TWAI 3FQQA 4MH4A 3I551 1RNIA 2JIOA 2OOXB 4TNUA 3J80f 2OZKA 1FDOA 1I6HI
chains in the Genus database with same CATH topology
1X0TA 4XX2A 1USPA 1TFIA 2VUMI 3NH4A 4AYBA 3CME1 1Y1WI 2K3RA 3J7A4 2HF1A 1NJI2 2PK7A 3GTLI 1W2BZ 1VQN1 2I3CA 3GTMI 3LUSA 3HOZI 2EGTA 3VMHA 3VB9A 3S2HI 3Q87A 5CM2M 1Q822 5C44I 4HGZA 5IT9f 1RO0A 3CXCY 4A3EI 3IF8A 2KI7B 1RLYA 3G6E1 1ZB8A 1Q7Y1 3PO3S 5T64A 3J81b 3OW2Z 3GTKI 3CD61 1JWHC 4NBEA 3RZOI 4E32A 1VQ91 3CCJ1 4NBCA 3CCU1 3HOVI 1QVFY 2JA5I 4RV9A 4E2WA 3CCS1 1VQ51 3CC4Z 4BY7I 1M1K2 2M48A 3CCL1 4A3LI 5D1OA 1Z01A 3D9XA 4HH4A 4E2YA 1DL6A 5T67A 3VMIA 3QWUA 3MONA 2KPIA 2IZ4A 4A3KI 2RIQA 3I55Z 3S15I 1K731 2F4OA 2OTJ1 3GTMS 4DQYB 1VQPZ 3F3PC 3J80b 1WIIA 3CCVZ 2R93I 4NBBA 4NBDA 1YUKA 1YI21 1Q811 1TWGI 4NFRA 3G71Z 1W2BY 1VQ61 2PMZA 5FLXf 4A3MI 4NBHA 4E31A 2PM9A 3S1MI 2AKLA 3CC21 3EEDA 1QVGZ 2DE5A 1VQNZ 4DK1A 3IX0A 1RO4A 3NH8A 4NOZA 2Q4ZA 2RHBA 2F4MA 3S17I 3T4NB 1KQSZ 3S1QI 3CCM1 1VQO1 4E30A 2RBLA 3GTJI 3D6WA 3NDJA 5IT9b 1X3ZA 4BY1I 3G6EZ 3NH5A 2V8IA 3CCQ1 2O53A 1Q7Y2 1VQ71 1K9M1 3OW2Y 3CD6Z 1TWCI 1YJN1 4CL1A 1ZH1A 4X6AI 3IFUA 3I07A 1VQ9Z 2O4HA 3G4S1 2M6NA 3TDHB 2RPRA 3KIHA 4A3JI 1M901 1KRLA 1VQLZ 2QEXZ 3U50C 3CCSZ 1WCMI 5A2Qb 4NB9A 1S721 4A93I 2NVQI 4HGYA 2JUBA 4S1TA 3CCE1 3CMA1 1WW9A 4MXUA 3KIFA 2YADA 1VLAA 1JJ2Z 4QTUA 4RVGA 3M4OI 1K732 1Q861 3MZKB 3CPWZ 2OTJZ 4E2XA 1P9NA 1K8A1 2JS4A 3GTQI 2GTHA 5A2Qf 4QTTA 1YJW1 1TWFI 3HOUI 1RQFA 2QA4Z 3JAMf 4RVDA 1YI2Z 4RS4A 1Q812 2ZAEB 1YIJZ 2R7ZI 1QYPA 1L1OC 1YIT1 5FLMI 3BG1B 3VTNA 5FLXb 1YJ91 2E9HA 1KC81 3CC2Z 4BBSI 1QVGY 1QF8A 2W04A 5C4JI 2V8JA 2R6MA 2QLVB 1VQ81 1Y1VI 4NBFA 5D1OB 1KQSY 3GTGI 2JR6A 2IZ3A 3FQMA 3H3VJ 1YHQ1 3HOWI 3EERA 3CMEZ 2JNYA 2B63I 2DE6A 2W03A 2DE7A 3CQZI 5LL6f 2Y0SA 3NDIA 2R92I 1K9M2 5T6BA 4RVFA 2NVXI 3BG0B 1X3WA 2GTIA 2QKDA 1VQM1 2NVYI 3CC41 2GU2A 3G4SZ 3GTPI 4NBGA 1M902 1R9TI 1KD11 2H85A 3CC71 3GCFA 2YU9I 2E2II 3I561 