1YHQZ

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yhqZ00
1YI2Z 1VQPZ 3CCM1 3CC2Z 1Q811 1M1K1 3CCEZ 1YHQ1 1K8A2 1W2BZ 3CC71 1JJ2Z 2QA41 1KC81 3OW2Y 1YIT1 1VQO1 1VQNZ 1KQSY 1Q861 3CCJ1 1N8R1 1YHQZ 1VQ71 1QVFY 3G6E1 3CC7Z 1VQ61 1YJNZ 3CCU1 1KD12 3CCLZ 2QA4Z 1M902 1YITZ 1VQOZ 1K8A1 3CC41 1VQL1 3CCJZ 3CPWY 3CCV1 1YIJ1 1VQ51 3I551 1Q7Y2 1YJ9Z 3CCUZ 3I561 1K9M2 3CMA1 1VQ8Z 1S721 1VQK1 3CCMZ 1VQM1 3CXCZ 3CC4Z 1VQLZ 2OTL1 2OTJ1 3CD61 1YIJZ 1VQ91 1KD11 3CME1 1M901 1NJI2 3I56Z 3CMAZ 1S72Z 1JJ2Y 2QEX1 1VQMZ 1QVGY 3G711 1Q7Y1 1VQ7Z 1K732 2OTJZ 3G6EZ 1VQP1 1VQ9Z 1K9M1 1VQ6Z 3CMEZ 3CCS1 3OW2Z 1YJW1 1KQSZ 1Q822 3G71Z 3CCR1 3CCVZ 1QVFZ 1NJI1 3G4S1 1VQ5Z 3I55Z 3CCSZ 3CCQ1 1VQ41 1W2BY 1Q812 1VQKZ 1M1K2 1YJWZ 1K731 1YJN1 1QVGZ 2OTLZ 3CCL1 3CCRZ 3CPWZ 3CD6Z 1YI21 3G4SZ 3CC21 3CXCY 1KC82 3CCE1 1Q821 3CCQZ 1VQ4Z 1Q862 2QEXZ 1N8R2 1YJ91 1VQ81 1VQN1
chains in the Genus database with same CATH superfamily
1VQPZ 4E30A 4NBAA 1WIIA 1Q811 3S17I 1K8A2 2W03A 3S1NI 3S16I 2RT9A 1KQSY 1YUKA 1WW9A 2VPZA 3TDHB 1N8R1 1VQ71 3IR7A 4A3BI 2GU2A 5IT9f 3CCU1 4NBGA 2JS4A 2RHBA 3P5JB 3I4MI 3NH8A 3H3VJ 4A3MI 3GTMS 3J80b 3CPWY 1YIJ1 3S2DI 4AYBA 3I561 3CMA1 1S721 3GKQA 3J7A4 2AYDA 3S14I 3JAMf 4HGZA 4Y7NI 3CD61 4RVHA 3CME1 5A2Qf 2F4MA 3GTKI 1NJI2 3PO3I 3GTPI 2QEX1 2LEXA 1RQFA 2JNYA 2O53A 1K732 2OTJZ 5C44I 1I50I 1VQ6Z 2VPXA 4NBDA 2I3CA 2IZ4A 4A3EI 2R92I 1ML8A 2VF1A 3OW2Z 2EGTA 1N2FA 1Y8CA 2E9HA 2JIPA 3VB9A 1Y1WI 1Z01A 3G71Z 3GTLI 3VTNA 5A2Qb 3I55Z 2NVTI 2E2JI 2VUMI 3CCSZ 2VPWA 1VQ41 4MONA 3VMGA 2M48A 2HF1A 1Z02A 2NVQI 1QVGZ 1TFIA 3CCL1 2KPIA 3CCRZ 1YI21 1SFOI 3G4SZ 1TWGI 1QXFA 5CM2M 3CCQZ 1AA6A 4XX2A 2G2KA 1YJ91 3VMIA 3S1QI 3H0GI 5LL6f 1VQ81 3CC2Z 2V8KA 1YHQ1 2OZKA 2JA8I 2QA41 3OW2Y 1VQO1 1VQNZ 2ZAEB 2RBLA 3T4NB 1Q861 4NBHA 1JWHC 3CCJ1 2BJOA 5C3EI 2IZ3A 3G6E1 2JR6A 3S2HI 3Q87A 5D1PA 1YJNZ 2F4OA 3HOUI 1M902 1K83I 3I07A 1K8A1 2JIRA 2IV2X 3I4NI 4RVFA 3J80f 4A93I 1VQ51 2B63I 3M4OI 1RO2A 4MD8A 2E2HI 1L1OC 3CCUZ 1K9M2 3CCMZ 1VQM1 3CXCZ 4MH4A 1QYPA 4NBBA 2OTL1 2KI7B 3M3YI 1YIJZ 1VQ91 2V8IA 4HH4A 1P9NA 2DE6A 4DK1A 2OOYB 3I56Z 