4MD9A

Crystal structure of symmetric ck2 holoenzyme with mutated alpha subunit (f121e truncated at aa 336)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
201
structure length
201
Chain Sequence
VSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Casein kinase II subunit beta
publication title Active Form of the Protein Kinase CK2 alpha 2 beta 2 Holoenzyme Is a Strong Complex with Symmetric Architecture.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 201
sequence length 201
chains with identical sequence B, C, D, I, J, N, O
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 4md9A01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4md9A02
2RT9A 1JWHC 1RQFA 2M48A 4MD9A 1QF8A 2M6NA 2JMOA 4MD8A 4NH1C 3EEDA 4DGLA 4MD7A 2R6MA
chains in the Genus database with same CATH superfamily
3FKII 3FQMA 5FLMI 1Q822 3NH4A 3CC41 3G4SZ 2PMZA 4EWCA 1TWHI 2HF1A 3I4NI 4NB9A 2GU2A 1W2BZ 2RBLA 3JAMb 1YITZ 1R9TI 1TWCI 3K7AI 2OOYB 3CCQ1 5CM2M 1X3WA 1I3QI 3CCJ1 1Y1VI 1TWAI 3CQZI 1TFIA 1Z01A 2K5RA 3CCU1 3VB9A 3GTPI 3LUSA 1Y8CA 2OOXB 4MD8A 3S15I 5C3EI 3HOXI 2VPWA 3CCQZ 3I4MI 4S1TA 3Q87A 2E2HI 1ZH1A 3I56Z 2QR1B 5T6BA 1VQL1 2IV2X 1M1K2 2OZKA 2JA5I 1YJN1 3QWUA 4DGLA 2BJOA 3M4OI 3CCS1 3CCUZ 2NAPA 1ZB8A 5D1PA 3CXCY 3HOUI 4HGYA 2LIYA 3GTLI 2JA8I 2I3CA 5LL6f 2F4OA 1Q7Y2 2E9HA 1DL6A 1VQLZ 1N8R2 1RO2A 3CMA1 3CCSZ 2F4MA 5AN9F 1Y1VS 4NBHA 2JIPA 1K8A1 4A3DI 3EEDA 3D9XA 1FDIA 1VQ4Z 2VPYA 1QF8A 1K731 3S2HI 2EGTA 2DE5A 4RV9A 1QVFY 1NUIA 3CMAZ 3HOWI 3J7A4 4A3EI 1Y1WI 4AYBA 1FDOA 4A3FI 2JS4A 2VUGA 3IFUA 3NDJA 3VMGA 5D1OA 2QEXZ 2GTIA 1QVGZ 3CME1 2V8JA 1RLYA 4QTUA 3CPWZ 2JR6A 4A3MI 4RVFA 5IP9I 5IT9f 3PO2I 1VQKZ 1SFOI 2IZ4A 1WJ2A 3CCL1 4A93I 1YIJZ 3NH5A 2WB1A 3CC71 1Q862 4RS4A 5C4JI 1KC82 4RVDA 4BY7I 3U50C 4NBDA 4A3II 5D1OB 3CCLZ 3GTOI 1PFTA 2Q51A 2H85A 1Q7Y1 2O4HA 3CC7Z 4E2ZA 1VQ9Z 1KD11 4NOZA 1JJ2Z 2V45A 4BXXI 5A2Qb 1VQM1 5C4XI 1SIWA 4MRIA 5A2Qf 3CC4Z 1VQN1 1S721 1NJI2 