1VQ91

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq9100
3CD61 1K732 3G711 1VQ41 1YJNZ 1KD12 1K731 3CCLZ 1YHQZ 1VQN1 1VQLZ 1QVFY 3CCEZ 3CCM1 3CC7Z 1YHQ1 1YJWZ 2QA4Z 1Q822 3CCV1 1Q812 1M1K2 1YIJZ 1JJ2Y 3CCJZ 1VQM1 1Q811 1QVFZ 3CCU1 1VQ4Z 1M1K1 1NJI2 1VQ9Z 1KC82 1NJI1 1JJ2Z 1VQ91 3G4SZ 3I551 1KC81 1S721 1VQKZ 3CME1 1VQ51 3CCSZ 3CMA1 1YJN1 1KD11 1M902 1K9M2 1N8R1 3CCL1 1VQ8Z 1M901 1VQL1 3CCE1 3CC71 1Q821 1YI2Z 2QA41 1YJW1 1VQ5Z 1YITZ 1YIJ1 3CC2Z 3CCJ1 1YJ9Z 3CCRZ 2OTLZ 3G4S1 3OW2Y 1VQK1 3CCQZ 3CCS1 1VQ7Z 3G6EZ 1VQOZ 3CC4Z 3OW2Z 1VQPZ 1K8A2 3CXCY 1K9M1 2OTJZ 2QEXZ 1VQ6Z 1VQ81 3CD6Z 1VQP1 1KQSY 1VQ61 1YI21 3CMEZ 3CXCZ 1YIT1 1VQNZ 3CC21 1KQSZ 1YJ91 3CCMZ 3CPWY 3CCR1 3CCVZ 2OTL1 1Q7Y2 1QVGY 1Q862 3I56Z 1VQMZ 1Q7Y1 3CPWZ 3CCUZ 1Q861 3I561 1QVGZ 3CCQ1 1W2BY 1VQ71 3G6E1 1VQO1 3I55Z 3CC41 1N8R2 1K8A1 2OTJ1 3G71Z 2QEX1 1S72Z 3CMAZ 1W2BZ
chains in the Genus database with same CATH superfamily
1R9TI 4HH4A 3M4OI 4NBBA 3RZOI 4EWCA 4NB8A 3HOWI 4NBDA 3U50C 1K731 2JMOA 3CCLZ 2M6NA 2HF1A 3IX0A 2R92I 2YU9I 3CC7Z 1Q822 3PO3I 2QREB 2JS4A 2JA7I 5IP7I 3PO3S 2NVXI 1JJ2Y 1Q811 3PO2I 2LEXA 1RQFA 1N2FA 1NJI2 1VQ9Z 4A3FI 3J81f 3S16I 2K3RA 2E2HI 2QLVB 2GTHA 3IR7A 4A93I 2WB1A 2F4OA 4A3JI 3CCL1 2YADA 4RVDA 3I4NI 3GTGI 4A3II 3CC71 1Q821 1YI2Z 5A2Qb 1YITZ 1ZB8A 3KIFA 2DE7A 3CCRZ 3D6WA 1WZNA 2OZKA 4DQYB 5AN9F 4NBCA 2H85A 3BG1B 3CCQZ 3Q87A 3I07A 3GKQA 3K7AI 3G6EZ 3CC4Z 3IF8A 1K8A2 1TWAI 2OTJZ 3J80b 3GTOI 2VUMI 4BY1I 2VF1A 5IT9b 3CD6Z 1VQP1 1KQSY 2AYDA 3GTLI 1YI21 4NH1C 3CXCZ 1YIT1 5C44I 4NBAA 1VQNZ 3GTMS 2P28A 3S1QI 1WCMI 2IV2X 3CCR1 4NBFA 2W03A 1KRLA 1Q862 2WAQA 3CPWZ 1TWGI 5C4XI 3CCUZ 3HOUI 3S17I 2QKDA 3I561 1X0TA 4E31A 3CCQ1 3G6E1 3CC41 5IP9I 1K8A1 4RV9A 1WIIA 4A3GI 2OTJ1 1S72Z 3CMAZ 3CMEZ 1N8R1 1PFTA 4E2YA 3CD61 1K732 3G711 2B63I 1KD12 3NH4A 2BJOA 1VQN1 