4BXXI

Arrested rna polymerase ii-bye1 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 17
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4bxxI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4bxxI02
1ZB8A 3CQZI 1DL6A 2JA7I 2R92I 2E2HI 2NVYI 3GTKI 3S1MI 4NBCA 4NOZA 4NBEA 4BBSI 1TWGI 1TWFI 1L1OC 3M4OI 4A3FI 1TWAI 4BY1I 3HOUI 1ZB9A 5C4JI 1SFOI 3HOYI 3RZDI 3I4MI 5IP9I 4A3BI 1RLYA 3ESWA 4QTTA 3GTMI 5IP7I 2VUMI 2JA6I 2R7ZI 3K7AI 1NUIA 2F4MA 1I50I 4QTUA 2NVQI 2F4OA 2P3YA 3HOXI 3GTGI 1QYPA 2E2II 1WCMI 4BY7I 1R9TI 1X3ZA 4BBRI 2HF1A 3U50C 4A3KI 4A3CI 4NBDA 4NB9A 1PFTA 2J6AA 1Y1VS 4A3EI 4A93I 3S2DI 3GCFA 4Y52I 1X3WA 2JR6A 3H0GI 3GTJI 4MH4A 2JA8I 3S16I 1TWHI 4NB8A 4A3JI 3D6WA 3VB9A 3HOVI 4A3MI 3I4NI 1I3QI 3PO3I 2JNYA 2K5RA 1TFIA 2NVXI 3LUSA 2DE7A 2RBLA 4XX2A 3Q87A 4NBFA 5C44I 5C4XI 1RO4A 5CM2M 3H3VJ 4NBAA 3GTMS 3PO2I 2AKLA 2E2JI 1WW9A 3S14I 3VMHA 1N2FA 3I07A 2JA5I 4A3LI 4BXXI 3GKQA 1YUAA 3EERA 4NBBA 2B63I 2PK7A 4A3DI 4Y7NI 1TWCI 2KPIA 1LQLA 1VLAA 1K83I 3S1RI 3S2HI 4NBHA 3S17I 2DE5A 3S1QI 1USPA 1ML8A 4A3II 1I6HI 2JS4A 2YU9I 4X6AI 4NBGA 3VMGA 5FLMI 3GTPI 3GTLI 1Y1VI 3S1NI 1USPB 3HOWI 2BJOA 3HOZI 3S15I 3GTQI 2DE6A 1Y1WI 5C3EI 3FKII 2NVTI 3RZOI 3VMIA 3M3YI 2R93I 3GTOI 3PO3S 4A3GI
chains in the Genus database with same CATH superfamily
1DL6A 2EGTA 3VTNA 4E2YA 3J80f 2R92I 4NBCA 1NJI1 1QVFZ 3CCEZ 1TWFI 2O53A 3CC4Z 1QVFY 5FLXf 3M4OI 3HOUI 1ZB9A 3HOYI 3J81f 3CCRZ 4RVHA 5IP7I 2JA6I 2F4MA 1VQN1 1KD11 2V3VA 1QYPA 1VQ71 2E2II 1WCMI 4BBRI 1VQPZ 1VQKZ 2E9HA 2QA4Z 1VQ61 4E33A 4Y52I 5T64A 1VQ5Z 4RVDA 2GU2A 3GTJI 1N8R1 3S16I 2NAPA 3IF8A 1JWHC 1WIIA 2LFUA 3D6WA 3IR7A 3VB9A 4E2ZA 3CC41 3I4NI 2QRDB 4HH4A 3P5JB 3IX0A 3PO3I 1W2BZ 1Y8CA 2NVXI 3LUSA 2DE7A 2KI7B 4MXUA 1W2BY 5C4XI 2R6MA 5CM2M 3QWUA 2PM9A 1K9M2 1KQSZ 1Q862 1KQSY 5D1PA 1N2FA 4BXXI 1YI21 1YUAA 1Z02A 3F3FC 2YADA 3F3PC 2LEXA 2QREB 3CD6Z 1VQ51 3S2HI 1AA6A 2I3CA 5T67A 2W03A 3OW2Y 3JAMb 1VQ4Z 1ML8A 3MZKB 1NP6A 2JS4A 2YU9I 3GTPI 3D9XA 1Y1VI 3G6EZ 2Y0SA 1USPB 3HOWI 3T4NB 1S72Z 3HOZI 1ZH1A 1YJWZ 4AYBA 2R93I 3GTOI 3G71Z 3CCJZ 1YIJZ 4E31A 2OZKA 3CCM1 2NVYI 1Z01A 4BBSI 2G2KA 1YUKA 4HGZA 1VQ8Z 1YHQ1 5C4JI 1SFOI 2W04A 3I4MI 2RT9A 