3CCR1 1S72Z 1NUIA 3P5JB 1VQK1 1N2FA 4A3CI 3H0GI 3CCEZ 4E2ZA 3K7AI 1N8R1 3CMAZ 2WAQA 4RVHA 1VQP1 3CCV1 1USPB 4NB8A 2OTL1 2VUGA 3PO2I 4A3II 1JJ2Y 3CCJZ 3RZDI 3CCUZ 1Q862 3CPWY 1Y1VS 1VQ41 2LFUA 1K8A2 3G711 4NBAA 4A3FI 1YJWZ 3S1RI 1VQ5Z 1ML8A 2JMOA 2QRDB 2BJOA 3FKII 2VF1A 4BBRI 2V8KA 2K5RA 1TWHI 3CCLZ 1Z03A 3ESWA 3JAMb 5IP7I 5AN9F 1YITZ 3S14I 4MONA 2RT9A 2WB1A 4NH1C 2P28A 1YJ9Z 1KC82 3S1NI 2Q51A 4EWCA 1VQ8Z 1I50I 2HU9A 2E2HI 1NJI1 4A3DI 3M3YI 1YHQZ 2QRCB 2JA7I 2E2JI 4MD8A 3GTOI 4A3GI 4MD7A 1VQ6Z 2QREB 5D1PA 3TE5B 4A3BI 2G2KA 3S16I 1S7MA 1Q821 1VQL1 2QEX1 2QR1B 2NVTI 1VQMZ 3CXCZ 1YUAA 4Y7NI 1RO2A 4E33A 3GKQA 2J6AA 2JA6I 3CCMZ 1VQOZ 3J81f 1KD12 5IP9I 3CC7Z 3I4NI 4DGLA 3I56Z 3CCRZ 1SFOI 4MD9A 3S2DI 1VQKZ 2P3YA 4MRIA 5C4XI 1N8R2 3CCQZ 1QVFZ 1K83I 1Z02A 4Y52I 1VQ7Z 3HKZA 2OTLZ 1YJNZ 3HOYI 3F3FC 1M1K1 1NP6A 2QA41 3MZLB 3NFZA 5C3EI 4BXXI 3I4MI 1ZB9A 2JA8I 1VQ4Z 1YIJ1 1PFTA 2OOYB 3PO3I 3HOXI 1I3QI 1LQLA 3VMGA 2LIYA 1TWAI 3FQQA 4MH4A 3I551 1RNIA 2OOXB 4TNUA 3J80f 2OZKA 1I6HI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S14 I;  4NBD A;  4XX2 A;  1USP A;  2R7Z I;  1QYP A;  1L1O C;  1TFI A;  2VUM I;  1TWG I;  5FLM I;  1Y1W I;  2HF1 A;  3S1N I;  4A3M I;  2PK7 A;  3GTL I;  4NBH A;  1I50 I;  2E2H I;  4BBS I;  4A3D I;  5C4J I;  2AKL A;  3M3Y I;  3S1M I;  1Y1V I;  4NBF A;  2DE5 A;  1RO4 A;  2JR6 A;  3GTG I;  3H3V J;  4NOZ A;  2JA7 I;  2E2J I;  2F4M A;  3HOW I;  3S17 I;  3GTM I;  3EER A;  3LUS A;  3GTO I;  3HOZ I;  3S1Q I;  4A3G I;  2RBL A;  2JNY A;  3VMH A;  3GTJ I;  3VB9 A;  3S2H I;  3D6W A;  3Q87 A;  5CM2 M;  2B63 I;  5C44 I;  4A3B I;  2DE6 A;  2DE7 A;  3S16 I;  1X3Z A;  3CQZ I;  4BY1 I;  4A3E I;  2R92 I;  2NVT I;  2NVX I;  1RLY A;  1X3W A;  1YUA A;  4Y7N I;  1ZB8 A;  2NVY I;  3PO3 S;  1TWC I;  3GKQ A;  2J6A A;  2JA6 I;  3GTK I;  4X6A I;  3GTP I;  3I07 A;  4NBG A;  5IP9 I;  4NBE A;  3RZO I;  1R9T I;  3I4N