3CMAZ 1S72Z 2K5RA 1FDIA 3HKZA 3PO2I 3NH5A 4RVGA 4NBEA 3GTQI 1VQP1 4QTTA 3J81b 3CMEZ 4BY1I 3FKII 2Q4ZA 1QF8A 4MRIA 3F3PC 2V8JA 4X6AI 1TWHI 3CCVZ 1QVFZ 1NJI1 4BXXI 1USPB 2RPRA 2VPYA 3IFUA 1S7MA 3NH4A 1VQKZ 1M1K2 1K731 2M6NA 1USPA 4S1TA 1SIWA 3CXCY 4NBCA 1KC82 3BG0B 3CCE1 1VQ4Z 2PK7A 1X3WA 1YI2Z 4HGYA 1FDOA 4E32A 1LQLA 4BBSI 1Y1VI 1X0TA 3FQMA 1W2BZ 5C4JI 4NB8A 3CC71 3GTOI 1JJ2Z 4E33A 3HOYI 3S1MI 3HOWI 2V45A 4A3JI 2LIYA 1YIT1 2J6AA 2WAQA 4A3FI 2DE5A 1YHQZ 1R9TI 2JIMA 3PO3S 1QVFY 4DQYB 5FLXb 3MZLB 1ZB8A 1VQ61 2Q51A 1KD12 3NFZA 2QA4Z 4A3DI 4EWCA 1VQOZ 3CC41 2V3VA 1VQL1 3NDIA 1WCMI 3CCJZ 3GTGI 3I551 4E2WA 1Q7Y2 4MXUA 4E2YA 3GTJI 3MZKB 1NUIA 4NFRA 2W04A 2QRCB 2QRDB 2NVXI 3BG1B 1VLAA 1M901 5T64A 2VUGA 1I3QI 3F3FC 3D9XA 4RS4A 2H85A 2JIQA 1JJ2Y 1VQMZ 1QVGY 3KIFA 1VQ7Z 2NAPA 4DGLA 2R7ZI 1WZNA 3S15I 1VQ9Z 1K9M1 3GTMI 5AN9F 3J81f 1ZH1A 4A3GI 2QR1B 5FLMI 1YJW1 2NVYI 1Q822 3K7AI 2OOXB 1KRLA 2R6MA 3IX0A 1TWFI 3EEDA 1Q812 1YJN1 4A3II 4MD7A 2HU9A 1Q16A 3CD6Z 3QWUA 4BBRI 2P3YA 3KIHA 2PMZA 4NOZA 3D6WA 2QEXZ 1N8R2 3S1RI 2E7ZA 3HOXI 2PM9A 3CCM1 3MONA 3RZDI 4RVDA 1M1K1 3CCEZ 2LFUA 5IP7I 4NH1C 2E2II 2JA5I 1RO4A 1TWCI 2JUBA 3TE5B 4Y52I 2YADA 3RZOI 1KC81 2Y0SA 1RLYA 1WJ2A 3LUSA 2JMOA 3CC7Z 5IT9b 5FLXf 3CQZI 2AKLA 3CCLZ 4RV9A 5T67A 5T6BA 1TWAI 1PFTA 2RIQA 1YITZ 2K3RA 1X3ZA 4NB9A 4CL1A 5C4XI 2P28A 2QKDA 3CCV1 1DL6A 3FQQA 3HOVI 2WB1A 1I6HI 1YJ9Z 3D2LA 3HOZI 1VQ8Z 2YU9I 1VQK1 3JAMb 3CC4Z 5IP9I 1VQLZ 4MD9A 2OTJ1 2QLVB 1KD11 3GCFA 4QTUA 3VMHA 3NDJA 4TNUA 1NP6A 4A3CI 3G711 1Q7Y1 1RO0A 3G6EZ 3CCS1 2JA6I 4NBFA 1KQSZ 2GTHA 1YUAA 1Y1VS 3CCR1 3G4S1 1VQ5Z 1ZB9A 3CCQ1 1RNIA 1W2BY 3EERA 4E2ZA 1YJWZ 4E31A 2JIOA 2OTLZ 3ESWA 2O4HA 3CPWZ 5D1OB 4E2XA 3CC21 2JA7I 4BY7I 1Z03A 1Q821 4A3LI 2QREB 4A3KI 1Q862 2DE7A 2GTIA 3IF8A 2R93I 3U50C 5D1OA 1VQN1
chains in the Genus database with same CATH topology
