3HOYI

Complete rna polymerase ii elongation complex vi
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hoyI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hoyI02
3S1MI 5C4XI 1Y1VS 3D6WA 4NBBA 3PO3I 3S1RI 1L1OC 1TWCI 3S16I 3CQZI 3EERA 1PFTA 5FLMI 3K7AI 3S14I 2RBLA 3LUSA 3S17I 4BY1I 4A3FI 3GTLI 3M3YI 1WW9A 4A3LI 1QYPA 1USPA 4NBFA 2YU9I 2R93I 2JA8I 4A3EI 1ML8A 1R9TI 1X3WA 2VUMI 3HOXI 4NBAA 3Q87A 2AKLA 4BBSI 2BJOA 4Y7NI 1RLYA 4BY7I 2B63I 3S15I 3HOYI 4A3II 5IP9I 2E2JI 2JA5I 2DE6A 2JS4A 3VMGA 2P3YA 1YUAA 3GTMI 3PO2I 4XX2A 5C4JI 4A3DI 5IP7I 1TFIA 3GTMS 3GTGI 1LQLA 1RO4A 3VMHA 2DE7A 2R92I 3H3VJ 4NOZA 3M4OI 3RZDI 4A3BI 4NBCA 3I4NI 2F4OA 2E2II 3I07A 1I3QI 4A3JI 5C3EI 4NBGA 1K83I 4NBDA 3ESWA 4A93I 4X6AI 1VLAA 3VMIA 1WCMI 1I6HI 2JNYA 2E2HI 4A3CI 2KPIA 1Y1WI 4A3GI 3GTPI 1USPB 2JR6A 5CM2M 1ZB9A 3H0GI 2HF1A 4QTUA 2R7ZI 3S2DI 1DL6A 3I4MI 1NUIA 3S1QI 3S1NI 2J6AA 4MH4A 3FKII 4NB9A 3HOZI 4A3MI 3GCFA 2F4MA 5C44I 4NB8A 1TWFI 2K5RA 4BXXI 3HOVI 2NVXI 3GKQA 3HOUI 3PO3S 4Y52I 3RZOI 3U50C 3GTJI 3VB9A 1X3ZA 4QTTA 2NVYI 4A3KI 2NVTI 1TWGI 2JA7I 3S2HI 2NVQI 3GTKI 3HOWI 4NBEA 2JA6I 3GTOI 3GTQI 4BBRI 1ZB8A 1N2FA 1SFOI 1TWHI 4NBHA 1TWAI 1Y1VI 1I50I 2DE5A 2PK7A
chains in the Genus database with same CATH superfamily
1YIJZ 5LL6f 5A2Qf 1Q822 3S1RI 1VQK1 3CCEZ 3CQZI 3NDIA 1YIT1 1VQ6Z 1JWHC 1YI21 4DQYB 3CC7Z 3G6E1 2IZ3A 2E7ZA 2JA8I 2QA4Z 2VUMI 3D9XA 3HOXI 4NBAA 3Q87A 4AYBA 4BBSI 1Q861 1KC82 4Y7NI 2O53A 4BY7I 1VQKZ 3KIFA 2PM9A 2VPZA 1S7MA 1YUAA 3GTMI 3PO2I 2EGTA 5C4JI 4A3DI 2W03A 3CMEZ 3GTGI 2DE7A 3KIHA 1JJ2Z 1QVFY 3M4OI 3HKZA 4NBCA 1YJNZ 1M901 5D1OB 4RVGA 1VQP1 1I3QI 1Z03A 4E33A 2V8KA 4RS4A 3VMIA 2VPXA 2Y0SA 4CL1A 4HGYA 4A3GI 4RVHA 1NP6A 1VQ4Z 4E2WA 4QTUA 1DL6A 1VQN1 3I4MI 3NH8A 4TNUA 3FKII 2QEX1 2RHBA 1VQPZ 3MZKB 1NJI1 4E30A 3VTNA 2F4MA 1AA6A 4MD7A 3TDHB 1TWFI 3I561 2LFUA 1Q821 1M1K2 3NH5A 3GKQA 2NAPA 4Y52I 1FDIA 4RVFA 3D2LA 4A3KI 4DGLA 1TWGI 2KI7B 2NVQI 4S1TA 1QF8A 1NJI2 2QEXZ 3J80f 4BBRI 4MRIA 2PK7A 2OTL1 1M902 1VQ71 1KRLA 1RO0A 3S16I 2WB1A 3CPWZ 1YHQ1 5FLMI 4BY1I 3M3YI 4A3LI 3CCMZ 1W2BY 4A3EI 4E2YA 1ML8A 5T64A 3I55Z 2RT9A 3F3FC 2BJOA 2QA41 1Q7Y2 2I3CA 1YJ9Z 3S15I 3J81b 1YHQZ 