4MD9A

Crystal structure of symmetric ck2 holoenzyme with mutated alpha subunit (f121e truncated at aa 336)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
201
structure length
201
Chain Sequence
VSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit beta
publication title Active Form of the Protein Kinase CK2 alpha 2 beta 2 Holoenzyme Is a Strong Complex with Symmetric Architecture.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 46
structure length 201
sequence length 201
chains with identical sequence B, C, D, I, J, N, O
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 4md9A01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4md9A02
1JWHC 1RQFA 3EEDA 2M6NA 4DGLA 2R6MA 4MD8A 4MD9A 1QF8A 2JMOA 2M48A 2RT9A 4MD7A 4NH1C
chains in the Genus database with same CATH superfamily
3ESWA 4BBRI 2JA6I 4MD8A 2K5RA 4BY7I 1YIT1 1YJN1 1RO2A 1YIJZ 4HGZA 3CCMZ 4NBDA 3J80b 1P9NA 2E2HI 5LL6f 1VQ41 3VB9A 2JA7I 3RZOI 2W04A 3S1MI 3PO2I 2PMZA 3CCE1 1WCMI 1X3WA 3I561 1YJ91 2P28A 2DE7A 3G711 1YHQ1 3CC71 4A3JI 3GTGI 1FDIA 2IZ4A 4S1TA 3G4S1 1M1K1 1ZH1A 5D1OA 2RBLA 3H0GI 2O4HA 2E2JI 2JA5I 2E2II 2M6NA 1TWFI 4NBBA 1VQN1 3G6E1 3CCR1 2JNYA 1JJ2Y 1VQLZ 1USPA 1NUIA 5T6BA 2VPXA 1DL6A 3D6WA 2NVYI 3TE5B 3GTQI 1AA6A 4A3EI 3NDIA 4Y7NI 2QRCB 5IP9I 2WAQA 1WJ2A 3CCLZ 2QA41 1NJI2 3J7A4 4E30A 4DGLA 3FQQA 5T64A 1QF8A 3CCSZ 3CCUZ 2M48A 3IFUA 1I50I 1Q7Y1 3I551 3M3YI 3CMEZ 1S721 1KD12 1I3QI 2YU9I 1RLYA 4QTTA 2VUMI 3HOXI 2BJOA 1VQP1 4NOZA 4BY1I 4A3BI 3D2LA 4A3GI 2OZKA 3S17I 4A3KI 1YITZ 4BBSI 4Y52I 1KC81 3NH4A 2V8JA 4NB8A 2VF1A 1NP6A 1Y8CA 4A3II 4A3MI 3VTNA 3GTKI 2JIQA 5C4XI 1Z01A 2OOYB 2VUGA 2OTJZ 5C4JI 3U50C 4NBFA 1ZB9A 3CCEZ 1Z02A 2F4MA 3LUSA 1M901 3EEDA 3I56Z 3GTLI 3MZKB 3G71Z 3CC7Z 1YHQZ 4E2ZA 4NH1C 1Q822 3CPWY 1K9M2 5D1PA 3MONA 2RHBA 3CD61 2LEXA 2KI7B 1VQNZ 1SFOI 3IR7A 3G6EZ 5A2Qf 3CCRZ 3S2DI 1TWHI 2NVQI 1KQSY 1Y1WI 3FQMA 4DQYB 2P3YA 2OTJ1 3CQZI 2V8KA 1VQ7Z 4MRIA 