5A2Qb 4EWCA 4RVFA 3KIHA 2R7ZI 3CD61 1NUIA 1I50I 1Q822 1VQ91 1K8A2 2RPRA 3HOXI 3GTGI 3I551 2GTIA 2M48A 1R9TI 2Q4ZA 5AN9F 2JUBA 4A3CI 1S721 3CCS1 2VPXA 4RV9A 2QEXZ 3S2DI 4NFRA 3CCUZ 3CCJ1 1YIJ1 3I56Z 4E32A 1X3WA 2JR6A 3JAMf 3H0GI 2VUGA 2JIRA 1TWHI 1M901 4CL1A 3HOVI 1M1K1 2K5RA 1YITZ 2RBLA 4XX2A 3Q87A 1Q7Y2 5IT9f 5C44I 1VQOZ 3H3VJ 1RO2A 3GTMS 4HGYA 1RNIA 2Q51A 2P28A 1WW9A 3CCVZ 3I07A 1K732 3EERA 4DGLA 3CCE1 4MD7A 1TWCI 1LQLA 2QEX1 2V8KA 4DQYB 5A2Qf 3CMEZ 2LIYA 4E30A 2QR1B 1Q812 3CCU1 3I561 1USPA 3CCR1 4E2XA 4A3II 3EEDA 1I6HI 5D1OA 4NBGA 3CMAZ 3CC2Z 2V45A 1WJ2A 5C3EI 1KC82 2OTLZ 3VMIA 1VQP1 1VQK1 1ZB8A 3CQZI 3NFZA 2QA41 2E2HI 2IZ4A 3S1MI 3GTKI 2E7ZA 2V8IA 3OW2Z 4NBEA 2VF1A 1TWGI 1YJ9Z 4TNUA 1KRLA 3NH4A 1L1OC 3CCV1 1Z03A 3TDHB 1TWAI 3CCQZ 3RZDI 5IP9I 1VQLZ 3CME1 2VUMI 4A3GI 2NVQI 2OTJZ 2P3YA 3G4SZ 5LL6f 5T6BA 4BY7I 3CC21 3U50C 4A3KI 2JIPA 1NJI2 1YJNZ 4NBDA 4NB9A 1FDIA 2J6AA 4A93I 4RS4A 1K9M1 1Q861 2IV2X 1M902 4MH4A 4E2WA 3HKZA 1KD12 4A3JI 1VQ41 2HU9A 1VQNZ 1VQMZ 2JNYA 3G6E1 2GTHA 1VQ7Z 4NBFA 4NH1C 3CC7Z 1FDOA 1QXFA 1RO4A 2VPYA 1YJW1 2OTJ1 4NBAA 2AKLA 3NDJA 3G711 1JJ2Z 2O4HA 1VQ6Z 1N8R2 4DK1A 3S14I 1JJ2Y 3VMHA 1YJN1 2JA5I 4MD9A 4S1TA 4A3DI 4Y7NI 1VQ81 3NH8A 1K83I 1SIWA 3BG0B 3D2LA 4NBHA 2JIQA 1QF8A 2RHBA 4X6AI 3MZLB 5FLMI 3S1NI 2BJOA 1P9NA 3S15I 3FQMA 1Y1WI 1VQM1 3NH5A 3FKII 2NVTI 1Q821 3M3YI 3PO3S 1K8A1 3CC71 2WAQA 2OOXB 2JA7I 1YI2Z 4NOZA 2QLVB 4A3FI 4BY1I 4A3BI 2M6NA 1RLYA 3NDIA 3ESWA 4QTTA 3GTMI 3TE5B 3CCLZ 3K7AI 4QTUA 3CPWZ 2F4OA 1S7MA 1YIT1 3CPWY 1X0TA 1X3ZA 2QRCB 1VQO1 2HF1A 2QKDA 2VPZA 2ZAEB 3IFUA 2JMOA 1PFTA 1RQFA 1RO0A 1Y1VS 3KIFA 3CCMZ 4A3EI 2RIQA 1Q7Y1 3FQQA 3GCFA 3J7A4 3J80b 2JA8I 4NB8A 1YHQZ 1K731 3BG1B 5FLXb 4A3MI 1I3QI 3CMA1 3J81b 1TFIA 1VQ9Z 1Q811 2V8JA 3I55Z 3CCL1 2PMZA 3PO2I 2OTL1 3CCSZ 2K3RA 5D1OB 3CXCZ 2WB1A 2E2JI 4A3LI 3CXCY 3GKQA 4NBBA 1KC81 2B63I 2IZ3A 5IT9b 2PK7A 2OOYB 1YJ91 1M1K2 2KPIA 1VLAA 3S1RI 2H85A 2AYDA 3CCQ1 3S17I 2DE5A 3S1QI 1VQL1 4RVGA 1WZNA 2JIMA 3VMGA 3GTLI 1QVGZ 3MONA 3G4S1 3GTQI 4MONA 2DE6A 1QVGY 4MD8A 2JIOA 1Q16A 3RZOI 2VPWA 4MRIA
chains in the Genus database with same CATH topology
