1YHQZ

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yhqZ00
1Q861 1VQ4Z 1VQ51 1YHQZ 1W2BZ 1NJI2 3CMAZ 1YIJ1 3CMA1 1NJI1 3CCUZ 2QEXZ 2QEX1 1JJ2Z 3CCM1 1W2BY 3CC7Z 1KD11 1VQN1 1VQO1 1N8R2 2OTJ1 1QVFZ 3CD6Z 3CCJZ 3CCL1 1N8R1 1VQ8Z 1KQSZ 1JJ2Y 3CME1 1YI21 1VQPZ 3G6EZ 3CCS1 1Q811 1VQ5Z 1VQP1 3G6E1 3CPWZ 1YJN1 2OTLZ 1YIJZ 1QVFY 2OTL1 2QA4Z 1KQSY 2QA41 1VQL1 1VQM1 1Q822 3CCMZ 1Q821 1VQ7Z 3CC21 3CPWY 3CCQ1 1VQ71 1VQK1 1VQNZ 3I551 1VQOZ 2OTJZ 1QVGZ 3CCLZ 3CMEZ 3CCVZ 1Q7Y2 1YI2Z 3CCV1 1S721 3G711 3CCSZ 1Q7Y1 1YJNZ 1QVGY 3OW2Z 3G4S1 1M1K2 1VQLZ 1VQMZ 1VQ91 3CCRZ 3I561 1M1K1 3CCEZ 3CCR1 1K732 1M902 3CCE1 1YJW1 3CC2Z 3CC41 3CCQZ 1VQKZ 3OW2Y 1K731 3I55Z 1M901 1K8A2 3CXCZ 1YIT1 1YJ9Z 1K8A1 1YJ91 1S72Z 3G71Z 1VQ41 1YHQ1 3G4SZ 3CXCY 3CCU1 1VQ9Z 1K9M2 1KD12 3I56Z 1YJWZ 1K9M1 3CC4Z 3CC71 1VQ6Z 1VQ61 1KC82 3CD61 3CCJ1 1Q812 1Q862 1YITZ 1VQ81 1KC81
chains in the Genus database with same CATH superfamily
3HOVI 2DE5A 4QTUA 2JIPA 2NAPA 3GTMI 3CMAZ 3QWUA 4HGYA 3CMA1 4A3MI 1WW9A 2VF1A 2J6AA 3FQQA 2VPZA 3D9XA 4A3LI 2HF1A 2KI7B 3U50C 1I6HI 1VQN1 3TE5B 3J7A4 1N8R2 1QVFZ 2YU9I 3CD6Z 3CCJZ 2DE7A 3J81b 3CCL1 1N8R1 3M3YI 1Z02A 3T4NB 4MONA 1YI21 2BJOA 2VPXA 2WB1A 3S1QI 1Z01A 3CPWZ 2OTLZ 4E33A 2OOYB 3JAMf 2RIQA 2OTL1 1R9TI 3NH4A 3RZOI 1VQM1 2O53A 3GTGI 2NVQI 3CCMZ 1QYPA 5T67A 3J81f 3I551 1VQOZ 2OTJZ 1ZH1A 2P28A 2JA6I 3CCVZ 4E32A 3CCV1 3CCSZ 5T64A 2KPIA 3PO3S 1I3QI 4S1TA 2JIOA 3I4MI 2DE6A 5D1OA 1K732 1YJW1 3CC41 3CCQZ 3S2DI 1K731 4E2ZA 4RS4A 3VTNA 5FLXf 2QKDA 4NOZA 4AYBA 2R92I 1NP6A 2OZKA 3S15I 1S72Z 3HOYI 3BG1B 4TNUA 4BY1I 3MZLB 2F4MA 4E30A 3HOZI 1USPB 3PO2I 1RNIA 1X0TA 1VQ9Z 1KD12 3I56Z 4A3FI 1RQFA 3NH8A 1Y1VS 4A3BI 5AN9F 4XX2A 2HU9A 1Q812 1Q862 3IFUA 3GTPI 3NDJA 1YITZ 1VQ81 3S1MI 1DL6A 1Q861 3ESWA 1VQ4Z 1YHQZ 1FDOA 1WCMI 1NJI2 4NBDA 3VMGA 5IP9I 1NJI1 1YUKA 1W2BY 4NBCA 5D1OB 2F4OA 1N2FA 4NBBA 3FQMA 3GKQA 4NB9A 4A93I 1AA6A 1Q822 2VUMI 4A3GI 3JAMb 2G2KA 1Q821 5A2Qb 1VQ7Z 4NH1C 2GU2A 1VQ71 1VQK1 1VQNZ 2W04A 3MZKB 3HOUI 1WIIA 3CCLZ 2P3YA 2VPWA 1YI2Z 1USPA 2O4HA 3BG0B 3G711 5CM2M 1Y1WI 1RO4A 3G4S1 2QREB 1VQMZ 