2E9HA 5D1OA 3EERA 1FDIA 5T64A 1VQLZ 1YUKA 1QVFY 1YJWZ 3CQZI 4MD8A 1Q812 2Q4ZA 1YIJZ 1LQLA 3HKZA 3GTPI 3CCU1 2EGTA 2KPIA 4TNUA 3F3FC 1USPB 2M48A 4NB9A 2IZ4A 1JJ2Z 3G4SZ 2LFUA 1KC81 1TWFI 3D9XA 4DK1A 1S721 1VQKZ 3CME1 3CMA1 3TDHB 4E32A 1KD11 2P3YA 1VQ8Z 1P9NA 2RHBA 1VQL1 1YJW1 4E2XA 3J81b 1X3WA 1K83I 1YIJ1 2W04A 1RO2A 2OTLZ 1USPA 2RIQA 1TFIA 2Y0SA 3G4S1 4E2WA 2J6AA 4BBRI 1I50I 1FDOA 1VQK1 1WJ2A 3HOYI 1VQ7Z 1RLYA 2DE5A 2Q51A 1VQPZ 2QEXZ 3VB9A 1VQ81 2GU2A 2OOXB 3MZLB 3NDJA 1VQ61 3KIHA 4A3BI 5T67A 3BG0B 3HOZI 2JIOA 2RPRA 1RO0A 1I3QI 1KQSZ 3VMHA 3CCMZ 3TE5B 4AYBA 2LIYA 3CCVZ 2OTL1 4MRIA 4BBSI 1RO4A 3NFZA 3I56Z 3S1RI 3S2HI 2JNYA 2E2II 2VPWA 2JUBA 3VMGA 3JAMb 1W2BY 1SFOI 4E33A 1VQ71 3ESWA 3I55Z 5FLXb 1N8R2 3G71Z 2QEX1 4QTTA 2QR1B 2JIQA 2PMZA 4MD9A 5D1OB 1YJNZ 3GTQI 2NVYI 1Y8CA 1Z02A 1S7MA 3CCM1 1YHQ1 3CCV1 3M3YI 1Z03A 2NAPA 2VPYA 1Y1WI 3H0GI 3CCJZ 4A3KI 3GCFA 1QVFZ 2JIRA 1M1K1 1X3ZA 3MZKB 2GTIA 4MONA 2JIMA 5IT9f 1KC82 1QYPA 3I551 1JWHC 1NP6A 1NUIA 5C3EI 4NBGA 2F4MA 2G2KA 2KI7B 1YJN1 3NH5A 1ZH1A 5LL6f 4A3LI 1M901 2AKLA 3J7A4 4A3EI 3CCJ1 1YJ9Z 1QXFA 2JR6A 4MXUA 3S2DI 1L1OC 3I4MI 3FKII 2IZ3A 2JA6I 4RS4A 2HU9A 2DE6A 3OW2Y 2V3VA 3EEDA 4A3DI 3D2LA 1RNIA 3S1MI 1VQ6Z 1SIWA 3S15I 5FLMI 2NVTI 2R93I 3VMIA 3FQMA 1Q16A 1ML8A 2R7ZI 2V8IA 2PM9A 2JA8I 3FQQA 2PK7A 4HGYA 3QWUA 2JA5I 2QRCB 1YJ91 2V8JA 1TWCI 2O4HA 1QVGY 4RVFA 1VQMZ 1Q7Y1 2QRDB 4NBEA 2NVQI 1W2BZ 1VQ5Z 3S14I 4A3CI 3HOXI 1VQ41 1YHQZ 4NFRA 1WW9A 3CCEZ 5C4JI 2QA4Z 3NH8A 1DL6A 3LUSA 1M1K2 4MH4A 1VQM1 3H3VJ 5A2Qf 4NBHA 5CM2M 2O53A 1NJI1 2K5RA 1VQ91 1YUAA 1QF8A 2OOYB 2I3CA 4XX2A 3RZDI 4HGZA 1VQ51 3CCSZ 3NDIA 2E7ZA 3T4NB 2RBLA 1M902 1K9M2 2RT9A 4QTUA 1ZB9A 3HOVI 1AA6A 3CCE1 5D1PA 3VTNA 2QA41 3JAMf 3J80f 3GTMI 2JIPA 5FLXf 3CC2Z 4Y52I 4A3MI 2VUGA 3MONA 4BY7I 3CCS1 4NOZA 2VPXA 1VQOZ 3S1NI 3OW2Z 2VPZA 2V45A 3CXCY 1K9M1 3GTJI 4E30A 2E2JI 3GTKI 4MD7A 3CC21 1TWHI 4RVHA 3CPWY 4DGLA 3P5JB 5T6BA 4BXXI 1Z01A 1I6HI 1Q7Y2 3IFUA 4RVGA 3F3PC 1VLAA 4CL1A 4Y7NI 4S1TA 2ZAEB 1Q861 2R6MA 2V8KA 1QVGZ 1VQO1 1Y1VI 4E2ZA 4X6AI 1VQ4Z 1Y1VS