3CCRZ 5IP9I 2E2JI 3JAMb 2RPRA 3CC41 1VQL1 4MXUA 1VQ81 5IP7I 1RO4A 3VMHA 5FLXb 3CME1 1FDOA 2R92I 4NOZA 5AN9F 1WZNA 4MD8A 2F4OA 2E2II 2VF1A 3FQQA 4E2ZA 1YJN1 4NBGA 1M1K1 1K83I 4NBDA 3MONA 1VLAA 1QVFZ 1X0TA 3CC4Z 1VQLZ 1Y1WI 1KD12 1VQ8Z 3IR7A 2OOXB 2IZ4A 1USPB 1ZB9A 2K3RA 1VQ91 1VQ41 4NB9A 3CCLZ 3HOZI 4A3MI 3J7A4 5C44I 4NB8A 3IFUA 3HOVI 2PMZA 3CCQ1 1RO2A 1KQSZ 3RZOI 3CXCY 1N8R2 3GTJI 4QTTA 1VQ9Z 3P5JB 3HOWI 2JA6I 3GTOI 2G2KA 1ZB8A 4NBHA 1Q7Y1 1I50I 1KQSY 5D1OA 2OTJZ 3S1MI 5C4XI 4RV9A 1Y1VS 3D6WA 1QXFA 3PO3I 2OZKA 3CCQZ 1L1OC 1TWCI 3EERA 3CD61 1PFTA 3K7AI 3CMA1 2RBLA 2GTHA 3G4S1 4RVDA 1QYPA 4NBFA 2P28A 1R9TI 3CCM1 2M48A 3IX0A 2QLVB 3I551 1YJW1 1S72Z 3T4NB 1RLYA 1W2BZ 2B63I 1YJ91 3CCU1 4EWCA 1SIWA 2JIMA 3CD6Z 1ZH1A 3CMAZ 2DE6A 3CCR1 3VMGA 3G4SZ 1KD11 2GTIA 2Q4ZA 4E31A 2V45A 1TFIA 3H3VJ 1YJWZ 1Q16A 4A3BI 1K8A2 2QKDA 3J81f 3I4NI 3CCUZ 3G71Z 5C3EI 3JAMf 1Z02A 1RQFA 2E2HI 1N8R1 3IF8A 5T6BA 2O4HA 1P9NA 1QVGZ 5FLXf 3GTPI 5CM2M 3H0GI 2R7ZI 3S2DI 2LEXA 1NUIA 3S1QI 3S1NI 2J6AA 2JUBA 2OOYB 3OW2Y 1WIIA 2VPWA 2YADA 2E9HA 3CCL1 2GU2A 2IV2X 2K5RA 4BXXI 5IT9b 3CC21 1QVGY 2QREB 2JIPA 3FQMA 3HOUI 4MD9A 4E32A 2R6MA 5A2Qb 1X3ZA 2NVYI 2JMOA 2JA7I 3S2HI 2QR1B 2W04A 3BG0B 2Q51A 4NBEA 1Z01A 1VQO1 3CXCZ 2HU9A 3CCJZ 3GTQI 4HH4A 1N2FA 1SFOI 1TWAI 1Y1VI 2DE5A 3CC2Z 1YITZ 4NBBA 2JIQA 1YUKA 2JIRA 2OTJ1 1YI2Z 3S14I 3LUSA 3G6EZ 3S17I 4A3FI 3GTLI 3CCV1 1K9M2 1K732 1WW9A 2AYDA 4DK1A 1USPA 1VQOZ 2YU9I 2R93I 1Q812 1X3WA 2RIQA 2AKLA 1K8A1 3CCS1 1S721 3HOYI 2V8IA 5D1PA 4A3II 2WAQA 4NFRA 2JA5I 3CCVZ 2JS4A 1RNIA 4E2XA 2P3YA 2LIYA 1JJ2Y 4XX2A 3GTMS 1LQLA 1VQ51 2V3VA 3F3PC 3NFZA 3RZDI 3CCSZ 1Q862 5T67A 3I07A 2VPYA 3MZLB 4A3JI 1VQM1 3ESWA 4A93I 4X6AI 2V8JA 3NH4A 3G711 1WCMI 1I6HI 2JNYA 4A3CI 2KPIA 3TE5B 3BG1B 1VQNZ 2JR6A 2HF1A 2VUGA 3EEDA 2M6NA 1VQ5Z 4MH4A 2QRCB 1KC81 3I56Z 3GCFA 4MONA 3J80b 1VQMZ 1YIJ1 2NVXI 3OW2Z 2QRDB 2JIOA 3PO3S 1Y8CA 3CCE1 3U50C 2ZAEB 1VQ61 1K9M1 1WJ2A 3VB9A 1K731 4HGZA 2NVTI 3CC71 3GTKI 2H85A 4NH1C 1Q811 2OTLZ 3CPWY 1TWHI 3CCJ1 3QWUA 5IT9f 1VQ7Z 3NDJA
chains in the Genus database with same CATH topology