1DL6A 2EGTA 3VTNA 4E2YA 3J80f 2R92I 4NBCA 1NJI1 1QVFZ 3CCEZ 1TWFI 2O53A 3CC4Z 1QVFY 5FLXf 3M4OI 3HOUI 1ZB9A 3HOYI 3J81f 3CCRZ 4RVHA 5IP7I 2JA6I 2F4MA 1VQN1 1KD11 1QYPA 1VQ71 2E2II 1WCMI 4BBRI 1VQPZ 1VQKZ 2E9HA 2QA4Z 1VQ61 4E33A 4Y52I 5T64A 1VQ5Z 4RVDA 2GU2A 3GTJI 1N8R1 3S16I 3IF8A 1JWHC 1WIIA 2LFUA 3D6WA 3VB9A 4E2ZA 3CC41 3I4NI 2QRDB 4HH4A 3P5JB 3IX0A 3PO3I 1W2BZ 2NVXI 3LUSA 2DE7A 2KI7B 4MXUA 1W2BY 5C4XI 2R6MA 5CM2M 3QWUA 2PM9A 1K9M2 1KQSZ 1Q862 1KQSY 5D1PA 1N2FA 4BXXI 1YI21 1YUAA 1Z02A 3F3FC 2YADA 3F3PC 2QREB 3CD6Z 1VQ51 3S2HI 2I3CA 5T67A 2W03A 3OW2Y 3JAMb 1VQ4Z 1ML8A 3MZKB 1NP6A 2JS4A 2YU9I 3GTPI 3D9XA 1Y1VI 3G6EZ 2Y0SA 1USPB 3HOWI 3T4NB 1S72Z 3HOZI 1ZH1A 1YJWZ 4AYBA 2R93I 3GTOI 3G71Z 3CCJZ 1YIJZ 4E31A 2OZKA 3CCM1 2NVYI 1Z01A 4BBSI 2G2KA 1YUKA 4HGZA 1VQ8Z 1YHQ1 5C4JI 1SFOI 2W04A 3I4MI 2RT9A 5A2Qb 4EWCA 4RVFA 3KIHA 2R7ZI 3CD61 1NUIA 1I50I 1Q822 1VQ91 1K8A2 2RPRA 3HOXI 3GTGI 3I551 2GTIA 2M48A 1R9TI 2Q4ZA 5AN9F 2JUBA 4A3CI 1S721 3CCS1 4RV9A 2QEXZ 3S2DI 4NFRA 3CCUZ 3CCJ1 1YIJ1 3I56Z 4E32A 1X3WA 2JR6A 3JAMf 3H0GI 2VUGA 1TWHI 1M901 4CL1A 3HOVI 1M1K1 2K5RA 1YITZ 2RBLA 4XX2A 3Q87A 1Q7Y2 5IT9f 5C44I 1VQOZ 3H3VJ 1RO2A 3GTMS 4HGYA 1RNIA 2Q51A 2P28A 1WW9A 3CCVZ 3I07A 1K732 3EERA 4DGLA 3CCE1 4MD7A 1TWCI 1LQLA 2QEX1 2V8KA 4DQYB 5A2Qf 3CMEZ 2LIYA 4E30A 2QR1B 1Q812 3CCU1 3I561 1USPA 3CCR1 4E2XA 4A3II 3EEDA 1I6HI 5D1OA 4NBGA 3CMAZ 3CC2Z 5C3EI 1KC82 2OTLZ 3VMIA 1VQP1 1VQK1 1ZB8A 3CQZI 3NFZA 2QA41 2E2HI 2IZ4A 3S1MI 3GTKI 2V8IA 3OW2Z 4NBEA 2VF1A 1TWGI 1YJ9Z 4TNUA 1KRLA 3NH4A 1L1OC 3CCV1 1Z03A 3TDHB 1TWAI 3CCQZ 3RZDI 5IP9I 1VQLZ 3CME1 2VUMI 4A3GI 2NVQI 2OTJZ 2P3YA 3G4SZ 5LL6f 5T6BA 4BY7I 3CC21 3U50C 4A3KI 1NJI2 1YJNZ 4NBDA 4NB9A 2J6AA 4A93I 4RS4A 1K9M1 1Q861 1M902 4MH4A 4E2WA 3HKZA 1KD12 4A3JI 1VQ41 2HU9A 1VQNZ 1VQMZ 2JNYA 3G6E1 2GTHA 1VQ7Z 4NBFA 4NH1C 3CC7Z 1RO4A 1YJW1 2OTJ1 4NBAA 2AKLA 3NDJA 3G711 1JJ2Z 2O4HA 1VQ6Z 1N8R2 4DK1A 3S14I 1JJ2Y 3VMHA 1YJN1 2JA5I 4MD9A 4S1TA 4A3DI 4Y7NI 1VQ81 3NH8A 1K83I 3BG0B 4NBHA 1QF8A 2RHBA 4X6AI 3MZLB 5FLMI 3S1NI 2BJOA 1P9NA 3S15I 3FQMA 1Y1WI 1VQM1 3NH5A 3FKII 2NVTI 1Q821 3M3YI 3PO3S 1K8A1 3CC71 2WAQA 2OOXB 2JA7I 1YI2Z 4NOZA 2QLVB 4A3FI 4BY1I 4A3BI 2M6NA 1RLYA 3NDIA 3ESWA 4QTTA 3GTMI 3TE5B 3CCLZ 