4BXXI

Arrested rna polymerase ii-bye1 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 17
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4bxxI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4bxxI02
4MH4A 2DE5A 3CQZI 3GTGI 3HOZI 1WW9A 4NBEA 3S2HI 1LQLA 2PK7A 3U50C 3S1QI 4A3KI 3M4OI 4NBBA 1TFIA 2JR6A 3FKII 4NBDA 2NVQI 4NB8A 5C44I 3GTMS 3Q87A 3VMHA 4XX2A 2J6AA 2VUMI 2NVXI 3S14I 1SFOI 1TWFI 1X3WA 1NUIA 4NBAA 2E2JI 5FLMI 5IP9I 2JA6I 4QTUA 4A93I 3S15I 3S1MI 1RO4A 1USPA 3S16I 2NVYI 4BY1I 4NOZA 2E2HI 3PO3S 2R93I 1Y1VI 3H3VJ 3S1NI 1ML8A 4A3FI 1ZB8A 2F4MA 1I6HI 3GTOI 3HOUI 1VLAA 3I4MI 4NBCA 2AKLA 1TWGI 5IP7I 5CM2M 2JA5I 4BBSI 1YUAA 3D6WA 1K83I 5C4XI 4A3MI 1N2FA 4NB9A 3GKQA 2KPIA 1TWHI 4QTTA 2R7ZI 3S1RI 2DE6A 2E2II 2P3YA 4A3DI 3GTKI 2JNYA 2JA7I 3I4NI 1X3ZA 3S17I 1I3QI 2JS4A 1USPB 2R92I 3HOWI 3RZDI 3RZOI 4A3LI 4A3BI 3EERA 4A3GI 1ZB9A 2RBLA 1Y1VS 4BXXI 3ESWA 1WCMI 3GTPI 2K5RA 4NBFA 1I50I 3H0GI 4NBHA 5C4JI 3HOVI 3HOXI 1L1OC 4Y7NI 3VMGA 3GTLI 3GTMI 1TWCI 4A3II 4A3JI 3M3YI 2F4OA 3GCFA 3K7AI 3LUSA 2NVTI 3S2DI 1TWAI 1PFTA 4X6AI 3PO2I 2B63I 2YU9I 5C3EI 3VB9A 3GTJI 4Y52I 1DL6A 3VMIA 1RLYA 4A3EI 1R9TI 1QYPA 3I07A 3GTQI 2HF1A 4BBRI 3HOYI 4A3CI 2BJOA 2DE7A 3PO3I 4BY7I 2JA8I 4NBGA 1Y1WI
chains in the Genus database with same CATH superfamily
3CCVZ 2E9HA 1Q811 2DE5A 1K9M1 3CQZI 3S2HI 1NJI1 2NAPA 1KRLA 3QWUA 4AYBA 2QEX1 3S1QI 3M4OI 3BG1B 1YIT1 2GU2A 2NVQI 4NB8A 2VPXA 5C44I 1M1K2 2Q51A 2JIRA 3NH4A 3CC41 3CMAZ 3CC2Z 1KQSY 1NUIA 4DQYB 1QVFY 3NH5A 1YI21 2PMZA 4A93I 3FQMA 3G71Z 1WZNA 5FLXf 1RO2A 2E2HI 4DK1A 4HGZA 1AA6A 3CCEZ 1YJ9Z 2WB1A 4MD8A 1VQ5Z 1VQK1 3CCUZ 2AKLA 2VPZA 2JA5I 2OOXB 3F3PC 1K83I 5C4XI 2H85A 3JAMb 1Q7Y1 2E7ZA 1QVGZ 1FDIA 4QTTA 4E33A 1YJW1 2P3YA 2O53A 4A3DI 2LIYA 2JNYA 1VQM1 2QRCB 3S17I 1USPB 2R92I 1M902 4RVFA 4E2ZA 3J7A4 4A3LI 2OTJZ 1ZB9A 2JIPA 2RBLA 2YADA 1I50I 2OZKA 2JIOA 1P9NA 1L1OC 1YHQ1 5T67A 4A3II 3IX0A 2QA4Z 1PFTA 2V8IA 3CCL1 1VQ81 2K3RA 1K8A2 3CCJ1 3CME1 1DL6A 3VMIA 1RLYA 1VQ41 2R6MA 1RQFA 4HGYA 1QVGY 4BY7I 1WIIA 5IT9b 2JA8I 1Y1WI 2HU9A 1Z01A 3VTNA 2JIQA 1WW9A 3CC71 3HKZA 4RVDA 5LL6f 2VPWA 4MD7A 3CPWZ 2VUMI 3T4NB 2NVXI 4E2WA 1JJ2Z 1Z03A 1VQPZ 2KI7B 