5FLMI 2JR6A 3M4OI 1TWGI 3NH5A 3KIFA 3KIHA 2JIPA 2JIOA 2QA4Z 4E32A 2H85A 3BG0B 3OW2Y 1VQ61 2JA8I 3I4NI 1TFIA 3RZDI 3CCQ1 3I55Z 1FDOA 1YUAA 3GTOI 2OOXB 5FLXf 1VQM1 1S72Z 3IX0A 2J6AA 3Q87A 2VPYA 1QVFY 1VQ71 1NJI1 2HF1A 3GTJI 1VQPZ 2GU2A 2GTIA 2QEX1 3H3VJ 2QR1B 2RPRA 3I07A 1M1K2 3JAMf 4NFRA 3GTMS 1W2BZ 2R6MA 4CL1A 1VLAA 2JMOA 2IV2X 3CCV1 2OTL1 1TWAI 1YJWZ 1Q811 5A2Qb 3S1NI 2V45A 3NH8A 2WB1A 2DE6A 2NAPA 3FKII 4TNUA 2B63I 3S1RI 1VQKZ 3QWUA 1N2FA 4E2XA 4A3DI 4MD9A 4NBEA 1ML8A 3GKQA 5IP7I 4RV9A 1PFTA 3CC21 3J80f 1X3ZA 1VQ51 2YADA 1Q861 3EERA 3CD6Z 1YJW1 1QYPA 2RT9A 2LFUA 2O53A 4MXUA 1I6HI 3K7AI 1K731 5FLXb 3CMA1 3GTPI 2RIQA 3PO3S 1VQK1 1VQ81 3VMHA 1QXFA 2Q4ZA 3VMGA 4A3CI 2F4OA 1X0TA 3S16I 3JAMb 3T4NB 3GTMI 1RQFA 2K3RA 3GCFA 3NDJA 1JJ2Z 1K8A2 1VQ6Z 3I4MI 3VMIA 3CC41 1KC82 2R93I 4QTUA 4NBAA 1K83I 2NVXI 1YI2Z 3CCQZ 1SIWA 4AYBA 2LIYA 5AN9F 1JWHC 3P5JB 4DK1A 1VQMZ 5CM2M 3NFZA 3CXCY 1Z03A 2IZ3A 1M902 2E7ZA 1N8R2 1VQOZ 4E31A 4E33A 2QEXZ 4HH4A 2QRDB 5T67A 3S2HI 3HOUI 1VQ91 1WW9A 3CCVZ 3BG1B 1ZB8A 2OTLZ 2EGTA 3HOZI 2ZAEB 5IT9f 3TDHB 2KPIA 1QVGY 1YI21 3PO3I 4RS4A 2AYDA 3CCJ1 3HOVI 4E2WA 1VQO1 2JS4A 1S7MA 1YIJ1 3CCM1 4BXXI 5C44I 3CC2Z 1VQ5Z 1R9TI 2Q51A 3MZLB 2G2KA 1KD11 3J81f 1WZNA 2PM9A 4NB9A 3HOWI 2VPZA 3F3PC 1YUKA 3CMAZ 2V8IA 4RVHA 1VQ8Z 1LQLA 1Y1VI 1Y1VS 3CPWZ 2HU9A 4EWCA 2R7ZI 3HOYI 4NBGA 2Y0SA 3S15I 2W03A 2QKDA 4A3FI 2PK7A 1VQL1 4MD7A 1RO0A 1RNIA 3CC4Z 1KQSZ 5IT9b 2QREB 1Q812 3S14I 4RVGA 1WIIA 4E2YA 1Q7Y2 3CXCZ 4NBHA 3CCL1 3S1QI 2R92I 2E9HA 1Q821 5D1OB 1K8A1 2GTHA 4RVFA 1K9M1 4A93I 4HGYA 3OW2Z 1YJNZ 3IF8A 4RVDA 2I3CA 1W2BY 1TWCI 3CCS1 3CCU1 2NVTI 5C3EI 2AKLA 2JUBA 1QVGZ 4MONA 1USPB 1VQ9Z 1Q862 4X6AI 3D9XA 1VQ4Z 3CME1 1Q16A 1KRLA 3J81b 3F3FC 2JIRA 4A3LI 1RO4A 4NBCA 1QVFZ 2JIMA 1N8R1 2DE5A 1K732 1YJ9Z 4MH4A 1L1OC 2QLVB 4XX2A 2VPWA 3G4SZ 3CCJZ 2V3VA 3HKZA
chains in the Genus database with same CATH topology