3K7AI 4QTUA 3CPWZ 2F4OA 1S7MA 1YIT1 3CPWY 1X0TA 1X3ZA 2QRCB 1VQO1 2HF1A 2QKDA 2ZAEB 3IFUA 2JMOA 1PFTA 1RQFA 1RO0A 1Y1VS 3KIFA 3CCMZ 4A3EI 2RIQA 1Q7Y1 3FQQA 3GCFA 3J7A4 3J80b 2JA8I 4NB8A 1YHQZ 1K731 3BG1B 5FLXb 4A3MI 1I3QI 3CMA1 3J81b 1TFIA 1VQ9Z 1Q811 2V8JA 3I55Z 3CCL1 2PMZA 3PO2I 2OTL1 3CCSZ 2K3RA 5D1OB 3CXCZ 2WB1A 2E2JI 4A3LI 3CXCY 3GKQA 4NBBA 1KC81 2B63I 2IZ3A 5IT9b 2PK7A 2OOYB 1YJ91 1M1K2 2KPIA 1VLAA 3S1RI 2H85A 3CCQ1 3S17I 2DE5A 3S1QI 1VQL1 4RVGA 3VMGA 3GTLI 1QVGZ 3MONA 3G4S1 3GTQI 4MONA 2DE6A 1QVGY 4MD8A 3RZOI 4MRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZB8 A;  3CQZ I;  1DL6 A;  2JA7 I;  2R92 I;  2E2H I;  2NVY I;  3GTK I;  3S1M I;  4NBC A;  4NOZ A;  4NBE A;  4BBS I;  1TWG I;  1TWF I;  1L1O C;  3M4O I;  4A3F I;  1TWA I;  4BY1 I;  3HOU I;  1ZB9 A;  5C4J I;  1SFO I;  3HOY I;  3RZD I;  3I4M I;  5IP9 I;  4A3B I;  1RLY A;  3ESW A;  4QTT A;  3GTM I;  5IP7 I;  2VUM I;  2JA6 I;  2R7Z I;  3K7A I;  1NUI A;  2F4M A;  1I50 I;  4QTU A;  2NVQ I;  2F4O A;  2P3Y A;  3HOX I;  3GTG I;  1QYP A;  2E2I I;  1WCM I;  4BY7 I;  1R9T I;  1X3Z A;  4BBR I;  2HF1 A;  3U50 C;  4A3K I;  4A3C I;  4NBD A;  4NB9 A;  1PFT A;  2J6A A;  1Y1V S;  4A3E I;  4A93 I;  3S2D I;  3GCF A;  4Y52 I;  1X3W A;  2JR6 A;  3H0G I;  3GTJ I;  4MH4 A;  2JA8 I;  3S16 I;  1TWH I;  4NB8 A;  4A3J I;  3D6W A;  3VB9 A;  3HOV I;  4A3M I;  3I4N I;  1I3Q I;  3PO3 I;  2JNY A;  2K5R A;  1TFI A;  2NVX I;  3LUS A;  2DE7 A;  2RBL A;  4XX2 A;  3Q87 A;  4NBF A;  5C44 I;  5C4X I;  1RO4 A;  5CM2 M;  3H3V J;  4NBA A;  3GTM S;  3PO2 I;  2AKL A;  2E2J I;  1WW9 A;  3S14 I;  3VMH A;  1N2F A;  3I07 A;  2JA5 I;  4A3L I;  4BXX I;  3GKQ A;  1YUA A;  3EER A;  4NBB A;  2B63 I;  2PK7 A;  4A3D I;  4Y7N I;  1TWC I;  2KPI A;  1LQL A;  1VLA A;  1K83 I;  3S1R I;  3S2H I;  4NBH A;  3S17 I;  2DE5 A;  3S1Q I;  1USP A;  1ML8 A;  4A3I I;  1I6H I;  2JS4 A;  2YU9 I;  4X6A I;  4NBG A;  3VMG A;  5FLM I;  3GTP I;  3GTL I;  1Y1V I;  3S1N I;  1USP B;  3HOW I;  2BJO A;  3HOZ I;  3S15 I;  3GTQ I;  2DE6 A;  1Y1W I;  5C3E I;  3FKI I;  2NVT I;  3RZO I;  3VMI A;  3M3Y I;  2R93 I;  3GTO I;  3PO3 S;  4A3G I; 
#chains in the Genus database with same CATH topology