3GTMS 3IX0A 5A2Qf 3CCEZ 1M902 1TWGI 3CCE1 3IR7A 1I50I 3Q87A 3OW2Y 4MD8A 3I55Z 1M901 4RVFA 3VMIA 2V8IA 1K8A2 2Q4ZA 2V8JA 1K83I 1K8A1 4NBEA 2EGTA 4Y7NI 3F3PC 5FLXb 4E31A 1PFTA 2JNYA 2RT9A 2IZ4A 3TDHB 1L1OC 3CXCY 4A3JI 3HOXI 3S1RI 3M4OI 3CCU1 1K9M2 2E2HI 2K3RA 1TWFI 4NBHA 1YJWZ 1K9M1 1SIWA 3CC4Z 3H3VJ 3CC71 2M6NA 2VUGA 2H85A 4RV9A 3D6WA 1S7MA 1SFOI 1VQ51 1W2BZ 3S17I 1YIJ1 2OOXB 3K7AI 1Y1VI 4A3CI 1KD11 4NBGA 2PK7A 3J80b 1RO0A 4MD7A 1VQ8Z 1JJ2Y 3CME1 2E9HA 2Y0SA 1RLYA 3GTKI 2AKLA 1VQPZ 1Q811 1VQP1 2B63I 2JA8I 1YJN1 4HGZA 2RHBA 1KQSY 2QR1B 4BBRI 1VQL1 4MD9A 1NUIA 2PMZA 4MXUA 3NH5A 3CC21 4A3KI 2WAQA 3VB9A 2NVTI 2AYDA 3J80f 3HOWI 1X3WA 1FDIA 4NB8A 4CL1A 2E7ZA 2JS4A 4NFRA 4DGLA 4DQYB 2JUBA 2QLVB 1QVGY 3OW2Z 5C4JI 5IP7I 5C4XI 4EWCA 2LEXA 3CCRZ 3CCR1 1VQKZ 3LUSA 1JWHC 3CXCZ 1P9NA 2ZAEB 2R93I 3G71Z 1TWCI 2NVXI 2PM9A 4DK1A 4QTTA 4RVHA 3G4SZ 2W03A 1Z03A 3EERA 2QRCB 3CQZI 4E2WA 4RVDA 2IV2X 1VQ6Z 4BXXI 1QF8A 2RPRA 1VQ61 3RZDI 3CD61 1TWAI 3CCJ1 5C44I 3NFZA 2V45A 2IZ3A 3PO3I 1TWHI 2QRDB 4A3II 3S1NI 3MONA 2JR6A 2V3VA 3GTJI 2I3CA 4HH4A 3CCUZ 2QEXZ 3GTLI 2QEX1 1JJ2Z 3CCM1 1X3ZA 3D2LA 3CC7Z 2Q51A 1VQO1 2OTJ1 1Y8CA 1YUAA 1KQSZ 2YADA 1LQLA 4A3EI 5LL6f 3H0GI 3G6EZ 3CCS1 3FKII 1VQ5Z 3G6E1 2V8KA 1YIJZ 1QVFY 2JIQA 2QA4Z 1ZB9A 1Q16A 1TFIA 2QA41 2NVYI 4E2XA 3GTOI 4MH4A 5FLMI 2VPYA 3CPWY 3CCQ1 1WZNA 4NBFA 1QVGZ 4E2YA 3CMEZ 1Q7Y2 2LFUA 1S721 1Q7Y1 2JIMA 1YJNZ 3S16I 1M1K2 3KIHA 2LIYA 1WJ2A 4RVGA 1VQLZ 1ML8A 1VQ91 3GCFA 1M1K1 3I561 2E2JI 4X6AI 3S14I 1RO2A 1QXFA 4Y52I 3CC2Z 4BY7I 2M48A 4NBAA 2RBLA 2R6MA 3GTQI 5D1PA 3NDIA 5IT9b 3HKZA 1YIT1 1YJ9Z 1YJ91 1VQ41 3EEDA 1VLAA 1YHQ1 4A3DI 5C3EI 2R7ZI 3I07A 5T6BA 1KRLA 2E2II 3F3FC 2JA5I 3VMHA 2JMOA 3S2HI 3IF8A 3P5JB 2GTIA 3I4NI 2JIRA 3KIFA 5IT9f 1KC82 2JA7I 1ZB8A 2K5RA 4BBSI 1KC81 2GTHA 4MRIA
chains in the Genus database with same CATH topology
3HOVI 2DE5A 4QTUA 3GTMI 3CMAZ 3QWUA 4HGYA 3CMA1 4A3MI 1WW9A 2VF1A 2J6AA 3FQQA 3D9XA 4A3LI 2HF1A 2KI7B 3U50C 1I6HI 1VQN1 3TE5B 3J7A4 1N8R2 1QVFZ 2YU9I 3CD6Z 3CCJZ 2DE7A 3J81b 3CCL1 1N8R1 3M3YI 1Z02A 3T4NB 4MONA 1YI21 2BJOA 2WB1A 3S1QI 1Z01A 3CPWZ 2OTLZ 4E33A 2OOYB 3JAMf 2RIQA 2OTL1 1R9TI 3NH4A 3RZOI 1VQM1 2O53A 3GTGI 2NVQI 3CCMZ 1QYPA 5T67A 3J81f 3I551 1VQOZ 2OTJZ 1ZH1A 2P28A 2JA6I 3CCVZ 4E32A 3CCV1 3CCSZ 5T64A 2KPIA 3PO3S 1I3QI 4S1TA 3I4MI 2DE6A 5D1OA 1K732 1YJW1 3CC41 3CCQZ 3S2DI 1K731 4E2ZA 4RS4A 3VTNA 5FLXf 2QKDA 4NOZA 4AYBA 2R92I 1NP6A 2OZKA 3S15I 1S72Z 3HOYI 3BG1B 4TNUA 4BY1I 3MZLB 2F4MA 4E30A 3HOZI 1USPB 3PO2I 1RNIA 1X0TA 1VQ9Z 1KD12 3I56Z 4A3FI 1RQFA 3NH8A 1Y1VS 4A3BI 5AN9F 4XX2A 2HU9A 1Q812 1Q862 3IFUA 3GTPI 3NDJA 1YITZ 1VQ81 3S1MI 1DL6A 1Q861 3ESWA 1VQ4Z 1YHQZ 1WCMI 1NJI2 4NBDA 3VMGA 5IP9I 1NJI1 1YUKA 1W2BY 4NBCA 5D1OB 2F4OA 1N2FA 4NBBA 3FQMA 3GKQA 4NB9A 4A93I 1Q822 2VUMI 4A3GI 3JAMb 2G2KA 1Q821 5A2Qb 1VQ7Z 4NH1C 2GU2A 1VQ71 1VQK1 1VQNZ 2W04A 3MZKB 3HOUI 1WIIA 3CCLZ 2P3YA 1YI2Z 1USPA 2O4HA 3BG0B 3G711 5CM2M 1Y1WI 1RO4A 3G4S1 2QREB 1VQMZ 3GTMS 3IX0A 5A2Qf 3CCEZ 1M902 1TWGI 3CCE1 1I50I 3Q87A 3OW2Y 4MD8A 3I55Z 1M901 4RVFA 3VMIA 2V8IA 1K8A2 2Q4ZA 2V8JA 1K83I 1K8A1 4NBEA 2EGTA 4Y7NI 3F3PC 5FLXb 4E31A 1PFTA 2JNYA 2RT9A 2IZ4A 3TDHB 1L1OC 3CXCY 4A3JI 3HOXI 3S1RI 3M4OI 3CCU1 1K9M2 2E2HI 2K3RA 1TWFI 4NBHA 1YJWZ 1K9M1 3CC4Z 3H3VJ 3CC71 2M6NA 2VUGA 2H85A 4RV9A 3D6WA 1S7MA 1SFOI 1VQ51 1W2BZ 3S17I 1YIJ1 2OOXB 3K7AI 1Y1VI 4A3CI 1KD11 4NBGA 2PK7A 3J80b 1RO0A 4MD7A 1VQ8Z 1JJ2Y 3CME1 2E9HA 2Y0SA 1RLYA 3GTKI 2AKLA 1VQPZ 1Q811 1VQP1 2B63I 2JA8I 1YJN1 4HGZA 2RHBA 1KQSY 2QR1B 4BBRI 1VQL1 4MD9A 1NUIA 2PMZA 4MXUA 3NH5A 3CC21 4A3KI 2WAQA 3VB9A 2NVTI 3J80f 3HOWI 1X3WA 4NB8A 4CL1A 2JS4A 4NFRA 4DGLA 4DQYB 2JUBA 2QLVB 1QVGY 3OW2Z 5C4JI 5IP7I 5C4XI 4EWCA 3CCRZ 3CCR1 1VQKZ 3LUSA 1JWHC 3CXCZ 1P9NA 2ZAEB 2R93I 3G71Z 1TWCI 2NVXI 2PM9A 4DK1A 4QTTA 4RVHA 3G4SZ 2W03A 1Z03A 3EERA 2QRCB 3CQZI 4E2WA 4RVDA 1VQ6Z 4BXXI 1QF8A 2RPRA 1VQ61 3RZDI 3CD61 1TWAI 3CCJ1 5C44I 3NFZA 2IZ3A 3PO3I 1TWHI 2QRDB 4A3II 3S1NI 3MONA 2JR6A 3GTJI 2I3CA 4HH4A 3CCUZ 2QEXZ 3GTLI 2QEX1 1JJ2Z 3CCM1 1X3ZA 3CC7Z 2Q51A 1VQO1 2OTJ1 1YUAA 1KQSZ 2YADA 1LQLA 4A3EI 5LL6f 3H0GI 3G6EZ 3CCS1 3FKII 1VQ5Z 3G6E1 2V8KA 1YIJZ 1QVFY 2QA4Z 1ZB9A 1TFIA 2QA41 2NVYI 4E2XA 3GTOI 4MH4A 5FLMI 