3ESWA 4BBRI 2JA6I 4MD8A 2K5RA 4BY7I 1YIT1 1YJN1 1RO2A 1YIJZ 4HGZA 3CCMZ 4NBDA 3J80b 1P9NA 2E2HI 5LL6f 1VQ41 3VB9A 2JA7I 3RZOI 2W04A 3S1MI 3PO2I 2PMZA 3CCE1 1WCMI 1X3WA 3I561 1YJ91 2P28A 2DE7A 3G711 1YHQ1 3CC71 4A3JI 3GTGI 2IZ4A 4S1TA 3G4S1 1M1K1 1ZH1A 5D1OA 2RBLA 3H0GI 2O4HA 2E2JI 2JA5I 2E2II 2M6NA 1TWFI 4NBBA 1VQN1 3G6E1 3CCR1 2JNYA 1JJ2Y 1VQLZ 1USPA 1NUIA 5T6BA 1DL6A 3D6WA 2NVYI 3TE5B 3GTQI 4A3EI 3NDIA 4Y7NI 2QRCB 5IP9I 2WAQA 3CCLZ 2QA41 1NJI2 3J7A4 4E30A 4DGLA 3FQQA 5T64A 1QF8A 3CCSZ 3CCUZ 2M48A 3IFUA 1I50I 1Q7Y1 3I551 3M3YI 3CMEZ 1S721 1KD12 1I3QI 2YU9I 1RLYA 4QTTA 2VUMI 3HOXI 2BJOA 1VQP1 4NOZA 4BY1I 4A3BI 4A3GI 2OZKA 3S17I 4A3KI 1YITZ 4BBSI 4Y52I 1KC81 3NH4A 2V8JA 4NB8A 2VF1A 1NP6A 4A3II 4A3MI 3VTNA 3GTKI 5C4XI 1Z01A 2OOYB 2VUGA 2OTJZ 5C4JI 3U50C 4NBFA 1ZB9A 3CCEZ 1Z02A 2F4MA 3LUSA 1M901 3EEDA 3I56Z 3GTLI 3MZKB 3G71Z 3CC7Z 1YHQZ 4E2ZA 4NH1C 1Q822 3CPWY 1K9M2 5D1PA 3MONA 2RHBA 3CD61 2KI7B 1VQNZ 1SFOI 3G6EZ 3CCRZ 5A2Qf 3S2DI 1TWHI 2NVQI 1KQSY 1Y1WI 3FQMA 4DQYB 2P3YA 2OTJ1 3CQZI 2V8KA 1VQ7Z 4MRIA 5FLMI 2JR6A 3M4OI 1TWGI 3NH5A 3KIFA 3KIHA 2QA4Z 4E32A 2H85A 3BG0B 3OW2Y 1VQ61 2JA8I 3I4NI 1TFIA 3RZDI 3CCQ1 3I55Z 1YUAA 3GTOI 2OOXB 5FLXf 1VQM1 1S72Z 3IX0A 2J6AA 3Q87A 1QVFY 1VQ71 1NJI1 2HF1A 3GTJI 1VQPZ 2GU2A 2GTIA 2QEX1 3H3VJ 2QR1B 2RPRA 3I07A 1M1K2 3JAMf 4NFRA 3GTMS 1W2BZ 2R6MA 4CL1A 1VLAA 2JMOA 3CCV1 2OTL1 1TWAI 1YJWZ 1Q811 5A2Qb 3S1NI 3NH8A 2WB1A 2DE6A 3FKII 4TNUA 2B63I 3S1RI 1VQKZ 3QWUA 4E2XA 4A3DI 4MD9A 4NBEA 1ML8A 3GKQA 5IP7I 4RV9A 1PFTA 3CC21 3J80f 1X3ZA 1VQ51 2YADA 1Q861 3EERA 3CD6Z 1YJW1 1QYPA 2RT9A 2LFUA 2O53A 4MXUA 1I6HI 3K7AI 1K731 5FLXb 3CMA1 3GTPI 2RIQA 3PO3S 1VQK1 1VQ81 3VMHA 2Q4ZA 3VMGA 4A3CI 2F4OA 1X0TA 3S16I 3JAMb 3T4NB 3GTMI 1RQFA 2K3RA 3GCFA 3NDJA 1JJ2Z 1K8A2 1VQ6Z 3I4MI 3VMIA 3CC41 1KC82 2R93I 4QTUA 4NBAA 1K83I 2NVXI 1YI2Z 3CCQZ 4AYBA 2LIYA 5AN9F 1JWHC 3P5JB 4DK1A 1VQMZ 5CM2M 3NFZA 3CXCY 1Z03A 2IZ3A 1M902 1N8R2 1VQOZ 4E31A 4E33A 2QEXZ 4HH4A 2QRDB 5T67A 3S2HI 3HOUI 1VQ91 