 1DL6 A;  2EGT A;  3VTN A;  4E2Y A;  3J80 f;  2R92 I;  4NBC A;  1NJI 1;  1QVF Z;  3CCE Z;  1TWF I;  2O53 A;  3CC4 Z;  1QVF Y;  5FLX f;  3M4O I;  3HOU I;  1ZB9 A;  3HOY I;  3J81 f;  3CCR Z;  4RVH A;  5IP7 I;  2JA6 I;  2F4M A;  1VQN 1;  1KD1 1;  2V3V A;  1QYP A;  1VQ7 1;  2E2I I;  1WCM I;  4BBR I;  1VQP Z;  1VQK Z;  2E9H A;  2QA4 Z;  1VQ6 1;  4E33 A;  4Y52 I;  5T64 A;  1VQ5 Z;  4RVD A;  2GU2 A;  3GTJ I;  1N8R 1;  3S16 I;  2NAP A;  3IF8 A;  1JWH C;  1WII A;  2LFU A;  3D6W A;  3IR7 A;  3VB9 A;  4E2Z A;  3CC4 1;  3I4N I;  2QRD B;  4HH4 A;  3P5J B;  3IX0 A;  3PO3 I;  1W2B Z;  1Y8C A;  2NVX I;  3LUS A;  2DE7 A;  2KI7 B;  4MXU A;  1W2B Y;  5C4X I;  2R6M A;  5CM2 M;  3QWU A;  2PM9 A;  1K9M 2;  1KQS Z;  1Q86 2;  1KQS Y;  5D1P A;  1N2F A;  4BXX I;  1YI2 1;  1YUA A;  1Z02 A;  3F3F C;  2YAD A;  3F3P C;  2LEX A;  2QRE B;  3CD6 Z;  1VQ5 1;  3S2H I;  1AA6 A;  2I3C A;  5T67 A;  2W03 A;  3OW2 Y;  3JAM b;  1VQ4 Z;  1ML8 A;  3MZK B;  1NP6 A;  2JS4 A;  2YU9 I;  3GTP I;  3D9X A;  1Y1V I;  3G6E Z;  2Y0S A;  1USP B;  3HOW I;  3T4N B;  1S72 Z;  3HOZ I;  1ZH1 A;  1YJW Z;  4AYB A;  2R93 I;  3GTO I;  3G71 Z;  3CCJ Z;  1YIJ Z;  4E31 A;  2OZK A;  3CCM 1;  2NVY I;  1Z01 A;  4BBS I;  2G2K A;  1YUK A;  4HGZ A;  1VQ8 Z;  1YHQ 1;  5C4J I;  1SFO I;  2W04 A;  3I4M I;  2RT9 A;  5A2Q b;  4EWC A;  4RVF A;  3KIH A;  2R7Z I;  3CD6 1;  1NUI A;  1I50 I;  1Q82 2;  1VQ9 1;  1K8A 2;  2RPR A;  3HOX I;  3GTG I;  3I55 1;  2GTI A;  2M48 A;  1R9T I;  2Q4Z A;  5AN9 F;  2JUB A;  4A3C I;  1S72 1;  3CCS 1;  2VPX A;  4RV9 A;  2QEX Z;  3S2D I;  4NFR A;  3CCU Z;  3CCJ 1;  1YIJ 1;  3I56 Z;  4E32 A;  1X3W A;  2JR6 A;  3JAM f;  3H0G I;  2VUG A;  2JIR A;  1TWH I;  1M90 1;  4CL1 A;  3HOV I;  1M1K 1;  2K5R A;  1YIT Z;  2RBL A;  4XX2 A;  3Q87 A;  1Q7Y 2;  5IT9 f;  5C44 I;  1VQO Z;  3H3V J;  1RO2 A;  3GTM S;  4HGY A;  1RNI A;  2Q51 A;  2P28 A;  1WW9 A;  3CCV Z;  3I07 A;  1K73 2;  3EER A;  4DGL A;  3CCE 1;  4MD7 A;  1TWC I;  1LQL A;  2QEX 1;  2V8K A;  4DQY B;  5A2Q f;  3CME Z;  2LIY A;  4E30 A;  2QR1 B;  1Q81 2;  3CCU 1;  3I56 1;  1USP A;  3CCR 1;  4E2X A;  4A3I I;  3EED A;  1I6H I;  5D1O A;  4NBG A;  3CMA Z;  3CC2 