1YIJZ 5LL6f 5A2Qf 1Q822 3S1RI 1VQK1 3CCEZ 3CQZI 3NDIA 1YIT1 1VQ6Z 1JWHC 1YI21 4DQYB 3CC7Z 3G6E1 2IZ3A 2JA8I 2QA4Z 2VUMI 3D9XA 3HOXI 4NBAA 3Q87A 4AYBA 4BBSI 1Q861 1KC82 4Y7NI 2O53A 4BY7I 1VQKZ 3KIFA 2PM9A 1S7MA 1YUAA 3GTMI 3PO2I 2EGTA 5C4JI 4A3DI 2W03A 3CMEZ 3GTGI 2DE7A 3KIHA 1JJ2Z 1QVFY 3M4OI 3HKZA 4NBCA 1YJNZ 1M901 5D1OB 4RVGA 1VQP1 1I3QI 1Z03A 4E33A 2V8KA 4RS4A 3VMIA 2Y0SA 4CL1A 4HGYA 4A3GI 4RVHA 1NP6A 1VQ4Z 4E2WA 4QTUA 1DL6A 1VQN1 3I4MI 3NH8A 4TNUA 3FKII 2QEX1 2RHBA 1VQPZ 3MZKB 1NJI1 4E30A 3VTNA 2F4MA 4MD7A 3TDHB 1TWFI 3I561 2LFUA 1Q821 1M1K2 3NH5A 3GKQA 4Y52I 4RVFA 4A3KI 4DGLA 1TWGI 2KI7B 2NVQI 4S1TA 1QF8A 1NJI2 2QEXZ 3J80f 4BBRI 4MRIA 2PK7A 2OTL1 1M902 1VQ71 1KRLA 1RO0A 3S16I 2WB1A 3CPWZ 1YHQ1 5FLMI 4BY1I 3M3YI 4A3LI 3CCMZ 1W2BY 4A3EI 4E2YA 1ML8A 5T64A 3I55Z 2RT9A 3F3FC 2BJOA 2QA41 1Q7Y2 2I3CA 1YJ9Z 3S15I 3J81b 1YHQZ 3CCRZ 5IP9I 2E2JI 3JAMb 2RPRA 3CC41 1VQL1 4MXUA 1VQ81 5IP7I 1RO4A 3VMHA 5FLXb 3CME1 2R92I 4NOZA 5AN9F 4MD8A 2F4OA 2E2II 2VF1A 3FQQA 4E2ZA 1YJN1 4NBGA 1M1K1 1K83I 4NBDA 3MONA 1VLAA 1QVFZ 1X0TA 3CC4Z 1VQLZ 1Y1WI 1KD12 1VQ8Z 2OOXB 2IZ4A 1USPB 1ZB9A 2K3RA 1VQ91 1VQ41 4NB9A 3CCLZ 3HOZI 4A3MI 3J7A4 5C44I 4NB8A 3IFUA 3HOVI 2PMZA 3CCQ1 1RO2A 1KQSZ 3RZOI 3CXCY 1N8R2 3GTJI 4QTTA 1VQ9Z 3P5JB 3HOWI 2JA6I 3GTOI 2G2KA 1ZB8A 4NBHA 1Q7Y1 1I50I 1KQSY 5D1OA 2OTJZ 3S1MI 5C4XI 4RV9A 1Y1VS 3D6WA 3PO3I 2OZKA 3CCQZ 1L1OC 1TWCI 3EERA 3CD61 1PFTA 3K7AI 3CMA1 2RBLA 2GTHA 3G4S1 4RVDA 1QYPA 4NBFA 2P28A 1R9TI 3CCM1 2M48A 3IX0A 2QLVB 3I551 1YJW1 1S72Z 3T4NB 1RLYA 1W2BZ 2B63I 1YJ91 3CCU1 4EWCA 3CD6Z 1ZH1A 3CMAZ 2DE6A 3CCR1 3VMGA 3G4SZ 1KD11 2GTIA 2Q4ZA 4E31A 1TFIA 3H3VJ 1YJWZ 4A3BI 1K8A2 2QKDA 3J81f 3I4NI 3CCUZ 3G71Z 5C3EI 3JAMf 1Z02A 1RQFA 2E2HI 1N8R1 3IF8A 5T6BA 2O4HA 1P9NA 1QVGZ 5FLXf 3GTPI 5CM2M 3H0GI 2R7ZI 3S2DI 1NUIA 3S1QI 3S1NI 2J6AA 2JUBA 2OOYB 3OW2Y 1WIIA 2YADA 2E9HA 3CCL1 2GU2A 2K5RA 4BXXI 5IT9b 3CC21 1QVGY 2QREB 3FQMA 3HOUI 4MD9A 4E32A 2R6MA 5A2Qb 1X3ZA 2NVYI 2JMOA 2JA7I 3S2HI 2QR1B 2W04A 3BG0B 2Q51A 4NBEA 1Z01A 1VQO1 3CXCZ 2HU9A 3CCJZ 3GTQI 4HH4A 1N2FA 1SFOI 1TWAI 1Y1VI 2DE5A 3CC2Z 1YITZ 4NBBA 1YUKA 2OTJ1 1YI2Z 3S14I 3LUSA 3G6EZ 3S17I 4A3FI 3GTLI 3CCV1 1K9M2 1K732 1WW9A 4DK1A 1USPA 1VQOZ 2YU9I 2R93I 1Q812 1X3WA 2RIQA 2AKLA 1K8A1 3CCS1 