1YHQZ

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2005-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yhqZ00
1VQNZ 1W2BY 1M902 1YHQZ 1KQSY 1KC81 1VQ8Z 1K9M1 3G4S1 1VQO1 1VQ91 1KD11 3CD61 1QVGY 3CPWZ 1VQ81 3G4SZ 1K731 1N8R2 3CCJZ 1VQ9Z 3CD6Z 1VQK1 1Q811 2OTL1 1K8A2 2QA41 1YJN1 1Q861 2OTJ1 2OTLZ 3CCSZ 2QA4Z 3I56Z 2OTJZ 1KC82 3OW2Z 1K9M2 1Q821 3I551 3CCR1 1QVFY 1VQ51 1VQM1 1KD12 1JJ2Z 1VQOZ 3G711 1W2BZ 3I55Z 2QEX1 3CCRZ 1YJ91 1K732 1KQSZ 1S721 1VQ5Z 1VQMZ 3G6E1 1NJI1 3G71Z 1YJ9Z 2QEXZ 1Q812 1QVGZ 1VQKZ 3G6EZ 1Q862 1YJNZ 3CCQ1 1YJW1 1Q7Y1 1YIT1 1M1K1 3CC41 3CCQZ 1YJWZ 1YITZ 1Q822 3CXCY 3CCV1 1VQP1 1VQ71 1VQ61 3CCL1 3CC4Z 1VQN1 1YHQ1 3CPWY 1M901 1VQ7Z 3CCVZ 1VQPZ 1VQ6Z 3CCLZ 1VQL1 1S72Z 1QVFZ 1NJI2 3CME1 3CXCZ 1VQLZ 3CCJ1 3CC21 1YI21 1N8R1 3CMEZ 1VQ41 1Q7Y2 1M1K2 3CMA1 3CC2Z 1YI2Z 3CCU1 3CCM1 3CCE1 3CC71 1K8A1 1YIJ1 1VQ4Z 3OW2Y 3CMAZ 3CCS1 1JJ2Y 3CCUZ 3I561 3CCMZ 3CCEZ 3CC7Z 1YIJZ
chains in the Genus database with same CATH superfamily
3T4NB 2VPXA 2E2JI 1RQFA 1WZNA 4NH1C 1K83I 1FDIA 4BY7I 1SIWA 1Y8CA 2QRDB 1K9M1 2JIMA 3G4S1 3QWUA 3GTMI 1NUIA 1KD11 4HGZA 3CD61 4RVGA 2VPYA 2DE5A 4NBEA 3G4SZ 4NBFA 1R9TI 5FLXf 1YUAA 3CD6Z 2JIQA 3F3FC 2JA8I 5T67A 3I4NI 2OTL1 1K8A2 3HOUI 2JR6A 2QA41 5C4JI 4E30A 2NVYI 4NFRA 2OTLZ 2QA4Z 2JS4A 5C44I 3D6WA 1N2FA 2QKDA 4Y7NI 4NB9A 3F3PC 3HOXI 1RO4A 1K9M2 1QVFY 1VQM1 1KD12 3NH5A 1RLYA 1WW9A 3G711 1YJ91 2QEX1 3NDJA 1S721 1VQMZ 3S1QI 1TFIA 2Q4ZA 3BG0B 4MRIA 2G2KA 1NJI1 3G71Z 4MD8A 1YJ9Z 4E2YA 2QEXZ 5FLXb 1VQKZ 3IFUA 4A3JI 2O53A 3GTLI 4BBSI 1YJW1 3MZKB 4NBDA 3GCFA 1YJWZ 1ZH1A 2K5RA 1PFTA 4A3II 3RZDI 2RIQA 1YHQ1 3FQMA 3PO3I 5D1OB 5A2Qf 1DL6A 4A3KI 2NVQI 1QVFZ 1NJI2 4TNUA 4AYBA 3S2HI 3CXCZ 5CM2M 3CC21 1YI21 2IV2X 3LUSA 2QRCB 1VQ41 2VPZA 2W04A 2QR1B 2ZAEB 4XX2A 2VUMI 3CC2Z 1YI2Z 4E33A 3CCM1 3CC71 2JIPA 1VQ4Z 3RZOI 3HOWI 3I561 2RPRA 1Q16A 2V8IA 3CCMZ 3CC7Z 2PM9A 1JJ2Y 1VQ81 1I50I 1Y1WI 1NP6A 2DE7A 1KC81 1ML8A 1VQ8Z 2W03A 4MD9A 1VQ91 3VB9A 1USPB 4QTTA 1K731 3CCJZ 1VQ9Z 2P28A 3U50C 4A3BI 3NH8A 3HOYI 5IP7I 2DE6A 4Y52I 3GTPI 4NBHA 3GTMS 2O4HA 2NAPA 4A3CI 4S1TA 1KC82 