1VQ91

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq9100
1VQ8Z 1W2BY 3I551 1YIJ1 3G4SZ 1Q7Y1 1VQ41 2QA4Z 1VQ7Z 1N8R1 3CC4Z 1YIJZ 1VQPZ 1Q861 1K8A2 3G6E1 1VQ4Z 1NJI1 1VQOZ 1VQMZ 1QVGY 1YHQ1 1KC81 1KQSY 3CC71 1Q821 1VQKZ 3OW2Y 1KD11 1K9M1 1VQ9Z 2QEXZ 2OTJ1 1VQ5Z 3CMA1 3CME1 3CCRZ 3CCUZ 3CCV1 1M901 1S721 1VQL1 1K732 1JJ2Z 3CCEZ 3CCJZ 1YJ91 1YJN1 3I55Z 3G711 3CCQ1 1VQLZ 3I561 3CPWZ 1YI21 3G71Z 3G6EZ 1K8A1 3CXCZ 2OTL1 1YHQZ 1YJW1 3CC7Z 1NJI2 1QVFZ 1KC82 1Q822 2OTJZ 3CMAZ 3CMEZ 3CCL1 1YIT1 3CC21 1KD12 1K9M2 1Q812 3CCVZ 3OW2Z 1S72Z 1JJ2Y 1YJ9Z 1VQ61 1K731 1YJNZ 1M1K2 3CCM1 3CCQZ 1VQ81 1Q7Y2 3G4S1 1W2BZ 3I56Z 1YI2Z 1N8R2 2QA41 1VQ71 3CC41 1Q862 1VQP1 3CCS1 1VQO1 2OTLZ 1YJWZ 1VQM1 3CD61 1QVGZ 3CCSZ 1VQK1 1QVFY 1VQN1 1KQSZ 1VQ91 2QEX1 3CD6Z 3CCLZ 1YITZ 1VQNZ 1VQ51 3CC2Z 3CCR1 1Q811 3CCU1 1M902 3CPWY 1VQ6Z 3CCE1 3CCJ1 1M1K1 3CXCY 3CCMZ
chains in the Genus database with same CATH superfamily
5IT9b 1FDIA 1K83I 1QYPA 2LEXA 1USPA 2E2JI 3H0GI 1Q861 1K8A2 2PM9A 3I07A 2JIMA 3ESWA 2QRDB 2AYDA 2E2HI 1VQMZ 1TWAI 3S1NI 1KD11 2VUGA 3PO2I 3RZDI 2OTJ1 1VQ5Z 3CMA1 3VTNA 2OOYB 1M901 1S721 1VQL1 1Z01A 3CCEZ 3CCJZ 1RO4A 1SIWA 3LUSA 4A3DI 2KPIA 3F3PC 3JAMb 3CPWZ 3VMGA 4A3BI 3S15I 2V8JA 4NBAA 3G71Z 1K8A1 5FLMI 3CXCZ 3KIFA 2KI7B 2OTL1 3MZKB 2VPXA 4NBCA 1NJI2 4RVDA 2JA8I 4E2ZA 1KC82 4CL1A 1L1OC 2WB1A 2H85A 2G2KA 4A3GI 4DQYB 3S14I 1WCMI 1YJ9Z 4A3EI 1YJNZ 1YUAA 5AN9F 1ZB8A 3CCM1 3CCQZ 4A3KI 1Q7Y2 3I56Z 1I6HI 2Y0SA 2ZAEB 3VMHA 1YI2Z 2JIOA 1TFIA 2PMZA 3GTMI 4E32A 1WIIA 3I4NI 1VQO1 1VLAA 3HOZI 2I3CA 3BG1B 4QTTA 3S1RI 1WW9A 4MRIA 1P9NA 1ML8A 3J80f 1ZH1A 2JA5I 5D1OA 1VQNZ 1KRLA 2VPYA 4E30A 2YADA 1X3ZA 4NB9A 3GTPI 5FLXf 2LIYA 1VQ6Z 3U50C 4Y52I 2P3YA 1VQ8Z 3I551 2IV2X 1Y8CA 1Q7Y1 3BG0B 2OZKA 1VQ7Z 3CC4Z 3NH4A 5IP9I 2R92I 2W04A 2NVXI 2JA6I 2VPWA 4BXXI 1TWHI 5A2Qb 3KIHA 3CC71 1VQKZ 4NH1C 2WAQA 2QLVB 3HOVI 1K9M1 2Q51A 1VQ9Z 1WZNA 3CCRZ 1RLYA 2RBLA 3J81f 3S16I 3CCV1 1I50I 1FDOA 3P5JB 3HKZA 1K732 1JWHC 1Y1VI 4A3II 2K5RA 3GTKI 1VQLZ 5D1PA 1ZB9A 2RPRA 4X6AI 3IX0A 3G6EZ 2B63I 1RQFA 2JS4A 2QKDA 1YHQZ 1RO0A 2GTIA 4HH4A 