3NDIA 5FLMI 5IP9I 3OW2Z 3NFZA 1VQN1 3S1MI 1Q862 3CCV1 3S16I 4BY1I 1KC81 1VQ9Z 2G2KA 2LEXA 2W04A 1Y1VI 3S1NI 2PM9A 2WAQA 5AN9F 1I6HI 1KD11 2OTLZ 5T64A 5D1OA 3I4MI 3CCS1 1N8R2 3CCMZ 1Q812 1K9M2 1N2FA 1VQLZ 1NJI2 2KPIA 2Y0SA 2QEXZ 1YIJ1 1YITZ 3GTKI 2JA7I 2GTHA 3CPWY 1YJ91 3CC4Z 4NH1C 1JJ2Y 3RZDI 1QF8A 3J81b 3OW2Y 3ESWA 5FLXb 3CD61 4NBFA 4NBHA 1JWHC 3VMGA 3G6EZ 3NH8A 3GTLI 4RVGA 3KIFA 4A3JI 4MXUA 3EEDA 3NDJA 2V8KA 3PO2I 2B63I 2YU9I 2P28A 1VQKZ 5D1PA 3GTJI 1VQ6Z 3IF8A 1Z02A 4A3EI 1R9TI 1QYPA 3I07A 4NFRA 3J80b 1YJN1 3HOYI 4A3CI 2IZ4A 1Q7Y2 3IFUA 3CCRZ 2IV2X 1YJWZ 3G4SZ 1VQO1 1K731 1VQMZ 4NBEA 1SIWA 2RHBA 2PK7A 3U50C 4A3KI 4NBBA 1TFIA 2JR6A 3FKII 4NBDA 3GTMS 5A2Qf 4EWCA 3VMHA 2JIMA 2J6AA 3S14I 4RVHA 1S72Z 4TNUA 1SFOI 3CCQ1 3I561 1RO4A 4E32A 4NOZA 1VQ8Z 3PO3S 3H3VJ 1RO0A 3CCJZ 2AYDA 3CMEZ 3F3FC 3MZLB 4A3FI 1Q822 1ZB8A 1VQ4Z 4RV9A 3GTOI 3HOUI 4NBCA 2GTIA 4E30A 2QRDB 2QKDA 3I55Z 5IP7I 1VQ71 1YUAA 3D6WA 1KQSZ 4E31A 1QVFZ 4NB9A 2R7ZI 3CC7Z 3S1RI 2VF1A 1X0TA 4E2YA 1QXFA 4HH4A 1VQ91 3I4NI 1X3ZA 1WJ2A 3RZOI 1RNIA 3EERA 4A3GI 1M1K1 1WCMI 2K5RA 3CMA1 3CC21 3HOVI 5D1OB 4Y7NI 4RS4A 1KC82 1TWCI 1VQL1 3M3YI 2F4OA 3GCFA 3LUSA 3S2DI 1YUKA 3G711 4X6AI 1KD12 3CCE1 4Y52I 3CCSZ 2V8JA 2OOYB 1VQ51 2IZ3A 3CCU1 3D2LA 1YI2Z 2VPYA 3D9XA 2M6NA 1YIJZ 4MH4A 3J81f 3G6E1 3GTGI 3HOZI 1LQLA 2JUBA 2QLVB 3JAMf 4MONA 3Q87A 2Q4ZA 1VQ61 3CD6Z 4XX2A 1M901 2OTJ1 4MRIA 1TWFI 1X3WA 1W2BZ 4NBAA 2E2JI 3BG0B 2JA6I 3MONA 3CCR1 4QTUA 2RT9A 3S15I 3J80f 3CXCZ 3P5JB 1USPA 3G4S1 2NVYI 2RIQA 2W03A 2R93I 1ML8A 2QA41 2F4MA 1Q16A 1YJNZ 1VLAA 1K8A1 1TWGI 1S721 2M48A 4S1TA 5CM2M 4E2XA 1VQOZ 4BBSI 4A3MI 1YHQZ 1K732 5A2Qb 3GKQA 1TWHI 2DE6A 2E2II 2EGTA 3CCLZ 2RPRA 2V3VA 3FQQA 5IT9f 1I3QI 2JS4A 2V45A 3HOWI 3TDHB 2ZAEB 1Q821 2O4HA 4A3BI 1W2BY 3KIHA 3CCQZ 3I56Z 1Y1VS 4BXXI 3TE5B 3GTPI 4DGLA 3CXCY 3H0GI 5C4JI 3HOXI 3I551 2QR1B 5T6BA 3GTMI 1VQP1 3IR7A 2JMOA 3K7AI 1Q861 2NVTI 1TWAI 2I3CA 4MD9A 5C3EI 1ZH1A 3VB9A 4CL1A 2QREB 1Y8CA 2LFUA 1NP6A 1VQ7Z 3GTQI 2HF1A 1S7MA 2OTL1 4BBRI 1FDOA 2BJOA 1N8R1 2DE7A 3PO3I 1VQNZ 4NBGA 3MZKB 3CCM1 2VUGA
chains in the Genus database with same CATH topology