1WW9A 3CCVZ 3BG1B 1ZB8A 2OTLZ 2EGTA 3HOZI 2ZAEB 5IT9f 3TDHB 2KPIA 1QVGY 1YI21 3PO3I 4RS4A 3CCJ1 3HOVI 4E2WA 1VQO1 2JS4A 1S7MA 1YIJ1 3CCM1 4BXXI 5C44I 3CC2Z 1VQ5Z 1R9TI 2Q51A 3MZLB 2G2KA 1KD11 3J81f 2PM9A 4NB9A 3HOWI 3F3PC 1YUKA 3CMAZ 2V8IA 4RVHA 1VQ8Z 1LQLA 1Y1VI 1Y1VS 3CPWZ 2HU9A 4EWCA 2R7ZI 3HOYI 4NBGA 2Y0SA 3S15I 2W03A 2QKDA 4A3FI 2PK7A 1VQL1 4MD7A 1RO0A 1RNIA 3CC4Z 1KQSZ 5IT9b 2QREB 1Q812 3S14I 4RVGA 1WIIA 4E2YA 1Q7Y2 3CXCZ 4NBHA 3CCL1 3S1QI 2R92I 2E9HA 1Q821 5D1OB 1K8A1 2GTHA 4RVFA 1K9M1 4A93I 4HGYA 3OW2Z 1YJNZ 3IF8A 4RVDA 2I3CA 1W2BY 1TWCI 3CCS1 3CCU1 2NVTI 5C3EI 2AKLA 2JUBA 1QVGZ 4MONA 1USPB 1VQ9Z 1Q862 4X6AI 3D9XA 1VQ4Z 3CME1 1KRLA 3J81b 3F3FC 4A3LI 1RO4A 4NBCA 1QVFZ 1N8R1 2DE5A 1K732 1YJ9Z 4MH4A 1L1OC 2QLVB 4XX2A 3G4SZ 3CCJZ 1N2FA 3HKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWH C;  1RQF A;  3EED A;  2M6N A;  4DGL A;  2R6M A;  4MD8 A;  4MD9 A;  1QF8 A;  2JMO A;  2M48 A;  2RT9 A;  4MD7 A;  4NH1 C; 
#chains in the Genus database with same CATH topology
 3ESW A;  4BBR I;  2JA6 I;  4MD8 A;  2K5R A;  4BY7 I;  1YIT 1;  1YJN 1;  1RO2 A;  1YIJ Z;  4HGZ A;  3CCM Z;  4NBD A;  3J80 b;  1P9N A;  2E2H I;  5LL6 f;  1VQ4 1;  3VB9 A;  2JA7 I;  3RZO I;  2W04 A;  3S1M I;  3PO2 I;  2PMZ A;  3CCE 1;  1WCM I;  1X3W A;  3I56 1;  1YJ9 1;  2P28 A;  2DE7 A;  3G71 1;  1YHQ 1;  3CC7 1;  4A3J I;  3GTG I;  1FDI A;  2IZ4 A;  4S1T A;  3G4S 1;  1M1K 1;  1ZH1 A;  5D1O A;  2RBL A;  3H0G I;  2O4H A;  2E2J I;  2JA5 I;  2E2I I;  2M6N A;  1TWF I;  4NBB A;  1VQN 1;  3G6E 1;  3CCR 1;  2JNY A;  1JJ2 Y;  1VQL Z;  1USP A;  1NUI A;  5T6B A;  2VPX A;  1DL6 A;  3D6W A;  2NVY I;  3TE5 B;  3GTQ I;  1AA6 A;  4A3E I;  3NDI A;  4Y7N I;  2QRC B;  5IP9 I;  2WAQ A;  1WJ2 A;  3CCL Z;  2QA4 1;  1NJI 2;  3J7A 4;  4E30 A;  4DGL A;  3FQQ A;  5T64 A;  1QF8 A;  3CCS Z;  3CCU Z;  2M48 A;  3IFU A;  1I50 I;  1Q7Y 1;  3I55 1;  3M3Y I;  3CME Z;  1S72 1;  1KD1 2;  1I3Q I;  2YU9 I;  1RLY