2E9HA 2V45A 1Q821 4NBBA 4NBAA 3J80f 2F4MA 3I551 2VUGA 4RS4A 4CL1A 1JJ2Z 3Q87A 3IX0A 1RO0A 1QF8A 3I55Z 3VMGA 1K732 1WJ2A 1AA6A 2LIYA 3S17I 2GU2A 1I6HI 2B63I 3S1NI 2R7ZI 4BBRI 1S7MA 2IZ4A 3GTQI 1Q7Y1 3GTGI 4MONA 2KPIA 5C4XI 3CC41 4NOZA 5LL6f 3S14I 4BXXI 3VMHA 1Q822 3CXCY 1VQP1 1X3ZA 4A3EI 1VQ71 4NBGA 2VF1A 3CCL1 3CC4Z 1TWCI 1ZB9A 1VQN1 1P9NA 4MXUA 3CPWY 1M901 1VQ7Z 1VQPZ 3S2DI 3D9XA 4RV9A 3S1RI 3CCLZ 1VQL1 2RBLA 3TDHB 2OZKA 1S72Z 2JIOA 3GTKI 1X3WA 1VQLZ 2BJOA 3M3YI 1N8R1 4QTUA 3HOZI 3EEDA 2RT9A 1Q7Y2 3PO3S 1KRLA 1VLAA 1I3QI 5T64A 2M6NA 2R92I 2YU9I 2V8JA 3CCS1 3GTJI 2JIRA 1SFOI 2J6AA 4DQYB 1M902 3IF8A 1YHQZ 1KQSY 4E2WA 1VQO1 1L1OC 5D1OA 2V3VA 3CPWZ 1N8R2 5IT9f 2JUBA 1YUKA 5AN9F 2YADA 1YJN1 2EGTA 4RVDA 3S1MI 3ESWA 2OTJ1 1TWGI 3I56Z 3JAMf 1Z01A 2OTJZ 3FQQA 2GTIA 5A2Qb 1RNIA 1VQ51 4NB8A 2JA7I 2KI7B 2LEXA 1KQSZ 1VQ5Z 2VPWA 2P3YA 1USPA 1LQLA 3HOVI 1X0TA 1Z02A 1Y1VS 2RHBA 2AYDA 1M1K1 3KIHA 2IZ3A 4MD7A 1Y1VI 1RO2A 3VTNA 2R93I 3D2LA 4RVFA 4EWCA 2NVTI 2QLVB 3CME1 4E31A 5FLMI 3TE5B 3CMEZ 2HF1A 1M1K2 3H0GI 2JA5I 4A3FI 3CCU1 3IR7A 3CCE1 4HH4A 1YIJ1 2E7ZA 3OW2Y 2JMOA 2PK7A 3J81f 4A3GI 3CCUZ 2GTHA 3CCEZ 3J80b 1YIJZ 3NFZA 2V8KA 3H3VJ 1VQNZ 1W2BY 3GTOI 2M48A 1QVGY 1QXFA 2Q51A 1JWHC 3I4MI 4E32A 1VQK1 3I07A 1Q811 3K7AI 1TWAI 1Q861 5IP9I 2E2HI 3CCSZ 3FKII 3J81b 2HU9A 4A3DI 3OW2Z 3CCR1 3VMIA 2F4OA 2Y0SA 3MONA 1VQOZ 1WIIA 2JA6I 1W2BZ 3CCRZ 2K3RA 4X6AI 1WCMI 3PO2I 3G6E1 5D1PA 4E2ZA 3KIFA 3GKQA 4E2XA 3P5JB 1Q812 3J7A4 3S16I 1TWHI 1QVGZ 3M4OI 3G6EZ 1Q862 1YJNZ 1Z03A 3CCQ1 4HGYA 1FDOA 4MH4A 1YIT1 4BY1I 3S15I 2E2II 2R6MA 3BG1B 2AKLA 5C3EI 3CCQZ 1YITZ 3CCV1 1VQ61 3CQZI 1ZB8A 2QREB 4A3LI 3CCVZ 2PMZA 1VQ6Z 3HKZA 5T6BA 3EERA 5IT9b 2WB1A 4NBCA 2NVXI 1QYPA 4DGLA 3CCJ1 2LFUA 3MZLB 4RVHA 2JNYA 3NDIA 3NH4A 2WAQA 2H85A 4DK1A 3CMA1 4A93I 2OOYB 1K8A1 2I3CA 2OOXB 3JAMb 4A3MI 3CMAZ 1TWFI
chains in the Genus database with same CATH topology