chains in the Genus database with same CATH topology
1R9TI 4HH4A 3M4OI 4NBBA 3RZOI 4EWCA 4NB8A 3HOWI 4NBDA 3U50C 1K731 2JMOA 3CCLZ 2M6NA 2HF1A 3IX0A 2R92I 2YU9I 3CC7Z 1Q822 3PO3I 2QREB 2JS4A 2JA7I 5IP7I 3PO3S 2NVXI 1JJ2Y 1Q811 3PO2I 1RQFA 1N2FA 1NJI2 1VQ9Z 4A3FI 3J81f 3S16I 2K3RA 2E2HI 2QLVB 2GTHA 4A93I 2WB1A 2F4OA 4A3JI 3CCL1 2YADA 4RVDA 3I4NI 3GTGI 4A3II 3CC71 1Q821 1YI2Z 5A2Qb 1YITZ 1ZB8A 3KIFA 2DE7A 3CCRZ 3D6WA 2OZKA 4DQYB 5AN9F 4NBCA 2H85A 3BG1B 3CCQZ 3Q87A 3I07A 3GKQA 3K7AI 3G6EZ 3CC4Z 3IF8A 1K8A2 1TWAI 2OTJZ 3J80b 3GTOI 2VUMI 4BY1I 2VF1A 5IT9b 3CD6Z 1VQP1 1KQSY 3GTLI 1YI21 4NH1C 3CXCZ 1YIT1 5C44I 4NBAA 1VQNZ 3GTMS 2P28A 3S1QI 1WCMI 3CCR1 4NBFA 2W03A 1KRLA 1Q862 2WAQA 3CPWZ 1TWGI 5C4XI 3CCUZ 3HOUI 3S17I 2QKDA 3I561 1X0TA 4E31A 3CCQ1 3G6E1 3CC41 5IP9I 1K8A1 4RV9A 1WIIA 4A3GI 2OTJ1 1S72Z 3CMAZ 3CMEZ 1N8R1 1PFTA 4E2YA 3CD61 1K732 3G711 2B63I 1KD12 3NH4A 2BJOA 1VQN1 2E9HA 5D1OA 3EERA 5T64A 1VQLZ 1YUKA 1QVFY 1YJWZ 3CQZI 4MD8A 1Q812 2Q4ZA 1YIJZ 1LQLA 3HKZA 3GTPI 3CCU1 2EGTA 2KPIA 4TNUA 3F3FC 1USPB 2M48A 4NB9A 2IZ4A 1JJ2Z 3G4SZ 2LFUA 1KC81 1TWFI 3D9XA 4DK1A 1S721 1VQKZ 3CME1 3CMA1 3TDHB 4E32A 1KD11 2P3YA 1VQ8Z 1P9NA 2RHBA 1VQL1 1YJW1 4E2XA 3J81b 1X3WA 1K83I 1YIJ1 2W04A 1RO2A 2OTLZ 1USPA 2RIQA 1TFIA 2Y0SA 3G4S1 4E2WA 2J6AA 4BBRI 1I50I 1VQK1 3HOYI 1VQ7Z 1RLYA 2DE5A 2Q51A 1VQPZ 2QEXZ 3VB9A 1VQ81 2GU2A 2OOXB 3MZLB 3NDJA 1VQ61 3KIHA 4A3BI 5T67A 3BG0B 3HOZI 2RPRA 1RO0A 1I3QI 1KQSZ 3VMHA 3CCMZ 3TE5B 4AYBA 2LIYA 3CCVZ 2OTL1 4MRIA 4BBSI 1RO4A 3NFZA 3I56Z 3S1RI 3S2HI 2JNYA 2E2II 2JUBA 3VMGA 3JAMb 1W2BY 1SFOI 4E33A 1VQ71 3ESWA 