3GKQA 1R9TI 1QVFZ 4MH4A 1Q822 3CMEZ 1LQLA 3CCL1 1YIT1 4RVGA 5T6BA 1X3WA 3HOUI 3S2HI 2PK7A 1K731 2O53A 4XX2A 4RVHA 1W2BZ 3QWUA 2R6MA 4MD7A 3S17I 1N8R2 3J7A4 5LL6f 3IR7A 4QTUA 3GTGI 2DE5A 1YJWZ 1VQM1 2YU9I 3CD61 1S7MA 1QVGZ 1KQSZ 1QXFA 4E31A 2RHBA 3GTMS 3MONA 1VQ51 3CC2Z 1USPB 3S1MI 3GCFA 4NOZA 3CCE1 3CCJ1 1YIJ1 3G4SZ 1VQ41 1N2FA 4DK1A 3FQMA 4DGLA 2JR6A 2Q4ZA 2QA4Z 1N8R1 1VQPZ 1Z02A 3NFZA 5C3EI 1NJI1 2BJOA 4TNUA 3GTOI 3NH8A 1KC81 4A93I 2EGTA 3OW2Y 2O4HA 2QEXZ 4NB8A 2NAPA 2JMOA 3CCUZ 3D9XA 3RZOI 1SFOI 1JJ2Z 4E33A 1YJ91 1WJ2A 3EERA 1YJN1 3GTLI 3CCQ1 2VUMI 4NBEA 5T67A 4A3JI 2NVYI 3I561 2NVQI 1YI21 2JA7I 5CM2M 3H3VJ 2R93I 2NVTI 4MD8A 1Y1VS 3HOYI 3J80b 1RO2A 4NFRA 4RS4A 2JNYA 4BBSI 2JUBA 3T4NB 2IZ3A 2OTJZ 3CMAZ 2VPZA 5FLXb 1DL6A 1NUIA 1KD12 1S72Z 2K3RA 3EEDA 1VQ61 1QF8A 1M1K2 4MONA 2F4OA 2QR1B 1VQ81 4BY1I 2J6AA 4E2WA 5C4JI 4NBBA 4MXUA 3CQZI 1VQ71 4EWCA 3CC41 2E9HA 3JAMf 3D2LA 2V8KA 3CCS1 2OTLZ 5D1OB 2V3VA 3IF8A 4A3LI 3HOXI 3S2DI 2W03A 1VQK1 1QVFY 2RT9A 4A3MI 2GTHA 4RVFA 2M6NA 3I4MI 3J81b 1VQ91 4E2XA 1Y1WI 3CD6Z 2JIQA 3CCR1 3NDIA 3S1QI 1YUKA 3CPWY 2HU9A 2E7ZA 1M1K1 3CXCY 3CCMZ 1TWFI 3M3YI 1W2BY 4NBDA 4E2YA 1YIJZ 3G6E1 1VQ4Z 1VQOZ 2OOXB 1QVGY 1YHQ1 1KQSY 1Q821 3NH5A 5T64A 3FQQA 3TE5B 3MZLB 2QREB 3VMIA 3CME1 5IP7I 2V8IA 3HOWI 2E2II 3GTQI 2HF1A 3I55Z 3G711 3PO3S 4Y7NI 4NBGA 1Z03A 3NDJA 2AKLA 5C44I 3Q87A 4BBRI 2RIQA 3PO3I 1YJW1 3CC7Z 4HGYA 4BY7I 5A2Qf 3GTJI 4NBFA 2VF1A 3CC21 3D6WA 1Q812 1K9M2 4AYBA 3CCVZ 5C4XI 3OW2Z 3F3FC 1JJ2Y 2GU2A 4NBHA 4A3FI 2JIRA 3TDHB 2R7ZI 5IT9f 3G4S1 1RNIA 4RV9A 2P28A 2QA41 2M48A 2F4MA 1Q862 2V45A 1VQP1 2LFUA 1I3QI 3FKII 4A3CI 1PFTA 2DE6A 3IFUA 1TWGI 3CCSZ 3K7AI 1VQN1 3VB9A 2IZ4A 1AA6A 2JIPA 4HGZA 1Q16A 2QEX1 1NP6A 3CCLZ 1YITZ 2DE7A 3M4OI 1TWCI 2QRCB 4MD9A 1Q811 3CCU1 1M902 1X0TA 4S1TA
chains in the Genus database with same CATH topology