I;  4A3J I;  1SFO I;  4NBC A;  3HOV I;  3GCF A;  2YU9 I;  2P3Y A;  3S2D I;  2E2I I;  3U50 C;  2JA5 I;  5C4X I;  1WCM I;  1NUI A;  1K83 I;  4Y52 I;  1N2F A;  4A3C I;  3H0G I;  4NB9 A;  3K7A I;  4A93 I;  2NVQ I;  4BY7 I;  3HOY I;  1USP B;  1WW9 A;  4NB8 A;  3PO2 I;  4A3I I;  5C3E I;  4A3L I;  4BXX I;  3I4M I;  1ZB9 A;  2JA8 I;  3RZD I;  1VLA A;  1DL6 A;  3VMI A;  1Y1V S;  4QTU A;  1PFT A;  3M4O I;  3PO3 I;  3HOX I;  2KPI A;  1I3Q I;  4A3K I;  1LQL A;  4NBA A;  3VMG A;  3S15 I;  4A3F I;  3S1R I;  2F4O A;  3GTM S;  2JS4 A;  1TWA I;  1ML8 A;  3GTQ I;  4MH4 A;  2BJO A;  3FKI I;  4QTT A;  1TWF I;  4BBR I;  3HOU I;  2K5R A;  1TWH I;  3ESW A;  5IP7 I;  1I6H I;  2R93 I;  4NBB A; 
#chains in the Genus database with same CATH topology
 1X0T A;  4XX2 A;  1USP A;  1TFI A;  2VUM I;  3NH4 A;  4AYB A;  3CME 1;  1Y1W I;  2K3R A;  2V3V A;  3J7A 4;  2HF1 A;  1NJI 2;  2PK7 A;  3GTL I;  1W2B Z;  1VQN 1;  2I3C A;  3GTM I;  3LUS A;  3HOZ I;  2EGT A;  3VMH A;  3VB9 A;  3S2H I;  3Q87 A;  5CM2 M;  1Q82 2;  5C44 I;  4HGZ A;  5IT9 f;  1RO0 A;  3CXC Y;  4A3E I;  3IF8 A;  2KI7 B;  1RLY A;  2JIM A;  3G6E 1;  1ZB8 A;  1Q7Y 1;  3PO3 S;  5T64 A;  3J81 b;  3OW2 Z;  3GTK I;  3CD6 1;  1JWH C;  4NBE A;  3RZO I;  4E32 A;  1VQ9 1;  3CCJ 1;  4NBC A;  3CCU 1;  3HOV I;  1QVF Y;  2JA5 I;  4RV9 A;  4E2W A;  3CCS 1;  1VQ5 1;  3CC4 Z;  3IR7 A;  4BY7 I;  1M1K 2;  2M48 A;  3CCL 1;  4A3L I;  5D1O A;  1Z01 A;  3D9X A;  4HH4 A;  4E2Y A;  1DL6 A;  5T67 A;  3VMI A;  3QWU A;  3MON A;  2KPI A;  2IZ4 A;  4A3K I;  2RIQ A;  3I55 Z;  3S15 I;  1K73 1;  2F4O A;  2OTJ 1;  2VPZ A;  3GTM S;  4DQY B;  1VQP Z;  3F3P C;  3J80 b;  1WII A;  2JIQ A;  3CCV Z;  2R93 I;  4NBB A;  4NBD A;  1YUK A;  1YI2 1;  1Q81 1;  1TWG I;  4NFR A;  3G71 Z;  1W2B Y;  1VQ6 1;  2PMZ A;  2VPW A;  5FLX f;  4A3M I;  3D2L A;  4NBH A;  4E31 A;  2PM9 A;  3S1M I;  2AKL A;  3CC2 1;  3EED