3CCVZ 2E9HA 1Q811 2DE5A 1K9M1 3CQZI 3S2HI 1NJI1 1KRLA 3QWUA 4AYBA 2QEX1 3S1QI 3M4OI 3BG1B 1YIT1 2GU2A 2NVQI 4NB8A 5C44I 1M1K2 2Q51A 3NH4A 3CC41 3CMAZ 3CC2Z 1KQSY 1NUIA 4DQYB 1QVFY 3NH5A 1YI21 2PMZA 4A93I 3FQMA 3G71Z 5FLXf 1RO2A 2E2HI 4DK1A 4HGZA 3CCEZ 1YJ9Z 2WB1A 4MD8A 1VQ5Z 1VQK1 3CCUZ 2AKLA 2JA5I 2OOXB 3F3PC 1K83I 5C4XI 2H85A 3JAMb 1Q7Y1 1QVGZ 4QTTA 4E33A 1YJW1 2P3YA 2O53A 4A3DI 2LIYA 2JNYA 1VQM1 2QRCB 3S17I 1USPB 2R92I 1M902 4RVFA 4E2ZA 3J7A4 4A3LI 2OTJZ 1ZB9A 2RBLA 2YADA 1I50I 2OZKA 1P9NA 1L1OC 1YHQ1 5T67A 4A3II 3IX0A 2QA4Z 1PFTA 2V8IA 3CCL1 1VQ81 2K3RA 1K8A2 3CCJ1 3CME1 1DL6A 3VMIA 1RLYA 1VQ41 2R6MA 1RQFA 4HGYA 1QVGY 4BY7I 1WIIA 5IT9b 2JA8I 1Y1WI 2HU9A 1Z01A 3VTNA 1WW9A 3CC71 3HKZA 4RVDA 5LL6f 4MD7A 3CPWZ 2VUMI 3T4NB 2NVXI 4E2WA 1JJ2Z 1Z03A 1VQPZ 2KI7B 3NDIA 5FLMI 5IP9I 3OW2Z 3NFZA 1VQN1 3S1MI 1Q862 3CCV1 3S16I 4BY1I 1KC81 1VQ9Z 2G2KA 2W04A 1Y1VI 3S1NI 2PM9A 2WAQA 5AN9F 1I6HI 1KD11 2OTLZ 5T64A 5D1OA 3I4MI 3CCS1 1N8R2 3CCMZ 1Q812 1K9M2 1N2FA 1VQLZ 1NJI2 2KPIA 2Y0SA 2QEXZ 1YIJ1 1YITZ 3GTKI 2JA7I 2GTHA 3CPWY 1YJ91 3CC4Z 4NH1C 1JJ2Y 3RZDI 1QF8A 3J81b 3OW2Y 3ESWA 5FLXb 3CD61 4NBFA 4NBHA 1JWHC 3VMGA 3G6EZ 3NH8A 3GTLI 4RVGA 3KIFA 4A3JI 4MXUA 3EEDA 3NDJA 2V8KA 3PO2I 2B63I 2YU9I 2P28A 1VQKZ 5D1PA 3GTJI 1VQ6Z 3IF8A 1Z02A 4A3EI 1R9TI 1QYPA 3I07A 4NFRA 3J80b 1YJN1 3HOYI 4A3CI 2IZ4A 1Q7Y2 3IFUA 3CCRZ 1YJWZ 3G4SZ 1VQO1 1K731 1VQMZ 4NBEA 2RHBA 2PK7A 3U50C 4A3KI 4NBBA 1TFIA 2JR6A 3FKII 4NBDA 3GTMS 5A2Qf 4EWCA 3VMHA 2J6AA 3S14I 4RVHA 1S72Z 4TNUA 1SFOI 3CCQ1 3I561 1RO4A 4E32A 4NOZA 1VQ8Z 3PO3S 3H3VJ 1RO0A 3CCJZ 3CMEZ 3F3FC 3MZLB 4A3FI 1Q822 1ZB8A 1VQ4Z 4RV9A 3GTOI 3HOUI 4NBCA 2GTIA 4E30A 2QRDB 2QKDA 3I55Z 5IP7I 1VQ71 1YUAA 3D6WA 1KQSZ 4E31A 1QVFZ 4NB9A 2R7ZI 3CC7Z 3S1RI 2VF1A 1X0TA 4E2YA 4HH4A 1VQ91 3I4NI 1X3ZA 3RZOI 1RNIA 3EERA 4A3GI 1M1K1 1WCMI 2K5RA 3CMA1 3CC21 3HOVI 5D1OB 4Y7NI 4RS4A 1KC82 1TWCI 1VQL1 3M3YI 2F4OA 3GCFA 3LUSA 3S2DI 1YUKA 3G711 4X6AI 1KD12 3CCE1 4Y52I 3CCSZ 2V8JA 2OOYB 1VQ51 2IZ3A 3CCU1 1YI2Z 3D9XA 2M6NA 1YIJZ 4MH4A 3J81f 3G6E1 3GTGI 3HOZI 1LQLA 2JUBA 2QLVB 3JAMf 4MONA 3Q87A 2Q4ZA 1VQ61 3CD6Z 4XX2A 1M901 2OTJ1 4MRIA 1TWFI 1X3WA 1W2BZ 4NBAA 2E2JI 3BG0B 2JA6I 3MONA 3CCR1 4QTUA 2RT9A 3S15I 3J80f 3CXCZ 3P5JB 