3T4NB 2E2JI 1RQFA 4NH1C 1K83I 4BY7I 2QRDB 1K9M1 3G4S1 3QWUA 3GTMI 1NUIA 1KD11 4HGZA 3CD61 4RVGA 2DE5A 4NBEA 3G4SZ 4NBFA 1R9TI 5FLXf 1YUAA 3CD6Z 3F3FC 2JA8I 5T67A 3I4NI 2OTL1 1K8A2 3HOUI 2JR6A 2QA41 5C4JI 4E30A 2NVYI 4NFRA 2OTLZ 2QA4Z 2JS4A 5C44I 3D6WA 1N2FA 2QKDA 4Y7NI 4NB9A 3F3PC 3HOXI 1RO4A 1K9M2 1QVFY 1VQM1 1KD12 3NH5A 1RLYA 1WW9A 3G711 1YJ91 2QEX1 3NDJA 1S721 1VQMZ 3S1QI 1TFIA 2Q4ZA 3BG0B 4MRIA 2G2KA 1NJI1 3G71Z 4MD8A 1YJ9Z 4E2YA 2QEXZ 5FLXb 1VQKZ 3IFUA 4A3JI 2O53A 3GTLI 4BBSI 1YJW1 3MZKB 4NBDA 3GCFA 1YJWZ 1ZH1A 2K5RA 1PFTA 4A3II 3RZDI 2RIQA 1YHQ1 3FQMA 3PO3I 5D1OB 5A2Qf 1DL6A 4A3KI 2NVQI 1QVFZ 1NJI2 4TNUA 4AYBA 3S2HI 3CXCZ 5CM2M 3CC21 1YI21 3LUSA 2QRCB 1VQ41 2W04A 2QR1B 2ZAEB 4XX2A 2VUMI 3CC2Z 1YI2Z 4E33A 3CCM1 3CC71 1VQ4Z 3RZOI 3HOWI 3I561 2RPRA 3CCMZ 2V8IA 3CC7Z 2PM9A 1JJ2Y 1VQ81 1I50I 1Y1WI 1NP6A 2DE7A 1KC81 1ML8A 1VQ8Z 2W03A 4MD9A 1VQ91 3VB9A 1USPB 4QTTA 1K731 3CCJZ 1VQ9Z 2P28A 3U50C 4A3BI 3NH8A 3HOYI 5IP7I 2DE6A 4Y52I 3GTPI 4NBHA 3GTMS 2O4HA 4A3CI 4S1TA 1KC82 2E9HA 1Q821 4NBBA 4NBAA 3J80f 2F4MA 3I551 2VUGA 4RS4A 4CL1A 1JJ2Z 3Q87A 3IX0A 1RO0A 1QF8A 3I55Z 3VMGA 1K732 2LIYA 3S17I 2GU2A 1I6HI 2B63I 3S1NI 2R7ZI 4BBRI 1S7MA 2IZ4A 3GTQI 1Q7Y1 3GTGI 4MONA 2KPIA 5C4XI 3CC41 4NOZA 5LL6f 3S14I 4BXXI 3VMHA 1Q822 3CXCY 1VQP1 1X3ZA 4A3EI 1VQ71 4NBGA 2VF1A 3CCL1 3CC4Z 1TWCI 1ZB9A 1VQN1 1P9NA 4MXUA 3CPWY 1M901 1VQ7Z 1VQPZ 3S2DI 3D9XA 4RV9A 3S1RI 3CCLZ 1VQL1 2RBLA 3TDHB 2OZKA 1S72Z 3GTKI 1X3WA 1VQLZ 2BJOA 3M3YI 1N8R1 4QTUA 3HOZI 3EEDA 2RT9A 1Q7Y2 3PO3S 1KRLA 1VLAA 1I3QI 5T64A 2M6NA 2R92I 2YU9I 2V8JA 3CCS1 3GTJI 1SFOI 2J6AA 4DQYB 1M902 3IF8A 1YHQZ 1KQSY 4E2WA 1VQO1 1L1OC 5D1OA 3CPWZ 1N8R2 5IT9f 2JUBA 1YUKA 5AN9F 2YADA 1YJN1 2EGTA 4RVDA 3S1MI 3ESWA 2OTJ1 1TWGI 3I56Z 3JAMf 1Z01A 2OTJZ 3FQQA 2GTIA 5A2Qb 1RNIA 1VQ51 4NB8A 2JA7I 2KI7B 1KQSZ 1VQ5Z 2P3YA 1USPA 1LQLA 3HOVI 1X0TA 1Z02A 1Y1VS 2RHBA 1M1K1 3KIHA 2IZ3A 4MD7A 1Y1VI 1RO2A 3VTNA 2R93I 4RVFA 4EWCA 2NVTI 2QLVB 3CME1 4E31A 5FLMI 3TE5B 3CMEZ 2HF1A 1M1K2 3H0GI 2JA5I 4A3FI 3CCU1 3CCE1 4HH4A 1YIJ1 3OW2Y 2JMOA 2PK7A 3J81f 4A3GI 3CCUZ 2GTHA 3CCEZ 3J80b 1YIJZ 3NFZA 2V8KA 3H3VJ 1VQNZ 1W2BY 3GTOI 2M48A 1QVGY 2Q51A 1JWHC 3I4MI 4E32A 1VQK1 3I07A 1Q811 3K7AI 1TWAI 1Q861 5IP9I 2E2HI 3CCSZ 3FKII 3J81b 2HU9A 4A3DI 3OW2Z 3CCR1 3VMIA 2F4OA 1VQOZ 2Y0SA 