Z;  2V45 A;  1WJ2 A;  5C3E I;  1KC8 2;  2OTL Z;  3VMI A;  1VQP 1;  1VQK 1;  1ZB8 A;  3CQZ I;  3NFZ A;  2QA4 1;  2E2H I;  2IZ4 A;  3S1M I;  3GTK I;  2E7Z A;  2V8I A;  3OW2 Z;  4NBE A;  2VF1 A;  1TWG I;  1YJ9 Z;  4TNU A;  1KRL A;  3NH4 A;  1L1O C;  3CCV 1;  1Z03 A;  3TDH B;  1TWA I;  3CCQ Z;  3RZD I;  5IP9 I;  1VQL Z;  3CME 1;  2VUM I;  4A3G I;  2NVQ I;  2OTJ Z;  2P3Y A;  3G4S Z;  5LL6 f;  5T6B A;  4BY7 I;  3CC2 1;  3U50 C;  4A3K I;  2JIP A;  1NJI 2;  1YJN Z;  4NBD A;  4NB9 A;  1FDI A;  2J6A A;  4A93 I;  4RS4 A;  1K9M 1;  1Q86 1;  2IV2 X;  1M90 2;  4MH4 A;  4E2W A;  3HKZ A;  1KD1 2;  4A3J I;  1VQ4 1;  2HU9 A;  1VQN Z;  1VQM Z;  2JNY A;  3G6E 1;  2GTH A;  1VQ7 Z;  4NBF A;  4NH1 C;  3CC7 Z;  1FDO A;  1QXF A;  1RO4 A;  2VPY A;  1YJW 1;  2OTJ 1;  4NBA A;  2AKL A;  3NDJ A;  3G71 1;  1JJ2 Z;  2O4H A;  1VQ6 Z;  1N8R 2;  4DK1 A;  3S14 I;  1JJ2 Y;  3VMH A;  1YJN 1;  2JA5 I;  4MD9 A;  4S1T A;  4A3D I;  4Y7N I;  1VQ8 1;  3NH8 A;  1K83 I;  1SIW A;  3BG0 B;  3D2L A;  4NBH A;  2JIQ A;  1QF8 A;  2RHB A;  4X6A I;  3MZL B;  5FLM I;  3S1N I;  2BJO A;  1P9N A;  3S15 I;  3FQM A;  1Y1W I;  1VQM 1;  3NH5 A;  3FKI I;  2NVT I;  1Q82 1;  3M3Y I;  3PO3 S;  1K8A 1;  3CC7 1;  2WAQ A;  2OOX B;  2JA7 I;  1YI2 Z;  4NOZ A;  2QLV B;  4A3F I;  4BY1 I;  4A3B I;  2M6N A;  1RLY A;  3NDI A;  3ESW A;  4QTT A;  3GTM I;  3TE5 B;  3CCL Z;  3K7A I;  4QTU A;  3CPW Z;  2F4O A;  1S7M A;  1YIT 1;  3CPW Y;  1X0T A;  1X3Z A;  2QRC B;  1VQO 1;  2HF1 A;  2QKD A;  2VPZ A;  2ZAE B;  3IFU A;  2JMO A;  1PFT A;  1RQF A;  1RO0 A;  1Y1V S;  3KIF A;  3CCM Z;  4A3E I;  2RIQ A;  1Q7Y 1;  3FQQ A;  3GCF A;  3J7A 4;  3J80 b;  2JA8 I;  4NB8 A;  1YHQ Z;  1K73 1;  3BG1 B;  5FLX b;  4A3M I;  1I3Q I;  3CMA 1;  3J81 b;  1TFI A;  1VQ9 Z;  1Q81 1;  2V8J A;  3I55 Z;  3CCL 1;  2PMZ A;  3PO2 I;  2OTL 1;  3CCS Z;  2K3R A;  5D1O B;  3CXC Z;  2WB1 A;  2E2J I;  4A3L I;  3CXC Y;  3GKQ A;  4NBB A;  1KC8 1;  2B63 I;  2IZ3 A;  5IT9 b;  2PK7 A;  2OOY B;  1YJ9 1;  1M1K 2;  2KPI A;  1VLA A;  3S1R I;  2H85 A;  2AYD A;  3CCQ 1;  3S17 I;  2DE5 A;  3S1Q I;  1VQL 1;  4RVG A;  1WZN A;  2JIM A;  3VMG A;  3GTL I;  1QVG Z;  3MON A;  3G4S 1;  3GTQ I;  4MON A;  2DE6 A;  1QVG Y;  4MD8 A;  2JIO A;  1Q16 A;  3RZO I;  2VPW A;  4MRI A; 