A;  4QTT A;  2VUM I;  3HOX I;  2BJO A;  1VQP 1;  4NOZ A;  4BY1 I;  4A3B I;  3D2L A;  4A3G I;  2OZK A;  3S17 I;  4A3K I;  1YIT Z;  4BBS I;  4Y52 I;  1KC8 1;  3NH4 A;  2V8J A;  4NB8 A;  2VF1 A;  1NP6 A;  1Y8C A;  4A3I I;  4A3M I;  3VTN A;  3GTK I;  2JIQ A;  5C4X I;  1Z01 A;  2OOY B;  2VUG A;  2OTJ Z;  5C4J I;  3U50 C;  4NBF A;  1ZB9 A;  3CCE Z;  1Z02 A;  2F4M A;  3LUS A;  1M90 1;  3EED A;  3I56 Z;  3GTL I;  3MZK B;  3G71 Z;  3CC7 Z;  1YHQ Z;  4E2Z A;  4NH1 C;  1Q82 2;  3CPW Y;  1K9M 2;  5D1P A;  3MON A;  2RHB A;  3CD6 1;  2LEX A;  2KI7 B;  1VQN Z;  1SFO I;  3IR7 A;  3G6E Z;  5A2Q f;  3CCR Z;  3S2D I;  1TWH I;  2NVQ I;  1KQS Y;  1Y1W I;  3FQM A;  4DQY B;  2P3Y A;  2OTJ 1;  3CQZ I;  2V8K A;  1VQ7 Z;  4MRI A;  5FLM I;  2JR6 A;  3M4O I;  1TWG I;  3NH5 A;  3KIF A;  3KIH A;  2JIP A;  2JIO A;  2QA4 Z;  4E32 A;  2H85 A;  3BG0 B;  3OW2 Y;  1VQ6 1;  2JA8 I;  3I4N I;  1TFI A;  3RZD I;  3CCQ 1;  3I55 Z;  1FDO A;  1YUA A;  3GTO I;  2OOX B;  5FLX f;  1VQM 1;  1S72 Z;  3IX0 A;  2J6A A;  3Q87 A;  2VPY A;  1QVF Y;  1VQ7 1;  1NJI 1;  2HF1 A;  3GTJ I;  1VQP Z;  2GU2 A;  2GTI A;  2QEX 1;  3H3V J;  2QR1 B;  2RPR A;  3I07 A;  1M1K 2;  3JAM f;  4NFR A;  3GTM S;  1W2B Z;  2R6M A;  4CL1 A;  1VLA A;  2JMO A;  2IV2 X;  3CCV 1;  2OTL 1;  1TWA I;  1YJW Z;  1Q81 1;  5A2Q b;  3S1N I;  2V45 A;  3NH8 A;  2WB1 A;  2DE6 A;  2NAP A;  3FKI I;  4TNU A;  2B63 I;  3S1R I;  1VQK Z;  3QWU A;  1N2F A;  4E2X A;  4A3D I;  4MD9 A;  4NBE A;  1ML8 A;  3GKQ A;  5IP7 I;  4RV9 A;  1PFT A;  3CC2 1;  3J80 f;  1X3Z A;  1VQ5 1;  2YAD A;  1Q86 1;  3EER A;  3CD6 Z;  1YJW 1;  1QYP A;  2RT9 A;  2LFU A;  2O53 A;  4MXU A;  1I6H I;  3K7A I;  1K73 1;  5FLX b;  3CMA 1;  3GTP I;  2RIQ A;  3PO3 S;  1VQK 1;  1VQ8 1;  3VMH A;  1QXF A;  2Q4Z A;  3VMG A;  4A3C I;  2F4O A;  1X0T A;  3S16 I;  3JAM b;  3T4N B;  3GTM I;  1RQF A;  2K3R A;  3GCF A;  3NDJ A;  1JJ2 Z;  1K8A 2;  1VQ6 Z;  3I4M I;  3VMI A;  3CC4 1;  1KC8 