1YHQZ

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
b'RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yhqZ00
1M1K1 3OW2Z 1KD11 1VQ6Z 3CCM1 3CCL1 3CCR1 3G6EZ 3CC41 3CCS1 1Q862 3G711 1Q821 1KQSZ 1Q811 1VQKZ 1VQNZ 3CCU1 1K8A1 3I561 1VQ71 3OW2Y 2QA41 3I551 1YJ91 1M902 3CCQ1 1VQ51 1YIT1 3CCVZ 3CME1 1Q7Y2 1VQ9Z 1KQSY 1S72Z 1NJI1 1YJNZ 2OTJZ 1YIJ1 3CC21 3G4SZ 3CCE1 3CCJZ 1KC81 3CC7Z 1QVFZ 1VQ61 3CMAZ 1VQ4Z 2OTLZ 1Q861 3G6E1 1VQLZ 1JJ2Z 3CPWZ 1K9M2 1VQPZ 2QEXZ 1Q822 1VQK1 1YHQZ 1K732 1VQN1 1YJWZ 1VQ8Z 1QVFY 1W2BZ 1M901 1K8A2 1VQOZ 1VQMZ 1JJ2Y 1N8R2 3CPWY 1QVGZ 1YI2Z 3CCV1 1VQ91 1S721 1YJN1 1W2BY 2OTJ1 3CCMZ 3CCRZ 3CCLZ 1M1K2 3CC4Z 1KD12 3CCSZ 3G4S1 3CCJ1 3CD6Z 3G71Z 1QVGY 3CC71 1KC82 3CXCZ 3CCUZ 1Q812 2OTL1 1VQ41 3I56Z 3CMA1 1VQ7Z 1VQL1 2QA4Z 1K9M1 3I55Z 1YJ9Z 3CCQZ 3CD61 1VQ5Z 1VQP1 1Q7Y1 2QEX1 1YITZ 3CMEZ 1K731 1YHQ1 1YJW1 1VQ81 3CXCY 1NJI2 1N8R1 1VQO1 1VQM1 1YIJZ 3CC2Z 1YI21 3CCEZ
chains in the Genus database with same CATH superfamily
2JNYA 4NBFA 1KD11 4BBRI 4NOZA 3G6EZ 3QWUA 2NVXI 1Q821 4NBDA 5LL6f 1VQKZ 2F4OA 1VQ71 2IZ3A 3I551 2QRDB 1M902 5C3EI 2NVQI 1VQ51 3GTJI 3CCVZ 1Q7Y2 2VPWA 4QTTA 1S72Z 2V45A 2DE7A 1YJNZ 1Z02A 2E7ZA 3MZKB 3CC21 3CCE1 3GTPI 2WB1A 2IV2X 1I3QI 5IT9f 2AYDA 1I6HI 1VQ61 1WJ2A 1VQLZ 2V8JA 1K9M2 2QEXZ 3FQQA 3S15I 2V3VA 1Q822 4MD7A 5A2Qf 4E32A 1K732 3GTKI 1QXFA 2QR1B 4A3JI 2JS4A 2JIPA 1JJ2Y 4BXXI 1N8R2 1VLAA 3VB9A 1YI2Z 2OOXB 2K3RA 2R7ZI 4NH1C 1ZB8A 4XX2A 3CCLZ 3CC4Z 3CD6Z 1TWAI 2RIQA 3GCFA 4DK1A 1K83I 3J81f 3CMA1 1TWGI 1FDOA 3CCQZ 3CD61 1VQP1 3PO2I 2OOYB 1WCMI 2LIYA 2QLVB 1VQ81 2G2KA 3LUSA 2JMOA 3NH4A 1VQO1 1VQM1 3MONA 2OZKA 1WIIA 1R9TI 3S17I 3D9XA 3NDJA 2JIQA 5FLMI 5D1OB 1L1OC 3NDIA 1USPB 1Y1VI 2R6MA 3CCM1 2JUBA 3CCS1 1P9NA 4RVFA 3G711 4E2XA 4HGYA 1Y1WI 5CM2M 5IT9b 2V8KA 3CCU1 1ML8A 4CL1A 1YUAA 3I561 1YJ91 3IR7A 2E9HA 3CME1 1VQ9Z 4HGZA 1NJI1 5C4JI 3FKII 3TDHB 3EEDA 2OTJZ 2JIOA 4MONA 2M48A 3HOUI 2PMZA 2RT9A 3FQMA 1KC81 3JAMf 3VMHA 1JWHC 5T6BA 1Q861 3G6E1 2EGTA 1JJ2Z 2DE6A 1S7MA 1Z01A 2O4HA 2QREB 5C44I 4NBEA 3GTQI 3RZOI 1VQK1 4BY1I 1RLYA 2KPIA 3BG1B 2NAPA 4RVGA 