3NFZA 2OTJ1 1VQ51 5IP7I 1AA6A 1YUAA 1YJW1 3D2LA 5FLXf 1KQSY 2J6AA 2JMOA 4TNUA 1VQMZ 3CCJZ 4MH4A 2NVYI 2WAQA 1VQNZ 4NB8A 4Y7NI 4CL1A 5T67A 3GTJI 2OTJZ 2OTL1 1Q16A 3IX0A 1WCMI 2KPIA 1YJWZ 3CCV1 2QRCB 2E2II 3S1MI 3S1NI 4A3BI 5T64A 3G6E1 3KIHA 1YJNZ 3F3FC 2OTLZ 3CXCZ 3D6WA 3H0GI 1K83I 1S7MA 3H3VJ 1QYPA 4NBBA 2GTHA 1M901 4BBSI 2JA7I 4A3JI 4MD9A 1TWGI 2RPRA 1YJ91 1Z03A 1Q861 2R92I 4XX2A 3G6EZ 2QKDA 2JNYA 3TE5B 1KC81 2LEXA 4MXUA 3T4NB 1Q821 4NH1C 3MZKB 1N2FA 1TWFI 3OW2Y 1QVFZ 4Y52I 3CCM1 2VPXA 2ZAEB 2E2JI 2B63I 4HGZA 2G2KA 3GTMI 2YU9I 3S1QI 2JIMA 4E32A 2NVTI 3IF8A 3I551 5IT9b 2R6MA 1VLAA 2RHBA 3CCMZ 3J80b 2QA41 4A3LI 3J81f 3F3PC 1X3ZA 3HOYI 3J80f 3CC21 3CMEZ 2K3RA 1VQP1 3G711 1M1K1 2HU9A 3I55Z 2QLVB 2V8KA 2QA4Z 3I07A 1Q812 1L1OC 3EERA 2JIQA 2QRDB 2Y0SA 4RVGA 2W03A 1K8A2 1VQPZ 2AKLA 3TDHB 3G71Z 1YHQ1 2JIOA 2NVXI 1VQ71 1N8R1 4QTTA 4E31A 3GTMS 4E30A 1W2BY 2V8IA 1VQO1 4BY1I 3BG1B 4BBRI 1X0TA 1K9M2 1KRLA 2P3YA 1YHQZ 5FLXb 1VQ7Z 4E33A 1RNIA 3GTKI 4NFRA 4X6AI 4NBGA 3GCFA 1WZNA 3HOZI 1VQOZ 1VQ61 3JAMf 1S72Z 3S1RI 3CCE1 3I561 1VQ5Z 1QXFA 4E2XA 4A3GI 2LFUA 2V3VA 1KQSZ 3HOVI 1USPB 3CCR1 2VPZA 3NDIA 1I6HI 1VQ6Z 2W04A 1WW9A 4DQYB 3CCEZ 2DE6A 3RZOI 1I50I 4NBEA 1ML8A 3VMIA 2JIRA 3VMHA 3CCVZ 3PO3S 2YADA 4NBCA 4HH4A 3CCRZ 3GTGI 2P28A 2NVQI 2E7ZA 4E2WA 3VTNA 2RT9A 3MZLB 1VQ41 2M6NA 1KD12 4A3KI 3S17I 3KIFA 1Q811 1RO4A 1YI21 4NBAA 4RVHA 1YJ9Z 1WIIA 3FQQA 2VF1A 1RQFA 3GKQA 2IZ3A 1NP6A 1YI2Z 3M3YI 3NH8A 2QEX1 2Q4ZA 1Z02A 1VQ81 1K9M1 3IR7A 1QVGY 3OW2Z 1NJI1 3J81b 4MONA 3CPWY 4A3CI 2R7ZI 2JA6I 2PK7A 1VQK1 1LQLA 3ESWA 1VQ8Z 2KI7B 3GTQI 4E2YA 2RIQA 1YIJ1 1ZB9A 3BG0B 4MD7A 3CD61 3S2DI 3S16I 2AYDA 1JWHC 5C44I 1YUKA 2QREB 3RZDI 2VUMI 2M48A 2DE7A 1RO0A 3CC2Z 2O53A 4DK1A 4NBFA 1M902 3G4S1 3HKZA 1VQ91 2JUBA 3P5JB 3CD6Z 1K732 1USPA 3MONA 2R93I 1JJ2Y 1YIT1 1P9NA 3PO3I 2PM9A 3S14I
chains in the Genus database with same CATH topology