1USPA 3G4S1 2NVYI 2RIQA 2W03A 2R93I 1ML8A 2QA41 2F4MA 1YJNZ 1VLAA 1K8A1 1TWGI 1S721 2M48A 4S1TA 5CM2M 4E2XA 1VQOZ 4BBSI 4A3MI 1YHQZ 1K732 5A2Qb 3GKQA 1TWHI 2DE6A 2E2II 2EGTA 3CCLZ 2RPRA 3FQQA 5IT9f 1I3QI 2JS4A 3HOWI 3TDHB 2ZAEB 1Q821 2O4HA 4A3BI 1W2BY 3KIHA 3CCQZ 3I56Z 1Y1VS 4BXXI 3TE5B 3GTPI 4DGLA 3CXCY 3H0GI 5C4JI 3HOXI 3I551 2QR1B 5T6BA 3GTMI 1VQP1 2JMOA 3K7AI 1Q861 2NVTI 1TWAI 2I3CA 4MD9A 5C3EI 1ZH1A 3VB9A 4CL1A 2QREB 2LFUA 1NP6A 1VQ7Z 3GTQI 2HF1A 1S7MA 2OTL1 4BBRI 2BJOA 1N8R1 2DE7A 3PO3I 1VQNZ 4NBGA 3MZKB 3CCM1 2VUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MH4 A;  2DE5 A;  3CQZ I;  3GTG I;  3HOZ I;  1WW9 A;  4NBE A;  3S2H I;  1LQL A;  2PK7 A;  3U50 C;  3S1Q I;  4A3K I;  3M4O I;  4NBB A;  1TFI A;  2JR6 A;  3FKI I;  4NBD A;  2NVQ I;  4NB8 A;  5C44 I;  3GTM S;  3Q87 A;  3VMH A;  4XX2 A;  2J6A A;  2VUM I;  2NVX I;  3S14 I;  1SFO I;  1TWF I;  1X3W A;  1NUI A;  4NBA A;  2E2J I;  5FLM I;  5IP9 I;  2JA6 I;  4QTU A;  4A93 I;  3S15 I;  3S1M I;  1RO4 A;  1USP A;  3S16 I;  2NVY I;  4BY1 I;  4NOZ A;  2E2H I;  3PO3 S;  2R93 I;  1Y1V I;  3H3V J;  3S1N I;  1ML8 A;  4A3F I;  1ZB8 A;  2F4M A;  1I6H I;  3GTO I;  3HOU I;  1VLA A;  3I4M I;  4NBC A;  2AKL A;  1TWG I;  5IP7 I;  5CM2 M;  2JA5 I;  4BBS I;  1YUA A;  3D6W A;  1K83 I;  5C4X I;  4A3M I;  1N2F A;  4NB9 A;  3GKQ A;  2KPI A;  1TWH I;  4QTT A;  2R7Z I;  3S1R I;  2DE6 A;  2E2I I;  2P3Y A;  4A3D I;  3GTK I;  2JNY A;  2JA7 I;  3I4N I;  1X3Z A;  3S17 I;  1I3Q I;  2JS4 A;  1USP B;  2R92 I;  3HOW I;  3RZD I;  3RZO I;  4A3L I;  4A3B I;  3EER A;  4A3G I;  1ZB9 A;  2RBL A;  1Y1V S;  4BXX I;  3ESW A;  1WCM I;  3GTP I;  2K5R A;  4NBF A;  1I50 I;  3H0G I;  4NBH A;  5C4J I;  3HOV I;  3HOX I;  1L1O C;  4Y7N I;  3VMG A;  3GTL I;  3GTM I;  1TWC I;  4A3I I;  4A3J I;  3M3Y I;  2F4O A;  3GCF A;  3K7A I;  3LUS A;  2NVT I;  3S2D I;  1TWA I;  1PFT A;  4X6A I;  3PO2 I;  2B63 I;  2YU9 I;  5C3E I;  3VB9 A;  3GTJ I;  4Y52 I;  1DL6 A;  3VMI A;  1RLY A;  4A3E I;  1R9T I;  1QYP A;  3I07 A;  3GTQ I;  2HF1 A;  4BBR I;  3HOY I;  4A3C I;  2BJO A;  2DE7 A;  3PO3 I;  4BY7 I;  2JA8 I;  4NBG A;  1Y1W I; 
#chains in the Genus database with same CATH topology