3T4NB 2AKLA 3J81b 4A3BI 2ZAEB 4A3II 3CPWY 3ESWA 3U50C 3CCV1 2Q4ZA 2PK7A 1S721 2Q51A 5IP7I 4E30A 1YJN1 2WAQA 2IZ4A 3K7AI 2JA6I 3S1MI 1NUIA 3CCRZ 4HH4A 2E2JI 1KD12 4A3LI 3HOWI 3TE5B 1QVGY 3S2DI 2QKDA 4A3MI 1KC82 1Y1VS 1VQL1 2QA4Z 3H3VJ 4MD8A 4RVDA 3D6WA 2QEX1 1YITZ 2JA5I 2NVTI 3Q87A 5FLXf 4S1TA 3S14I 3CXCY 3EERA 1YIJZ 2I3CA 3VTNA 2P28A 1YI21 3IFUA 4E33A 2VPZA 4A3CI 1M1K1 1LQLA 3RZDI 2VF1A 3CCL1 3CC41 3NH8A 3S1RI 4MH4A 3S1NI 1Q811 2R92I 1VQNZ 3J80f 1K8A1 3JAMb 2JR6A 2GTIA 5C4XI 3OW2Y 4A3FI 3CCQ1 2VPXA 1KQSY 3HOVI 2BJOA 4E31A 3J7A4 3GTMI 1N2FA 2H85A 1FDIA 2DE5A 1ZB9A 3G4SZ 4BY7I 4Y7NI 1DL6A 3CCJZ 4E2ZA 2LFUA 4A3DI 2E2II 4X6AI 3CC7Z 4E2YA 2OTLZ 1VQ4Z 1RO4A 3CPWZ 3I4MI 3KIFA 3S16I 3H0GI 2NVYI 3BG0B 1YHQZ 1YJWZ 2JIRA 4TNUA 1QVFY 2JA7I 5A2Qb 1M901 1K8A2 2PM9A 1PFTA 1QVGZ 4BBSI 1VQ91 2W04A 2VUGA 4NBHA 1X0TA 2R93I 1W2BY 3HOZI 2OTJ1 3HKZA 4E2WA 1TWHI 4MXUA 4QTUA 3HOXI 2RPRA 4Y52I 2VUMI 4NBCA 2JA8I 3CXCZ 3PO3I 1QF8A 1QYPA 1VQ7Z 2QRCB 2HU9A 1K9M1 3I55Z 2RBLA 4NFRA 3VMIA 3MZLB 1VQ5Z 1K731 3S1QI 4DGLA 3M3YI 3J80b 1NJI2 1N8R1 2LEXA 2B63I 2GTHA 3I4NI 3IX0A 3CC2Z 2W03A 2Y0SA 3CCEZ 3D2LA 1AA6A 2VPYA 1X3WA 3OW2Z 1VQ6Z 3CCR1 3GTMS 4A3KI 1Q862 2KI7B 3GKQA 1KQSZ 4DQYB 1SIWA 2QA41 1X3ZA 3M4OI 1YIT1 4NBAA 5AN9F 3F3PC 1TWFI 4RS4A 1Q16A 3KIHA 1SFOI 4MRIA 3P5JB 1YIJ1 1YUKA 5D1PA 1WZNA 1TFIA 1RO2A 1QVFZ 5T64A 3IF8A 1WW9A 2YU9I 4NBGA 3GTOI 3CMAZ 3CQZI 1ZH1A 5D1OA 1VQPZ 2O53A 4RVHA 1NP6A 1USPA 1VQN1 1VQ8Z 3HOYI 5IP9I 3PO3S 1W2BZ 1VQOZ 4A3GI 1VQMZ 3VMGA 3GTLI 2JIMA 1RNIA 2HF1A 4EWCA 1RO0A 4NBBA 3NFZA 1Z03A 3CCMZ 2GU2A 1M1K2 3CCSZ 3G4S1 3CCJ1 3G71Z 2V8IA 2M6NA 3CC71 3I07A 3F3FC 4AYBA 3CCUZ 4A3EI 1Q812 2OTL1 2J6AA 3I56Z 1VQ41 4A93I 1KRLA 1TWCI 1YJ9Z 2P3YA 2YADA 1RQFA 1Q7Y1 3CMEZ 1YHQ1 1YJW1 2RHBA 1I50I 4MD9A 5FLXb 4NB9A 3GTGI 3NH5A 1Y8CA 2F4MA 4RV9A 5T67A 3S2HI 2K5RA 2E2HI 4NB8A
chains in the Genus database with same CATH topology