3FKII 3FQMA 5FLMI 1Q822 3NH4A 3CC41 3G4SZ 2PMZA 4EWCA 1TWHI 2HF1A 3I4NI 4NB9A 2GU2A 1W2BZ 2RBLA 3JAMb 1YITZ 1R9TI 1TWCI 3K7AI 2OOYB 3CCQ1 5CM2M 1X3WA 1I3QI 3CCJ1 1Y1VI 1TWAI 3CQZI 1TFIA 1Z01A 2K5RA 3CCU1 3VB9A 3GTPI 3LUSA 2OOXB 4MD8A 3S15I 5C3EI 3HOXI 3CCQZ 3I4MI 4S1TA 3Q87A 2E2HI 1ZH1A 3I56Z 2QR1B 5T6BA 1VQL1 1M1K2 2OZKA 2JA5I 1YJN1 3QWUA 4DGLA 2BJOA 3M4OI 3CCS1 3CCUZ 1ZB8A 5D1PA 3CXCY 3HOUI 4HGYA 2LIYA 3GTLI 2JA8I 2I3CA 5LL6f 2F4OA 1Q7Y2 2E9HA 1DL6A 1VQLZ 1N8R2 1RO2A 3CMA1 3CCSZ 2F4MA 5AN9F 1Y1VS 4NBHA 1K8A1 4A3DI 3EEDA 3D9XA 1VQ4Z 1QF8A 1K731 3S2HI 2EGTA 2DE5A 4RV9A 1QVFY 1NUIA 3CMAZ 3HOWI 3J7A4 4A3EI 1Y1WI 4AYBA 4A3FI 2JS4A 2VUGA 3IFUA 3NDJA 3VMGA 5D1OA 2QEXZ 2GTIA 1QVGZ 3CME1 2V8JA 1RLYA 4QTUA 3CPWZ 2JR6A 4A3MI 4RVFA 5IP9I 5IT9f 3PO2I 1VQKZ 1SFOI 2IZ4A 3CCL1 4A93I 1YIJZ 3NH5A 2WB1A 3CC71 1Q862 4RS4A 5C4JI 1KC82 4RVDA 4BY7I 3U50C 4NBDA 4A3II 5D1OB 3CCLZ 3GTOI 1PFTA 2Q51A 2H85A 1Q7Y1 2O4HA 3CC7Z 4E2ZA 1VQ9Z 1KD11 4NOZA 1JJ2Z 4BXXI 5A2Qb 1VQM1 5C4XI 4MRIA 5A2Qf 3CC4Z 1VQN1 1S721 1NJI2 3NFZA 2OTJ1 1VQ51 5IP7I 1YUAA 1YJW1 5FLXf 1KQSY 2J6AA 2JMOA 4TNUA 1VQMZ 3CCJZ 4MH4A 2NVYI 2WAQA 1VQNZ 4NB8A 4Y7NI 4CL1A 5T67A 3GTJI 2OTJZ 2OTL1 3IX0A 1WCMI 2KPIA 1YJWZ 3CCV1 2QRCB 2E2II 3S1MI 3S1NI 4A3BI 5T64A 3G6E1 3KIHA 1YJNZ 3F3FC 2OTLZ 3CXCZ 3D6WA 3H0GI 1K83I 1S7MA 3H3VJ 1QYPA 4NBBA 2GTHA 1M901 4BBSI 2JA7I 4A3JI 4MD9A 1TWGI 2RPRA 1YJ91 1Z03A 1Q861 2R92I 4XX2A 3G6EZ 2QKDA 2JNYA 3TE5B 1KC81 4MXUA 3T4NB 1Q821 4NH1C 3MZKB 1N2FA 1TWFI 3OW2Y 1QVFZ 4Y52I 3CCM1 2ZAEB 2E2JI 2B63I 4HGZA 2G2KA 3GTMI 2YU9I 3S1QI 4E32A 2NVTI 3IF8A 3I551 5IT9b 2R6MA 1VLAA 2RHBA 3CCMZ 3J80b 2QA41 4A3LI 3J81f 3F3PC 1X3ZA 3HOYI 3J80f 3CC21 3CMEZ 2K3RA 1VQP1 3G711 1M1K1 2HU9A 3I55Z 2QLVB 2V8KA 2QA4Z 3I07A 1Q812 1L1OC 3EERA 2QRDB 2Y0SA 4RVGA 2W03A 1K8A2 1VQPZ 2AKLA 3TDHB 3G71Z 1YHQ1 2NVXI 1VQ71 1N8R1 4QTTA 4E31A 3GTMS 4E30A 1W2BY 2V8IA 1VQO1 4BY1I 3BG1B 4BBRI 1X0TA 1K9M2 1KRLA 2P3YA 1YHQZ 5FLXb 1VQ7Z 4E33A 1RNIA 3GTKI 4NFRA 4X6AI 4NBGA 