1VQPZ 4E30A 4NBAA 1WIIA 1Q811 3S17I 1K8A2 2W03A 3S1NI 3S16I 2RT9A 1KQSY 1YUKA 1WW9A 3TDHB 1N8R1 1VQ71 4A3BI 2GU2A 5IT9f 3CCU1 4NBGA 2JS4A 2RHBA 3P5JB 3I4MI 3NH8A 3H3VJ 4A3MI 3GTMS 3J80b 3CPWY 1YIJ1 3S2DI 4AYBA 3I561 3CMA1 1S721 3GKQA 3J7A4 3S14I 3JAMf 4HGZA 4Y7NI 3CD61 4RVHA 3CME1 5A2Qf 2F4MA 3GTKI 1NJI2 3PO3I 3GTPI 2QEX1 1RQFA 2JNYA 2O53A 1K732 2OTJZ 5C44I 1I50I 1VQ6Z 4NBDA 2I3CA 2IZ4A 4A3EI 2R92I 1ML8A 2VF1A 3OW2Z 2EGTA 1N2FA 2E9HA 3VB9A 1Y1WI 1Z01A 3G71Z 3GTLI 3VTNA 5A2Qb 3I55Z 2NVTI 2E2JI 2VUMI 3CCSZ 1VQ41 4MONA 3VMGA 2M48A 2HF1A 1Z02A 2NVQI 1QVGZ 1TFIA 3CCL1 2KPIA 3CCRZ 1YI21 1SFOI 3G4SZ 1TWGI 5CM2M 3CCQZ 4XX2A 2G2KA 1YJ91 3VMIA 3S1QI 3H0GI 5LL6f 1VQ81 3CC2Z 2V8KA 1YHQ1 2OZKA 2JA8I 2QA41 3OW2Y 1VQO1 1VQNZ 2ZAEB 2RBLA 3T4NB 1Q861 4NBHA 1JWHC 3CCJ1 2BJOA 5C3EI 2IZ3A 3G6E1 2JR6A 3S2HI 3Q87A 5D1PA 1YJNZ 2F4OA 3HOUI 1M902 1K83I 3I07A 1K8A1 3I4NI 4RVFA 3J80f 4A93I 1VQ51 2B63I 3M4OI 1RO2A 4MD8A 2E2HI 1L1OC 3CCUZ 1K9M2 3CCMZ 1VQM1 3CXCZ 4MH4A 1QYPA 4NBBA 2OTL1 2KI7B 3M3YI 1YIJZ 1VQ91 2V8IA 4HH4A 1P9NA 2DE6A 4DK1A 2OOYB 3I56Z 3CMAZ 1S72Z 2K5RA 3HKZA 3PO2I 3NH5A 4RVGA 4NBEA 3GTQI 1VQP1 4QTTA 3J81b 3CMEZ 4BY1I 3FKII 2Q4ZA 1QF8A 4MRIA 3F3PC 2V8JA 4X6AI 1TWHI 3CCVZ 1QVFZ 1NJI1 4BXXI 1USPB 2RPRA 3IFUA 1S7MA 3NH4A 1VQKZ 1M1K2 1K731 2M6NA 1USPA 4S1TA 3CXCY 4NBCA 1KC82 3BG0B 3CCE1 1VQ4Z 2PK7A 1X3WA 1YI2Z 4HGYA 4E32A 1LQLA 4BBSI 1Y1VI 1X0TA 3FQMA 1W2BZ 5C4JI 4NB8A 3CC71 3GTOI 1JJ2Z 4E33A 3HOYI 3S1MI 3HOWI 4A3JI 2LIYA 1YIT1 2J6AA 2WAQA 4A3FI 2DE5A 1YHQZ 1R9TI 3PO3S 1QVFY 4DQYB 5FLXb 3MZLB 1ZB8A 1VQ61 2Q51A 1KD12 3NFZA 2QA4Z 4A3DI 4EWCA 1VQOZ 3CC41 1VQL1 3NDIA 1WCMI 3CCJZ 3GTGI 3I551 4E2WA 1Q7Y2 4MXUA 4E2YA 3GTJI 3MZKB 1NUIA 4NFRA 2W04A 2QRCB 2QRDB 2NVXI 3BG1B 1VLAA 1M901 5T64A 2VUGA 1I3QI 3F3FC 3D9XA 4RS4A 2H85A 1JJ2Y 1VQMZ 1QVGY 3KIFA 1VQ7Z 4DGLA 2R7ZI 3S15I 1VQ9Z 1K9M1 3GTMI 5AN9F 3J81f 1ZH1A 4A3GI 2QR1B 5FLMI 1YJW1 2NVYI 1Q822 3K7AI 2OOXB 1KRLA 2R6MA 3IX0A 1TWFI 3EEDA 1Q812 1YJN1 4A3II 4MD7A 2HU9A 3CD6Z 3QWUA 4BBRI 2P3YA 3KIHA 2PMZA 4NOZA 3D6WA 2QEXZ 1N8R2 3S1RI 3HOXI 2PM9A 3CCM1 3MONA 3RZDI 4RVDA 1M1K1 3CCEZ 2LFUA 5IP7I 4NH1C 2E2II 2JA5I 1RO4A 1TWCI 2JUBA 3TE5B 4Y52I 2YADA 3RZOI 1KC81 2Y0SA 1RLYA 3LUSA 2JMOA 3CC7Z 5IT9b 5FLXf 3CQZI 2AKLA 3CCLZ 4RV9A 5T67A 5T6BA 1TWAI 1PFTA 2RIQA 1YITZ 2K3RA 1X3ZA 4NB9A 4CL1A 5C4XI 2P28A 