2JNYA 4NBFA 1KD11 4BBRI 4NOZA 3G6EZ 3QWUA 2NVXI 1Q821 4NBDA 5LL6f 1VQKZ 2F4OA 1VQ71 2IZ3A 3I551 2QRDB 1M902 5C3EI 2NVQI 1VQ51 3GTJI 3CCVZ 1Q7Y2 4QTTA 1S72Z 2DE7A 1YJNZ 1Z02A 3MZKB 3CC21 3CCE1 3GTPI 2WB1A 1I3QI 5IT9f 1I6HI 1VQ61 1VQLZ 2V8JA 1K9M2 2QEXZ 3FQQA 3S15I 1Q822 4MD7A 5A2Qf 4E32A 1K732 3GTKI 2QR1B 4A3JI 2JS4A 1JJ2Y 4BXXI 1N8R2 1VLAA 3VB9A 1YI2Z 2OOXB 2K3RA 2R7ZI 4NH1C 1ZB8A 4XX2A 3CCLZ 3CC4Z 3CD6Z 1TWAI 2RIQA 3GCFA 4DK1A 1K83I 3J81f 3CMA1 1TWGI 3CCQZ 3CD61 1VQP1 3PO2I 2OOYB 1WCMI 2LIYA 2QLVB 1VQ81 2G2KA 3LUSA 2JMOA 3NH4A 1VQO1 1VQM1 3MONA 2OZKA 1WIIA 1R9TI 3S17I 3D9XA 3NDJA 5FLMI 5D1OB 1L1OC 3NDIA 1USPB 1Y1VI 2R6MA 3CCM1 2JUBA 3CCS1 1P9NA 4RVFA 3G711 4E2XA 4HGYA 1Y1WI 5CM2M 5IT9b 2V8KA 3CCU1 1ML8A 4CL1A 1YUAA 3I561 1YJ91 2E9HA 3CME1 1VQ9Z 4HGZA 1NJI1 5C4JI 3FKII 3TDHB 3EEDA 2OTJZ 4MONA 2M48A 3HOUI 2PMZA 2RT9A 3FQMA 1KC81 3JAMf 3VMHA 1JWHC 5T6BA 1Q861 3G6E1 2EGTA 1JJ2Z 2DE6A 1S7MA 1Z01A 2O4HA 2QREB 5C44I 4NBEA 3GTQI 3RZOI 1VQK1 4BY1I 1RLYA 2KPIA 3BG1B 4RVGA 3T4NB 2AKLA 3J81b 4A3BI 2ZAEB 4A3II 3CPWY 3ESWA 3U50C 3CCV1 2Q4ZA 2PK7A 1S721 2Q51A 5IP7I 4E30A 1YJN1 2WAQA 2IZ4A 3K7AI 2JA6I 3S1MI 1NUIA 3CCRZ 4HH4A 2E2JI 1KD12 4A3LI 3HOWI 3TE5B 1QVGY 3S2DI 2QKDA 4A3MI 1KC82 1Y1VS 1VQL1 2QA4Z 3H3VJ 4MD8A 4RVDA 3D6WA 2QEX1 1YITZ 2JA5I 2NVTI 3Q87A 5FLXf 4S1TA 3S14I 3CXCY 3EERA 1YIJZ 2I3CA 3VTNA 2P28A 1YI21 3IFUA 4E33A 4A3CI 1M1K1 1LQLA 3RZDI 2VF1A 3CCL1 3CC41 3NH8A 3S1RI 4MH4A 3S1NI 1Q811 2R92I 1VQNZ 3J80f 1K8A1 3JAMb 2JR6A 2GTIA 5C4XI 3OW2Y 4A3FI 3CCQ1 1KQSY 3HOVI 2BJOA 4E31A 3J7A4 3GTMI 1N2FA 2H85A 2DE5A 1ZB9A 3G4SZ 4BY7I 4Y7NI 1DL6A 3CCJZ 4E2ZA 2LFUA 4A3DI 2E2II 4X6AI 3CC7Z 4E2YA 2OTLZ 1VQ4Z 1RO4A 3CPWZ 3I4MI 3KIFA 3S16I 3H0GI 2NVYI 3BG0B 1YHQZ 1YJWZ 1QVFY 4TNUA 2JA7I 5A2Qb 1M901 1K8A2 2PM9A 1PFTA 1QVGZ 4BBSI 1VQ91 2W04A 2VUGA 4NBHA 1X0TA 2R93I 1W2BY 3HOZI 2OTJ1 3HKZA 4E2WA 1TWHI 4MXUA 4QTUA 3HOXI 2RPRA 4Y52I 2VUMI 4NBCA 2JA8I 3CXCZ 3PO3I 1QF8A 1QYPA 1VQ7Z 2QRCB 2HU9A 1K9M1 3I55Z 2RBLA 4NFRA 3VMIA 3MZLB 1VQ5Z 1K731 3S1QI 4DGLA 3M3YI 3J80b 1NJI2 1N8R1 2B63I 2GTHA 3I4NI 3IX0A 3CC2Z 2W03A 2Y0SA 3CCEZ 1X3WA 3OW2Z 1VQ6Z 3CCR1 3GTMS 4A3KI 1Q862 2KI7B 3GKQA 1KQSZ 4DQYB 2QA41 1X3ZA 3M4OI 1YIT1 4NBAA 5AN9F 3F3PC 1TWFI 4RS4A 3KIHA 1SFOI 4MRIA 3P5JB 1YIJ1 1YUKA 5D1PA 1TFIA 1RO2A 1QVFZ 5T64A 