3GCFA 3HOZI 1VQOZ 1VQ61 3JAMf 1S72Z 3S1RI 3CCE1 3I561 1VQ5Z 4E2XA 4A3GI 2LFUA 1KQSZ 3HOVI 1USPB 3CCR1 3NDIA 1I6HI 1VQ6Z 2W04A 1WW9A 4DQYB 3CCEZ 2DE6A 3RZOI 1I50I 4NBEA 1ML8A 3VMIA 3VMHA 3PO3S 3CCVZ 2YADA 4NBCA 4HH4A 3CCRZ 3GTGI 2P28A 2NVQI 4E2WA 3VTNA 2RT9A 3MZLB 1VQ41 2M6NA 1KD12 4A3KI 3S17I 3KIFA 1Q811 1RO4A 1YI21 4NBAA 4RVHA 1YJ9Z 1WIIA 3FQQA 2VF1A 1RQFA 3GKQA 2IZ3A 1NP6A 1YI2Z 3M3YI 3NH8A 2QEX1 2Q4ZA 1Z02A 1VQ81 1K9M1 1QVGY 3OW2Z 1NJI1 3J81b 4MONA 3CPWY 4A3CI 2R7ZI 2JA6I 2PK7A 1VQK1 1LQLA 3ESWA 1VQ8Z 2KI7B 3GTQI 4E2YA 2RIQA 1YIJ1 1ZB9A 3BG0B 4MD7A 3CD61 3S2DI 3S16I 1JWHC 5C44I 1YUKA 2QREB 3RZDI 2VUMI 2M48A 2DE7A 1RO0A 3CC2Z 2O53A 4DK1A 4NBFA 1M902 3G4S1 3HKZA 1VQ91 2JUBA 3P5JB 3CD6Z 1K732 1USPA 3MONA 2R93I 1JJ2Y 1YIT1 1P9NA 3PO3I 2PM9A 3S14I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RT9 A;  1JWH C;  1RQF A;  2M48 A;  4MD9 A;  1QF8 A;  2M6N A;  2JMO A;  4MD8 A;  4NH1 C;  3EED A;  4DGL A;  4MD7 A;  2R6M A; 
#chains in the Genus database with same CATH topology
 3FKI I;  3FQM A;  5FLM I;  1Q82 2;  3NH4 A;  3CC4 1;  3G4S Z;  2PMZ A;  4EWC A;  1TWH I;  2HF1 A;  3I4N I;  4NB9 A;  2GU2 A;  1W2B Z;  2RBL A;  3JAM b;  1YIT Z;  1R9T I;  1TWC I;  3K7A I;  2OOY B;  3CCQ 1;  5CM2 M;  1X3W A;  1I3Q I;  3CCJ 1;  1Y1V I;  1TWA I;  3CQZ I;  1TFI A;  1Z01 A;  2K5R A;  3CCU 1;  3VB9 A;  3GTP I;  3LUS A;  1Y8C A;  2OOX B;  4MD8 A;  3S15 I;  5C3E I;  3HOX I;  2VPW A;  3CCQ Z;  3I4M I;  4S1T A;  3Q87 A;  2E2H I;  1ZH1 A;  3I56 Z;  2QR1 B;  5T6B A;  1VQL 1;  2IV2 X;  1M1K 2;  2OZK A;  2JA5 I;  1YJN 1;  3QWU A;  4DGL A;  2BJO A;  3M4O I;  3CCS 1;  3CCU Z;  2NAP A;  1ZB8 A;  5D1P A;  3CXC Y;  3HOU I;  4HGY A;  2LIY A;  3GTL I;  2JA8 I;  2I3C A;  5LL6 f;  2F4O A;  1Q7Y 2;  2E9H A;  1DL6 A;  1VQL Z;  1N8R 2;  1RO2 A;  3CMA 1;  3CCS Z;  2F4M A;  5AN9 F;  1Y1V S;  4NBH A;  2JIP A;  1K8A 1;  4A3D I;  3EED A;  3D9X A;  1FDI A;  1VQ4 Z;  2VPY A;  1QF8 A;  1K73 