A;  1QVG Z;  2DE5 A;  1VQN Z;  4DK1 A;  3IX0 A;  1RO4 A;  3NH8 A;  4NOZ A;  2Q4Z A;  2RHB A;  2F4M A;  3S17 I;  3T4N B;  1KQS Z;  3S1Q I;  3CCM 1;  1VQO 1;  4E30 A;  2RBL A;  3GTJ I;  3D6W A;  3NDJ A;  5IT9 b;  1X3Z A;  4BY1 I;  3G6E Z;  3NH5 A;  2V8I A;  3CCQ 1;  2O53 A;  1Q7Y 2;  1VQ7 1;  1K9M 1;  3OW2 Y;  3CD6 Z;  1TWC I;  1YJN 1;  4CL1 A;  2IV2 X;  1ZH1 A;  4X6A I;  3IFU A;  3I07 A;  1VQ9 Z;  2O4H A;  3G4S 1;  2M6N A;  3TDH B;  2RPR A;  3KIH A;  4A3J I;  1M90 1;  1KRL A;  1VQL Z;  2QEX Z;  3U50 C;  3CCS Z;  1WCM I;  5A2Q b;  4NB9 A;  1S72 1;  4A93 I;  2NVQ I;  4HGY A;  2JUB A;  4S1T A;  3CCE 1;  3CMA 1;  1WW9 A;  2JIP A;  4MXU A;  3KIF A;  2V45 A;  2YAD A;  1VLA A;  1JJ2 Z;  4QTU A;  4RVG A;  3M4O I;  1K73 2;  1Q86 1;  3MZK B;  3CPW Z;  2OTJ Z;  4E2X A;  1P9N A;  1K8A 1;  2JS4 A;  3GTQ I;  2GTH A;  5A2Q f;  4QTT A;  1YJW 1;  1TWF I;  3HOU I;  1RQF A;  2QA4 Z;  1FDI A;  3JAM f;  4RVD A;  1YI2 Z;  4RS4 A;  1Q16 A;  1Q81 2;  2ZAE B;  1YIJ Z;  2R7Z I;  1QYP A;  1L1O C;  1YIT 1;  5FLM I;  3BG1 B;  3VTN A;  5FLX b;  1YJ9 1;  2E9H A;  1KC8 1;  3CC2 Z;  4BBS I;  1QVG Y;  1QF8 A;  2W04 A;  5C4J I;  2V8J A;  2R6M A;  2QLV B;  1VQ8 1;  1Y1V I;  4NBF A;  5D1O B;  1KQS Y;  3GTG I;  2JR6 A;  2IZ3 A;  3FQM A;  3H3V J;  1YHQ 1;  3HOW I;  1AA6 A;  3EER A;  1Y8C A;  3CME Z;  2JNY A;  2B63 I;  1WZN A;  2DE6 A;  2W03 A;  2DE7 A;  3CQZ I;  5LL6 f;  2Y0S A;  3NDI A;  2R92 I;  1K9M 2;  5T6B A;  4RVF A;  2NVX I;  3BG0 B;  1X3W A;  2GTI A;  2QKD A;  1VQM 1;  2NVY I;  3CC4 1;  2GU2 A;  3G4S Z;  3GTP I;  4NBG A;  1M90 2;  1R9T I;  1KD1 1;  2H85 A;  3CC7 1;  3GCF A;  2YU9 I;  2E2I I;  3I56 1;  3CCR 1;  2JIR A;  1S72 Z;  1NUI A;  3P5J B;  1VQK 1;  1N2F A;  4A3C I;  3H0G I;  3CCE Z;  4E2Z A;  3K7A I;  1N8R 1;  3CMA Z;  2WAQ A;  4RVH A;  1VQP 1;  3CCV 1;  1USP B;  4NB8 A;  2OTL 1;  2VUG A;  3PO2 I;  4A3I I;  1JJ2 Y;  3CCJ Z;  3RZD I;  3CCU Z;  1Q86 2;  3CPW Y;  1Y1V S;  2VPY A;  1VQ4 1;  2LFU A;  1K8A 2;  3G71 1;  4NBA A;  4A3F I;  1YJW Z;  3S1R I;  1VQ5 Z;  2AYD A;  1ML8 A;  2JMO A;  2QRD B;  2BJO A;  3FKI I;  2VF1 A;  4BBR I;  2V8K A;  2K5R A;  1TWH I;  3CCL Z;  1Z03 A;  3ESW A;  3JAM b;  1WJ2 A;  5IP7 I;  5AN9 F;  1YIT Z;  3S14 I;  4MON A;  1SIW A;  2RT9 A;  2WB1 A;  4NH1 C;  2P28 A;  1YJ9 Z;  1KC8 2;  3S1N I;  2Q51 A;  4EWC A;  1VQ8 Z;  1I50 I;  2HU9 A;  2E2H I;  2NAP A;  1NJI 1;  4A3D I;  3M3Y I;  1YHQ Z;  2QRC B;  2LEX A;  2E7Z A;  2JA7 I;  2E2J I;  4MD8 A;  3GTO I;  4A3G I;  4MD7 A;  1VQ6 Z;  2QRE B;  5D1P A;  3TE5 B;  4A3B I;  2G2K A;  3S16 I;  1S7M A;  1Q82 1;  1VQL 1;  2QEX 1;  2QR1 B;  2NVT I;  1VQM Z;  3CXC Z;  1YUA A;  4Y7N I;  1RO2 A;  4E33 A;  3GKQ A;  2J6A A;  2JA6 I;  3CCM Z;  1VQO Z;  3J81 f;  1KD1 2;  5IP9 I;  3CC7 Z;  3I4N I;  1QXF A;  4DGL A;  3I56 Z;  3CCR Z;  1SFO I;  4MD9 A;  3S2D I;  1VQK Z;  2P3Y A;  4MRI A;  5C4X I;  1N8R 2;  2VPX A;  3CCQ Z;  1QVF Z;  1K83 I;  1Z02 A;  4Y52 I;  1VQ7 Z;  3HKZ A;  2OTL Z;  1YJN Z;  3HOY I;  3F3F C;  1M1K 1;  1NP6 A;  2QA4 1;  3MZL B;  3NFZ A;  5C3E I;  4BXX I;  3I4M I;  1ZB9 A;  2JA8 I;  1VQ4 Z;  1YIJ 1;  1PFT A;  2OOY B;  3PO3 I;  3HOX I;  1I3Q I;  1LQL A;  3VMG A;  2LIY A;  1TWA I;  3FQQ A;  4MH4 A;  3I55 1;  1RNI A;  2JIO A;  2OOX B;  4TNU A;  3J80 f;  2OZK A;  1FDO A;  1I6H I; 
#chains in the Genus database with same CATH homology
 1X0T A;  4XX2 A;  1USP A;  1TFI A;  2VUM I;  3NH4 A;  4AYB A;  3CME 1;  1Y1W I;  2K3R A;  3J7A 4;  2HF1 A;  1NJI 2;  2PK7 A;  3GTL I;  1W2B Z;  1VQN 1;  2I3C A;  3GTM I;  3LUS A;  3HOZ I;  2EGT A;  3VMH A;  3VB9 A;  3S2H I;  3Q87 A;  5CM2 M;  1Q82 2;  5C44 I;  4HGZ A;  5IT9 f;  1RO0 A;  3CXC Y;  4A3E I;  3IF8 A;  2KI7 B;  1RLY A;  3G6E 1;  1ZB8 A;  1Q7Y 1;  3PO3 S;  5T64 A;  3J81 b;  3OW2 Z;  3GTK I;  3CD6 1;  1JWH