3MONA 1WIIA 2JA6I 1W2BZ 3CCRZ 2K3RA 4X6AI 1WCMI 3PO2I 3G6E1 5D1PA 4E2ZA 3KIFA 3GKQA 4E2XA 3P5JB 1Q812 3J7A4 3S16I 1TWHI 1QVGZ 3M4OI 3G6EZ 1Q862 1YJNZ 1Z03A 3CCQ1 4HGYA 4MH4A 4BY1I 1YIT1 3S15I 2E2II 2R6MA 3BG1B 2AKLA 5C3EI 3CCQZ 1YITZ 3CCV1 1VQ61 3CQZI 1ZB8A 2QREB 4A3LI 3CCVZ 2PMZA 1VQ6Z 3HKZA 5T6BA 3EERA 5IT9b 2WB1A 4NBCA 2NVXI 1QYPA 4DGLA 3CCJ1 2LFUA 3MZLB 4RVHA 2JNYA 3NDIA 3NH4A 2WAQA 2H85A 4DK1A 3CMA1 4A93I 2OOYB 1K8A1 2I3CA 2OOXB 3JAMb 4A3MI 3CMAZ 1TWFI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN Z;  1W2B Y;  1M90 2;  1YHQ Z;  1KQS Y;  1KC8 1;  1VQ8 Z;  1K9M 1;  3G4S 1;  1VQO 1;  1VQ9 1;  1KD1 1;  3CD6 1;  1QVG Y;  3CPW Z;  1VQ8 1;  3G4S Z;  1K73 1;  1N8R 2;  3CCJ Z;  1VQ9 Z;  3CD6 Z;  1VQK 1;  1Q81 1;  2OTL 1;  1K8A 2;  2QA4 1;  1YJN 1;  1Q86 1;  2OTJ 1;  2OTL Z;  3CCS Z;  2QA4 Z;  3I56 Z;  2OTJ Z;  1KC8 2;  3OW2 Z;  1K9M 2;  1Q82 1;  3I55 1;  3CCR 1;  1QVF Y;  1VQ5 1;  1VQM 1;  1KD1 2;  1JJ2 Z;  1VQO Z;  3G71 1;  1W2B Z;  3I55 Z;  2QEX 1;  3CCR Z;  1YJ9 1;  1K73 2;  1KQS Z;  1S72 1;  1VQ5 Z;  1VQM Z;  3G6E 1;  1NJI 1;  3G71 Z;  1YJ9 Z;  2QEX Z;  1Q81 2;  1QVG Z;  1VQK Z;  3G6E Z;  1Q86 2;  1YJN Z;  3CCQ 1;  1YJW 1;  1Q7Y 1;  1YIT 1;  1M1K 1;  3CC4 1;  3CCQ Z;  1YJW Z;  1YIT Z;  1Q82 2;  3CXC Y;  3CCV 1;  1VQP 1;  1VQ7 1;  1VQ6 1;  3CCL 1;  3CC4 Z;  1VQN 1;  1YHQ 1;  3CPW Y;  1M90 1;  1VQ7 Z;  3CCV Z;  1VQP Z;  1VQ6 Z;  3CCL Z;  1VQL 1;  1S72 Z;  1QVF Z;  1NJI 2;  3CME 1;  3CXC Z;  1VQL Z;  3CCJ 1;  3CC2 1;  1YI2 1;  1N8R 1;  3CME Z;  1VQ4 1;  1Q7Y 2;  1M1K 2;  3CMA 1;  3CC2 Z;  1YI2 Z;  3CCU 1;  3CCM 1;  3CCE 1;  3CC7 1;  1K8A 1;  1YIJ 1;  1VQ4 Z;  3OW2 Y;  3CMA Z;  3CCS 1;  1JJ2 Y;  3CCU Z;  3I56 1;  3CCM Z;  3CCE Z;  3CC7 Z;  1YIJ Z; 
#chains in the Genus database with same CATH topology