3CPWY 3CCQ1 4NBFA 1QVGZ 4E2YA 3CMEZ 1Q7Y2 2LFUA 1S721 1Q7Y1 1YJNZ 3S16I 1M1K2 3KIHA 2LIYA 4RVGA 1VQLZ 1ML8A 1VQ91 3GCFA 1M1K1 3I561 2E2JI 4X6AI 3S14I 1RO2A 4Y52I 3CC2Z 4BY7I 2M48A 4NBAA 2RBLA 2R6MA 3GTQI 5D1PA 3NDIA 5IT9b 3HKZA 1YIT1 1YJ9Z 1YJ91 1VQ41 3EEDA 1VLAA 1YHQ1 4A3DI 5C3EI 2R7ZI 3I07A 5T6BA 1KRLA 2E2II 3F3FC 2JA5I 3VMHA 2JMOA 3S2HI 3IF8A 3P5JB 2GTIA 3I4NI 3KIFA 5IT9f 1KC82 2JA7I 1ZB8A 2K5RA 4BBSI 1KC81 2GTHA 4MRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 1;  1VQ4 Z;  1VQ5 1;  1YHQ Z;  1W2B Z;  1NJI 2;  3CMA Z;  1YIJ 1;  3CMA 1;  1NJI 1;  3CCU Z;  2QEX Z;  2QEX 1;  1JJ2 Z;  3CCM 1;  1W2B Y;  3CC7 Z;  1KD1 1;  1VQN 1;  1VQO 1;  1N8R 2;  2OTJ 1;  1QVF Z;  3CD6 Z;  3CCJ Z;  3CCL 1;  1N8R 1;  1VQ8 Z;  1KQS Z;  1JJ2 Y;  3CME 1;  1YI2 1;  1VQP Z;  3G6E Z;  3CCS 1;  1Q81 1;  1VQ5 Z;  1VQP 1;  3G6E 1;  3CPW Z;  1YJN 1;  2OTL Z;  1YIJ Z;  1QVF Y;  2OTL 1;  2QA4 Z;  1KQS Y;  2QA4 1;  1VQL 1;  1VQM 1;  1Q82 2;  3CCM Z;  1Q82 1;  1VQ7 Z;  3CC2 1;  3CPW Y;  3CCQ 1;  1VQ7 1;  1VQK 1;  1VQN Z;  3I55 1;  1VQO Z;  2OTJ Z;  1QVG Z;  3CCL Z;  3CME Z;  3CCV Z;  1Q7Y 2;  1YI2 Z;  3CCV 1;  1S72 1;  3G71 1;  3CCS Z;  1Q7Y 1;  1YJN Z;  1QVG Y;  3OW2 Z;  3G4S 1;  1M1K 2;  1VQL Z;  1VQM Z;  1VQ9 1;  3CCR Z;  3I56 1;  1M1K 1;  3CCE Z;  3CCR 1;  1K73 2;  1M90 2;  3CCE 1;  1YJW 1;  3CC2 Z;  3CC4 1;  3CCQ Z;  1VQK Z;  3OW2 Y;  1K73 1;  3I55 Z;  1M90 1;  1K8A 2;  3CXC Z;  1YIT 1;  1YJ9 Z;  1K8A 1;  1YJ9 1;  1S72 Z;  3G71 Z;  1VQ4 1;  1YHQ 1;  3G4S Z;  3CXC Y;  3CCU 1;  1VQ9 Z;  1K9M 2;  1KD1 2;  3I56 Z;  1YJW Z;  1K9M 1;  3CC4 Z;  3CC7 1;  1VQ6 Z;  1VQ6 1;  1KC8 2;  3CD6 1;  3CCJ 1;  1Q81 2;  1Q86 2;  1YIT Z;  1VQ8 1;  1KC8 1; 
#chains in the Genus database with same CATH topology
 3HOV I;  2DE5 A;  4QTU A;  2JIP A;  2NAP A;  3GTM I;  3CMA Z;  3QWU A;  4HGY A;  3CMA 1;  4A3M I;  1WW9 A;  2VF1 A;  2J6A A;  3FQQ A;  2VPZ A;  3D9X A;  4A3L I;  2HF1 A;  2KI7 B;  3U50 C;  1I6H I;  1VQN 1;  3TE5 B;  3J7A 4;  1N8R 2;  1QVF Z;  2YU9 I;  3CD6 Z;  3CCJ Z;  2DE7 A;  3J81 b;  3CCL 1;  1N8R 1;  3M3Y I;  