1S721 3HOYI 2V8IA 5D1PA 4A3II 2WAQA 4NFRA 2JA5I 3CCVZ 2JS4A 1RNIA 4E2XA 2P3YA 2LIYA 1JJ2Y 4XX2A 3GTMS 1LQLA 1VQ51 3F3PC 3NFZA 3RZDI 3CCSZ 1Q862 5T67A 3I07A 3MZLB 4A3JI 1VQM1 3ESWA 4A93I 4X6AI 2V8JA 3NH4A 3G711 1WCMI 1I6HI 2JNYA 4A3CI 2KPIA 3TE5B 3BG1B 1VQNZ 2JR6A 2HF1A 2VUGA 3EEDA 2M6NA 1VQ5Z 4MH4A 2QRCB 1KC81 3I56Z 3GCFA 4MONA 3J80b 1VQMZ 1YIJ1 2NVXI 3OW2Z 2QRDB 3PO3S 3CCE1 3U50C 2ZAEB 1VQ61 1K9M1 3VB9A 1K731 4HGZA 2NVTI 3CC71 3GTKI 2H85A 4NH1C 1Q811 2OTLZ 3CPWY 1TWHI 3CCJ1 3QWUA 5IT9f 1VQ7Z 3NDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1M I;  5C4X I;  1Y1V S;  3D6W A;  4NBB A;  3PO3 I;  3S1R I;  1L1O C;  1TWC I;  3S16 I;  3CQZ I;  3EER A;  1PFT A;  5FLM I;  3K7A I;  3S14 I;  2RBL A;  3LUS A;  3S17 I;  4BY1 I;  4A3F I;  3GTL I;  3M3Y I;  1WW9 A;  4A3L I;  1QYP A;  1USP A;  4NBF A;  2YU9 I;  2R93 I;  2JA8 I;  4A3E I;  1ML8 A;  1R9T I;  1X3W A;  2VUM I;  3HOX I;  4NBA A;  3Q87 A;  2AKL A;  4BBS I;  2BJO A;  4Y7N I;  1RLY A;  4BY7 I;  2B63 I;  3S15 I;  3HOY I;  4A3I I;  5IP9 I;  2E2J I;  2JA5 I;  2DE6 A;  2JS4 A;  3VMG A;  2P3Y A;  1YUA A;  3GTM I;  3PO2 I;  4XX2 A;  5C4J I;  4A3D I;  5IP7 I;  1TFI A;  3GTM S;  3GTG I;  1LQL A;  1RO4 A;  3VMH A;  2DE7 A;  2R92 I;  3H3V J;  4NOZ A;  3M4O I;  3RZD I;  4A3B I;  4NBC A;  3I4N I;  2F4O A;  2E2I I;  3I07 A;  1I3Q I;  4A3J I;  5C3E I;  4NBG A;  1K83 I;  4NBD A;  3ESW A;  4A93 I;  4X6A I;  1VLA A;  3VMI A;  1WCM I;  1I6H I;  2JNY A;  2E2H I;  4A3C I;  2KPI A;  1Y1W I;  4A3G I;  3GTP I;  1USP B;  2JR6 A;  5CM2 M;  1ZB9 A;  3H0G I;  2HF1 A;  4QTU A;  2R7Z I;  3S2D I;  1DL6 A;  3I4M I;  1NUI A;  3S1Q I;  3S1N I;  2J6A A;  4MH4 A;  3FKI I;  4NB9 A;  3HOZ I;  4A3M I;  3GCF A;  2F4M A;  5C44 I;  4NB8 A;  1TWF I;  2K5R A;  4BXX I;  3HOV I;  2NVX I;  3GKQ A;  3HOU I;  3PO3 S;  4Y52 I;  3RZO I;  3U50 C;  3GTJ I;  3VB9 A;  1X3Z A;  4QTT A;  2NVY I;  4A3K I;  2NVT I;  1TWG I;  2JA7 I;  3S2H I;  2NVQ I;  3GTK I;  3HOW I;  4NBE A;  2JA6 I;  3GTO I;  3GTQ I;  4BBR I;  1ZB8 A;  1N2F A;  1SFO I;  1TWH I;  4NBH A;  1TWA I;  1Y1V I;  1I50 I;  2DE5 A;  2PK7 A; 
#chains in the Genus database with same CATH topology