3IF8A 1WW9A 2YU9I 4NBGA 3GTOI 3CMAZ 3CQZI 1ZH1A 5D1OA 1VQPZ 2O53A 4RVHA 1NP6A 1USPA 1VQN1 1VQ8Z 3HOYI 5IP9I 3PO3S 1W2BZ 1VQOZ 4A3GI 1VQMZ 3VMGA 3GTLI 1RNIA 2HF1A 4EWCA 1RO0A 4NBBA 3NFZA 1Z03A 3CCMZ 2GU2A 1M1K2 3CCSZ 3G4S1 3CCJ1 3G71Z 2V8IA 2M6NA 3CC71 3I07A 3F3FC 4AYBA 3CCUZ 4A3EI 1Q812 2OTL1 2J6AA 3I56Z 1VQ41 4A93I 1KRLA 1TWCI 1YJ9Z 2P3YA 2YADA 1RQFA 1Q7Y1 3CMEZ 1YHQ1 1YJW1 2RHBA 1I50I 4MD9A 5FLXb 4NB9A 3GTGI 3NH5A 2F4MA 4RV9A 5T67A 3S2HI 2K5RA 2E2HI 4NB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K 1;  3OW2 Z;  1KD1 1;  1VQ6 Z;  3CCM 1;  3CCL 1;  3CCR 1;  3G6E Z;  3CC4 1;  3CCS 1;  1Q86 2;  3G71 1;  1Q82 1;  1KQS Z;  1Q81 1;  1VQK Z;  1VQN Z;  3CCU 1;  1K8A 1;  3I56 1;  1VQ7 1;  3OW2 Y;  2QA4 1;  3I55 1;  1YJ9 1;  1M90 2;  3CCQ 1;  1VQ5 1;  1YIT 1;  3CCV Z;  3CME 1;  1Q7Y 2;  1VQ9 Z;  1KQS Y;  1S72 Z;  1NJI 1;  1YJN Z;  2OTJ Z;  1YIJ 1;  3CC2 1;  3G4S Z;  3CCE 1;  3CCJ Z;  1KC8 1;  3CC7 Z;  1QVF Z;  1VQ6 1;  3CMA Z;  1VQ4 Z;  2OTL Z;  1Q86 1;  3G6E 1;  1VQL Z;  1JJ2 Z;  3CPW Z;  1K9M 2;  1VQP Z;  2QEX Z;  1Q82 2;  1VQK 1;  1YHQ Z;  1K73 2;  1VQN 1;  1YJW Z;  1VQ8 Z;  1QVF Y;  1W2B Z;  1M90 1;  1K8A 2;  1VQO Z;  1VQM Z;  1JJ2 Y;  1N8R 2;  3CPW Y;  1QVG Z;  1YI2 Z;  3CCV 1;  1VQ9 1;  1S72 1;  1YJN 1;  1W2B Y;  2OTJ 1;  3CCM Z;  3CCR Z;  3CCL Z;  1M1K 2;  3CC4 Z;  1KD1 2;  3CCS Z;  3G4S 1;  3CCJ 1;  3CD6 Z;  3G71 Z;  1QVG Y;  3CC7 1;  1KC8 2;  3CXC Z;  3CCU Z;  1Q81 2;  2OTL 1;  1VQ4 1;  3I56 Z;  3CMA 1;  1VQ7 Z;  1VQL 1;  2QA4 Z;  1K9M 1;  3I55 Z;  1YJ9 Z;  3CCQ Z;  3CD6 1;  1VQ5 Z;  1VQP 1;  1Q7Y 1;  2QEX 1;  1YIT Z;  3CME Z;  1K73 1;  1YHQ 1;  1YJW 1;  1VQ8 1;  3CXC Y;  1NJI 2;  1N8R 1;  1VQO 1;  1VQM 1;  1YIJ Z;  3CC2 Z;  1YI2 1;  3CCE Z; 
#chains in the Genus database with same CATH topology