C;  4NBE A;  3RZO I;  4E32 A;  1VQ9 1;  3CCJ 1;  4NBC A;  3CCU 1;  3HOV I;  1QVF Y;  2JA5 I;  4RV9 A;  4E2W A;  3CCS 1;  1VQ5 1;  3CC4 Z;  4BY7 I;  1M1K 2;  2M48 A;  3CCL 1;  4A3L I;  5D1O A;  1Z01 A;  3D9X A;  4HH4 A;  4E2Y A;  1DL6 A;  5T67 A;  3VMI A;  3QWU A;  3MON A;  2KPI A;  2IZ4 A;  4A3K I;  2RIQ A;  3I55 Z;  3S15 I;  1K73 1;  2F4O A;  2OTJ 1;  3GTM S;  4DQY B;  1VQP Z;  3F3P C;  3J80 b;  1WII A;  3CCV Z;  2R93 I;  4NBB A;  4NBD A;  1YUK A;  1YI2 1;  1Q81 1;  1TWG I;  4NFR A;  3G71 Z;  1W2B Y;  1VQ6 1;  2PMZ A;  5FLX f;  4A3M I;  4NBH A;  4E31 A;  2PM9 A;  3S1M I;  2AKL A;  3CC2 1;  3EED A;  1QVG Z;  2DE5 A;  1VQN Z;  4DK1 A;  3IX0 A;  1RO4 A;  3NH8 A;  4NOZ A;  2Q4Z A;  2RHB A;  2F4M A;  3S17 I;  3T4N B;  1KQS Z;  3S1Q I;  3CCM 1;  1VQO 1;  4E30 A;  2RBL A;  3GTJ I;  3D6W A;  3NDJ A;  5IT9 b;  1X3Z A;  4BY1 I;  3G6E Z;  3NH5 A;  2V8I A;  3CCQ 1;  2O53 A;  1Q7Y 2;  1VQ7 1;  1K9M 1;  3OW2 Y;  3CD6 Z;  1TWC I;  1YJN 1;  4CL1 A;  1ZH1 A;  4X6A I;  3IFU A;  3I07 A;  1VQ9 Z;  2O4H A;  3G4S 1;  2M6N A;  3TDH B;  2RPR A;  3KIH A;  4A3J I;  1M90 1;  1KRL A;  1VQL Z;  2QEX Z;  3U50 C;  3CCS Z;  1WCM I;  5A2Q b;  4NB9 A;  1S72 1;  4A93 I;  2NVQ I;  4HGY A;  2JUB A;  4S1T A;  3CCE 1;  3CMA 1;  1WW9 A;  4MXU A;  3KIF A;  2YAD A;  1VLA A;  1JJ2 Z;  4QTU A;  4RVG A;  3M4O I;  1K73 2;  1Q86 1;  3MZK B;  3CPW Z;  2OTJ Z;  4E2X A;  1P9N A;  1K8A 1;  2JS4 A;  3GTQ I;  2GTH A;  5A2Q f;  4QTT A;  1YJW 1;  1TWF I;  3HOU I;  1RQF A;  2QA4 Z;  3JAM f;  4RVD A;  1YI2 Z;  4RS4 A;  1Q81 2;  2ZAE B;  1YIJ Z;  2R7Z I;  1QYP A;  1L1O C;  1YIT 1;  5FLM I;  3BG1 B;  3VTN A;  5FLX b;  1YJ9 1;  2E9H A;  1KC8 1;  3CC2 Z;  4BBS I;  1QVG Y;  1QF8 A;  2W04 A;  5C4J I;  2V8J A;  2R6M A;  2QLV B;  1VQ8 1;  1Y1V I;  4NBF A;  5D1O B;  1KQS Y;  3GTG I;  2JR6 A;  2IZ3 A;  3FQM A;  3H3V J;  1YHQ 1;  3HOW I;  3EER A;  3CME Z;  2JNY