3I55Z 5FLXb 1N8R2 3G71Z 2QEX1 4QTTA 2QR1B 2PMZA 4MD9A 5D1OB 1YJNZ 3GTQI 2NVYI 1Z02A 1S7MA 3CCM1 1YHQ1 3CCV1 3M3YI 1Z03A 1Y1WI 3H0GI 3CCJZ 4A3KI 3GCFA 1QVFZ 1M1K1 1X3ZA 3MZKB 2GTIA 4MONA 5IT9f 1KC82 1QYPA 3I551 1JWHC 1NP6A 1NUIA 5C3EI 4NBGA 2F4MA 2G2KA 2KI7B 1YJN1 3NH5A 1ZH1A 5LL6f 4A3LI 1M901 2AKLA 3J7A4 4A3EI 3CCJ1 1YJ9Z 2JR6A 4MXUA 3S2DI 1L1OC 3I4MI 3FKII 2IZ3A 2JA6I 4RS4A 2HU9A 2DE6A 3OW2Y 3EEDA 4A3DI 1RNIA 3S1MI 1VQ6Z 3S15I 5FLMI 2NVTI 2R93I 3VMIA 3FQMA 1ML8A 2R7ZI 2V8IA 2PM9A 2JA8I 3FQQA 2PK7A 4HGYA 3QWUA 2JA5I 2QRCB 1YJ91 2V8JA 1TWCI 2O4HA 1QVGY 4RVFA 1VQMZ 1Q7Y1 2QRDB 4NBEA 2NVQI 1W2BZ 1VQ5Z 3S14I 4A3CI 3HOXI 1VQ41 1YHQZ 4NFRA 1WW9A 3CCEZ 5C4JI 2QA4Z 3NH8A 1DL6A 3LUSA 1M1K2 4MH4A 1VQM1 3H3VJ 5A2Qf 4NBHA 5CM2M 2O53A 1NJI1 2K5RA 1VQ91 1YUAA 1QF8A 2OOYB 2I3CA 4XX2A 3RZDI 4HGZA 1VQ51 3CCSZ 3NDIA 3T4NB 2RBLA 1M902 1K9M2 2RT9A 4QTUA 1ZB9A 3HOVI 3CCE1 5D1PA 3VTNA 2QA41 3JAMf 3J80f 3GTMI 3CC2Z 5FLXf 4Y52I 4A3MI 2VUGA 3MONA 4BY7I 3CCS1 4NOZA 1VQOZ 3S1NI 3OW2Z 3CXCY 1K9M1 3GTJI 4E30A 2E2JI 3GTKI 4MD7A 3CC21 1TWHI 4RVHA 3CPWY 4DGLA 3P5JB 5T6BA 4BXXI 1Z01A 1I6HI 1Q7Y2 3IFUA 4RVGA 3F3PC 1VLAA 4CL1A 4Y7NI 4S1TA 2ZAEB 1Q861 2R6MA 2V8KA 1QVGZ 1VQO1 1Y1VI 4E2ZA 4X6AI 1VQ4Z 1Y1VS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 1;  1K73 2;  3G71 1;  1VQ4 1;  1YJN Z;  1KD1 2;  1K73 1;  3CCL Z;  1YHQ Z;  1VQN 1;  1VQL Z;  1QVF Y;  3CCE Z;  3CCM 1;  3CC7 Z;  1YHQ 1;  1YJW Z;  2QA4 Z;  1Q82 2;  3CCV 1;  1Q81 2;  1M1K 2;  1YIJ Z;  1JJ2 Y;  3CCJ Z;  1VQM 1;  1Q81 1;  1QVF Z;  3CCU 1;  1VQ4 Z;  1M1K 1;  1NJI 2;  1VQ9 Z;  1KC8 2;  1NJI 1;  1JJ2 Z;  1VQ9 1;  3G4S Z;  3I55 1;  1KC8 1;  1S72 1;  1VQK Z;  3CME 1;  1VQ5 1;  3CCS Z;  3CMA 1;  1YJN 1;  1KD1 1;  1M90 2;  1K9M 2;  1N8R 1;  3CCL 1;  1VQ8 Z;  1M90 1;  1VQL 1;  3CCE 1;  3CC7 1;  1Q82 1;  