 1YIJ Z;  5LL6 f;  5A2Q f;  1Q82 2;  3S1R I;  1VQK 1;  3CCE Z;  3CQZ I;  3NDI A;  1YIT 1;  1VQ6 Z;  1JWH C;  1YI2 1;  4DQY B;  3CC7 Z;  3G6E 1;  2IZ3 A;  2E7Z A;  2JA8 I;  2QA4 Z;  2VUM I;  3D9X A;  3HOX I;  4NBA A;  3Q87 A;  4AYB A;  4BBS I;  1Q86 1;  1KC8 2;  4Y7N I;  2O53 A;  4BY7 I;  1VQK Z;  3KIF A;  2PM9 A;  2VPZ A;  1S7M A;  1YUA A;  3GTM I;  3PO2 I;  2EGT A;  5C4J I;  4A3D I;  2W03 A;  3CME Z;  3GTG I;  2DE7 A;  3KIH A;  1JJ2 Z;  1QVF Y;  3M4O I;  3HKZ A;  4NBC A;  1YJN Z;  1M90 1;  5D1O B;  4RVG A;  1VQP 1;  1I3Q I;  1Z03 A;  4E33 A;  2V8K A;  4RS4 A;  3VMI A;  2VPX A;  2Y0S A;  4CL1 A;  4HGY A;  4A3G I;  4RVH A;  1NP6 A;  1VQ4 Z;  4E2W A;  4QTU A;  1DL6 A;  1VQN 1;  3I4M I;  3NH8 A;  4TNU A;  3FKI I;  2QEX 1;  2RHB A;  1VQP Z;  3MZK B;  1NJI 1;  4E30 A;  3VTN A;  2F4M A;  1AA6 A;  4MD7 A;  3TDH B;  1TWF I;  3I56 1;  2LFU A;  1Q82 1;  1M1K 2;  3NH5 A;  3GKQ A;  2NAP A;  4Y52 I;  1FDI A;  4RVF A;  3D2L A;  4A3K I;  4DGL A;  1TWG I;  2KI7 B;  2NVQ I;  4S1T A;  1QF8 A;  1NJI 2;  2QEX Z;  3J80 f;  4BBR I;  4MRI A;  2PK7 A;  2OTL 1;  1M90 2;  1VQ7 1;  1KRL A;  1RO0 A;  3S16 I;  2WB1 A;  3CPW Z;  1YHQ 1;  5FLM I;  4BY1 I;  3M3Y I;  4A3L I;  3CCM Z;  1W2B Y;  4A3E I;  4E2Y A;  1ML8 A;  5T64 A;  3I55 Z;  2RT9 A;  3F3F C;  2BJO A;  2QA4 1;  1Q7Y 2;  2I3C A;  1YJ9 Z;  3S15 I;  3J81 b;  1YHQ Z;  3CCR Z;  5IP9 I;  2E2J I;  3JAM b;  2RPR A;  3CC4 1;  1VQL 1;  4MXU A;  1VQ8 1;  5IP7 I;  1RO4 A;  3VMH A;  5FLX b;  3CME 1;  1FDO A;  2R92 I;  4NOZ A;  5AN9 F;  1WZN A;  4MD8 A;  2F4O A;  2E2I I;  2VF1 A;  3FQQ A;  4E2Z A;  1YJN 1;  4NBG A;  1M1K 1;  1K83 I;  4NBD A;  3MON A;  1VLA A;  1QVF Z;  1X0T A;  3CC4 Z;  1VQL Z;  1Y1W I;  1KD1 2;  1VQ8 Z;  3IR7 A;  2OOX B;  2IZ4 A;  1USP B;  1ZB9 A;  2K3R A;  1VQ9 1;  1VQ4 1;  4NB9 A;  3CCL Z;  3HOZ I;  4A3M I;  3J7A 4;  5C44 I;  4NB8 A;  3IFU A;  3HOV I;  2PMZ A;  3CCQ 1;  1RO2 A;  1KQS Z;  3RZO I;  3CXC Y;  1N8R 2;  3GTJ I;  4QTT A;  1VQ9 Z;  3P5J B;  3HOW I;  2JA6 I;  3GTO I;  2G2K A;  1ZB8 A;  4NBH A;  1Q7Y 1;  1I50 I;  1KQS Y;  5D1O A;  2OTJ Z;  3S1M I;  5C4X I;  4RV9 A;  1Y1V S;  3D6W A;  1QXF A;  3PO3 I;  2OZK A;  3CCQ Z;  1L1O