5IT9b 1K83I 1QYPA 1USPA 2E2JI 3H0GI 1Q861 1K8A2 2PM9A 3I07A 3ESWA 2QRDB 2E2HI 1VQMZ 1TWAI 3S1NI 1KD11 2VUGA 3PO2I 3RZDI 2OTJ1 1VQ5Z 3CMA1 3VTNA 2OOYB 1M901 1S721 1VQL1 1Z01A 3CCEZ 3CCJZ 1RO4A 3LUSA 4A3DI 2KPIA 3F3PC 3JAMb 3CPWZ 3VMGA 4A3BI 3S15I 2V8JA 4NBAA 3G71Z 1K8A1 5FLMI 3CXCZ 3KIFA 2KI7B 2OTL1 3MZKB 4NBCA 1NJI2 4RVDA 2JA8I 4E2ZA 1KC82 4CL1A 1L1OC 2WB1A 2H85A 2G2KA 4A3GI 4DQYB 3S14I 1WCMI 1YJ9Z 4A3EI 1YJNZ 1YUAA 5AN9F 1ZB8A 3CCM1 3CCQZ 4A3KI 1Q7Y2 3I56Z 1I6HI 2Y0SA 2ZAEB 3VMHA 1YI2Z 1TFIA 2PMZA 3GTMI 4E32A 1WIIA 3I4NI 1VQO1 1VLAA 3HOZI 2I3CA 3BG1B 4QTTA 3S1RI 1WW9A 4MRIA 1P9NA 1ML8A 3J80f 1ZH1A 2JA5I 5D1OA 1VQNZ 1KRLA 4E30A 2YADA 1X3ZA 4NB9A 3GTPI 5FLXf 2LIYA 1VQ6Z 3U50C 4Y52I 2P3YA 1VQ8Z 3I551 1Q7Y1 3BG0B 2OZKA 1VQ7Z 3CC4Z 3NH4A 5IP9I 2R92I 2W04A 2NVXI 2JA6I 4BXXI 1TWHI 5A2Qb 3KIHA 3CC71 1VQKZ 4NH1C 2WAQA 2QLVB 3HOVI 1K9M1 2Q51A 1VQ9Z 3CCRZ 1RLYA 2RBLA 3J81f 3S16I 3CCV1 1I50I 3P5JB 3HKZA 1K732 1JWHC 1Y1VI 4A3II 2K5RA 3GTKI 1VQLZ 5D1PA 1ZB9A 2RPRA 4X6AI 3IX0A 3G6EZ 2B63I 1RQFA 2JS4A 2QKDA 1YHQZ 1RO0A 2GTIA 4HH4A 3GKQA 1R9TI 1QVFZ 4MH4A 1Q822 3CMEZ 1LQLA 3CCL1 1YIT1 4RVGA 5T6BA 1X3WA 3HOUI 3S2HI 2PK7A 1K731 2O53A 4XX2A 4RVHA 1W2BZ 3QWUA 2R6MA 4MD7A 3S17I 1N8R2 3J7A4 5LL6f 4QTUA 3GTGI 2DE5A 1YJWZ 1VQM1 2YU9I 3CD61 1S7MA 1QVGZ 1KQSZ 4E31A 2RHBA 3GTMS 3MONA 1VQ51 3CC2Z 1USPB 3S1MI 3GCFA 4NOZA 3CCE1 3CCJ1 1YIJ1 3G4SZ 1VQ41 1N2FA 4DK1A 3FQMA 4DGLA 2JR6A 2Q4ZA 2QA4Z 1N8R1 1VQPZ 1Z02A 3NFZA 5C3EI 1NJI1 2BJOA 4TNUA 3GTOI 3NH8A 1KC81 4A93I 2EGTA 3OW2Y 2O4HA 2QEXZ 4NB8A 2JMOA 3CCUZ 3D9XA 3RZOI 1SFOI 1JJ2Z 4E33A 1YJ91 3EERA 1YJN1 3GTLI 3CCQ1 2VUMI 4NBEA 5T67A 4A3JI 2NVYI 3I561 2NVQI 1YI21 2JA7I 5CM2M 3H3VJ 2R93I 2NVTI 4MD8A 1Y1VS 3HOYI 3J80b 1RO2A 4NFRA 4RS4A 2JNYA 4BBSI 2JUBA 3T4NB 2IZ3A 2OTJZ 3CMAZ 5FLXb 1DL6A 1NUIA 1KD12 1S72Z 2K3RA 3EEDA 1VQ61 1QF8A 1M1K2 4MONA 2F4OA 2QR1B 1VQ81 4BY1I 2J6AA 4E2WA 5C4JI 4NBBA 4MXUA 3CQZI 1VQ71 4EWCA 3CC41 2E9HA 3JAMf 2V8KA 3CCS1 2OTLZ 5D1OB 3IF8A 4A3LI 3HOXI 3S2DI 2W03A 1VQK1 1QVFY 2RT9A 4A3MI 2GTHA 4RVFA 2M6NA 3I4MI 3J81b 1VQ91 4E2XA 1Y1WI 3CD6Z 3CCR1 3NDIA 3S1QI 1YUKA 3CPWY 2HU9A 1M1K1 3CXCY 3CCMZ 1TWFI 3M3YI 1W2BY 4NBDA 4E2YA 1YIJZ 3G6E1 1VQ4Z 1VQOZ 2OOXB 1QVGY 1YHQ1 1KQSY 1Q821 3NH5A 5T64A 3FQQA 3TE5B 3MZLB 2QREB 3VMIA 3CME1 5IP7I 2V8IA 3HOWI 2E2II 3GTQI 2HF1A 3I55Z 3G711 3PO3S 