1;  3S2H I;  2EGT A;  2DE5 A;  4RV9 A;  1QVF Y;  1NUI A;  3CMA Z;  3HOW I;  3J7A 4;  4A3E I;  1Y1W I;  4AYB A;  1FDO A;  4A3F I;  2JS4 A;  2VUG A;  3IFU A;  3NDJ A;  3VMG A;  5D1O A;  2QEX Z;  2GTI A;  1QVG Z;  3CME 1;  2V8J A;  1RLY A;  4QTU A;  3CPW Z;  2JR6 A;  4A3M I;  4RVF A;  5IP9 I;  5IT9 f;  3PO2 I;  1VQK Z;  1SFO I;  2IZ4 A;  1WJ2 A;  3CCL 1;  4A93 I;  1YIJ Z;  3NH5 A;  2WB1 A;  3CC7 1;  1Q86 2;  4RS4 A;  5C4J I;  1KC8 2;  4RVD A;  4BY7 I;  3U50 C;  4NBD A;  4A3I I;  5D1O B;  3CCL Z;  3GTO I;  1PFT A;  2Q51 A;  2H85 A;  1Q7Y 1;  2O4H A;  3CC7 Z;  4E2Z A;  1VQ9 Z;  1KD1 1;  4NOZ A;  1JJ2 Z;  2V45 A;  4BXX I;  5A2Q b;  1VQM 1;  5C4X I;  1SIW A;  4MRI A;  5A2Q f;  3CC4 Z;  1VQN 1;  1S72 1;  1NJI 2;  3NFZ A;  2OTJ 1;  1VQ5 1;  5IP7 I;  1AA6 A;  1YUA A;  1YJW 1;  3D2L A;  5FLX f;  1KQS Y;  2J6A A;  2JMO A;  4TNU A;  1VQM Z;  3CCJ Z;  4MH4 A;  2NVY I;  2WAQ A;  1VQN Z;  4NB8 A;  4Y7N I;  4CL1 A;  5T67 A;  3GTJ I;  2OTJ Z;  2OTL 1;  1Q16 A;  3IX0 A;  1WCM I;  2KPI A;  1YJW Z;  3CCV 1;  2QRC B;  2E2I I;  3S1M I;  3S1N I;  4A3B I;  5T64 A;  3G6E 1;  3KIH A;  1YJN Z;  3F3F C;  2OTL Z;  3CXC Z;  3D6W A;  3H0G I;  1K83 I;  1S7M A;  3H3V J;  1QYP A;  4NBB A;  2GTH A;  1M90 1;  4BBS I;  2JA7 I;  4A3J I;  4MD9 A;  1TWG I;  2RPR A;  1YJ9 1;  1Z03 A;  1Q86 1;  2R92 I;  4XX2 A;  3G6E Z;  2QKD A;  2JNY A;  3TE5 B;  1KC8 1;  2LEX A;  4MXU A;  3T4N B;  1Q82 1;  4NH1 C;  3MZK B;  1N2F A;  1TWF I;  3OW2 Y;  1QVF Z;  4Y52 I;  3CCM 1;  2VPX A;  2ZAE B;  2E2J I;  2B63 I;  4HGZ A;  2G2K A;  3GTM I;  2YU9 I;  3S1Q I;  2JIM A;  4E32 A;  2NVT I;  3IF8 A;  3I55 1;  5IT9 b;  2R6M A;  1VLA A;  2RHB A;  3CCM Z;  3J80 b;  2QA4 1;  4A3L I;  3J81 f;  3F3P C;  1X3Z A;  3HOY I;  3J80 f;  3CC2 1;  3CME Z;  2K3R A;  1VQP 1;  3G71 1;  1M1K 1;  2HU9 A;  3I55 Z;  2QLV B;  2V8K A;  2QA4 Z;  3I07 A;  1Q81 2;  1L1O C;  3EER A;  2JIQ A;  2QRD B;  2Y0S A;  4RVG A;  2W03 A;  1K8A 