 2JNY A;  4NBF A;  1KD1 1;  4BBR I;  4NOZ A;  3G6E Z;  3QWU A;  2NVX I;  1Q82 1;  4NBD A;  5LL6 f;  1VQK Z;  2F4O A;  1VQ7 1;  2IZ3 A;  3I55 1;  2QRD B;  1M90 2;  5C3E I;  2NVQ I;  1VQ5 1;  3GTJ I;  3CCV Z;  1Q7Y 2;  2VPW A;  4QTT A;  1S72 Z;  2V45 A;  2DE7 A;  1YJN Z;  1Z02 A;  2E7Z A;  3MZK B;  3CC2 1;  3CCE 1;  3GTP I;  2WB1 A;  2IV2 X;  1I3Q I;  5IT9 f;  2AYD A;  1I6H I;  1VQ6 1;  1WJ2 A;  1VQL Z;  2V8J A;  1K9M 2;  2QEX Z;  3FQQ A;  3S15 I;  2V3V A;  1Q82 2;  4MD7 A;  5A2Q f;  4E32 A;  1K73 2;  3GTK I;  1QXF A;  2QR1 B;  4A3J I;  2JS4 A;  2JIP A;  1JJ2 Y;  4BXX I;  1N8R 2;  1VLA A;  3VB9 A;  1YI2 Z;  2OOX B;  2K3R A;  2R7Z I;  4NH1 C;  1ZB8 A;  4XX2 A;  3CCL Z;  3CC4 Z;  3CD6 Z;  1TWA I;  2RIQ A;  3GCF A;  4DK1 A;  1K83 I;  3J81 f;  3CMA 1;  1TWG I;  1FDO A;  3CCQ Z;  3CD6 1;  1VQP 1;  3PO2 I;  2OOY B;  1WCM I;  2LIY A;  2QLV B;  1VQ8 1;  2G2K A;  3LUS A;  2JMO A;  3NH4 A;  1VQO 1;  1VQM 1;  3MON A;  2OZK A;  1WII A;  1R9T I;  3S17 I;  3D9X A;  3NDJ A;  2JIQ A;  5FLM I;  5D1O B;  1L1O C;  3NDI A;  1USP B;  1Y1V I;  2R6M A;  3CCM 1;  2JUB A;  3CCS 1;  1P9N A;  4RVF A;  3G71 1;  4E2X A;  4HGY A;  1Y1W I;  5CM2 M;  5IT9 b;  2V8K A;  3CCU 1;  1ML8 A;  4CL1 A;  1YUA A;  3I56 1;  1YJ9 1;  3IR7 A;  2E9H A;  3CME 1;  1VQ9 Z;  4HGZ A;  1NJI 1;  5C4J I;  3FKI I;  3TDH B;  3EED A;  2OTJ Z;  2JIO A;  4MON A;  2M48 A;  3HOU I;  2PMZ A;  2RT9 A;  3FQM A;  1KC8 1;  3JAM f;  3VMH A;  1JWH C;  5T6B A;  1Q86 1;  3G6E 1;  2EGT A;  1JJ2 Z;  2DE6 A;  1S7M A;  1Z01 A;  2O4H A;  2QRE B;  5C44 I;  4NBE A;  3GTQ I;  3RZO I;  1VQK 1;  4BY1 I;  1RLY A;  2KPI A;  3BG1 B;  2NAP A;  4RVG A;  3T4N B;  2AKL A;  3J81 b;  4A3B I;  2ZAE B;  4A3I I;  3CPW Y;  3ESW A;  3U50 C;  3CCV 1;  2Q4Z A;  2PK7 A;  1S72 1;  2Q51 A;  5IP7 I;  4E30 A;  1YJN 1;  2WAQ A;  2IZ4 A;  3K7A I;  2JA6 I;  3S1M I;  1NUI A;  3CCR Z;  4HH4 A;  2E2J I;  1KD1 2;  4A3L I;  3HOW I;  3TE5 B;  1QVG Y;  3S2D I;  2QKD A;  4A3M I;  1KC8 2;  1Y1V S;  1VQL 1;  2QA4 Z;  3H3V J;  4MD8 A;  4RVD A;  3D6W A;  2QEX 1;  1YIT Z;  2JA5 I;  2NVT I;  3Q87 A;  5FLX f;  4S1T A;  3S14 I;  3CXC Y;  3EER A;  1YIJ Z;  2I3C A;  3VTN A;  2P28 A;  1YI2 1;  3IFU A;  4E33 A;  2VPZ A;  4A3C I;  1M1K 1;  1LQL A;  3RZD I;  2VF1 A;  3CCL 1;  3CC4 1;  3NH8 A;  3S1R I;  4MH4 A;  3S1N I;  1Q81 1;  2R92 I;  1VQN Z;  3J80 f;  1K8A 1;  3JAM b;  2JR6 A;  2GTI A;  5C4X