 3T4N B;  2VPX A;  2E2J I;  1RQF A;  1WZN A;  4NH1 C;  1K83 I;  1FDI A;  4BY7 I;  1SIW A;  1Y8C A;  2QRD B;  1K9M 1;  2JIM A;  3G4S 1;  3QWU A;  3GTM I;  1NUI A;  1KD1 1;  4HGZ A;  3CD6 1;  4RVG A;  2VPY A;  2DE5 A;  4NBE A;  3G4S Z;  4NBF A;  1R9T I;  5FLX f;  1YUA A;  3CD6 Z;  2JIQ A;  3F3F C;  2JA8 I;  5T67 A;  3I4N I;  2OTL 1;  1K8A 2;  3HOU I;  2JR6 A;  2QA4 1;  5C4J I;  4E30 A;  2NVY I;  4NFR A;  2OTL Z;  2QA4 Z;  2JS4 A;  5C44 I;  3D6W A;  1N2F A;  2QKD A;  4Y7N I;  4NB9 A;  3F3P C;  3HOX I;  1RO4 A;  1K9M 2;  1QVF Y;  1VQM 1;  1KD1 2;  3NH5 A;  1RLY A;  1WW9 A;  3G71 1;  1YJ9 1;  2QEX 1;  3NDJ A;  1S72 1;  1VQM Z;  3S1Q I;  1TFI A;  2Q4Z A;  3BG0 B;  4MRI A;  2G2K A;  1NJI 1;  3G71 Z;  4MD8 A;  1YJ9 Z;  4E2Y A;  2QEX Z;  5FLX b;  1VQK Z;  3IFU A;  4A3J I;  2O53 A;  3GTL I;  4BBS I;  1YJW 1;  3MZK B;  4NBD A;  3GCF A;  1YJW Z;  1ZH1 A;  2K5R A;  1PFT A;  4A3I I;  3RZD I;  2RIQ A;  1YHQ 1;  3FQM A;  3PO3 I;  5D1O B;  5A2Q f;  1DL6 A;  4A3K I;  2NVQ I;  1QVF Z;  1NJI 2;  4TNU A;  4AYB A;  3S2H I;  3CXC Z;  5CM2 M;  3CC2 1;  1YI2 1;  2IV2 X;  3LUS A;  2QRC B;  1VQ4 1;  2VPZ A;  2W04 A;  2QR1 B;  2ZAE B;  4XX2 A;  2VUM I;  3CC2 Z;  1YI2 Z;  4E33 A;  3CCM 1;  3CC7 1;  2JIP A;  1VQ4 Z;  3RZO I;  3HOW I;  3I56 1;  2RPR A;  1Q16 A;  2V8I A;  3CCM Z;  3CC7 Z;  2PM9 A;  1JJ2 Y;  1VQ8 1;  1I50 I;  1Y1W I;  1NP6 A;  2DE7 A;  1KC8 1;  1ML8 A;  1VQ8 Z;  2W03 A;  4MD9 A;  1VQ9 1;  3VB9 A;  1USP B;  4QTT A;  1K73 1;  3CCJ Z;  1VQ9 Z;  2P28 A;  3U50 C;  4A3B I;  3NH8 A;  3HOY I;  5IP7 I;  2DE6 A;  4Y52 I;  3GTP I;  4NBH A;  3GTM S;  2O4H A;  2NAP A;  4A3C I;  4S1T A;  1KC8 2;  2E9H A;  2V45 A;  1Q82 1;  4NBB A;  4NBA A;  3J80 f;  2F4M A;  3I55 1;  2VUG A;  4RS4 A;  4CL1 A;  1JJ2 Z;  3Q87 A;  3IX0 A;  1RO0 A;  1QF8 A;  3I55 Z;  3VMG A;  1K73 2;  1WJ2 A;  1AA6 A;  2LIY A;  3S17 I;  2GU2 A;  1I6H I;  2B63 I;  3S1N I;  2R7Z I;  4BBR I;  1S7M A;  2IZ4 A;  3GTQ I;  1Q7Y 1;  3GTG I;  4MON A;  2KPI A;  5C4X I;  3CC4 1;  4NOZ A;  5LL6 f;  3S14 I;  4BXX I;  3VMH A;  1Q82 2;  3CXC Y;  1VQP 1;  1X3Z A;  4A3E I;  1VQ7 1;  4NBG A;  2VF1 A;  3CCL 1;  3CC4 Z;  1TWC I;  1ZB9 A;  1VQN 1;  1P9N A;  4MXU A;  3CPW Y;  1M90 1;  1VQ7 Z;  1VQP Z;  3S2D I;  3D9X A;  4RV9 A;  3S1R I;  3CCL Z;  1VQL 1;  2RBL A;  3TDH B;  2OZK A;  1S72 Z;  2JIO A;  3GTK I;  1X3W A;  1VQL Z;  2BJO A;  3M3Y I;  1N8R 1;  4QTU A;  