2;  2R93 I;  4QTU A;  4NBA A;  1K83 I;  2NVX I;  1YI2 Z;  3CCQ Z;  1SIW A;  4AYB A;  2LIY A;  5AN9 F;  1JWH C;  3P5J B;  4DK1 A;  1VQM Z;  5CM2 M;  3NFZ A;  3CXC Y;  1Z03 A;  2IZ3 A;  1M90 2;  2E7Z A;  1N8R 2;  1VQO Z;  4E31 A;  4E33 A;  2QEX Z;  4HH4 A;  2QRD B;  5T67 A;  3S2H I;  3HOU I;  1VQ9 1;  1WW9 A;  3CCV Z;  3BG1 B;  1ZB8 A;  2OTL Z;  2EGT A;  3HOZ I;  2ZAE B;  5IT9 f;  3TDH B;  2KPI A;  1QVG Y;  1YI2 1;  3PO3 I;  4RS4 A;  2AYD A;  3CCJ 1;  3HOV I;  4E2W A;  1VQO 1;  2JS4 A;  1S7M A;  1YIJ 1;  3CCM 1;  4BXX I;  5C44 I;  3CC2 Z;  1VQ5 Z;  1R9T I;  2Q51 A;  3MZL B;  2G2K A;  1KD1 1;  3J81 f;  1WZN A;  2PM9 A;  4NB9 A;  3HOW I;  2VPZ A;  3F3P C;  1YUK A;  3CMA Z;  2V8I A;  4RVH A;  1VQ8 Z;  1LQL A;  1Y1V I;  1Y1V S;  3CPW Z;  2HU9 A;  4EWC A;  2R7Z I;  3HOY I;  4NBG A;  2Y0S A;  3S15 I;  2W03 A;  2QKD A;  4A3F I;  2PK7 A;  1VQL 1;  4MD7 A;  1RO0 A;  1RNI A;  3CC4 Z;  1KQS Z;  5IT9 b;  2QRE B;  1Q81 2;  3S14 I;  4RVG A;  1WII A;  4E2Y A;  1Q7Y 2;  3CXC Z;  4NBH A;  3CCL 1;  3S1Q I;  2R92 I;  2E9H A;  1Q82 1;  5D1O B;  1K8A 1;  2GTH A;  4RVF A;  1K9M 1;  4A93 I;  4HGY A;  3OW2 Z;  1YJN Z;  3IF8 A;  4RVD A;  2I3C A;  1W2B Y;  1TWC I;  3CCS 1;  3CCU 1;  2NVT I;  5C3E I;  2AKL A;  2JUB A;  1QVG Z;  4MON A;  1USP B;  1VQ9 Z;  1Q86 2;  4X6A I;  3D9X A;  1VQ4 Z;  3CME 1;  1Q16 A;  1KRL A;  3J81 b;  3F3F C;  2JIR A;  4A3L I;  1RO4 A;  4NBC A;  1QVF Z;  2JIM A;  1N8R 1;  2DE5 A;  1K73 2;  1YJ9 Z;  4MH4 A;  1L1O C;  2QLV B;  4XX2 A;  2VPW A;  3G4S Z;  3CCJ Z;  2V3V A;  3HKZ A; 
#chains in the Genus database with same CATH homology
 3ESW A;  4BBR I;  2JA6 I;  4MD8 A;  2K5R A;  4BY7 I;  1YIT 1;  1YJN 1;  1RO2 A;  1YIJ Z;  4HGZ A;  3CCM Z;  4NBD A;  3J80 b;  1P9N A;  2E2H I;  5LL6 f;  1VQ4 1;  3VB9 A;  2JA7 I;  3RZO I;  2W04 A;  3S1M I;  3PO2 I;  2PMZ A;  3CCE 1;  1WCM I;  1X3W A;  3I56 1;  1YJ9 1;  2P28 A;  2DE7 A;  3G71 1;  1YHQ 1;  3CC7 1;  4A3J