1YI2 Z;  2QA4 1;  1YJW 1;  1VQ5 Z;  1YIT Z;  1YIJ 1;  3CC2 Z;  3CCJ 1;  1YJ9 Z;  3CCR Z;  2OTL Z;  3G4S 1;  3OW2 Y;  1VQK 1;  3CCQ Z;  3CCS 1;  1VQ7 Z;  3G6E Z;  1VQO Z;  3CC4 Z;  3OW2 Z;  1VQP Z;  1K8A 2;  3CXC Y;  1K9M 1;  2OTJ Z;  2QEX Z;  1VQ6 Z;  1VQ8 1;  3CD6 Z;  1VQP 1;  1KQS Y;  1VQ6 1;  1YI2 1;  3CME Z;  3CXC Z;  1YIT 1;  1VQN Z;  3CC2 1;  1KQS Z;  1YJ9 1;  3CCM Z;  3CPW Y;  3CCR 1;  3CCV Z;  2OTL 1;  1Q7Y 2;  1QVG Y;  1Q86 2;  3I56 Z;  1VQM Z;  1Q7Y 1;  3CPW Z;  3CCU Z;  1Q86 1;  3I56 1;  1QVG Z;  3CCQ 1;  1W2B Y;  1VQ7 1;  3G6E 1;  1VQO 1;  3I55 Z;  3CC4 1;  1N8R 2;  1K8A 1;  2OTJ 1;  3G71 Z;  2QEX 1;  1S72 Z;  3CMA Z;  1W2B Z; 
#chains in the Genus database with same CATH topology
 1R9T I;  4HH4 A;  3M4O I;  4NBB A;  3RZO I;  4EWC A;  4NB8 A;  3HOW I;  4NBD A;  3U50 C;  1K73 1;  2JMO A;  3CCL Z;  2M6N A;  2HF1 A;  3IX0 A;  2R92 I;  2YU9 I;  3CC7 Z;  1Q82 2;  3PO3 I;  2QRE B;  2JS4 A;  2JA7 I;  5IP7 I;  3PO3 S;  2NVX I;  1JJ2 Y;  1Q81 1;  3PO2 I;  2LEX A;  1RQF A;  1N2F A;  1NJI 2;  1VQ9 Z;  4A3F I;  3J81 f;  3S16 I;  2K3R A;  2E2H I;  2QLV B;  2GTH A;  3IR7 A;  4A93 I;  2WB1 A;  2F4O A;  4A3J I;  3CCL 1;  2YAD A;  4RVD A;  3I4N I;  3GTG I;  4A3I I;  3CC7 1;  1Q82 1;  1YI2 Z;  5A2Q b;  1YIT Z;  1ZB8 A;  3KIF A;  2DE7 A;  3CCR Z;  3D6W A;  1WZN A;  2OZK A;  4DQY B;  5AN9 F;  4NBC A;  2H85 A;  3BG1 B;  3CCQ Z;  3Q87 A;  3I07 A;  3GKQ A;  3K7A I;  3G6E Z;  3CC4 Z;  3IF8 A;  1K8A 2;  1TWA I;  2OTJ Z;  3J80 b;  3GTO I;  2VUM I;  4BY1 I;  2VF1 A;  5IT9 b;  3CD6 Z;  1VQP 1;  1KQS Y;  2AYD A;  3GTL I;  1YI2 1;  4NH1 C;  3CXC Z;  1YIT 1;  5C44 I;  4NBA A;  1VQN Z;  3GTM S;  2P28 A;  3S1Q I;  1WCM I;  2IV2 X;  3CCR 1;  4NBF A;  2W03 A;  1KRL A;  1Q86 2;  2WAQ A;  3CPW Z;  1TWG I;  5C4X I;  3CCU Z;  3HOU I;  3S17 I;  2QKD A;  3I56 