4Y7NI 4NBGA 1Z03A 3NDJA 2AKLA 5C44I 3Q87A 4BBRI 2RIQA 3PO3I 1YJW1 3CC7Z 4HGYA 4BY7I 5A2Qf 3GTJI 4NBFA 2VF1A 3CC21 3D6WA 1Q812 1K9M2 4AYBA 3CCVZ 5C4XI 3OW2Z 3F3FC 1JJ2Y 2GU2A 4NBHA 4A3FI 3TDHB 2R7ZI 5IT9f 3G4S1 1RNIA 4RV9A 2P28A 2QA41 2M48A 2F4MA 1Q862 1VQP1 2LFUA 1I3QI 3FKII 4A3CI 1PFTA 2DE6A 3IFUA 1TWGI 3CCSZ 3K7AI 1VQN1 3VB9A 2IZ4A 4HGZA 2QEX1 1NP6A 3CCLZ 1YITZ 2DE7A 3M4OI 1TWCI 2QRCB 4MD9A 1Q811 3CCU1 1M902 1X0TA 4S1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ8 Z;  1W2B Y;  3I55 1;  1YIJ 1;  3G4S Z;  1Q7Y 1;  1VQ4 1;  2QA4 Z;  1VQ7 Z;  1N8R 1;  3CC4 Z;  1YIJ Z;  1VQP Z;  1Q86 1;  1K8A 2;  3G6E 1;  1VQ4 Z;  1NJI 1;  1VQO Z;  1VQM Z;  1QVG Y;  1YHQ 1;  1KC8 1;  1KQS Y;  3CC7 1;  1Q82 1;  1VQK Z;  3OW2 Y;  1KD1 1;  1K9M 1;  1VQ9 Z;  2QEX Z;  2OTJ 1;  1VQ5 Z;  3CMA 1;  3CME 1;  3CCR Z;  3CCU Z;  3CCV 1;  1M90 1;  1S72 1;  1VQL 1;  1K73 2;  1JJ2 Z;  3CCE Z;  3CCJ Z;  1YJ9 1;  1YJN 1;  3I55 Z;  3G71 1;  3CCQ 1;  1VQL Z;  3I56 1;  3CPW Z;  1YI2 1;  3G71 Z;  3G6E Z;  1K8A 1;  3CXC Z;  2OTL 1;  1YHQ Z;  1YJW 1;  3CC7 Z;  1NJI 2;  1QVF Z;  1KC8 2;  1Q82 2;  2OTJ Z;  3CMA Z;  3CME Z;  3CCL 1;  1YIT 1;  3CC2 1;  1KD1 2;  1K9M 2;  1Q81 2;  3CCV Z;  3OW2 Z;  1S72 Z;  1JJ2 Y;  1YJ9 Z;  1VQ6 1;  1K73 1;  1YJN Z;  1M1K 2;  3CCM 1;  3CCQ Z;  1VQ8 1;  1Q7Y 2;  3G4S 1;  1W2B Z;  3I56 Z;  1YI2 Z;  1N8R 2;  2QA4 1;  1VQ7 1;  3CC4 1;  1Q86 2;  1VQP 1;  3CCS 1;  1VQO 1;  2OTL Z;  1YJW Z;  1VQM 1;  3CD6 1;  1QVG Z;  3CCS Z;  1VQK 1;  1QVF Y;  1VQN 1;  1KQS Z;  1VQ9 1;  2QEX 1;  3CD6 Z;  3CCL Z;  1YIT Z;  1VQN Z;  1VQ5 1;  3CC2 Z;  3CCR 1;  1Q81 1;  3CCU 1;  1M90 2;  3CPW Y;  1VQ6 Z;  3CCE 1;  3CCJ 1;  1M1K 1;  3CXC Y;  3CCM Z; 
#chains in the Genus database with same CATH topology
 5IT9 b;  1FDI A;  1K83 I;  1QYP A;  2LEX A;  1USP A;  2E2J I;  3H0G I;  1Q86 1;  1K8A 2;  2PM9 A;  3I07 A;  2JIM A;  3ESW A;  2QRD B;  2AYD A;  2E2H I;  1VQM Z;  1TWA I;  3S1N I;  1KD1 1;  2VUG A;  3PO2 I;  3RZD I;  2OTJ 1;  1VQ5 Z;  3CMA 1;  3VTN A;  2OOY B;  1M90 1;  1S72 1;  1VQL 1;  1Z01 A;  3CCE Z;  3CCJ Z;  