I;  3GTG I;  2IZ4 A;  4S1T A;  3G4S 1;  1M1K 1;  1ZH1 A;  5D1O A;  2RBL A;  3H0G I;  2O4H A;  2E2J I;  2JA5 I;  2E2I I;  2M6N A;  1TWF I;  4NBB A;  1VQN 1;  3G6E 1;  3CCR 1;  2JNY A;  1JJ2 Y;  1VQL Z;  1USP A;  1NUI A;  5T6B A;  1DL6 A;  3D6W A;  2NVY I;  3TE5 B;  3GTQ I;  4A3E I;  3NDI A;  4Y7N I;  2QRC B;  5IP9 I;  2WAQ A;  3CCL Z;  2QA4 1;  1NJI 2;  3J7A 4;  4E30 A;  4DGL A;  3FQQ A;  5T64 A;  1QF8 A;  3CCS Z;  3CCU Z;  2M48 A;  3IFU A;  1I50 I;  1Q7Y 1;  3I55 1;  3M3Y I;  3CME Z;  1S72 1;  1KD1 2;  1I3Q I;  2YU9 I;  1RLY A;  4QTT A;  2VUM I;  3HOX I;  2BJO A;  1VQP 1;  4NOZ A;  4BY1 I;  4A3B I;  4A3G I;  2OZK A;  3S17 I;  4A3K I;  1YIT Z;  4BBS I;  4Y52 I;  1KC8 1;  3NH4 A;  2V8J A;  4NB8 A;  2VF1 A;  1NP6 A;  4A3I I;  4A3M I;  3VTN A;  3GTK I;  5C4X I;  1Z01 A;  2OOY B;  2VUG A;  2OTJ Z;  5C4J I;  3U50 C;  4NBF A;  1ZB9 A;  3CCE Z;  1Z02 A;  2F4M A;  3LUS A;  1M90 1;  3EED A;  3I56 Z;  3GTL I;  3MZK B;  3G71 Z;  3CC7 Z;  1YHQ Z;  4E2Z A;  4NH1 C;  1Q82 2;  3CPW Y;  1K9M 2;  5D1P A;  3MON A;  2RHB A;  3CD6 1;  2KI7 B;  1VQN Z;  1SFO I;  3G6E Z;  3CCR Z;  5A2Q f;  3S2D I;  1TWH I;  2NVQ I;  1KQS Y;  1Y1W I;  3FQM A;  4DQY B;  2P3Y A;  2OTJ 1;  3CQZ I;  2V8K A;  1VQ7 Z;  4MRI A;  5FLM I;  2JR6 A;  3M4O I;  1TWG I;  3NH5 A;  3KIF A;  3KIH A;  2QA4 Z;  4E32 A;  2H85 A;  3BG0 B;  3OW2 Y;  1VQ6 1;  2JA8 I;  3I4N I;  1TFI A;  3RZD I;  3CCQ 1;  3I55 Z;  1YUA A;  3GTO I;  2OOX B;  5FLX f;  1VQM 1;  1S72 Z;  3IX0 A;  2J6A A;  3Q87 A;  1QVF Y;  1VQ7 1;  1NJI 1;  2HF1 A;  3GTJ I;  1VQP Z;  2GU2 A;  2GTI A;  2QEX 1;  3H3V J;  2QR1 B;  2RPR A;  3I07 A;  1M1K 2;  3JAM f;  4NFR A;  3GTM S;  1W2B Z;  2R6M A;  4CL1 A;  1VLA A;  2JMO A;  3CCV 1;  2OTL 1;  1TWA I;  1YJW Z;  1Q81 1;  5A2Q b;  3S1N I;  3NH8 A;  2WB1 A;  2DE6 A;  3FKI I;  4TNU A;  2B63 I;  3S1R I;  1VQK Z;  3QWU A;  4E2X A;  4A3D I;  4MD9 A;  4NBE A;  1ML8 A;  3GKQ A;  5IP7 I;  4RV9 A;  1PFT