1;  1X0T A;  4E31 A;  3CCQ 1;  3G6E 1;  3CC4 1;  5IP9 I;  1K8A 1;  4RV9 A;  1WII A;  4A3G I;  2OTJ 1;  1S72 Z;  3CMA Z;  3CME Z;  1N8R 1;  1PFT A;  4E2Y A;  3CD6 1;  1K73 2;  3G71 1;  2B63 I;  1KD1 2;  3NH4 A;  2BJO A;  1VQN 1;  2E9H A;  5D1O A;  3EER A;  1FDI A;  5T64 A;  1VQL Z;  1YUK A;  1QVF Y;  1YJW Z;  3CQZ I;  4MD8 A;  1Q81 2;  2Q4Z A;  1YIJ Z;  1LQL A;  3HKZ A;  3GTP I;  3CCU 1;  2EGT A;  2KPI A;  4TNU A;  3F3F C;  1USP B;  2M48 A;  4NB9 A;  2IZ4 A;  1JJ2 Z;  3G4S Z;  2LFU A;  1KC8 1;  1TWF I;  3D9X A;  4DK1 A;  1S72 1;  1VQK Z;  3CME 1;  3CMA 1;  3TDH B;  4E32 A;  1KD1 1;  2P3Y A;  1VQ8 Z;  1P9N A;  2RHB A;  1VQL 1;  1YJW 1;  4E2X A;  3J81 b;  1X3W A;  1K83 I;  1YIJ 1;  2W04 A;  1RO2 A;  2OTL Z;  1USP A;  2RIQ A;  1TFI A;  2Y0S A;  3G4S 1;  4E2W A;  2J6A A;  4BBR I;  1I50 I;  1FDO A;  1VQK 1;  1WJ2 A;  3HOY I;  1VQ7 Z;  1RLY A;  2DE5 A;  2Q51 A;  1VQP Z;  2QEX Z;  3VB9 A;  1VQ8 1;  2GU2 A;  2OOX B;  3MZL B;  3NDJ A;  1VQ6 1;  3KIH A;  4A3B I;  5T67 A;  3BG0 B;  3HOZ I;  2JIO A;  2RPR A;  1RO0 A;  1I3Q I;  1KQS Z;  3VMH A;  3CCM Z;  3TE5 B;  4AYB A;  2LIY A;  3CCV Z;  2OTL 1;  4MRI A;  4BBS I;  1RO4 A;  3NFZ A;  3I56 Z;  3S1R I;  3S2H I;  2JNY A;  2E2I I;  2VPW A;  2JUB A;  3VMG A;  3JAM b;  1W2B Y;  1SFO I;  4E33 A;  1VQ7 1;  3ESW A;  3I55 Z;  5FLX b;  1N8R 2;  3G71 Z;  2QEX 1;  4QTT A;  2QR1 B;  2JIQ A;  2PMZ A;  4MD9 A;  5D1O B;  1YJN Z;  3GTQ I;  2NVY I;  1Y8C A;  1Z02 A;  1S7M A;  3CCM 1;  1YHQ 1;  3CCV 1;  3M3Y I;  1Z03 A;  2NAP A;  2VPY A;  1Y1W I;  3H0G I;  3CCJ Z;  4A3K I;  3GCF A;  1QVF Z;  2JIR A;  1M1K 1;  1X3Z A;  3MZK B;  2GTI A;  4MON A;  2JIM A;  5IT9 f;  1KC8 2;  1QYP A;  3I55 1;  1JWH C;  1NP6 A;  1NUI A;  5C3E I;  4NBG A;  2F4M A;  2G2K A;  2KI7 B;  1YJN 1;  3NH5 A;  1ZH1 A;  5LL6 f;  4A3L I;  1M90 1;  