2QKDA 3CCV1 1DL6A 3FQQA 3HOVI 2WB1A 1I6HI 1YJ9Z 3HOZI 1VQ8Z 2YU9I 1VQK1 3JAMb 3CC4Z 5IP9I 1VQLZ 4MD9A 2OTJ1 2QLVB 1KD11 3GCFA 4QTUA 3VMHA 3NDJA 4TNUA 1NP6A 4A3CI 3G711 1Q7Y1 1RO0A 3G6EZ 3CCS1 2JA6I 4NBFA 1KQSZ 2GTHA 1YUAA 1Y1VS 3CCR1 3G4S1 1VQ5Z 1ZB9A 3CCQ1 1RNIA 1W2BY 3EERA 4E2ZA 1YJWZ 4E31A 2OTLZ 3ESWA 2O4HA 3CPWZ 5D1OB 4E2XA 3CC21 2JA7I 4BY7I 1Z03A 1Q821 4A3LI 2QREB 4A3KI 1Q862 2DE7A 2GTIA 3IF8A 2R93I 3U50C 5D1OA 1VQN1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 Z;  1VQP Z;  3CCM 1;  3CC2 Z;  1Q81 1;  1M1K 1;  3CCE Z;  1YHQ 1;  1K8A 2;  1W2B Z;  3CC7 1;  1JJ2 Z;  2QA4 1;  1KC8 1;  3OW2 Y;  1YIT 1;  1VQO 1;  1VQN Z;  1KQS Y;  1Q86 1;  3CCJ 1;  1N8R 1;  1YHQ Z;  1VQ7 1;  1QVF Y;  3G6E 1;  3CC7 Z;  1VQ6 1;  1YJN Z;  3CCU 1;  1KD1 2;  3CCL Z;  2QA4 Z;  1M90 2;  1YIT Z;  1VQO Z;  1K8A 1;  3CC4 1;  1VQL 1;  3CCJ Z;  3CPW Y;  3CCV 1;  1YIJ 1;  1VQ5 1;  3I55 1;  1Q7Y 2;  1YJ9 Z;  3CCU Z;  3I56 1;  1K9M 2;  3CMA 1;  1VQ8 Z;  1S72 1;  1VQK 1;  3CCM Z;  1VQM 1;  3CXC Z;  3CC4 Z;  1VQL Z;  2OTL 1;  2OTJ 1;  3CD6 1;  1YIJ Z;  1VQ9 1;  1KD1 1;  3CME 1;  1M90 1;  1NJI 2;  3I56 Z;  3CMA Z;  1S72 Z;  1JJ2 Y;  2QEX 1;  1VQM Z;  1QVG Y;  3G71 1;  1Q7Y 1;  1VQ7 Z;  1K73 2;  2OTJ Z;  3G6E Z;  1VQP 1;  1VQ9 Z;  1K9M 1;  1VQ6 Z;  3CME Z;  3CCS 1;  3OW2 Z;  1YJW 1;  1KQS Z;  1Q82 2;  3G71 Z;  3CCR 1;  3CCV Z;  1QVF Z;  1NJI 1;  3G4S 1;  1VQ5 Z;  3I55 Z;  3CCS Z;  3CCQ 1;  1VQ4 1;  1W2B Y;  1Q81 2;  1VQK Z;  1M1K 2;  1YJW Z;  1K73 1;  1YJN 1;  1QVG Z;  2OTL Z;  3CCL 1;  3CCR Z;  3CPW Z;  3CD6 Z;  1YI2 1;  3G4S Z;  3CC2 1;  3CXC Y;  1KC8 2;  3CCE 1;  1Q82 1;  3CCQ Z;  1VQ4 Z;  1Q86 2;  2QEX Z;  1N8R 2;  1YJ9 1;  1VQ8 1;  1VQN 1; 
#chains in the Genus database with same CATH topology
 1VQP Z;  4E30 A;  4NBA A;  1WII A;  1Q81 1;  3S17 I;  1K8A 2;  2W03 A;  3S1N I;  3S16 I;  2RT9 A;  1KQS Y;  1YUK A;  1WW9 A;  2VPZ A;  3TDH B;  1N8R 1;  1VQ7 1;  3IR7 A;  4A3B I;  2GU2 A;  5IT9 f;  3CCU 1;  4NBG A;  2JS4 A;  2RHB A;  3P5J B;  3I4M I;  3NH8 A;  3H3V J;  4A3M I;  3GTM S;  3J80 b;  3CPW Y;  1YIJ 1;  