C;  1TWC I;  3EER A;  3CD6 1;  1PFT A;  3K7A I;  3CMA 1;  2RBL A;  2GTH A;  3G4S 1;  4RVD A;  1QYP A;  4NBF A;  2P28 A;  1R9T I;  3CCM 1;  2M48 A;  3IX0 A;  2QLV B;  3I55 1;  1YJW 1;  1S72 Z;  3T4N B;  1RLY A;  1W2B Z;  2B63 I;  1YJ9 1;  3CCU 1;  4EWC A;  1SIW A;  2JIM A;  3CD6 Z;  1ZH1 A;  3CMA Z;  2DE6 A;  3CCR 1;  3VMG A;  3G4S Z;  1KD1 1;  2GTI A;  2Q4Z A;  4E31 A;  2V45 A;  1TFI A;  3H3V J;  1YJW Z;  1Q16 A;  4A3B I;  1K8A 2;  2QKD A;  3J81 f;  3I4N I;  3CCU Z;  3G71 Z;  5C3E I;  3JAM f;  1Z02 A;  1RQF A;  2E2H I;  1N8R 1;  3IF8 A;  5T6B A;  2O4H A;  1P9N A;  1QVG Z;  5FLX f;  3GTP I;  5CM2 M;  3H0G I;  2R7Z I;  3S2D I;  2LEX A;  1NUI A;  3S1Q I;  3S1N I;  2J6A A;  2JUB A;  2OOY B;  3OW2 Y;  1WII A;  2VPW A;  2YAD A;  2E9H A;  3CCL 1;  2GU2 A;  2IV2 X;  2K5R A;  4BXX I;  5IT9 b;  3CC2 1;  1QVG Y;  2QRE B;  2JIP A;  3FQM A;  3HOU I;  4MD9 A;  4E32 A;  2R6M A;  5A2Q b;  1X3Z A;  2NVY I;  2JMO A;  2JA7 I;  3S2H I;  2QR1 B;  2W04 A;  3BG0 B;  2Q51 A;  4NBE A;  1Z01 A;  1VQO 1;  3CXC Z;  2HU9 A;  3CCJ Z;  3GTQ I;  4HH4 A;  1N2F A;  1SFO I;  1TWA I;  1Y1V I;  2DE5 A;  3CC2 Z;  1YIT Z;  4NBB A;  2JIQ A;  1YUK A;  2JIR A;  2OTJ 1;  1YI2 Z;  3S14 I;  3LUS A;  3G6E Z;  3S17 I;  4A3F I;  3GTL I;  3CCV 1;  1K9M 2;  1K73 2;  1WW9 A;  2AYD A;  4DK1 A;  1USP A;  1VQO Z;  2YU9 I;  2R93 I;  1Q81 2;  1X3W A;  2RIQ A;  2AKL A;  1K8A 1;  3CCS 1;  1S72 1;  3HOY I;  2V8I A;  5D1P A;  4A3I I;  2WAQ A;  4NFR A;  2JA5 I;  3CCV Z;  2JS4 A;  1RNI A;  4E2X A;  2P3Y A;  2LIY A;  1JJ2 Y;  4XX2 A;  3GTM S;  1LQL A;  1VQ5 1;  2V3V A;  3F3P C;  3NFZ A;  3RZD I;  3CCS Z;  1Q86 2;  5T67 A;  3I07 A;  2VPY A;  3MZL B;  4A3J I;  1VQM 1;  3ESW A;  4A93 I;  4X6A I;  2V8J A;  3NH4 A;  3G71 1;  1WCM I;  1I6H I;  2JNY A;  4A3C I;  2KPI A;  3TE5 B;  3BG1 B;  1VQN Z;  2JR6 A;  2HF1 A;  2VUG A;  3EED A;  2M6N A;  1VQ5 Z;  4MH4 A;  2QRC B;  1KC8 1;  3I56 Z;  3GCF A;  4MON A;  3J80 b;  1VQM Z;  1YIJ 1;  2NVX I;  3OW2 Z;  2QRD B;  2JIO A;  3PO3 S;  1Y8C A;  3CCE 1;  3U50 C;  2ZAE B;  1VQ6 1;  1K9M 1;  1WJ2 A;  3VB9 A;  1K73 1;  4HGZ A;  2NVT I;  3CC7 1;  3GTK I;  2H85 A;  4NH1 C;  1Q81 1;  2OTL Z;  3CPW Y;  1TWH I;  3CCJ 1;  3QWU A;  5IT9 f;  1VQ7 Z;  3NDJ A; 