2;  1VQP Z;  2AKL A;  3TDH B;  3G71 Z;  1YHQ 1;  2JIO A;  2NVX I;  1VQ7 1;  1N8R 1;  4QTT A;  4E31 A;  3GTM S;  4E30 A;  1W2B Y;  2V8I A;  1VQO 1;  4BY1 I;  3BG1 B;  4BBR I;  1X0T A;  1K9M 2;  1KRL A;  2P3Y A;  1YHQ Z;  5FLX b;  1VQ7 Z;  4E33 A;  1RNI A;  3GTK I;  4NFR A;  4X6A I;  4NBG A;  3GCF A;  1WZN A;  3HOZ I;  1VQO Z;  1VQ6 1;  3JAM f;  1S72 Z;  3S1R I;  3CCE 1;  3I56 1;  1VQ5 Z;  1QXF A;  4E2X A;  4A3G I;  2LFU A;  2V3V A;  1KQS Z;  3HOV I;  1USP B;  3CCR 1;  2VPZ A;  3NDI A;  1I6H I;  1VQ6 Z;  2W04 A;  1WW9 A;  4DQY B;  3CCE Z;  2DE6 A;  3RZO I;  1I50 I;  4NBE A;  1ML8 A;  3VMI A;  2JIR A;  3VMH A;  3CCV Z;  3PO3 S;  2YAD A;  4NBC A;  4HH4 A;  3CCR Z;  3GTG I;  2P28 A;  2NVQ I;  2E7Z A;  4E2W A;  3VTN A;  2RT9 A;  3MZL B;  1VQ4 1;  2M6N A;  1KD1 2;  4A3K I;  3S17 I;  3KIF A;  1Q81 1;  1RO4 A;  1YI2 1;  4NBA A;  4RVH A;  1YJ9 Z;  1WII A;  3FQQ A;  2VF1 A;  1RQF A;  3GKQ A;  2IZ3 A;  1NP6 A;  1YI2 Z;  3M3Y I;  3NH8 A;  2QEX 1;  2Q4Z A;  1Z02 A;  1VQ8 1;  1K9M 1;  3IR7 A;  1QVG Y;  3OW2 Z;  1NJI 1;  3J81 b;  4MON A;  3CPW Y;  4A3C I;  2R7Z I;  2JA6 I;  2PK7 A;  1VQK 1;  1LQL A;  3ESW A;  1VQ8 Z;  2KI7 B;  3GTQ I;  4E2Y A;  2RIQ A;  1YIJ 1;  1ZB9 A;  3BG0 B;  4MD7 A;  3CD6 1;  3S2D I;  3S16 I;  2AYD A;  1JWH C;  5C44 I;  1YUK A;  2QRE B;  3RZD I;  2VUM I;  2M48 A;  2DE7 A;  1RO0 A;  3CC2 Z;  2O53 A;  4DK1 A;  4NBF A;  1M90 2;  3G4S 1;  3HKZ A;  1VQ9 1;  2JUB A;  3P5J B;  3CD6 Z;  1K73 2;  1USP A;  3MON A;  2R93 I;  1JJ2 Y;  1YIT 1;  1P9N A;  3PO3 I;  2PM9 A;  3S14 I; 
#chains in the Genus database with same CATH homology
 3FKI I;  3FQM A;  5FLM I;  1Q82 2;  3NH4 A;  3CC4 1;  3G4S Z;  2PMZ A;  4EWC A;  1TWH I;  2HF1 A;  3I4N I;  4NB9 A;  2GU2 A;  1W2B Z;  2RBL A;  3JAM b;  1YIT Z;  1R9T I;  1TWC I;  3K7A I;  2OOY B;  3CCQ 1;  5CM2 M;  1X3W A;  1I3Q I;  3CCJ 1;  1Y1V I;  1TWA I;  3CQZ I;  1TFI A;  1Z01 A;  2K5R A;  3CCU 1;  3VB9 A;  3GTP