1Z02 A;  3T4N B;  4MON A;  1YI2 1;  2BJO A;  2VPX A;  2WB1 A;  3S1Q I;  1Z01 A;  3CPW Z;  2OTL Z;  4E33 A;  2OOY B;  3JAM f;  2RIQ A;  2OTL 1;  1R9T I;  3NH4 A;  3RZO I;  1VQM 1;  2O53 A;  3GTG I;  2NVQ I;  3CCM Z;  1QYP A;  5T67 A;  3J81 f;  3I55 1;  1VQO Z;  2OTJ Z;  1ZH1 A;  2P28 A;  2JA6 I;  3CCV Z;  4E32 A;  3CCV 1;  3CCS Z;  5T64 A;  2KPI A;  3PO3 S;  1I3Q I;  4S1T A;  2JIO A;  3I4M I;  2DE6 A;  5D1O A;  1K73 2;  1YJW 1;  3CC4 1;  3CCQ Z;  3S2D I;  1K73 1;  4E2Z A;  4RS4 A;  3VTN A;  5FLX f;  2QKD A;  4NOZ A;  4AYB A;  2R92 I;  1NP6 A;  2OZK A;  3S15 I;  1S72 Z;  3HOY I;  3BG1 B;  4TNU A;  4BY1 I;  3MZL B;  2F4M A;  4E30 A;  3HOZ I;  1USP B;  3PO2 I;  1RNI A;  1X0T A;  1VQ9 Z;  1KD1 2;  3I56 Z;  4A3F I;  1RQF A;  3NH8 A;  1Y1V S;  4A3B I;  5AN9 F;  4XX2 A;  2HU9 A;  1Q81 2;  1Q86 2;  3IFU A;  3GTP I;  3NDJ A;  1YIT Z;  1VQ8 1;  3S1M I;  1DL6 A;  1Q86 1;  3ESW A;  1VQ4 Z;  1YHQ Z;  1FDO A;  1WCM I;  1NJI 2;  4NBD A;  3VMG A;  5IP9 I;  1NJI 1;  1YUK A;  1W2B Y;  4NBC A;  5D1O B;  2F4O A;  1N2F A;  4NBB A;  3FQM A;  3GKQ A;  4NB9 A;  4A93 I;  1AA6 A;  1Q82 2;  2VUM I;  4A3G I;  3JAM b;  2G2K A;  1Q82 1;  5A2Q b;  1VQ7 Z;  4NH1 C;  2GU2 A;  1VQ7 1;  1VQK 1;  1VQN Z;  2W04 A;  3MZK B;  3HOU I;  1WII A;  3CCL Z;  2P3Y A;  2VPW A;  1YI2 Z;  1USP A;  2O4H A;  3BG0 B;  3G71 1;  5CM2 M;  1Y1W I;  1RO4 A;  3G4S 1;  2QRE B;  1VQM Z;  3GTM S;  3IX0 A;  5A2Q f;  3CCE Z;  1M90 2;  1TWG I;  3CCE 1;  3IR7 A;  1I50 I;  3Q87 A;  3OW2 Y;  4MD8 A;  3I55 Z;  1M90 1;  4RVF A;  3VMI A;  2V8I A;  1K8A 2;  2Q4Z A;  2V8J A;  1K83 I;  1K8A 1;  4NBE A;  2EGT A;  4Y7N I;  3F3P C;  5FLX b;  4E31 A;  1PFT A;  2JNY A;  2RT9 A;  2IZ4 A;  3TDH B;  1L1O C;  3CXC Y;  4A3J I;  3HOX I;  3S1R I;  3M4O I;  3CCU 1;  1K9M 2;  2E2H I;  2K3R A;  1TWF I;  4NBH A;  1YJW Z;  1K9M 1;  1SIW A;  3CC4 Z;  3H3V J;  3CC7 1;  2M6N A;  2VUG A;  2H85 A;  4RV9 A;  3D6W A;  1S7M A;  1SFO I;  1VQ5 1;  1W2B Z;  3S17 I;  1YIJ 1;  2OOX B;  3K7A I;  1Y1V I;  4A3C I;  1KD1 1;  4NBG A;  2PK7 A;  3J80 b;  1RO0 A;  4MD7 A;  1VQ8 Z;  1JJ2 Y;  