1RO4 A;  1SIW A;  3LUS A;  4A3D I;  2KPI A;  3F3P C;  3JAM b;  3CPW Z;  3VMG A;  4A3B I;  3S15 I;  2V8J A;  4NBA A;  3G71 Z;  1K8A 1;  5FLM I;  3CXC Z;  3KIF A;  2KI7 B;  2OTL 1;  3MZK B;  2VPX A;  4NBC A;  1NJI 2;  4RVD A;  2JA8 I;  4E2Z A;  1KC8 2;  4CL1 A;  1L1O C;  2WB1 A;  2H85 A;  2G2K A;  4A3G I;  4DQY B;  3S14 I;  1WCM I;  1YJ9 Z;  4A3E I;  1YJN Z;  1YUA A;  5AN9 F;  1ZB8 A;  3CCM 1;  3CCQ Z;  4A3K I;  1Q7Y 2;  3I56 Z;  1I6H I;  2Y0S A;  2ZAE B;  3VMH A;  1YI2 Z;  2JIO A;  1TFI A;  2PMZ A;  3GTM I;  4E32 A;  1WII A;  3I4N I;  1VQO 1;  1VLA A;  3HOZ I;  2I3C A;  3BG1 B;  4QTT A;  3S1R I;  1WW9 A;  4MRI A;  1P9N A;  1ML8 A;  3J80 f;  1ZH1 A;  2JA5 I;  5D1O A;  1VQN Z;  1KRL A;  2VPY A;  4E30 A;  2YAD A;  1X3Z A;  4NB9 A;  3GTP I;  5FLX f;  2LIY A;  1VQ6 Z;  3U50 C;  4Y52 I;  2P3Y A;  1VQ8 Z;  3I55 1;  2IV2 X;  1Y8C A;  1Q7Y 1;  3BG0 B;  2OZK A;  1VQ7 Z;  3CC4 Z;  3NH4 A;  5IP9 I;  2R92 I;  2W04 A;  2NVX I;  2JA6 I;  2VPW A;  4BXX I;  1TWH I;  5A2Q b;  3KIH A;  3CC7 1;  1VQK Z;  4NH1 C;  2WAQ A;  2QLV B;  3HOV I;  1K9M 1;  2Q51 A;  1VQ9 Z;  1WZN A;  3CCR Z;  1RLY A;  2RBL A;  3J81 f;  3S16 I;  3CCV 1;  1I50 I;  1FDO A;  3P5J B;  3HKZ A;  1K73 2;  1JWH C;  1Y1V I;  4A3I I;  2K5R A;  3GTK I;  1VQL Z;  5D1P A;  1ZB9 A;  2RPR A;  4X6A I;  3IX0 A;  3G6E Z;  2B63 I;  1RQF A;  2JS4 A;  2QKD A;  1YHQ Z;  1RO0 A;  2GTI A;  4HH4 A;  3GKQ A;  1R9T I;  1QVF Z;  4MH4 A;  1Q82 2;  3CME Z;  1LQL A;  3CCL 1;  1YIT 1;  4RVG A;  5T6B A;  1X3W A;  3HOU I;  3S2H I;  2PK7 A;  1K73 1;  2O53 A;  4XX2 A;  4RVH A;  1W2B Z;  3QWU A;  2R6M A;  4MD7 A;  3S17 I;  1N8R 2;  3J7A 4;  5LL6 f;  3IR7 A;  4QTU A;  3GTG I;  2DE5 A;  1YJW Z;  1VQM 1;  2YU9 I;  3CD6 1;  1S7M A;  1QVG Z;  1KQS Z;  1QXF A;  4E31 A;  2RHB A;  3GTM S;  3MON A;  1VQ5 1;  3CC2 Z;  1USP B;  3S1M I;  3GCF A;  4NOZ A;  3CCE 1;  3CCJ 1;  1YIJ 1;  3G4S Z;  1VQ4 1;  1N2F A;  4DK1 A;  3FQM A;  4DGL A;  2JR6 A;  2Q4Z A;  2QA4 Z;  1N8R 1;  1VQP Z;  1Z02 A;  3NFZ A;  5C3E I;  1NJI 1;  2BJO A;  4TNU A;  3GTO I;  3NH8 A;  1KC8 1;  4A93 I;  2EGT A;  