A;  2B63 I;  2DE6 A;  2W03 A;  2DE7 A;  3CQZ I;  5LL6 f;  2Y0S A;  3NDI A;  2R92 I;  1K9M 2;  5T6B A;  4RVF A;  2NVX I;  3BG0 B;  1X3W A;  2GTI A;  2QKD A;  1VQM 1;  2NVY I;  3CC4 1;  2GU2 A;  3G4S Z;  3GTP I;  4NBG A;  1M90 2;  1R9T I;  1KD1 1;  2H85 A;  3CC7 1;  3GCF A;  2YU9 I;  2E2I I;  3I56 1;  3CCR 1;  1S72 Z;  1NUI A;  3P5J B;  1VQK 1;  1N2F A;  4A3C I;  3H0G I;  3CCE Z;  4E2Z A;  3K7A I;  1N8R 1;  3CMA Z;  2WAQ A;  4RVH A;  1VQP 1;  3CCV 1;  1USP B;  4NB8 A;  2OTL 1;  2VUG A;  3PO2 I;  4A3I I;  1JJ2 Y;  3CCJ Z;  3RZD I;  3CCU Z;  1Q86 2;  3CPW Y;  1Y1V S;  1VQ4 1;  2LFU A;  1K8A 2;  3G71 1;  4NBA A;  4A3F I;  1YJW Z;  3S1R I;  1VQ5 Z;  1ML8 A;  2JMO A;  2QRD B;  2BJO A;  3FKI I;  2VF1 A;  4BBR I;  2V8K A;  2K5R A;  1TWH I;  3CCL Z;  1Z03 A;  3ESW A;  3JAM b;  5IP7 I;  5AN9 F;  1YIT Z;  3S14 I;  4MON A;  2RT9 A;  2WB1 A;  4NH1 C;  2P28 A;  1YJ9 Z;  1KC8 2;  3S1N I;  2Q51 A;  4EWC A;  1VQ8 Z;  1I50 I;  2HU9 A;  2E2H I;  1NJI 1;  4A3D I;  3M3Y I;  1YHQ Z;  2QRC B;  2JA7 I;  2E2J I;  4MD8 A;  3GTO I;  4A3G I;  4MD7 A;  1VQ6 Z;  2QRE B;  5D1P A;  3TE5 B;  4A3B I;  2G2K A;  3S16 I;  1S7M A;  1Q82 1;  1VQL 1;  2QEX 1;  2QR1 B;  2NVT I;  1VQM Z;  3CXC Z;  1YUA A;  4Y7N I;  1RO2 A;  4E33 A;  3GKQ A;  2J6A A;  2JA6 I;  3CCM Z;  1VQO Z;  3J81 f;  1KD1 2;  5IP9 I;  3CC7 Z;  3I4N I;  4DGL A;  3I56 Z;  3CCR Z;  1SFO I;  4MD9 A;  3S2D I;  1VQK Z;  2P3Y A;  4MRI A;  5C4X I;  1N8R 2;  3CCQ Z;  1QVF Z;  1K83 I;  1Z02 A;  4Y52 I;  1VQ7 Z;  3HKZ A;  2OTL Z;  1YJN Z;  3HOY I;  3F3F C;  1M1K 1;  1NP6 A;  2QA4 1;  3MZL B;  3NFZ A;  5C3E I;  4BXX I;  3I4M I;  1ZB9 A;  2JA8 I;  1VQ4 Z;  1YIJ 1;  1PFT A;  2OOY B;  3PO3 I;  3HOX I;  1I3Q I;  1LQL A;  3VMG A;  2LIY A;  1TWA I;  3FQQ A;  4MH4 A;  3I55 1;  1RNI A;  2OOX B;  4TNU A;  3J80 f;  2OZK A;  1I6H I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...