 3CCV Z;  2E9H A;  1Q81 1;  2DE5 A;  1K9M 1;  3CQZ I;  3S2H I;  1NJI 1;  2NAP A;  1KRL A;  3QWU A;  4AYB A;  2QEX 1;  3S1Q I;  3M4O I;  3BG1 B;  1YIT 1;  2GU2 A;  2NVQ I;  4NB8 A;  2VPX A;  5C44 I;  1M1K 2;  2Q51 A;  2JIR A;  3NH4 A;  3CC4 1;  3CMA Z;  3CC2 Z;  1KQS Y;  1NUI A;  4DQY B;  1QVF Y;  3NH5 A;  1YI2 1;  2PMZ A;  4A93 I;  3FQM A;  3G71 Z;  1WZN A;  5FLX f;  1RO2 A;  2E2H I;  4DK1 A;  4HGZ A;  1AA6 A;  3CCE Z;  1YJ9 Z;  2WB1 A;  4MD8 A;  1VQ5 Z;  1VQK 1;  3CCU Z;  2AKL A;  2VPZ A;  2JA5 I;  2OOX B;  3F3P C;  1K83 I;  5C4X I;  2H85 A;  3JAM b;  1Q7Y 1;  2E7Z A;  1QVG Z;  1FDI A;  4QTT A;  4E33 A;  1YJW 1;  2P3Y A;  2O53 A;  4A3D I;  2LIY A;  2JNY A;  1VQM 1;  2QRC B;  3S17 I;  1USP B;  2R92 I;  1M90 2;  4RVF A;  4E2Z A;  3J7A 4;  4A3L I;  2OTJ Z;  1ZB9 A;  2JIP A;  2RBL A;  2YAD A;  1I50 I;  2OZK A;  2JIO A;  1P9N A;  1L1O C;  1YHQ 1;  5T67 A;  4A3I I;  3IX0 A;  2QA4 Z;  1PFT A;  2V8I A;  3CCL 1;  1VQ8 1;  2K3R A;  1K8A 2;  3CCJ 1;  3CME 1;  1DL6 A;  3VMI A;  1RLY A;  1VQ4 1;  2R6M A;  1RQF A;  4HGY A;  1QVG Y;  4BY7 I;  1WII A;  5IT9 b;  2JA8 I;  1Y1W I;  2HU9 A;  1Z01 A;  3VTN A;  2JIQ A;  1WW9 A;  3CC7 1;  3HKZ A;  4RVD A;  5LL6 f;  2VPW A;  4MD7 A;  3CPW Z;  2VUM I;  3T4N B;  2NVX I;  4E2W A;  1JJ2 Z;  1Z03 A;  1VQP Z;  2KI7 B;  3NDI A;  5FLM I;  5IP9 I;  3OW2 Z;  3NFZ A;  1VQN 1;  3S1M I;  1Q86 2;  3CCV 1;  3S16 I;  4BY1 I;  1KC8 1;  1VQ9 Z;  2G2K A;  2LEX A;  2W04 A;  1Y1V I;  3S1N I;  2PM9 A;  2WAQ A;  5AN9 F;  1I6H I;  1KD1 1;  2OTL Z;  5T64 A;  5D1O A;  3I4M I;  3CCS 1;  1N8R 2;  3CCM Z;  1Q81 2;  1K9M 2;  1N2F A;  1VQL Z;  1NJI 2;  2KPI A;  2Y0S A;  2QEX Z;  1YIJ 1;  1YIT Z;  3GTK I;  2JA7 I;  2GTH A;  3CPW Y;  1YJ9 1;  3CC4 Z;  4NH1 C;  1JJ2 Y;  3RZD I;  1QF8 A;  3J81 b;  3OW2 Y;  3ESW A;  5FLX b;  3CD6 1;  4NBF A;  4NBH A;  1JWH C;  3VMG A;  3G6E Z;  3NH8 A;  3GTL I;  4RVG A;  3KIF A;  4A3J I;  4MXU A;  3EED A;  3NDJ A;  2V8K A;  3PO2 I;  2B63 I;  2YU9 I;  2P28 A;  1VQK Z;  5D1P A;  3GTJ I;  1VQ6 Z;  3IF8 A;  1Z02 A;  4A3E I;  1R9T I;  1QYP A;  3I07 A;  4NFR A;  3J80 b;  1YJN 1;  3HOY I;  4A3C I;  2IZ4 A;  1Q7Y 2;  3IFU A;  3CCR