3OW2 Y;  2O4H A;  2QEX Z;  4NB8 A;  2NAP A;  2JMO A;  3CCU Z;  3D9X A;  3RZO I;  1SFO I;  1JJ2 Z;  4E33 A;  1YJ9 1;  1WJ2 A;  3EER A;  1YJN 1;  3GTL I;  3CCQ 1;  2VUM I;  4NBE A;  5T67 A;  4A3J I;  2NVY I;  3I56 1;  2NVQ I;  1YI2 1;  2JA7 I;  5CM2 M;  3H3V J;  2R93 I;  2NVT I;  4MD8 A;  1Y1V S;  3HOY I;  3J80 b;  1RO2 A;  4NFR A;  4RS4 A;  2JNY A;  4BBS I;  2JUB A;  3T4N B;  2IZ3 A;  2OTJ Z;  3CMA Z;  2VPZ A;  5FLX b;  1DL6 A;  1NUI A;  1KD1 2;  1S72 Z;  2K3R A;  3EED A;  1VQ6 1;  1QF8 A;  1M1K 2;  4MON A;  2F4O A;  2QR1 B;  1VQ8 1;  4BY1 I;  2J6A A;  4E2W A;  5C4J I;  4NBB A;  4MXU A;  3CQZ I;  1VQ7 1;  4EWC A;  3CC4 1;  2E9H A;  3JAM f;  3D2L A;  2V8K A;  3CCS 1;  2OTL Z;  5D1O B;  2V3V A;  3IF8 A;  4A3L I;  3HOX I;  3S2D I;  2W03 A;  1VQK 1;  1QVF Y;  2RT9 A;  4A3M I;  2GTH A;  4RVF A;  2M6N A;  3I4M I;  3J81 b;  1VQ9 1;  4E2X A;  1Y1W I;  3CD6 Z;  2JIQ A;  3CCR 1;  3NDI A;  3S1Q I;  1YUK A;  3CPW Y;  2HU9 A;  2E7Z A;  1M1K 1;  3CXC Y;  3CCM Z;  1TWF I;  3M3Y I;  1W2B Y;  4NBD A;  4E2Y A;  1YIJ Z;  3G6E 1;  1VQ4 Z;  1VQO Z;  2OOX B;  1QVG Y;  1YHQ 1;  1KQS Y;  1Q82 1;  3NH5 A;  5T64 A;  3FQQ A;  3TE5 B;  3MZL B;  2QRE B;  3VMI A;  3CME 1;  5IP7 I;  2V8I A;  3HOW I;  2E2I I;  3GTQ I;  2HF1 A;  3I55 Z;  3G71 1;  3PO3 S;  4Y7N I;  4NBG A;  1Z03 A;  3NDJ A;  2AKL A;  5C44 I;  3Q87 A;  4BBR I;  2RIQ A;  3PO3 I;  1YJW 1;  3CC7 Z;  4HGY A;  4BY7 I;  5A2Q f;  3GTJ I;  4NBF A;  2VF1 A;  3CC2 1;  3D6W A;  1Q81 2;  1K9M 2;  4AYB A;  3CCV Z;  5C4X I;  3OW2 Z;  3F3F C;  1JJ2 Y;  2GU2 A;  4NBH A;  4A3F I;  2JIR A;  3TDH B;  2R7Z I;  5IT9 f;  3G4S 1;  1RNI A;  4RV9 A;  2P28 A;  2QA4 1;  2M48 A;  2F4M A;  1Q86 2;  2V45 A;  1VQP 1;  2LFU A;  1I3Q I;  3FKI I;  4A3C I;  1PFT A;  2DE6 A;  3IFU A;  1TWG I;  3CCS Z;  3K7A I;  1VQN 1;  3VB9 A;  2IZ4 A;  1AA6 A;  2JIP A;  4HGZ A;  1Q16 A;  2QEX 1;  1NP6 A;  3CCL Z;  1YIT Z;  2DE7 A;  3M4O I;  1TWC I;  2QRC B;  4MD9 A;  1Q81 1;  3CCU 1;  1M90 2;  1X0T A;  4S1T A; 
#chains in the Genus database with same CATH homology