3S2D I;  4AYB A;  3I56 1;  3CMA 1;  1S72 1;  3GKQ A;  3J7A 4;  2AYD A;  3S14 I;  3JAM f;  4HGZ A;  4Y7N I;  3CD6 1;  4RVH A;  3CME 1;  5A2Q f;  2F4M A;  3GTK I;  1NJI 2;  3PO3 I;  3GTP I;  2QEX 1;  2LEX A;  1RQF A;  2JNY A;  2O53 A;  1K73 2;  2OTJ Z;  5C44 I;  1I50 I;  1VQ6 Z;  2VPX A;  4NBD A;  2I3C A;  2IZ4 A;  4A3E I;  2R92 I;  1ML8 A;  2VF1 A;  3OW2 Z;  2EGT A;  1N2F A;  1Y8C A;  2E9H A;  2JIP A;  3VB9 A;  1Y1W I;  1Z01 A;  3G71 Z;  3GTL I;  3VTN A;  5A2Q b;  3I55 Z;  2NVT I;  2E2J I;  2VUM I;  3CCS Z;  2VPW A;  1VQ4 1;  4MON A;  3VMG A;  2M48 A;  2HF1 A;  1Z02 A;  2NVQ I;  1QVG Z;  1TFI A;  3CCL 1;  2KPI A;  3CCR Z;  1YI2 1;  1SFO I;  3G4S Z;  1TWG I;  1QXF A;  5CM2 M;  3CCQ Z;  1AA6 A;  4XX2 A;  2G2K A;  1YJ9 1;  3VMI A;  3S1Q I;  3H0G I;  5LL6 f;  1VQ8 1;  3CC2 Z;  2V8K A;  1YHQ 1;  2OZK A;  2JA8 I;  2QA4 1;  3OW2 Y;  1VQO 1;  1VQN Z;  2ZAE B;  2RBL A;  3T4N B;  1Q86 1;  4NBH A;  1JWH C;  3CCJ 1;  2BJO A;  5C3E I;  2IZ3 A;  3G6E 1;  2JR6 A;  3S2H I;  3Q87 A;  5D1P A;  1YJN Z;  2F4O A;  3HOU I;  1M90 2;  1K83 I;  3I07 A;  1K8A 1;  2JIR A;  2IV2 X;  3I4N I;  4RVF A;  3J80 f;  4A93 I;  1VQ5 1;  2B63 I;  3M4O I;  1RO2 A;  4MD8 A;  2E2H I;  1L1O C;  3CCU Z;  1K9M 2;  3CCM Z;  1VQM 1;  3CXC Z;  4MH4 A;  1QYP A;  4NBB A;  2OTL 1;  2KI7 B;  3M3Y I;  1YIJ Z;  1VQ9 1;  2V8I A;  4HH4 A;  1P9N A;  2DE6 A;  4DK1 A;  2OOY B;  3I56 Z;  3CMA Z;  1S72 Z;  2K5R A;  1FDI A;  3HKZ A;  3PO2 I;  3NH5 A;  4RVG A;  4NBE A;  3GTQ I;  1VQP 1;  4QTT A;  3J81 b;  3CME Z;  4BY1 I;  3FKI I;  2Q4Z A;  1QF8 A;  4MRI A;  3F3P C;  2V8J A;  4X6A I;  1TWH I;  3CCV Z;  1QVF Z;  1NJI 1;  4BXX I;  1USP B;  2RPR A;  2VPY A;  3IFU A;  1S7M A;  3NH4 A;  1VQK Z;  1M1K 2;  1K73 1;  2M6N A;  1USP A;  4S1T A;  1SIW A;  3CXC Y;  4NBC A;  1KC8 2;  3BG0 B;  3CCE 1;  1VQ4 Z;  2PK7 A;  1X3W A;  1YI2 Z;  4HGY A;  1FDO A;  4E32 A;  1LQL A;  4BBS I;  1Y1V I;  1X0T A;  3FQM A;  1W2B Z;  5C4J I;  4NB8 A;  3CC7 1;  3GTO I;  1JJ2 Z;  4E33 A;  3HOY I;  3S1M I;  3HOW I;  2V45 A;  4A3J I;  2LIY A;  1YIT 1;  2J6A A;  2WAQ A;  4A3F I;  