A;  3CC2 1;  3J80 f;  1X3Z A;  1VQ5 1;  2YAD A;  1Q86 1;  3EER A;  3CD6 Z;  1YJW 1;  1QYP A;  2RT9 A;  2LFU A;  2O53 A;  4MXU A;  1I6H I;  3K7A I;  1K73 1;  5FLX b;  3CMA 1;  3GTP I;  2RIQ A;  3PO3 S;  1VQK 1;  1VQ8 1;  3VMH A;  2Q4Z A;  3VMG A;  4A3C I;  2F4O A;  1X0T A;  3S16 I;  3JAM b;  3T4N B;  3GTM I;  1RQF A;  2K3R A;  3GCF A;  3NDJ A;  1JJ2 Z;  1K8A 2;  1VQ6 Z;  3I4M I;  3VMI A;  3CC4 1;  1KC8 2;  2R93 I;  4QTU A;  4NBA A;  1K83 I;  2NVX I;  1YI2 Z;  3CCQ Z;  4AYB A;  2LIY A;  5AN9 F;  1JWH C;  3P5J B;  4DK1 A;  1VQM Z;  5CM2 M;  3NFZ A;  3CXC Y;  1Z03 A;  2IZ3 A;  1M90 2;  1N8R 2;  1VQO Z;  4E31 A;  4E33 A;  2QEX Z;  4HH4 A;  2QRD B;  5T67 A;  3S2H I;  3HOU I;  1VQ9 1;  1WW9 A;  3CCV Z;  3BG1 B;  1ZB8 A;  2OTL Z;  2EGT A;  3HOZ I;  2ZAE B;  5IT9 f;  3TDH B;  2KPI A;  1QVG Y;  1YI2 1;  3PO3 I;  4RS4 A;  3CCJ 1;  3HOV I;  4E2W A;  1VQO 1;  2JS4 A;  1S7M A;  1YIJ 1;  3CCM 1;  4BXX I;  5C44 I;  3CC2 Z;  1VQ5 Z;  1R9T I;  2Q51 A;  3MZL B;  2G2K A;  1KD1 1;  3J81 f;  2PM9 A;  4NB9 A;  3HOW I;  3F3P C;  1YUK A;  3CMA Z;  2V8I A;  4RVH A;  1VQ8 Z;  1LQL A;  1Y1V I;  1Y1V S;  3CPW Z;  2HU9 A;  4EWC A;  2R7Z I;  3HOY I;  4NBG A;  2Y0S A;  3S15 I;  2W03 A;  2QKD A;  4A3F I;  2PK7 A;  1VQL 1;  4MD7 A;  1RO0 A;  1RNI A;  3CC4 Z;  1KQS Z;  5IT9 b;  2QRE B;  1Q81 2;  3S14 I;  4RVG A;  1WII A;  4E2Y A;  1Q7Y 2;  3CXC Z;  4NBH A;  3CCL 1;  3S1Q I;  2R92 I;  2E9H A;  1Q82 1;  5D1O B;  1K8A 1;  2GTH A;  4RVF A;  1K9M 1;  4A93 I;  4HGY A;  3OW2 Z;  1YJN Z;  3IF8 A;  4RVD A;  2I3C A;  1W2B Y;  1TWC I;  3CCS 1;  3CCU 1;  2NVT I;  5C3E I;  2AKL A;  2JUB A;  1QVG Z;  4MON A;  1USP B;  1VQ9 Z;  1Q86 2;  4X6A I;  3D9X A;  1VQ4 Z;  3CME 1;  1KRL A;  3J81 b;  3F3F C;  4A3L I;  1RO4 A;  4NBC A;  1QVF Z;  1N8R 1;  2DE5 A;  1K73 2;  1YJ9 Z;  4MH4 A;  1L1O C;  2QLV B;  4XX2 A;  3G4S Z;  3CCJ Z;  1N2F A;  3HKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...