 5IT9 b;  1K83 I;  1QYP A;  1USP A;  2E2J I;  3H0G I;  1Q86 1;  1K8A 2;  2PM9 A;  3I07 A;  3ESW A;  2QRD B;  2E2H I;  1VQM Z;  1TWA I;  3S1N I;  1KD1 1;  2VUG A;  3PO2 I;  3RZD I;  2OTJ 1;  1VQ5 Z;  3CMA 1;  3VTN A;  2OOY B;  1M90 1;  1S72 1;  1VQL 1;  1Z01 A;  3CCE Z;  3CCJ Z;  1RO4 A;  3LUS A;  4A3D I;  2KPI A;  3F3P C;  3JAM b;  3CPW Z;  3VMG A;  4A3B I;  3S15 I;  2V8J A;  4NBA A;  3G71 Z;  1K8A 1;  5FLM I;  3CXC Z;  3KIF A;  2KI7 B;  2OTL 1;  3MZK B;  4NBC A;  1NJI 2;  4RVD A;  2JA8 I;  4E2Z A;  1KC8 2;  4CL1 A;  1L1O C;  2WB1 A;  2H85 A;  2G2K A;  4A3G I;  4DQY B;  3S14 I;  1WCM I;  1YJ9 Z;  4A3E I;  1YJN Z;  1YUA A;  5AN9 F;  1ZB8 A;  3CCM 1;  3CCQ Z;  4A3K I;  1Q7Y 2;  3I56 Z;  1I6H I;  2Y0S A;  2ZAE B;  3VMH A;  1YI2 Z;  1TFI A;  2PMZ A;  3GTM I;  4E32 A;  1WII A;  3I4N I;  1VQO 1;  1VLA A;  3HOZ I;  2I3C A;  3BG1 B;  4QTT A;  3S1R I;  1WW9 A;  4MRI A;  1P9N A;  1ML8 A;  3J80 f;  1ZH1 A;  2JA5 I;  5D1O A;  1VQN Z;  1KRL A;  4E30 A;  2YAD A;  1X3Z A;  4NB9 A;  3GTP I;  5FLX f;  2LIY A;  1VQ6 Z;  3U50 C;  4Y52 I;  2P3Y A;  1VQ8 Z;  3I55 1;  1Q7Y 1;  3BG0 B;  2OZK A;  1VQ7 Z;  3CC4 Z;  3NH4 A;  5IP9 I;  2R92 I;  2W04 A;  2NVX I;  2JA6 I;  4BXX I;  1TWH I;  5A2Q b;  3KIH A;  3CC7 1;  1VQK Z;  4NH1 C;  2WAQ A;  2QLV B;  3HOV I;  1K9M 1;  2Q51 A;  1VQ9 Z;  3CCR Z;  1RLY A;  2RBL A;  3J81 f;  3S16 I;  3CCV 1;  1I50 I;  3P5J B;  3HKZ A;  1K73 2;  1JWH C;  1Y1V I;  4A3I I;  2K5R A;  3GTK I;  1VQL Z;  5D1P A;  1ZB9 A;  2RPR A;  4X6A I;  3IX0 A;  3G6E Z;  2B63 I;  1RQF A;  2JS4 A;  2QKD A;  1YHQ Z;  1RO0 A;  2GTI A;  4HH4 A;  3GKQ A;  1R9T I;  1QVF Z;  4MH4 A;  1Q82 2;  3CME Z;  1LQL A;  3CCL 1;  1YIT 1;  4RVG A;  5T6B A;  1X3W A;  3HOU I;  3S2H I;  2PK7 A;  1K73 1;  2O53 A;  4XX2 A;  4RVH A;  1W2B Z;  3QWU A;  2R6M A;  4MD7 A;  3S17 I;  1N8R 2;  3J7A 4;  5LL6 f;  4QTU A;  3GTG I;  2DE5 A;  1YJW Z;  1VQM 1;  2YU9 I;  3CD6 1;  1S7M A;  1QVG Z;  1KQS Z;  4E31 A;  2RHB A;  3GTM S;  3MON A;  1VQ5 1;  3CC2 Z;  1USP B;  3S1M I;  3GCF A;  4NOZ A;  3CCE 1;  3CCJ 1;  1YIJ 1;  3G4S Z;  1VQ4 1;  1N2F A;  4DK1 A;  3FQM A;  4DGL