Z;  2IV2 X;  1YJW Z;  3G4S Z;  1VQO 1;  1K73 1;  1VQM Z;  4NBE A;  1SIW A;  2RHB A;  2PK7 A;  3U50 C;  4A3K I;  4NBB A;  1TFI A;  2JR6 A;  3FKI I;  4NBD A;  3GTM S;  5A2Q f;  4EWC A;  3VMH A;  2JIM A;  2J6A A;  3S14 I;  4RVH A;  1S72 Z;  4TNU A;  1SFO I;  3CCQ 1;  3I56 1;  1RO4 A;  4E32 A;  4NOZ A;  1VQ8 Z;  3PO3 S;  3H3V J;  1RO0 A;  3CCJ Z;  2AYD A;  3CME Z;  3F3F C;  3MZL B;  4A3F I;  1Q82 2;  1ZB8 A;  1VQ4 Z;  4RV9 A;  3GTO I;  3HOU I;  4NBC A;  2GTI A;  4E30 A;  2QRD B;  2QKD A;  3I55 Z;  5IP7 I;  1VQ7 1;  1YUA A;  3D6W A;  1KQS Z;  4E31 A;  1QVF Z;  4NB9 A;  2R7Z I;  3CC7 Z;  3S1R I;  2VF1 A;  1X0T A;  4E2Y A;  1QXF A;  4HH4 A;  1VQ9 1;  3I4N I;  1X3Z A;  1WJ2 A;  3RZO I;  1RNI A;  3EER A;  4A3G I;  1M1K 1;  1WCM I;  2K5R A;  3CMA 1;  3CC2 1;  3HOV I;  5D1O B;  4Y7N I;  4RS4 A;  1KC8 2;  1TWC I;  1VQL 1;  3M3Y I;  2F4O A;  3GCF A;  3LUS A;  3S2D I;  1YUK A;  3G71 1;  4X6A I;  1KD1 2;  3CCE 1;  4Y52 I;  3CCS Z;  2V8J A;  2OOY B;  1VQ5 1;  2IZ3 A;  3CCU 1;  3D2L A;  1YI2 Z;  2VPY A;  3D9X A;  2M6N A;  1YIJ Z;  4MH4 A;  3J81 f;  3G6E 1;  3GTG I;  3HOZ I;  1LQL A;  2JUB A;  2QLV B;  3JAM f;  4MON A;  3Q87 A;  2Q4Z A;  1VQ6 1;  3CD6 Z;  4XX2 A;  1M90 1;  2OTJ 1;  4MRI A;  1TWF I;  1X3W A;  1W2B Z;  4NBA A;  2E2J I;  3BG0 B;  2JA6 I;  3MON A;  3CCR 1;  4QTU A;  2RT9 A;  3S15 I;  3J80 f;  3CXC Z;  3P5J B;  1USP A;  3G4S 1;  2NVY I;  2RIQ A;  2W03 A;  2R93 I;  1ML8 A;  2QA4 1;  2F4M A;  1Q16 A;  1YJN Z;  1VLA A;  1K8A 1;  1TWG I;  1S72 1;  2M48 A;  4S1T A;  5CM2 M;  4E2X A;  1VQO Z;  4BBS I;  4A3M I;  1YHQ Z;  1K73 2;  5A2Q b;  3GKQ A;  1TWH I;  2DE6 A;  2E2I I;  2EGT A;  3CCL Z;  2RPR A;  2V3V A;  3FQQ A;  5IT9 f;  1I3Q I;  2JS4 A;  2V45 A;  3HOW I;  3TDH B;  2ZAE B;  1Q82 1;  2O4H A;  4A3B I;  1W2B Y;  3KIH A;  3CCQ Z;  3I56 Z;  1Y1V S;  4BXX I;  3TE5 B;  3GTP I;  4DGL A;  3CXC Y;  3H0G I;  5C4J I;  3HOX I;  3I55 1;  2QR1 B;  5T6B A;  3GTM I;  1VQP 1;  3IR7 A;  2JMO A;  3K7A I;  1Q86 1;  2NVT I;  1TWA I;  2I3C A;  4MD9 A;  5C3E I;  1ZH1 A;  3VB9 A;  4CL1 A;  2QRE B;  1Y8C A;  2LFU A;  1NP6 A;  1VQ7 Z;  3GTQ I;  2HF1 A;  1S7M A;  2OTL 1;  4BBR I;  1FDO A;  2BJO A;  1N8R 1;  2DE7 A;  3PO3 I;  1VQN Z;  4NBG A;  3MZK B;  3CCM 1;  2VUG A; 