I;  3LUS A;  2OOX B;  4MD8 A;  3S15 I;  5C3E I;  3HOX I;  3CCQ Z;  3I4M I;  4S1T A;  3Q87 A;  2E2H I;  1ZH1 A;  3I56 Z;  2QR1 B;  5T6B A;  1VQL 1;  1M1K 2;  2OZK A;  2JA5 I;  1YJN 1;  3QWU A;  4DGL A;  2BJO A;  3M4O I;  3CCS 1;  3CCU Z;  1ZB8 A;  5D1P A;  3CXC Y;  3HOU I;  4HGY A;  2LIY A;  3GTL I;  2JA8 I;  2I3C A;  5LL6 f;  2F4O A;  1Q7Y 2;  2E9H A;  1DL6 A;  1VQL Z;  1N8R 2;  1RO2 A;  3CMA 1;  3CCS Z;  2F4M A;  5AN9 F;  1Y1V S;  4NBH A;  1K8A 1;  4A3D I;  3EED A;  3D9X A;  1VQ4 Z;  1QF8 A;  1K73 1;  3S2H I;  2EGT A;  2DE5 A;  4RV9 A;  1QVF Y;  1NUI A;  3CMA Z;  3HOW I;  3J7A 4;  4A3E I;  1Y1W I;  4AYB A;  4A3F I;  2JS4 A;  2VUG A;  3IFU A;  3NDJ A;  3VMG A;  5D1O A;  2QEX Z;  2GTI A;  1QVG Z;  3CME 1;  2V8J A;  1RLY A;  4QTU A;  3CPW Z;  2JR6 A;  4A3M I;  4RVF A;  5IP9 I;  5IT9 f;  3PO2 I;  1VQK Z;  1SFO I;  2IZ4 A;  3CCL 1;  4A93 I;  1YIJ Z;  3NH5 A;  2WB1 A;  3CC7 1;  1Q86 2;  4RS4 A;  5C4J I;  1KC8 2;  4RVD A;  4BY7 I;  3U50 C;  4NBD A;  4A3I I;  5D1O B;  3CCL Z;  3GTO I;  1PFT A;  2Q51 A;  2H85 A;  1Q7Y 1;  2O4H A;  3CC7 Z;  4E2Z A;  1VQ9 Z;  1KD1 1;  4NOZ A;  1JJ2 Z;  4BXX I;  5A2Q b;  1VQM 1;  5C4X I;  4MRI A;  5A2Q f;  3CC4 Z;  1VQN 1;  1S72 1;  1NJI 2;  3NFZ A;  2OTJ 1;  1VQ5 1;  5IP7 I;  1YUA A;  1YJW 1;  5FLX f;  1KQS Y;  2J6A A;  2JMO A;  4TNU A;  1VQM Z;  3CCJ Z;  4MH4 A;  2NVY I;  2WAQ A;  1VQN Z;  4NB8 A;  4Y7N I;  4CL1 A;  5T67 A;  3GTJ I;  2OTJ Z;  2OTL 1;  3IX0 A;  1WCM I;  2KPI A;  1YJW Z;  3CCV 1;  2QRC B;  2E2I I;  3S1M I;  3S1N I;  4A3B I;  5T64 A;  3G6E 1;  3KIH A;  1YJN Z;  3F3F C;  2OTL Z;  3CXC Z;  3D6W A;  3H0G I;  1K83 I;  1S7M A;  3H3V J;  1QYP A;  4NBB A;  2GTH A;  1M90 1;  4BBS I;  2JA7 I;  4A3J I;  4MD9 A;  1TWG I;  2RPR A;  1YJ9 1;  1Z03 A;  1Q86 1;  2R92 I;  4XX2 A;  3G6E Z;  2QKD A;  2JNY A;  3TE5 B;  1KC8 1;  4MXU A;  3T4N B;  1Q82 1;  4NH1 C;  3MZK B;  1N2F A;  1TWF I;  3OW2 Y;  1QVF Z;  4Y52 I;  3CCM 