2DE5 A;  1YHQ Z;  1R9T I;  2JIM A;  3PO3 S;  1QVF Y;  4DQY B;  5FLX b;  3MZL B;  1ZB8 A;  1VQ6 1;  2Q51 A;  1KD1 2;  3NFZ A;  2QA4 Z;  4A3D I;  4EWC A;  1VQO Z;  3CC4 1;  2V3V A;  1VQL 1;  3NDI A;  1WCM I;  3CCJ Z;  3GTG I;  3I55 1;  4E2W A;  1Q7Y 2;  4MXU A;  4E2Y A;  3GTJ I;  3MZK B;  1NUI A;  4NFR A;  2W04 A;  2QRC B;  2QRD B;  2NVX I;  3BG1 B;  1VLA A;  1M90 1;  5T64 A;  2VUG A;  1I3Q I;  3F3F C;  3D9X A;  4RS4 A;  2H85 A;  2JIQ A;  1JJ2 Y;  1VQM Z;  1QVG Y;  3KIF A;  1VQ7 Z;  2NAP A;  4DGL A;  2R7Z I;  1WZN A;  3S15 I;  1VQ9 Z;  1K9M 1;  3GTM I;  5AN9 F;  3J81 f;  1ZH1 A;  4A3G I;  2QR1 B;  5FLM I;  1YJW 1;  2NVY I;  1Q82 2;  3K7A I;  2OOX B;  1KRL A;  2R6M A;  3IX0 A;  1TWF I;  3EED A;  1Q81 2;  1YJN 1;  4A3I I;  4MD7 A;  2HU9 A;  1Q16 A;  3CD6 Z;  3QWU A;  4BBR I;  2P3Y A;  3KIH A;  2PMZ A;  4NOZ A;  3D6W A;  2QEX Z;  1N8R 2;  3S1R I;  2E7Z A;  3HOX I;  2PM9 A;  3CCM 1;  3MON A;  3RZD I;  4RVD A;  1M1K 1;  3CCE Z;  2LFU A;  5IP7 I;  4NH1 C;  2E2I I;  2JA5 I;  1RO4 A;  1TWC I;  2JUB A;  3TE5 B;  4Y52 I;  2YAD A;  3RZO I;  1KC8 1;  2Y0S A;  1RLY A;  1WJ2 A;  3LUS A;  2JMO A;  3CC7 Z;  5IT9 b;  5FLX f;  3CQZ I;  2AKL A;  3CCL Z;  4RV9 A;  5T67 A;  5T6B A;  1TWA I;  1PFT A;  2RIQ A;  1YIT Z;  2K3R A;  1X3Z A;  4NB9 A;  4CL1 A;  5C4X I;  2P28 A;  2QKD A;  3CCV 1;  1DL6 A;  3FQQ A;  3HOV I;  2WB1 A;  1I6H I;  1YJ9 Z;  3D2L A;  3HOZ I;  1VQ8 Z;  2YU9 I;  1VQK 1;  3JAM b;  3CC4 Z;  5IP9 I;  1VQL Z;  4MD9 A;  2OTJ 1;  2QLV B;  1KD1 1;  3GCF A;  4QTU A;  3VMH A;  3NDJ A;  4TNU A;  1NP6 A;  4A3C I;  3G71 1;  1Q7Y 1;  1RO0 A;  3G6E Z;  3CCS 1;  2JA6 I;  4NBF A;  1KQS Z;  2GTH A;  1YUA A;  1Y1V S;  3CCR 1;  3G4S 1;  1VQ5 Z;  1ZB9 A;  3CCQ 1;  1RNI A;  1W2B Y;  3EER A;  4E2Z A;  1YJW Z;  4E31 A;  2JIO A;  2OTL Z;  3ESW A;  2O4H A;  3CPW Z;  5D1O B;  4E2X A;  3CC2 1;  2JA7 I;  4BY7 I;  1Z03 A;  1Q82 1;  4A3L I;  2QRE B;  4A3K I;  1Q86 2;  2DE7 A;  2GTI A;  3IF8 A;  2R93 I;  3U50 C;  5D1O A;  1VQN 1; 
#chains in the Genus database with same CATH homology