#chains in the Genus database with same CATH homology
 1YIJ Z;  5LL6 f;  5A2Q f;  1Q82 2;  3S1R I;  1VQK 1;  3CCE Z;  3CQZ I;  3NDI A;  1YIT 1;  1VQ6 Z;  1JWH C;  1YI2 1;  4DQY B;  3CC7 Z;  3G6E 1;  2IZ3 A;  2JA8 I;  2QA4 Z;  2VUM I;  3D9X A;  3HOX I;  4NBA A;  3Q87 A;  4AYB A;  4BBS I;  1Q86 1;  1KC8 2;  4Y7N I;  2O53 A;  4BY7 I;  1VQK Z;  3KIF A;  2PM9 A;  1S7M A;  1YUA A;  3GTM I;  3PO2 I;  2EGT A;  5C4J I;  4A3D I;  2W03 A;  3CME Z;  3GTG I;  2DE7 A;  3KIH A;  1JJ2 Z;  1QVF Y;  3M4O I;  3HKZ A;  4NBC A;  1YJN Z;  1M90 1;  5D1O B;  4RVG A;  1VQP 1;  1I3Q I;  1Z03 A;  4E33 A;  2V8K A;  4RS4 A;  3VMI A;  2Y0S A;  4CL1 A;  4HGY A;  4A3G I;  4RVH A;  1NP6 A;  1VQ4 Z;  4E2W A;  4QTU A;  1DL6 A;  1VQN 1;  3I4M I;  3NH8 A;  4TNU A;  3FKI I;  2QEX 1;  2RHB A;  1VQP Z;  3MZK B;  1NJI 1;  4E30 A;  3VTN A;  2F4M A;  4MD7 A;  3TDH B;  1TWF I;  3I56 1;  2LFU A;  1Q82 1;  1M1K 2;  3NH5 A;  3GKQ A;  4Y52 I;  4RVF A;  4A3K I;  4DGL A;  1TWG I;  2KI7 B;  2NVQ I;  4S1T A;  1QF8 A;  1NJI 2;  2QEX Z;  3J80 f;  4BBR I;  4MRI A;  2PK7 A;  2OTL 1;  1M90 2;  1VQ7 1;  1KRL A;  1RO0 A;  3S16 I;  2WB1 A;  3CPW Z;  1YHQ 1;  5FLM I;  4BY1 I;  3M3Y I;  4A3L I;  3CCM Z;  1W2B Y;  4A3E I;  4E2Y A;  1ML8 A;  5T64 A;  3I55 Z;  2RT9 A;  3F3F C;  2BJO A;  2QA4 1;  1Q7Y 2;  2I3C A;  1YJ9 Z;  3S15 I;  3J81 b;  1YHQ Z;  3CCR Z;  5IP9 I;  2E2J I;  3JAM b;  2RPR A;  3CC4 1;  1VQL 1;  4MXU A;  1VQ8 1;  5IP7 I;  1RO4 A;  3VMH A;  5FLX b;  3CME 1;  2R92 I;  4NOZ A;  5AN9 F;  4MD8 A;  2F4O A;  2E2I I;  2VF1 A;  3FQQ A;  4E2Z A;  1YJN 1;  4NBG A;  1M1K 1;  1K83 I;  4NBD A;  3MON A;  1VLA A;  1QVF Z;  1X0T A;  3CC4 Z;  1VQL Z;  1Y1W I;  1KD1 2;  1VQ8 Z;  2OOX B;  2IZ4 A;  1USP B;  1ZB9 A;  2K3R A;  1VQ9 1;  1VQ4 1;  4NB9 A;  3CCL Z;  3HOZ I;  4A3M I;  3J7A 4;  5C44 I;  4NB8 A;  3IFU A;  3HOV I;  2PMZ A;  3CCQ 1;  1RO2 A;  1KQS Z;  3RZO I;  3CXC Y;  1N8R 2;  3GTJ I;  4QTT A;  1VQ9 Z;  3P5J B;  3HOW I;  2JA6 I;  3GTO I;  2G2K A;  1ZB8 A;  4NBH A;  1Q7Y 1;  1I50 I;  1KQS Y;  5D1O A;  2OTJ Z;  3S1M I;  5C4X I;  4RV9 A;  1Y1V S;  3D6W A;  