3CME 1;  2E9H A;  2Y0S A;  1RLY A;  3GTK I;  2AKL A;  1VQP Z;  1Q81 1;  1VQP 1;  2B63 I;  2JA8 I;  1YJN 1;  4HGZ A;  2RHB A;  1KQS Y;  2QR1 B;  4BBR I;  1VQL 1;  4MD9 A;  1NUI A;  2PMZ A;  4MXU A;  3NH5 A;  3CC2 1;  4A3K I;  2WAQ A;  3VB9 A;  2NVT I;  2AYD A;  3J80 f;  3HOW I;  1X3W A;  1FDI A;  4NB8 A;  4CL1 A;  2E7Z A;  2JS4 A;  4NFR A;  4DGL A;  4DQY B;  2JUB A;  2QLV B;  1QVG Y;  3OW2 Z;  5C4J I;  5IP7 I;  5C4X I;  4EWC A;  2LEX A;  3CCR Z;  3CCR 1;  1VQK Z;  3LUS A;  1JWH C;  3CXC Z;  1P9N A;  2ZAE B;  2R93 I;  3G71 Z;  1TWC I;  2NVX I;  2PM9 A;  4DK1 A;  4QTT A;  4RVH A;  3G4S Z;  2W03 A;  1Z03 A;  3EER A;  2QRC B;  3CQZ I;  4E2W A;  4RVD A;  2IV2 X;  1VQ6 Z;  4BXX I;  1QF8 A;  2RPR A;  1VQ6 1;  3RZD I;  3CD6 1;  1TWA I;  3CCJ 1;  5C44 I;  3NFZ A;  2V45 A;  2IZ3 A;  3PO3 I;  1TWH I;  2QRD B;  4A3I I;  3S1N I;  3MON A;  2JR6 A;  2V3V A;  3GTJ I;  2I3C A;  4HH4 A;  3CCU Z;  2QEX Z;  3GTL I;  2QEX 1;  1JJ2 Z;  3CCM 1;  1X3Z A;  3D2L A;  3CC7 Z;  2Q51 A;  1VQO 1;  2OTJ 1;  1Y8C A;  1YUA A;  1KQS Z;  2YAD A;  1LQL A;  4A3E I;  5LL6 f;  3H0G I;  3G6E Z;  3CCS 1;  3FKI I;  1VQ5 Z;  3G6E 1;  2V8K A;  1YIJ Z;  1QVF Y;  2JIQ A;  2QA4 Z;  1ZB9 A;  1Q16 A;  1TFI A;  2QA4 1;  2NVY I;  4E2X A;  3GTO I;  4MH4 A;  5FLM I;  2VPY A;  3CPW Y;  3CCQ 1;  1WZN A;  4NBF A;  1QVG Z;  4E2Y A;  3CME Z;  1Q7Y 2;  2LFU A;  1S72 1;  1Q7Y 1;  2JIM A;  1YJN Z;  3S16 I;  1M1K 2;  3KIH A;  2LIY A;  1WJ2 A;  4RVG A;  1VQL Z;  1ML8 A;  1VQ9 1;  3GCF A;  1M1K 1;  3I56 1;  2E2J I;  4X6A I;  3S14 I;  1RO2 A;  1QXF A;  4Y52 I;  3CC2 Z;  4BY7 I;  2M48 A;  4NBA A;  2RBL A;  2R6M A;  3GTQ I;  5D1P A;  3NDI A;  5IT9 b;  3HKZ A;  1YIT 1;  1YJ9 Z;  1YJ9 1;  1VQ4 1;  3EED A;  1VLA A;  1YHQ 1;  4A3D I;  5C3E I;  2R7Z I;  3I07 A;  5T6B A;  1KRL A;  2E2I I;  3F3F C;  2JA5 I;  3VMH A;  2JMO A;  3S2H I;  3IF8 A;  3P5J B;  2GTI A;  3I4N I;  2JIR A;  3KIF A;  5IT9 f;  1KC8 2;  2JA7 I;  1ZB8 A;  2K5R A;  4BBS I;  1KC8 1;  2GTH A;  4MRI A; 
#chains in the Genus database with same CATH homology