 1VQP Z;  4E30 A;  4NBA A;  1WII A;  1Q81 1;  3S17 I;  1K8A 2;  2W03 A;  3S1N I;  3S16 I;  2RT9 A;  1KQS Y;  1YUK A;  1WW9 A;  3TDH B;  1N8R 1;  1VQ7 1;  4A3B I;  2GU2 A;  5IT9 f;  3CCU 1;  4NBG A;  2JS4 A;  2RHB A;  3P5J B;  3I4M I;  3NH8 A;  3H3V J;  4A3M I;  3GTM S;  3J80 b;  3CPW Y;  1YIJ 1;  3S2D I;  4AYB A;  3I56 1;  3CMA 1;  1S72 1;  3GKQ A;  3J7A 4;  3S14 I;  3JAM f;  4HGZ A;  4Y7N I;  3CD6 1;  4RVH A;  3CME 1;  5A2Q f;  2F4M A;  3GTK I;  1NJI 2;  3PO3 I;  3GTP I;  2QEX 1;  1RQF A;  2JNY A;  2O53 A;  1K73 2;  2OTJ Z;  5C44 I;  1I50 I;  1VQ6 Z;  4NBD A;  2I3C A;  2IZ4 A;  4A3E I;  2R92 I;  1ML8 A;  2VF1 A;  3OW2 Z;  2EGT A;  1N2F A;  2E9H A;  3VB9 A;  1Y1W I;  1Z01 A;  3G71 Z;  3GTL I;  3VTN A;  5A2Q b;  3I55 Z;  2NVT I;  2E2J I;  2VUM I;  3CCS Z;  1VQ4 1;  4MON A;  3VMG A;  2M48 A;  2HF1 A;  1Z02 A;  2NVQ I;  1QVG Z;  1TFI A;  3CCL 1;  2KPI A;  3CCR Z;  1YI2 1;  1SFO I;  3G4S Z;  1TWG I;  5CM2 M;  3CCQ Z;  4XX2 A;  2G2K A;  1YJ9 1;  3VMI A;  3S1Q I;  3H0G I;  5LL6 f;  1VQ8 1;  3CC2 Z;  2V8K A;  1YHQ 1;  2OZK A;  2JA8 I;  2QA4 1;  3OW2 Y;  1VQO 1;  1VQN Z;  2ZAE B;  2RBL A;  3T4N B;  1Q86 1;  4NBH A;  1JWH C;  3CCJ 1;  2BJO A;  5C3E I;  2IZ3 A;  3G6E 1;  2JR6 A;  3S2H I;  3Q87 A;  5D1P A;  1YJN Z;  2F4O A;  3HOU I;  1M90 2;  1K83 I;  3I07 A;  1K8A 1;  3I4N I;  4RVF A;  3J80 f;  4A93 I;  1VQ5 1;  2B63 I;  3M4O I;  1RO2 A;  4MD8 A;  2E2H I;  1L1O C;  3CCU Z;  1K9M 2;  3CCM Z;  1VQM 1;  3CXC Z;  4MH4 A;  1QYP A;  4NBB A;  2OTL 1;  2KI7 B;  3M3Y I;  1YIJ Z;  1VQ9 1;  2V8I A;  4HH4 A;  1P9N A;  2DE6 A;  4DK1 A;  2OOY B;  3I56 Z;  3CMA Z;  1S72 Z;  2K5R A;  3HKZ A;  3PO2 I;  3NH5 A;  4RVG A;  4NBE A;  3GTQ I;  1VQP 1;  4QTT A;  3J81 b;  3CME Z;  4BY1 I;  3FKI I;  2Q4Z A;  1QF8 A;  4MRI A;  3F3P C;  2V8J A;  4X6A I;  1TWH I;  3CCV Z;  1QVF Z;  1NJI 1;  4BXX I;  1USP B;  2RPR A;  3IFU A;  1S7M A;  3NH4 A;  1VQK Z;  1M1K 2;  1K73 1;  2M6N A;  1USP A;  4S1T A;  3CXC Y;  4NBC A;  1KC8 2;  3BG0 B;  3CCE 1;  1VQ4 Z;  2PK7 A;  1X3W A;  1YI2 Z;  4HGY A;  4E32 A;  1LQL A;  4BBS I;  1Y1V I;  1X0T A;  3FQM A;  1W2B Z;  5C4J I;  