3PO3 I;  2OZK A;  3CCQ Z;  1L1O C;  1TWC I;  3EER A;  3CD6 1;  1PFT A;  3K7A I;  3CMA 1;  2RBL A;  2GTH A;  3G4S 1;  4RVD A;  1QYP A;  4NBF A;  2P28 A;  1R9T I;  3CCM 1;  2M48 A;  3IX0 A;  2QLV B;  3I55 1;  1YJW 1;  1S72 Z;  3T4N B;  1RLY A;  1W2B Z;  2B63 I;  1YJ9 1;  3CCU 1;  4EWC A;  3CD6 Z;  1ZH1 A;  3CMA Z;  2DE6 A;  3CCR 1;  3VMG A;  3G4S Z;  1KD1 1;  2GTI A;  2Q4Z A;  4E31 A;  1TFI A;  3H3V J;  1YJW Z;  4A3B I;  1K8A 2;  2QKD A;  3J81 f;  3I4N I;  3CCU Z;  3G71 Z;  5C3E I;  3JAM f;  1Z02 A;  1RQF A;  2E2H I;  1N8R 1;  3IF8 A;  5T6B A;  2O4H A;  1P9N A;  1QVG Z;  5FLX f;  3GTP I;  5CM2 M;  3H0G I;  2R7Z I;  3S2D I;  1NUI A;  3S1Q I;  3S1N I;  2J6A A;  2JUB A;  2OOY B;  3OW2 Y;  1WII A;  2YAD A;  2E9H A;  3CCL 1;  2GU2 A;  2K5R A;  4BXX I;  5IT9 b;  3CC2 1;  1QVG Y;  2QRE B;  3FQM A;  3HOU I;  4MD9 A;  4E32 A;  2R6M A;  5A2Q b;  1X3Z A;  2NVY I;  2JMO A;  2JA7 I;  3S2H I;  2QR1 B;  2W04 A;  3BG0 B;  2Q51 A;  4NBE A;  1Z01 A;  1VQO 1;  3CXC Z;  2HU9 A;  3CCJ Z;  3GTQ I;  4HH4 A;  1N2F A;  1SFO I;  1TWA I;  1Y1V I;  2DE5 A;  3CC2 Z;  1YIT Z;  4NBB A;  1YUK A;  2OTJ 1;  1YI2 Z;  3S14 I;  3LUS A;  3G6E Z;  3S17 I;  4A3F I;  3GTL I;  3CCV 1;  1K9M 2;  1K73 2;  1WW9 A;  4DK1 A;  1USP A;  1VQO Z;  2YU9 I;  2R93 I;  1Q81 2;  1X3W A;  2RIQ A;  2AKL A;  1K8A 1;  3CCS 1;  1S72 1;  3HOY I;  2V8I A;  5D1P A;  4A3I I;  2WAQ A;  4NFR A;  2JA5 I;  3CCV Z;  2JS4 A;  1RNI A;  4E2X A;  2P3Y A;  2LIY A;  1JJ2 Y;  4XX2 A;  3GTM S;  1LQL A;  1VQ5 1;  3F3P C;  3NFZ A;  3RZD I;  3CCS Z;  1Q86 2;  5T67 A;  3I07 A;  3MZL B;  4A3J I;  1VQM 1;  3ESW A;  4A93 I;  4X6A I;  2V8J A;  3NH4 A;  3G71 1;  1WCM I;  1I6H I;  2JNY A;  4A3C I;  2KPI A;  3TE5 B;  3BG1 B;  1VQN Z;  2JR6 A;  2HF1 A;  2VUG A;  3EED A;  2M6N A;  1VQ5 Z;  4MH4 A;  2QRC B;  1KC8 1;  3I56 Z;  3GCF A;  4MON A;  3J80 b;  1VQM Z;  1YIJ 1;  2NVX I;  3OW2 Z;  2QRD B;  3PO3 S;  3CCE 1;  3U50 C;  2ZAE B;  1VQ6 1;  1K9M 1;  3VB9 A;  1K73 1;  4HGZ A;  2NVT I;  3CC7 1;  3GTK I;  2H85 A;  4NH1 C;  1Q81 1;  2OTL Z;  3CPW Y;  1TWH I;  3CCJ 1;  3QWU A;  5IT9 f;  1VQ7 Z;  3NDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...