 3HOV I;  2DE5 A;  4QTU A;  3GTM I;  3CMA Z;  3QWU A;  4HGY A;  3CMA 1;  4A3M I;  1WW9 A;  2VF1 A;  2J6A A;  3FQQ A;  3D9X A;  4A3L I;  2HF1 A;  2KI7 B;  3U50 C;  1I6H I;  1VQN 1;  3TE5 B;  3J7A 4;  1N8R 2;  1QVF Z;  2YU9 I;  3CD6 Z;  3CCJ Z;  2DE7 A;  3J81 b;  3CCL 1;  1N8R 1;  3M3Y I;  1Z02 A;  3T4N B;  4MON A;  1YI2 1;  2BJO A;  2WB1 A;  3S1Q I;  1Z01 A;  3CPW Z;  2OTL Z;  4E33 A;  2OOY B;  3JAM f;  2RIQ A;  2OTL 1;  1R9T I;  3NH4 A;  3RZO I;  1VQM 1;  2O53 A;  3GTG I;  2NVQ I;  3CCM Z;  1QYP A;  5T67 A;  3J81 f;  3I55 1;  1VQO Z;  2OTJ Z;  1ZH1 A;  2P28 A;  2JA6 I;  3CCV Z;  4E32 A;  3CCV 1;  3CCS Z;  5T64 A;  2KPI A;  3PO3 S;  1I3Q I;  4S1T A;  3I4M I;  2DE6 A;  5D1O A;  1K73 2;  1YJW 1;  3CC4 1;  3CCQ Z;  3S2D I;  1K73 1;  4E2Z A;  4RS4 A;  3VTN A;  5FLX f;  2QKD A;  4NOZ A;  4AYB A;  2R92 I;  1NP6 A;  2OZK A;  3S15 I;  1S72 Z;  3HOY I;  3BG1 B;  4TNU A;  4BY1 I;  3MZL B;  2F4M A;  4E30 A;  3HOZ I;  1USP B;  3PO2 I;  1RNI A;  1X0T A;  1VQ9 Z;  1KD1 2;  3I56 Z;  4A3F I;  1RQF A;  3NH8 A;  1Y1V S;  4A3B I;  5AN9 F;  4XX2 A;  2HU9 A;  1Q81 2;  1Q86 2;  3IFU A;  3GTP I;  3NDJ A;  1YIT Z;  1VQ8 1;  3S1M I;  1DL6 A;  1Q86 1;  3ESW A;  1VQ4 Z;  1YHQ Z;  1WCM I;  1NJI 2;  4NBD A;  3VMG A;  5IP9 I;  1NJI 1;  1YUK A;  1W2B Y;  4NBC A;  5D1O B;  2F4O A;  1N2F A;  4NBB A;  3FQM A;  3GKQ A;  4NB9 A;  4A93 I;  1Q82 2;  2VUM I;  4A3G I;  3JAM b;  2G2K A;  1Q82 1;  5A2Q b;  1VQ7 Z;  4NH1 C;  2GU2 A;  1VQ7 1;  1VQK 1;  1VQN Z;  2W04 A;  3MZK B;  3HOU I;  1WII A;  3CCL Z;  2P3Y A;  1YI2 Z;  1USP A;  2O4H A;  3BG0 B;  3G71 1;  5CM2 M;  1Y1W I;  1RO4 A;  3G4S 1;  2QRE B;  1VQM Z;  3GTM S;  3IX0 A;  5A2Q f;  3CCE Z;  1M90 2;  1TWG I;  3CCE 1;  1I50 I;  3Q87 A;  3OW2 Y;  4MD8 A;  3I55 Z;  1M90 1;  4RVF A;  3VMI A;  2V8I A;  1K8A 2;  2Q4Z A;  2V8J A;  1K83 I;  1K8A 1;  4NBE A;  2EGT A;  4Y7N I;  3F3P C;  5FLX b;  4E31 A;  1PFT A;  2JNY A;  2RT9 A;  2IZ4 A;  3TDH B;  1L1O C;  3CXC Y;  4A3J I;  3HOX I;  3S1R I;  3M4O I;  3CCU 1;  1K9M 2;  2E2H I;  2K3R A;  1TWF I;  4NBH A;  1YJW Z;  1K9M 1;  3CC4 Z;  3H3V J;  3CC7 1;  2M6N A;  2VUG