A;  2JR6 A;  2Q4Z A;  2QA4 Z;  1N8R 1;  1VQP Z;  1Z02 A;  3NFZ A;  5C3E I;  1NJI 1;  2BJO A;  4TNU A;  3GTO I;  3NH8 A;  1KC8 1;  4A93 I;  2EGT A;  3OW2 Y;  2O4H A;  2QEX Z;  4NB8 A;  2JMO A;  3CCU Z;  3D9X A;  3RZO I;  1SFO I;  1JJ2 Z;  4E33 A;  1YJ9 1;  3EER A;  1YJN 1;  3GTL I;  3CCQ 1;  2VUM I;  4NBE A;  5T67 A;  4A3J I;  2NVY I;  3I56 1;  2NVQ I;  1YI2 1;  2JA7 I;  5CM2 M;  3H3V J;  2R93 I;  2NVT I;  4MD8 A;  1Y1V S;  3HOY I;  3J80 b;  1RO2 A;  4NFR A;  4RS4 A;  2JNY A;  4BBS I;  2JUB A;  3T4N B;  2IZ3 A;  2OTJ Z;  3CMA Z;  5FLX b;  1DL6 A;  1NUI A;  1KD1 2;  1S72 Z;  2K3R A;  3EED A;  1VQ6 1;  1QF8 A;  1M1K 2;  4MON A;  2F4O A;  2QR1 B;  1VQ8 1;  4BY1 I;  2J6A A;  4E2W A;  5C4J I;  4NBB A;  4MXU A;  3CQZ I;  1VQ7 1;  4EWC A;  3CC4 1;  2E9H A;  3JAM f;  2V8K A;  3CCS 1;  2OTL Z;  5D1O B;  3IF8 A;  4A3L I;  3HOX I;  3S2D I;  2W03 A;  1VQK 1;  1QVF Y;  2RT9 A;  4A3M I;  2GTH A;  4RVF A;  2M6N A;  3I4M I;  3J81 b;  1VQ9 1;  4E2X A;  1Y1W I;  3CD6 Z;  3CCR 1;  3NDI A;  3S1Q I;  1YUK A;  3CPW Y;  2HU9 A;  1M1K 1;  3CXC Y;  3CCM Z;  1TWF I;  3M3Y I;  1W2B Y;  4NBD A;  4E2Y A;  1YIJ Z;  3G6E 1;  1VQ4 Z;  1VQO Z;  2OOX B;  1QVG Y;  1YHQ 1;  1KQS Y;  1Q82 1;  3NH5 A;  5T64 A;  3FQQ A;  3TE5 B;  3MZL B;  2QRE B;  3VMI A;  3CME 1;  5IP7 I;  2V8I A;  3HOW I;  2E2I I;  3GTQ I;  2HF1 A;  3I55 Z;  3G71 1;  3PO3 S;  4Y7N I;  4NBG A;  1Z03 A;  3NDJ A;  2AKL A;  5C44 I;  3Q87 A;  4BBR I;  2RIQ A;  3PO3 I;  1YJW 1;  3CC7 Z;  4HGY A;  4BY7 I;  5A2Q f;  3GTJ I;  4NBF A;  2VF1 A;  3CC2 1;  3D6W A;  1Q81 2;  1K9M 2;  4AYB A;  3CCV Z;  5C4X I;  3OW2 Z;  3F3F C;  1JJ2 Y;  2GU2 A;  4NBH A;  4A3F I;  3TDH B;  2R7Z I;  5IT9 f;  3G4S 1;  1RNI A;  4RV9 A;  2P28 A;  2QA4 1;  2M48 A;  2F4M A;  1Q86 2;  1VQP 1;  2LFU A;  1I3Q I;  3FKI I;  4A3C I;  1PFT A;  2DE6 A;  3IFU A;  1TWG I;  3CCS Z;  3K7A I;  1VQN 1;  3VB9 A;  2IZ4 A;  4HGZ A;  2QEX 1;  1NP6 A;  3CCL Z;  1YIT Z;  2DE7 A;  3M4O I;  1TWC I;  2QRC B;  4MD9 A;  1Q81 1;  3CCU 1;  1M90 2;  1X0T A;  4S1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...