4NB8 A;  3CC7 1;  3GTO I;  1JJ2 Z;  4E33 A;  3HOY I;  3S1M I;  3HOW I;  4A3J I;  2LIY A;  1YIT 1;  2J6A A;  2WAQ A;  4A3F I;  2DE5 A;  1YHQ Z;  1R9T I;  3PO3 S;  1QVF Y;  4DQY B;  5FLX b;  3MZL B;  1ZB8 A;  1VQ6 1;  2Q51 A;  1KD1 2;  3NFZ A;  2QA4 Z;  4A3D I;  4EWC A;  1VQO Z;  3CC4 1;  1VQL 1;  3NDI A;  1WCM I;  3CCJ Z;  3GTG I;  3I55 1;  4E2W A;  1Q7Y 2;  4MXU A;  4E2Y A;  3GTJ I;  3MZK B;  1NUI A;  4NFR A;  2W04 A;  2QRC B;  2QRD B;  2NVX I;  3BG1 B;  1VLA A;  1M90 1;  5T64 A;  2VUG A;  1I3Q I;  3F3F C;  3D9X A;  4RS4 A;  2H85 A;  1JJ2 Y;  1VQM Z;  1QVG Y;  3KIF A;  1VQ7 Z;  4DGL A;  2R7Z I;  3S15 I;  1VQ9 Z;  1K9M 1;  3GTM I;  5AN9 F;  3J81 f;  1ZH1 A;  4A3G I;  2QR1 B;  5FLM I;  1YJW 1;  2NVY I;  1Q82 2;  3K7A I;  2OOX B;  1KRL A;  2R6M A;  3IX0 A;  1TWF I;  3EED A;  1Q81 2;  1YJN 1;  4A3I I;  4MD7 A;  2HU9 A;  3CD6 Z;  3QWU A;  4BBR I;  2P3Y A;  3KIH A;  2PMZ A;  4NOZ A;  3D6W A;  2QEX Z;  1N8R 2;  3S1R I;  3HOX I;  2PM9 A;  3CCM 1;  3MON A;  3RZD I;  4RVD A;  1M1K 1;  3CCE Z;  2LFU A;  5IP7 I;  4NH1 C;  2E2I I;  2JA5 I;  1RO4 A;  1TWC I;  2JUB A;  3TE5 B;  4Y52 I;  2YAD A;  3RZO I;  1KC8 1;  2Y0S A;  1RLY A;  3LUS A;  2JMO A;  3CC7 Z;  5IT9 b;  5FLX f;  3CQZ I;  2AKL A;  3CCL Z;  4RV9 A;  5T67 A;  5T6B A;  1TWA I;  1PFT A;  2RIQ A;  1YIT Z;  2K3R A;  1X3Z A;  4NB9 A;  4CL1 A;  5C4X I;  2P28 A;  2QKD A;  3CCV 1;  1DL6 A;  3FQQ A;  3HOV I;  2WB1 A;  1I6H I;  1YJ9 Z;  3HOZ I;  1VQ8 Z;  2YU9 I;  1VQK 1;  3JAM b;  3CC4 Z;  5IP9 I;  1VQL Z;  4MD9 A;  2OTJ 1;  2QLV B;  1KD1 1;  3GCF A;  4QTU A;  3VMH A;  3NDJ A;  4TNU A;  1NP6 A;  4A3C I;  3G71 1;  1Q7Y 1;  1RO0 A;  3G6E Z;  3CCS 1;  2JA6 I;  4NBF A;  1KQS Z;  2GTH A;  1YUA A;  1Y1V S;  3CCR 1;  3G4S 1;  1VQ5 Z;  1ZB9 A;  3CCQ 1;  1RNI A;  1W2B Y;  3EER A;  4E2Z A;  1YJW Z;  4E31 A;  2OTL Z;  3ESW A;  2O4H A;  3CPW Z;  5D1O B;  4E2X A;  3CC2 1;  2JA7 I;  4BY7 I;  1Z03 A;  1Q82 1;  4A3L I;  2QRE B;  4A3K I;  1Q86 2;  2DE7 A;  2GTI A;  3IF8 A;  2R93 I;  3U50 C;  5D1O A;  1VQN 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...