I;  3OW2 Y;  4A3F I;  3CCQ 1;  2VPX A;  1KQS Y;  3HOV I;  2BJO A;  4E31 A;  3J7A 4;  3GTM I;  1N2F A;  2H85 A;  1FDI A;  2DE5 A;  1ZB9 A;  3G4S Z;  4BY7 I;  4Y7N I;  1DL6 A;  3CCJ Z;  4E2Z A;  2LFU A;  4A3D I;  2E2I I;  4X6A I;  3CC7 Z;  4E2Y A;  2OTL Z;  1VQ4 Z;  1RO4 A;  3CPW Z;  3I4M I;  3KIF A;  3S16 I;  3H0G I;  2NVY I;  3BG0 B;  1YHQ Z;  1YJW Z;  2JIR A;  4TNU A;  1QVF Y;  2JA7 I;  5A2Q b;  1M90 1;  1K8A 2;  2PM9 A;  1PFT A;  1QVG Z;  4BBS I;  1VQ9 1;  2W04 A;  2VUG A;  4NBH A;  1X0T A;  2R93 I;  1W2B Y;  3HOZ I;  2OTJ 1;  3HKZ A;  4E2W A;  1TWH I;  4MXU A;  4QTU A;  3HOX I;  2RPR A;  4Y52 I;  2VUM I;  4NBC A;  2JA8 I;  3CXC Z;  3PO3 I;  1QF8 A;  1QYP A;  1VQ7 Z;  2QRC B;  2HU9 A;  1K9M 1;  3I55 Z;  2RBL A;  4NFR A;  3VMI A;  3MZL B;  1VQ5 Z;  1K73 1;  3S1Q I;  4DGL A;  3M3Y I;  3J80 b;  1NJI 2;  1N8R 1;  2LEX A;  2B63 I;  2GTH A;  3I4N I;  3IX0 A;  3CC2 Z;  2W03 A;  2Y0S A;  3CCE Z;  3D2L A;  1AA6 A;  2VPY A;  1X3W A;  3OW2 Z;  1VQ6 Z;  3CCR 1;  3GTM S;  4A3K I;  1Q86 2;  2KI7 B;  3GKQ A;  1KQS Z;  4DQY B;  1SIW A;  2QA4 1;  1X3Z A;  3M4O I;  1YIT 1;  4NBA A;  5AN9 F;  3F3P C;  1TWF I;  4RS4 A;  1Q16 A;  3KIH A;  1SFO I;  4MRI A;  3P5J B;  1YIJ 1;  1YUK A;  5D1P A;  1WZN A;  1TFI A;  1RO2 A;  1QVF Z;  5T64 A;  3IF8 A;  1WW9 A;  2YU9 I;  4NBG A;  3GTO I;  3CMA Z;  3CQZ I;  1ZH1 A;  5D1O A;  1VQP Z;  2O53 A;  4RVH A;  1NP6 A;  1USP A;  1VQN 1;  1VQ8 Z;  3HOY I;  5IP9 I;  3PO3 S;  1W2B Z;  1VQO Z;  4A3G I;  1VQM Z;  3VMG A;  3GTL I;  2JIM A;  1RNI A;  2HF1 A;  4EWC A;  1RO0 A;  4NBB A;  3NFZ A;  1Z03 A;  3CCM Z;  2GU2 A;  1M1K 2;  3CCS Z;  3G4S 1;  3CCJ 1;  3G71 Z;  2V8I A;  2M6N A;  3CC7 1;  3I07 A;  3F3F C;  4AYB A;  3CCU Z;  4A3E I;  1Q81 2;  2OTL 1;  2J6A A;  3I56 Z;  1VQ4 1;  4A93 I;  1KRL A;  1TWC I;  1YJ9 Z;  2P3Y A;  2YAD A;  1RQF A;  1Q7Y 1;  3CME Z;  1YHQ 1;  1YJW 1;  2RHB A;  1I50 I;  4MD9 A;  5FLX b;  4NB9 A;  3GTG I;  3NH5 A;  1Y8C A;  2F4M A;  4RV9 A;  5T67 A;  3S2H I;  2K5R A;  2E2H I;  4NB8 A; 
#chains in the Genus database with same CATH homology