#chains in the Genus database with same CATH homology
 3CCV Z;  2E9H A;  1Q81 1;  2DE5 A;  1K9M 1;  3CQZ I;  3S2H I;  1NJI 1;  1KRL A;  3QWU A;  4AYB A;  2QEX 1;  3S1Q I;  3M4O I;  3BG1 B;  1YIT 1;  2GU2 A;  2NVQ I;  4NB8 A;  5C44 I;  1M1K 2;  2Q51 A;  3NH4 A;  3CC4 1;  3CMA Z;  3CC2 Z;  1KQS Y;  1NUI A;  4DQY B;  1QVF Y;  3NH5 A;  1YI2 1;  2PMZ A;  4A93 I;  3FQM A;  3G71 Z;  5FLX f;  1RO2 A;  2E2H I;  4DK1 A;  4HGZ A;  3CCE Z;  1YJ9 Z;  2WB1 A;  4MD8 A;  1VQ5 Z;  1VQK 1;  3CCU Z;  2AKL A;  2JA5 I;  2OOX B;  3F3P C;  1K83 I;  5C4X I;  2H85 A;  3JAM b;  1Q7Y 1;  1QVG Z;  4QTT A;  4E33 A;  1YJW 1;  2P3Y A;  2O53 A;  4A3D I;  2LIY A;  2JNY A;  1VQM 1;  2QRC B;  3S17 I;  1USP B;  2R92 I;  1M90 2;  4RVF A;  4E2Z A;  3J7A 4;  4A3L I;  2OTJ Z;  1ZB9 A;  2RBL A;  2YAD A;  1I50 I;  2OZK A;  1P9N A;  1L1O C;  1YHQ 1;  5T67 A;  4A3I I;  3IX0 A;  2QA4 Z;  1PFT A;  2V8I A;  3CCL 1;  1VQ8 1;  2K3R A;  1K8A 2;  3CCJ 1;  3CME 1;  1DL6 A;  3VMI A;  1RLY A;  1VQ4 1;  2R6M A;  1RQF A;  4HGY A;  1QVG Y;  4BY7 I;  1WII A;  5IT9 b;  2JA8 I;  1Y1W I;  2HU9 A;  1Z01 A;  3VTN A;  1WW9 A;  3CC7 1;  3HKZ A;  4RVD A;  5LL6 f;  4MD7 A;  3CPW Z;  2VUM I;  3T4N B;  2NVX I;  4E2W A;  1JJ2 Z;  1Z03 A;  1VQP Z;  2KI7 B;  3NDI A;  5FLM I;  5IP9 I;  3OW2 Z;  3NFZ A;  1VQN 1;  3S1M I;  1Q86 2;  3CCV 1;  3S16 I;  4BY1 I;  1KC8 1;  1VQ9 Z;  2G2K A;  2W04 A;  1Y1V I;  3S1N I;  2PM9 A;  2WAQ A;  5AN9 F;  1I6H I;  1KD1 1;  2OTL Z;  5T64 A;  5D1O A;  3I4M I;  3CCS 1;  1N8R 2;  3CCM Z;  1Q81 2;  1K9M 2;  1N2F A;  1VQL Z;  1NJI 2;  2KPI A;  2Y0S A;  2QEX Z;  1YIJ 1;  1YIT Z;  3GTK I;  2JA7 I;  2GTH A;  3CPW Y;  1YJ9 1;  3CC4 Z;  4NH1 C;  1JJ2 Y;  3RZD I;  1QF8 A;  3J81 b;  3OW2 Y;  3ESW A;  5FLX b;  3CD6 1;  4NBF A;  4NBH A;  1JWH C;  3VMG A;  3G6E Z;  3NH8 A;  3GTL I;  4RVG A;  3KIF A;  4A3J I;  4MXU A;  3EED A;  3NDJ A;  2V8K A;  3PO2 I;  2B63 I;  2YU9 I;  2P28 A;  1VQK Z;  5D1P A;  3GTJ I;  1VQ6 Z;  3IF8 A;  1Z02 A;  4A3E I;  1R9T I;  1QYP A;  3I07 A;  4NFR A;  3J80 b;  1YJN 1;  3HOY I;  4A3C I;  2IZ4 A;  1Q7Y 2;  3IFU A;  3CCR