3HOZ I;  3EED A;  2RT9 A;  1Q7Y 2;  3PO3 S;  1KRL A;  1VLA A;  1I3Q I;  5T64 A;  2M6N A;  2R92 I;  2YU9 I;  2V8J A;  3CCS 1;  3GTJ I;  2JIR A;  1SFO I;  2J6A A;  4DQY B;  1M90 2;  3IF8 A;  1YHQ Z;  1KQS Y;  4E2W A;  1VQO 1;  1L1O C;  5D1O A;  2V3V A;  3CPW Z;  1N8R 2;  5IT9 f;  2JUB A;  1YUK A;  5AN9 F;  2YAD A;  1YJN 1;  2EGT A;  4RVD A;  3S1M I;  3ESW A;  2OTJ 1;  1TWG I;  3I56 Z;  3JAM f;  1Z01 A;  2OTJ Z;  3FQQ A;  2GTI A;  5A2Q b;  1RNI A;  1VQ5 1;  4NB8 A;  2JA7 I;  2KI7 B;  2LEX A;  1KQS Z;  1VQ5 Z;  2VPW A;  2P3Y A;  1USP A;  1LQL A;  3HOV I;  1X0T A;  1Z02 A;  1Y1V S;  2RHB A;  2AYD A;  1M1K 1;  3KIH A;  2IZ3 A;  4MD7 A;  1Y1V I;  1RO2 A;  3VTN A;  2R93 I;  3D2L A;  4RVF A;  4EWC A;  2NVT I;  2QLV B;  3CME 1;  4E31 A;  5FLM I;  3TE5 B;  3CME Z;  2HF1 A;  1M1K 2;  3H0G I;  2JA5 I;  4A3F I;  3CCU 1;  3IR7 A;  3CCE 1;  4HH4 A;  1YIJ 1;  2E7Z A;  3OW2 Y;  2JMO A;  2PK7 A;  3J81 f;  4A3G I;  3CCU Z;  2GTH A;  3CCE Z;  3J80 b;  1YIJ Z;  3NFZ A;  2V8K A;  3H3V J;  1VQN Z;  1W2B Y;  3GTO I;  2M48 A;  1QVG Y;  1QXF A;  2Q51 A;  1JWH C;  3I4M I;  4E32 A;  1VQK 1;  3I07 A;  1Q81 1;  3K7A I;  1TWA I;  1Q86 1;  5IP9 I;  2E2H I;  3CCS Z;  3FKI I;  3J81 b;  2HU9 A;  4A3D I;  3OW2 Z;  3CCR 1;  3VMI A;  2F4O A;  2Y0S A;  3MON A;  1VQO Z;  1WII A;  2JA6 I;  1W2B Z;  3CCR Z;  2K3R A;  4X6A I;  1WCM I;  3PO2 I;  3G6E 1;  5D1P A;  4E2Z A;  3KIF A;  3GKQ A;  4E2X A;  3P5J B;  1Q81 2;  3J7A 4;  3S16 I;  1TWH I;  1QVG Z;  3M4O I;  3G6E Z;  1Q86 2;  1YJN Z;  1Z03 A;  3CCQ 1;  4HGY A;  1FDO A;  4MH4 A;  1YIT 1;  4BY1 I;  3S15 I;  2E2I I;  2R6M A;  3BG1 B;  2AKL A;  5C3E I;  3CCQ Z;  1YIT Z;  3CCV 1;  1VQ6 1;  3CQZ I;  1ZB8 A;  2QRE B;  4A3L I;  3CCV Z;  2PMZ A;  1VQ6 Z;  3HKZ A;  5T6B A;  3EER A;  5IT9 b;  2WB1 A;  4NBC A;  2NVX I;  1QYP A;  4DGL A;  3CCJ 1;  2LFU A;  3MZL B;  4RVH A;  2JNY A;  3NDI A;  3NH4 A;  2WAQ A;  2H85 A;  4DK1 A;  3CMA 1;  4A93 I;  2OOY B;  1K8A 1;  2I3C A;  2OOX B;  3JAM b;  4A3M I;  3CMA Z;  1TWF I; 
#chains in the Genus database with same CATH homology