 2JNY A;  4NBF A;  1KD1 1;  4BBR I;  4NOZ A;  3G6E Z;  3QWU A;  2NVX I;  1Q82 1;  4NBD A;  5LL6 f;  1VQK Z;  2F4O A;  1VQ7 1;  2IZ3 A;  3I55 1;  2QRD B;  1M90 2;  5C3E I;  2NVQ I;  1VQ5 1;  3GTJ I;  3CCV Z;  1Q7Y 2;  4QTT A;  1S72 Z;  2DE7 A;  1YJN Z;  1Z02 A;  3MZK B;  3CC2 1;  3CCE 1;  3GTP I;  2WB1 A;  1I3Q I;  5IT9 f;  1I6H I;  1VQ6 1;  1VQL Z;  2V8J A;  1K9M 2;  2QEX Z;  3FQQ A;  3S15 I;  1Q82 2;  4MD7 A;  5A2Q f;  4E32 A;  1K73 2;  3GTK I;  2QR1 B;  4A3J I;  2JS4 A;  1JJ2 Y;  4BXX I;  1N8R 2;  1VLA A;  3VB9 A;  1YI2 Z;  2OOX B;  2K3R A;  2R7Z I;  4NH1 C;  1ZB8 A;  4XX2 A;  3CCL Z;  3CC4 Z;  3CD6 Z;  1TWA I;  2RIQ A;  3GCF A;  4DK1 A;  1K83 I;  3J81 f;  3CMA 1;  1TWG I;  3CCQ Z;  3CD6 1;  1VQP 1;  3PO2 I;  2OOY B;  1WCM I;  2LIY A;  2QLV B;  1VQ8 1;  2G2K A;  3LUS A;  2JMO A;  3NH4 A;  1VQO 1;  1VQM 1;  3MON A;  2OZK A;  1WII A;  1R9T I;  3S17 I;  3D9X A;  3NDJ A;  5FLM I;  5D1O B;  1L1O C;  3NDI A;  1USP B;  1Y1V I;  2R6M A;  3CCM 1;  2JUB A;  3CCS 1;  1P9N A;  4RVF A;  3G71 1;  4E2X A;  4HGY A;  1Y1W I;  5CM2 M;  5IT9 b;  2V8K A;  3CCU 1;  1ML8 A;  4CL1 A;  1YUA A;  3I56 1;  1YJ9 1;  2E9H A;  3CME 1;  1VQ9 Z;  4HGZ A;  1NJI 1;  5C4J I;  3FKI I;  3TDH B;  3EED A;  2OTJ Z;  4MON A;  2M48 A;  3HOU I;  2PMZ A;  2RT9 A;  3FQM A;  1KC8 1;  3JAM f;  3VMH A;  1JWH C;  5T6B A;  1Q86 1;  3G6E 1;  2EGT A;  1JJ2 Z;  2DE6 A;  1S7M A;  1Z01 A;  2O4H A;  2QRE B;  5C44 I;  4NBE A;  3GTQ I;  3RZO I;  1VQK 1;  4BY1 I;  1RLY A;  2KPI A;  3BG1 B;  4RVG A;  3T4N B;  2AKL A;  3J81 b;  4A3B I;  2ZAE B;  4A3I I;  3CPW Y;  3ESW A;  3U50 C;  3CCV 1;  2Q4Z A;  2PK7 A;  1S72 1;  2Q51 A;  5IP7 I;  4E30 A;  1YJN 1;  2WAQ A;  2IZ4 A;  3K7A I;  2JA6 I;  3S1M I;  1NUI A;  3CCR Z;  4HH4 A;  2E2J I;  1KD1 2;  4A3L I;  3HOW I;  3TE5 B;  1QVG Y;  3S2D I;  2QKD A;  4A3M I;  1KC8 2;  1Y1V S;  1VQL 1;  2QA4 Z;  3H3V J;  4MD8 A;  4RVD A;  3D6W A;  2QEX 1;  1YIT Z;  2JA5 I;  2NVT I;  3Q87 A;  5FLX f;  4S1T A;  3S14 I;  3CXC Y;  3EER A;  1YIJ Z;  2I3C A;  3VTN A;  2P28 A;  1YI2 1;  3IFU A;  4E33 A;  4A3C I;  1M1K 1;  1LQL A;  3RZD I;  2VF1 A;  