#chains in the Genus database with same CATH homology
 1DL6 A;  2EGT A;  3VTN A;  4E2Y A;  3J80 f;  2R92 I;  4NBC A;  1NJI 1;  1QVF Z;  3CCE Z;  1TWF I;  2O53 A;  3CC4 Z;  1QVF Y;  5FLX f;  3M4O I;  3HOU I;  1ZB9 A;  3HOY I;  3J81 f;  3CCR Z;  4RVH A;  5IP7 I;  2JA6 I;  2F4M A;  1VQN 1;  1KD1 1;  1QYP A;  1VQ7 1;  2E2I I;  1WCM I;  4BBR I;  1VQP Z;  1VQK Z;  2E9H A;  2QA4 Z;  1VQ6 1;  4E33 A;  4Y52 I;  5T64 A;  1VQ5 Z;  4RVD A;  2GU2 A;  3GTJ I;  1N8R 1;  3S16 I;  3IF8 A;  1JWH C;  1WII A;  2LFU A;  3D6W A;  3VB9 A;  4E2Z A;  3CC4 1;  3I4N I;  2QRD B;  4HH4 A;  3P5J B;  3IX0 A;  3PO3 I;  1W2B Z;  2NVX I;  3LUS A;  2DE7 A;  2KI7 B;  4MXU A;  1W2B Y;  5C4X I;  2R6M A;  5CM2 M;  3QWU A;  2PM9 A;  1K9M 2;  1KQS Z;  1Q86 2;  1KQS Y;  5D1P A;  1N2F A;  4BXX I;  1YI2 1;  1YUA A;  1Z02 A;  3F3F C;  2YAD A;  3F3P C;  2QRE B;  3CD6 Z;  1VQ5 1;  3S2H I;  2I3C A;  5T67 A;  2W03 A;  3OW2 Y;  3JAM b;  1VQ4 Z;  1ML8 A;  3MZK B;  1NP6 A;  2JS4 A;  2YU9 I;  3GTP I;  3D9X A;  1Y1V I;  3G6E Z;  2Y0S A;  1USP B;  3HOW I;  3T4N B;  1S72 Z;  3HOZ I;  1ZH1 A;  1YJW Z;  4AYB A;  2R93 I;  3GTO I;  3G71 Z;  3CCJ Z;  1YIJ Z;  4E31 A;  2OZK A;  3CCM 1;  2NVY I;  1Z01 A;  4BBS I;  2G2K A;  1YUK A;  4HGZ A;  1VQ8 Z;  1YHQ 1;  5C4J I;  1SFO I;  2W04 A;  3I4M I;  2RT9 A;  5A2Q b;  4EWC A;  4RVF A;  3KIH A;  2R7Z I;  3CD6 1;  1NUI A;  1I50 I;  1Q82 2;  1VQ9 1;  1K8A 2;  2RPR A;  3HOX I;  3GTG I;  3I55 1;  2GTI A;  2M48 A;  1R9T I;  2Q4Z A;  5AN9 F;  2JUB A;  4A3C I;  1S72 1;  3CCS 1;  4RV9 A;  2QEX Z;  3S2D I;  4NFR A;  3CCU Z;  3CCJ 1;  1YIJ 1;  3I56 Z;  4E32 A;  1X3W A;  2JR6 A;  3JAM f;  3H0G I;  2VUG A;  1TWH I;  1M90 1;  4CL1 A;  3HOV I;  1M1K 1;  2K5R A;  1YIT Z;  2RBL A;  4XX2 A;  3Q87 A;  1Q7Y 2;  5IT9 f;  5C44 I;  1VQO Z;  3H3V J;  1RO2 A;  3GTM S;  4HGY A;  1RNI A;  2Q51 A;  2P28 A;  1WW9 A;  3CCV Z;  3I07 A;  1K73 2;  3EER A;  4DGL A;  3CCE 1;  4MD7 A;  1TWC I;  1LQL A;  2QEX 1;  2V8K A;  4DQY B;  5A2Q f;  3CME Z;  2LIY A;  4E30 A;  2QR1 B;  1Q81 2;  3CCU 1;  3I56 1;  1USP A;  3CCR 1;  4E2X A;  4A3I I;  3EED