 3T4N B;  2E2J I;  1RQF A;  4NH1 C;  1K83 I;  4BY7 I;  2QRD B;  1K9M 1;  3G4S 1;  3QWU A;  3GTM I;  1NUI A;  1KD1 1;  4HGZ A;  3CD6 1;  4RVG A;  2DE5 A;  4NBE A;  3G4S Z;  4NBF A;  1R9T I;  5FLX f;  1YUA A;  3CD6 Z;  3F3F C;  2JA8 I;  5T67 A;  3I4N I;  2OTL 1;  1K8A 2;  3HOU I;  2JR6 A;  2QA4 1;  5C4J I;  4E30 A;  2NVY I;  4NFR A;  2OTL Z;  2QA4 Z;  2JS4 A;  5C44 I;  3D6W A;  1N2F A;  2QKD A;  4Y7N I;  4NB9 A;  3F3P C;  3HOX I;  1RO4 A;  1K9M 2;  1QVF Y;  1VQM 1;  1KD1 2;  3NH5 A;  1RLY A;  1WW9 A;  3G71 1;  1YJ9 1;  2QEX 1;  3NDJ A;  1S72 1;  1VQM Z;  3S1Q I;  1TFI A;  2Q4Z A;  3BG0 B;  4MRI A;  2G2K A;  1NJI 1;  3G71 Z;  4MD8 A;  1YJ9 Z;  4E2Y A;  2QEX Z;  5FLX b;  1VQK Z;  3IFU A;  4A3J I;  2O53 A;  3GTL I;  4BBS I;  1YJW 1;  3MZK B;  4NBD A;  3GCF A;  1YJW Z;  1ZH1 A;  2K5R A;  1PFT A;  4A3I I;  3RZD I;  2RIQ A;  1YHQ 1;  3FQM A;  3PO3 I;  5D1O B;  5A2Q f;  1DL6 A;  4A3K I;  2NVQ I;  1QVF Z;  1NJI 2;  4TNU A;  4AYB A;  3S2H I;  3CXC Z;  5CM2 M;  3CC2 1;  1YI2 1;  3LUS A;  2QRC B;  1VQ4 1;  2W04 A;  2QR1 B;  2ZAE B;  4XX2 A;  2VUM I;  3CC2 Z;  1YI2 Z;  4E33 A;  3CCM 1;  3CC7 1;  1VQ4 Z;  3RZO I;  3HOW I;  3I56 1;  2RPR A;  3CCM Z;  2V8I A;  3CC7 Z;  2PM9 A;  1JJ2 Y;  1VQ8 1;  1I50 I;  1Y1W I;  1NP6 A;  2DE7 A;  1KC8 1;  1ML8 A;  1VQ8 Z;  2W03 A;  4MD9 A;  1VQ9 1;  3VB9 A;  1USP B;  4QTT A;  1K73 1;  3CCJ Z;  1VQ9 Z;  2P28 A;  3U50 C;  4A3B I;  3NH8 A;  3HOY I;  5IP7 I;  2DE6 A;  4Y52 I;  3GTP I;  4NBH A;  3GTM S;  2O4H A;  4A3C I;  4S1T A;  1KC8 2;  2E9H A;  1Q82 1;  4NBB A;  4NBA A;  3J80 f;  2F4M A;  3I55 1;  2VUG A;  4RS4 A;  4CL1 A;  1JJ2 Z;  3Q87 A;  3IX0 A;  1RO0 A;  1QF8 A;  3I55 Z;  3VMG A;  1K73 2;  2LIY A;  3S17 I;  2GU2 A;  1I6H I;  2B63 I;  3S1N I;  2R7Z I;  4BBR I;  1S7M A;  2IZ4 A;  3GTQ I;  1Q7Y 1;  3GTG I;  4MON A;  2KPI A;  5C4X I;  3CC4 1;  4NOZ A;  5LL6 f;  3S14 I;  4BXX I;  3VMH A;  1Q82 2;  3CXC Y;  1VQP 1;  1X3Z A;  4A3E I;  1VQ7 1;  4NBG A;  2VF1 A;  3CCL 1;  3CC4 Z;  1TWC I;  1ZB9 A;  1VQN 1;  1P9N A;  4MXU A;  3CPW Y;  1M90 1;  1VQ7 Z;  1VQP Z;  3S2D I;  3D9X A;  4RV9 A;  3S1R I;  