A;  2H85 A;  4RV9 A;  3D6W A;  1S7M A;  1SFO I;  1VQ5 1;  1W2B Z;  3S17 I;  1YIJ 1;  2OOX B;  3K7A I;  1Y1V I;  4A3C I;  1KD1 1;  4NBG A;  2PK7 A;  3J80 b;  1RO0 A;  4MD7 A;  1VQ8 Z;  1JJ2 Y;  3CME 1;  2E9H A;  2Y0S A;  1RLY A;  3GTK I;  2AKL A;  1VQP Z;  1Q81 1;  1VQP 1;  2B63 I;  2JA8 I;  1YJN 1;  4HGZ A;  2RHB A;  1KQS Y;  2QR1 B;  4BBR I;  1VQL 1;  4MD9 A;  1NUI A;  2PMZ A;  4MXU A;  3NH5 A;  3CC2 1;  4A3K I;  2WAQ A;  3VB9 A;  2NVT I;  3J80 f;  3HOW I;  1X3W A;  4NB8 A;  4CL1 A;  2JS4 A;  4NFR A;  4DGL A;  4DQY B;  2JUB A;  2QLV B;  1QVG Y;  3OW2 Z;  5C4J I;  5IP7 I;  5C4X I;  4EWC A;  3CCR Z;  3CCR 1;  1VQK Z;  3LUS A;  1JWH C;  3CXC Z;  1P9N A;  2ZAE B;  2R93 I;  3G71 Z;  1TWC I;  2NVX I;  2PM9 A;  4DK1 A;  4QTT A;  4RVH A;  3G4S Z;  2W03 A;  1Z03 A;  3EER A;  2QRC B;  3CQZ I;  4E2W A;  4RVD A;  1VQ6 Z;  4BXX I;  1QF8 A;  2RPR A;  1VQ6 1;  3RZD I;  3CD6 1;  1TWA I;  3CCJ 1;  5C44 I;  3NFZ A;  2IZ3 A;  3PO3 I;  1TWH I;  2QRD B;  4A3I I;  3S1N I;  3MON A;  2JR6 A;  3GTJ I;  2I3C A;  4HH4 A;  3CCU Z;  2QEX Z;  3GTL I;  2QEX 1;  1JJ2 Z;  3CCM 1;  1X3Z A;  3CC7 Z;  2Q51 A;  1VQO 1;  2OTJ 1;  1YUA A;  1KQS Z;  2YAD A;  1LQL A;  4A3E I;  5LL6 f;  3H0G I;  3G6E Z;  3CCS 1;  3FKI I;  1VQ5 Z;  3G6E 1;  2V8K A;  1YIJ Z;  1QVF Y;  2QA4 Z;  1ZB9 A;  1TFI A;  2QA4 1;  2NVY I;  4E2X A;  3GTO I;  4MH4 A;  5FLM I;  3CPW Y;  3CCQ 1;  4NBF A;  1QVG Z;  4E2Y A;  3CME Z;  1Q7Y 2;  2LFU A;  1S72 1;  1Q7Y 1;  1YJN Z;  3S16 I;  1M1K 2;  3KIH A;  2LIY A;  4RVG A;  1VQL Z;  1ML8 A;  1VQ9 1;  3GCF A;  1M1K 1;  3I56 1;  2E2J I;  4X6A I;  3S14 I;  1RO2 A;  4Y52 I;  3CC2 Z;  4BY7 I;  2M48 A;  4NBA A;  2RBL A;  2R6M A;  3GTQ I;  5D1P A;  3NDI A;  5IT9 b;  3HKZ A;  1YIT 1;  1YJ9 Z;  1YJ9 1;  1VQ4 1;  3EED A;  1VLA A;  1YHQ 1;  4A3D I;  5C3E I;  2R7Z I;  3I07 A;  5T6B A;  1KRL A;  2E2I I;  3F3F C;  2JA5 I;  3VMH A;  2JMO A;  3S2H I;  3IF8 A;  3P5J B;  2GTI A;  3I4N I;  3KIF A;  5IT9 f;  1KC8 2;  2JA7 I;  1ZB8 A;  2K5R A;  4BBS I;  1KC8 1;  2GTH A;  4MRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...