1;  2ZAE B;  2E2J I;  2B63 I;  4HGZ A;  2G2K A;  3GTM I;  2YU9 I;  3S1Q I;  4E32 A;  2NVT I;  3IF8 A;  3I55 1;  5IT9 b;  2R6M A;  1VLA A;  2RHB A;  3CCM Z;  3J80 b;  2QA4 1;  4A3L I;  3J81 f;  3F3P C;  1X3Z A;  3HOY I;  3J80 f;  3CC2 1;  3CME Z;  2K3R A;  1VQP 1;  3G71 1;  1M1K 1;  2HU9 A;  3I55 Z;  2QLV B;  2V8K A;  2QA4 Z;  3I07 A;  1Q81 2;  1L1O C;  3EER A;  2QRD B;  2Y0S A;  4RVG A;  2W03 A;  1K8A 2;  1VQP Z;  2AKL A;  3TDH B;  3G71 Z;  1YHQ 1;  2NVX I;  1VQ7 1;  1N8R 1;  4QTT A;  4E31 A;  3GTM S;  4E30 A;  1W2B Y;  2V8I A;  1VQO 1;  4BY1 I;  3BG1 B;  4BBR I;  1X0T A;  1K9M 2;  1KRL A;  2P3Y A;  1YHQ Z;  5FLX b;  1VQ7 Z;  4E33 A;  1RNI A;  3GTK I;  4NFR A;  4X6A I;  4NBG A;  3GCF A;  3HOZ I;  1VQO Z;  1VQ6 1;  3JAM f;  1S72 Z;  3S1R I;  3CCE 1;  3I56 1;  1VQ5 Z;  4E2X A;  4A3G I;  2LFU A;  1KQS Z;  3HOV I;  1USP B;  3CCR 1;  3NDI A;  1I6H I;  1VQ6 Z;  2W04 A;  1WW9 A;  4DQY B;  3CCE Z;  2DE6 A;  3RZO I;  1I50 I;  4NBE A;  1ML8 A;  3VMI A;  3VMH A;  3PO3 S;  3CCV Z;  2YAD A;  4NBC A;  4HH4 A;  3CCR Z;  3GTG I;  2P28 A;  2NVQ I;  4E2W A;  3VTN A;  2RT9 A;  3MZL B;  1VQ4 1;  2M6N A;  1KD1 2;  4A3K I;  3S17 I;  3KIF A;  1Q81 1;  1RO4 A;  1YI2 1;  4NBA A;  4RVH A;  1YJ9 Z;  1WII A;  3FQQ A;  2VF1 A;  1RQF A;  3GKQ A;  2IZ3 A;  1NP6 A;  1YI2 Z;  3M3Y I;  3NH8 A;  2QEX 1;  2Q4Z A;  1Z02 A;  1VQ8 1;  1K9M 1;  1QVG Y;  3OW2 Z;  1NJI 1;  3J81 b;  4MON A;  3CPW Y;  4A3C I;  2R7Z I;  2JA6 I;  2PK7 A;  1VQK 1;  1LQL A;  3ESW A;  1VQ8 Z;  2KI7 B;  3GTQ I;  4E2Y A;  2RIQ A;  1YIJ 1;  1ZB9 A;  3BG0 B;  4MD7 A;  3CD6 1;  3S2D I;  3S16 I;  1JWH C;  5C44 I;  1YUK A;  2QRE B;  3RZD I;  2VUM I;  2M48 A;  2DE7 A;  1RO0 A;  3CC2 Z;  2O53 A;  4DK1 A;  4NBF A;  1M90 2;  3G4S 1;  3HKZ A;  1VQ9 1;  2JUB A;  3P5J B;  3CD6 Z;  1K73 2;  1USP A;  3MON A;  2R93 I;  1JJ2 Y;  1YIT 1;  1P9N A;  3PO3 I;  2PM9 A;  3S14 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...