3CCL Z;  1VQL 1;  2RBL A;  3TDH B;  2OZK A;  1S72 Z;  3GTK I;  1X3W A;  1VQL Z;  2BJO A;  3M3Y I;  1N8R 1;  4QTU A;  3HOZ I;  3EED A;  2RT9 A;  1Q7Y 2;  3PO3 S;  1KRL A;  1VLA A;  1I3Q I;  5T64 A;  2M6N A;  2R92 I;  2YU9 I;  2V8J A;  3CCS 1;  3GTJ I;  1SFO I;  2J6A A;  4DQY B;  1M90 2;  3IF8 A;  1YHQ Z;  1KQS Y;  4E2W A;  1VQO 1;  1L1O C;  5D1O A;  3CPW Z;  1N8R 2;  5IT9 f;  2JUB A;  1YUK A;  5AN9 F;  2YAD A;  1YJN 1;  2EGT A;  4RVD A;  3S1M I;  3ESW A;  2OTJ 1;  1TWG I;  3I56 Z;  3JAM f;  1Z01 A;  2OTJ Z;  3FQQ A;  2GTI A;  5A2Q b;  1RNI A;  1VQ5 1;  4NB8 A;  2JA7 I;  2KI7 B;  1KQS Z;  1VQ5 Z;  2P3Y A;  1USP A;  1LQL A;  3HOV I;  1X0T A;  1Z02 A;  1Y1V S;  2RHB A;  1M1K 1;  3KIH A;  2IZ3 A;  4MD7 A;  1Y1V I;  1RO2 A;  3VTN A;  2R93 I;  4RVF A;  4EWC A;  2NVT I;  2QLV B;  3CME 1;  4E31 A;  5FLM I;  3TE5 B;  3CME Z;  2HF1 A;  1M1K 2;  3H0G I;  2JA5 I;  4A3F I;  3CCU 1;  3CCE 1;  4HH4 A;  1YIJ 1;  3OW2 Y;  2JMO A;  2PK7 A;  3J81 f;  4A3G I;  3CCU Z;  2GTH A;  3CCE Z;  3J80 b;  1YIJ Z;  3NFZ A;  2V8K A;  3H3V J;  1VQN Z;  1W2B Y;  3GTO I;  2M48 A;  1QVG Y;  2Q51 A;  1JWH C;  3I4M I;  4E32 A;  1VQK 1;  3I07 A;  1Q81 1;  3K7A I;  1TWA I;  1Q86 1;  5IP9 I;  2E2H I;  3CCS Z;  3FKI I;  3J81 b;  2HU9 A;  4A3D I;  3OW2 Z;  3CCR 1;  3VMI A;  2F4O A;  1VQO Z;  2Y0S A;  3MON A;  1WII A;  2JA6 I;  1W2B Z;  3CCR Z;  2K3R A;  4X6A I;  1WCM I;  3PO2 I;  3G6E 1;  5D1P A;  4E2Z A;  3KIF A;  3GKQ A;  4E2X A;  3P5J B;  1Q81 2;  3J7A 4;  3S16 I;  1TWH I;  1QVG Z;  3M4O I;  3G6E Z;  1Q86 2;  1YJN Z;  1Z03 A;  3CCQ 1;  4HGY A;  4MH4 A;  4BY1 I;  1YIT 1;  3S15 I;  2E2I I;  2R6M A;  3BG1 B;  2AKL A;  5C3E I;  3CCQ Z;  1YIT Z;  3CCV 1;  1VQ6 1;  3CQZ I;  1ZB8 A;  2QRE B;  4A3L I;  3CCV Z;  2PMZ A;  1VQ6 Z;  3HKZ A;  5T6B A;  3EER A;  5IT9 b;  2WB1 A;  4NBC A;  2NVX I;  1QYP A;  4DGL A;  3CCJ 1;  2LFU A;  3MZL B;  4RVH A;  2JNY A;  3NDI A;  3NH4 A;  2WAQ A;  2H85 A;  4DK1 A;  3CMA 1;  4A93 I;  2OOY B;  1K8A 1;  2I3C A;  2OOX B;  3JAM b;  4A3M I;  3CMA Z;  1TWF I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...