A;  1I6H I;  5D1O A;  4NBG A;  3CMA Z;  3CC2 Z;  5C3E I;  1KC8 2;  2OTL Z;  3VMI A;  1VQP 1;  1VQK 1;  1ZB8 A;  3CQZ I;  3NFZ A;  2QA4 1;  2E2H I;  2IZ4 A;  3S1M I;  3GTK I;  2V8I A;  3OW2 Z;  4NBE A;  2VF1 A;  1TWG I;  1YJ9 Z;  4TNU A;  1KRL A;  3NH4 A;  1L1O C;  3CCV 1;  1Z03 A;  3TDH B;  1TWA I;  3CCQ Z;  3RZD I;  5IP9 I;  1VQL Z;  3CME 1;  2VUM I;  4A3G I;  2NVQ I;  2OTJ Z;  2P3Y A;  3G4S Z;  5LL6 f;  5T6B A;  4BY7 I;  3CC2 1;  3U50 C;  4A3K I;  1NJI 2;  1YJN Z;  4NBD A;  4NB9 A;  2J6A A;  4A93 I;  4RS4 A;  1K9M 1;  1Q86 1;  1M90 2;  4MH4 A;  4E2W A;  3HKZ A;  1KD1 2;  4A3J I;  1VQ4 1;  2HU9 A;  1VQN Z;  1VQM Z;  2JNY A;  3G6E 1;  2GTH A;  1VQ7 Z;  4NBF A;  4NH1 C;  3CC7 Z;  1RO4 A;  1YJW 1;  2OTJ 1;  4NBA A;  2AKL A;  3NDJ A;  3G71 1;  1JJ2 Z;  2O4H A;  1VQ6 Z;  1N8R 2;  4DK1 A;  3S14 I;  1JJ2 Y;  3VMH A;  1YJN 1;  2JA5 I;  4MD9 A;  4S1T A;  4A3D I;  4Y7N I;  1VQ8 1;  3NH8 A;  1K83 I;  3BG0 B;  4NBH A;  1QF8 A;  2RHB A;  4X6A I;  3MZL B;  5FLM I;  3S1N I;  2BJO A;  1P9N A;  3S15 I;  3FQM A;  1Y1W I;  1VQM 1;  3NH5 A;  3FKI I;  2NVT I;  1Q82 1;  3M3Y I;  3PO3 S;  1K8A 1;  3CC7 1;  2WAQ A;  2OOX B;  2JA7 I;  1YI2 Z;  4NOZ A;  2QLV B;  4A3F I;  4BY1 I;  4A3B I;  2M6N A;  1RLY A;  3NDI A;  3ESW A;  4QTT A;  3GTM I;  3TE5 B;  3CCL Z;  3K7A I;  4QTU A;  3CPW Z;  2F4O A;  1S7M A;  1YIT 1;  3CPW Y;  1X0T A;  1X3Z A;  2QRC B;  1VQO 1;  2HF1 A;  2QKD A;  2ZAE B;  3IFU A;  2JMO A;  1PFT A;  1RQF A;  1RO0 A;  1Y1V S;  3KIF A;  3CCM Z;  4A3E I;  2RIQ A;  1Q7Y 1;  3FQQ A;  3GCF A;  3J7A 4;  3J80 b;  2JA8 I;  4NB8 A;  1YHQ Z;  1K73 1;  3BG1 B;  5FLX b;  4A3M I;  1I3Q I;  3CMA 1;  3J81 b;  1TFI A;  1VQ9 Z;  1Q81 1;  2V8J A;  3I55 Z;  3CCL 1;  2PMZ A;  3PO2 I;  2OTL 1;  3CCS Z;  2K3R A;  5D1O B;  3CXC Z;  2WB1 A;  2E2J I;  4A3L I;  3CXC Y;  3GKQ A;  4NBB A;  1KC8 1;  2B63 I;  2IZ3 A;  5IT9 b;  2PK7 A;  2OOY B;  1YJ9 1;  1M1K 2;  2KPI A;  1VLA A;  3S1R I;  2H85 A;  3CCQ 1;  3S17 I;  2DE5 A;  3S1Q I;  1VQL 1;  4RVG A;  3VMG A;  3GTL I;  1QVG Z;  3MON A;  3G4S 1;  3GTQ I;  4MON A;  2DE6 A;  1QVG Y;  4MD8 A;  3RZO I;  4MRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...