3CCL 1;  3CC4 1;  3NH8 A;  3S1R I;  4MH4 A;  3S1N I;  1Q81 1;  2R92 I;  1VQN Z;  3J80 f;  1K8A 1;  3JAM b;  2JR6 A;  2GTI A;  5C4X I;  3OW2 Y;  4A3F I;  3CCQ 1;  1KQS Y;  3HOV I;  2BJO A;  4E31 A;  3J7A 4;  3GTM I;  1N2F A;  2H85 A;  2DE5 A;  1ZB9 A;  3G4S Z;  4BY7 I;  4Y7N I;  1DL6 A;  3CCJ Z;  4E2Z A;  2LFU A;  4A3D I;  2E2I I;  4X6A I;  3CC7 Z;  4E2Y A;  2OTL Z;  1VQ4 Z;  1RO4 A;  3CPW Z;  3I4M I;  3KIF A;  3S16 I;  3H0G I;  2NVY I;  3BG0 B;  1YHQ Z;  1YJW Z;  1QVF Y;  4TNU A;  2JA7 I;  5A2Q b;  1M90 1;  1K8A 2;  2PM9 A;  1PFT A;  1QVG Z;  4BBS I;  1VQ9 1;  2W04 A;  2VUG A;  4NBH A;  1X0T A;  2R93 I;  1W2B Y;  3HOZ I;  2OTJ 1;  3HKZ A;  4E2W A;  1TWH I;  4MXU A;  4QTU A;  3HOX I;  2RPR A;  4Y52 I;  2VUM I;  4NBC A;  2JA8 I;  3CXC Z;  3PO3 I;  1QF8 A;  1QYP A;  1VQ7 Z;  2QRC B;  2HU9 A;  1K9M 1;  3I55 Z;  2RBL A;  4NFR A;  3VMI A;  3MZL B;  1VQ5 Z;  1K73 1;  3S1Q I;  4DGL A;  3M3Y I;  3J80 b;  1NJI 2;  1N8R 1;  2B63 I;  2GTH A;  3I4N I;  3IX0 A;  3CC2 Z;  2W03 A;  2Y0S A;  3CCE Z;  1X3W A;  3OW2 Z;  1VQ6 Z;  3CCR 1;  3GTM S;  4A3K I;  1Q86 2;  2KI7 B;  3GKQ A;  1KQS Z;  4DQY B;  2QA4 1;  1X3Z A;  3M4O I;  1YIT 1;  4NBA A;  5AN9 F;  3F3P C;  1TWF I;  4RS4 A;  3KIH A;  1SFO I;  4MRI A;  3P5J B;  1YIJ 1;  1YUK A;  5D1P A;  1TFI A;  1RO2 A;  1QVF Z;  5T64 A;  3IF8 A;  1WW9 A;  2YU9 I;  4NBG A;  3GTO I;  3CMA Z;  3CQZ I;  1ZH1 A;  5D1O A;  1VQP Z;  2O53 A;  4RVH A;  1NP6 A;  1USP A;  1VQN 1;  1VQ8 Z;  3HOY I;  5IP9 I;  3PO3 S;  1W2B Z;  1VQO Z;  4A3G I;  1VQM Z;  3VMG A;  3GTL I;  1RNI A;  2HF1 A;  4EWC A;  1RO0 A;  4NBB A;  3NFZ A;  1Z03 A;  3CCM Z;  2GU2 A;  1M1K 2;  3CCS Z;  3G4S 1;  3CCJ 1;  3G71 Z;  2V8I A;  2M6N A;  3CC7 1;  3I07 A;  3F3F C;  4AYB A;  3CCU Z;  4A3E I;  1Q81 2;  2OTL 1;  2J6A A;  3I56 Z;  1VQ4 1;  4A93 I;  1KRL A;  1TWC I;  1YJ9 Z;  2P3Y A;  2YAD A;  1RQF A;  1Q7Y 1;  3CME Z;  1YHQ 1;  1YJW 1;  2RHB A;  1I50 I;  4MD9 A;  5FLX b;  4NB9 A;  3GTG I;  3NH5 A;  2F4M A;  4RV9 A;  5T67 A;  3S2H I;  2K5R A;  2E2H I;  4NB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...