Z;  1YJW Z;  3G4S Z;  1VQO 1;  1K73 1;  1VQM Z;  4NBE A;  2RHB A;  2PK7 A;  3U50 C;  4A3K I;  4NBB A;  1TFI A;  2JR6 A;  3FKI I;  4NBD A;  3GTM S;  5A2Q f;  4EWC A;  3VMH A;  2J6A A;  3S14 I;  4RVH A;  1S72 Z;  4TNU A;  1SFO I;  3CCQ 1;  3I56 1;  1RO4 A;  4E32 A;  4NOZ A;  1VQ8 Z;  3PO3 S;  3H3V J;  1RO0 A;  3CCJ Z;  3CME Z;  3F3F C;  3MZL B;  4A3F I;  1Q82 2;  1ZB8 A;  1VQ4 Z;  4RV9 A;  3GTO I;  3HOU I;  4NBC A;  2GTI A;  4E30 A;  2QRD B;  2QKD A;  3I55 Z;  5IP7 I;  1VQ7 1;  1YUA A;  3D6W A;  1KQS Z;  4E31 A;  1QVF Z;  4NB9 A;  2R7Z I;  3CC7 Z;  3S1R I;  2VF1 A;  1X0T A;  4E2Y A;  4HH4 A;  1VQ9 1;  3I4N I;  1X3Z A;  3RZO I;  1RNI A;  3EER A;  4A3G I;  1M1K 1;  1WCM I;  2K5R A;  3CMA 1;  3CC2 1;  3HOV I;  5D1O B;  4Y7N I;  4RS4 A;  1KC8 2;  1TWC I;  1VQL 1;  3M3Y I;  2F4O A;  3GCF A;  3LUS A;  3S2D I;  1YUK A;  3G71 1;  4X6A I;  1KD1 2;  3CCE 1;  4Y52 I;  3CCS Z;  2V8J A;  2OOY B;  1VQ5 1;  2IZ3 A;  3CCU 1;  1YI2 Z;  3D9X A;  2M6N A;  1YIJ Z;  4MH4 A;  3J81 f;  3G6E 1;  3GTG I;  3HOZ I;  1LQL A;  2JUB A;  2QLV B;  3JAM f;  4MON A;  3Q87 A;  2Q4Z A;  1VQ6 1;  3CD6 Z;  4XX2 A;  1M90 1;  2OTJ 1;  4MRI A;  1TWF I;  1X3W A;  1W2B Z;  4NBA A;  2E2J I;  3BG0 B;  2JA6 I;  3MON A;  3CCR 1;  4QTU A;  2RT9 A;  3S15 I;  3J80 f;  3CXC Z;  3P5J B;  1USP A;  3G4S 1;  2NVY I;  2RIQ A;  2W03 A;  2R93 I;  1ML8 A;  2QA4 1;  2F4M A;  1YJN Z;  1VLA A;  1K8A 1;  1TWG I;  1S72 1;  2M48 A;  4S1T A;  5CM2 M;  4E2X A;  1VQO Z;  4BBS I;  4A3M I;  1YHQ Z;  1K73 2;  5A2Q b;  3GKQ A;  1TWH I;  2DE6 A;  2E2I I;  2EGT A;  3CCL Z;  2RPR A;  3FQQ A;  5IT9 f;  1I3Q I;  2JS4 A;  3HOW I;  3TDH B;  2ZAE B;  1Q82 1;  2O4H A;  4A3B I;  1W2B Y;  3KIH A;  3CCQ Z;  3I56 Z;  1Y1V S;  4BXX I;  3TE5 B;  3GTP I;  4DGL A;  3CXC Y;  3H0G I;  5C4J I;  3HOX I;  3I55 1;  2QR1 B;  5T6B A;  3GTM I;  1VQP 1;  2JMO A;  3K7A I;  1Q86 1;  2NVT I;  1TWA I;  2I3C A;  4MD9 A;  5C3E I;  1ZH1 A;  3VB9 A;  4CL1 A;  2QRE B;  2LFU A;  1NP6 A;  1VQ7 Z;  3GTQ I;  2HF1 A;  1S7M A;  2OTL 1;  4BBR I;  2BJO A;  1N8R 1;  2DE7 A;  3PO3 I;  1VQN Z;  4NBG A;  3MZK B;  3CCM 1;  2VUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...