2AKL A;  3J7A 4;  4A3E I;  3CCJ 1;  1YJ9 Z;  1QXF A;  2JR6 A;  4MXU A;  3S2D I;  1L1O C;  3I4M I;  3FKI I;  2IZ3 A;  2JA6 I;  4RS4 A;  2HU9 A;  2DE6 A;  3OW2 Y;  2V3V A;  3EED A;  4A3D I;  3D2L A;  1RNI A;  3S1M I;  1VQ6 Z;  1SIW A;  3S15 I;  5FLM I;  2NVT I;  2R93 I;  3VMI A;  3FQM A;  1Q16 A;  1ML8 A;  2R7Z I;  2V8I A;  2PM9 A;  2JA8 I;  3FQQ A;  2PK7 A;  4HGY A;  3QWU A;  2JA5 I;  2QRC B;  1YJ9 1;  2V8J A;  1TWC I;  2O4H A;  1QVG Y;  4RVF A;  1VQM Z;  1Q7Y 1;  2QRD B;  4NBE A;  2NVQ I;  1W2B Z;  1VQ5 Z;  3S14 I;  4A3C I;  3HOX I;  1VQ4 1;  1YHQ Z;  4NFR A;  1WW9 A;  3CCE Z;  5C4J I;  2QA4 Z;  3NH8 A;  1DL6 A;  3LUS A;  1M1K 2;  4MH4 A;  1VQM 1;  3H3V J;  5A2Q f;  4NBH A;  5CM2 M;  2O53 A;  1NJI 1;  2K5R A;  1VQ9 1;  1YUA A;  1QF8 A;  2OOY B;  2I3C A;  4XX2 A;  3RZD I;  4HGZ A;  1VQ5 1;  3CCS Z;  3NDI A;  2E7Z A;  3T4N B;  2RBL A;  1M90 2;  1K9M 2;  2RT9 A;  4QTU A;  1ZB9 A;  3HOV I;  1AA6 A;  3CCE 1;  5D1P A;  3VTN A;  2QA4 1;  3JAM f;  3J80 f;  3GTM I;  2JIP A;  5FLX f;  3CC2 Z;  4Y52 I;  4A3M I;  2VUG A;  3MON A;  4BY7 I;  3CCS 1;  4NOZ A;  2VPX A;  1VQO Z;  3S1N I;  3OW2 Z;  2VPZ A;  2V45 A;  3CXC Y;  1K9M 1;  3GTJ I;  4E30 A;  2E2J I;  3GTK I;  4MD7 A;  3CC2 1;  1TWH I;  4RVH A;  3CPW Y;  4DGL A;  3P5J B;  5T6B A;  4BXX I;  1Z01 A;  1I6H I;  1Q7Y 2;  3IFU A;  4RVG A;  3F3P C;  1VLA A;  4CL1 A;  4Y7N I;  4S1T A;  2ZAE B;  1Q86 1;  2R6M A;  2V8K A;  1QVG Z;  1VQO 1;  1Y1V I;  4E2Z A;  4X6A I;  1VQ4 Z;  1Y1V S; 
#chains in the Genus database with same CATH homology
 1R9T I;  4HH4 A;  3M4O I;  4NBB A;  3RZO I;  4EWC A;  4NB8 A;  3HOW I;  4NBD A;  3U50 C;  1K73 1;  2JMO A;  3CCL Z;  2M6N A;  2HF1 A;  3IX0 A;  2R92 I;  2YU9 I;  3CC7 Z;  1Q82 2;  3PO3 I;  2QRE B;  2JS4 A;  2JA7 I;  5IP7 I;  3PO3 S;  2NVX I;  1JJ2 Y;  1Q81 1;  3PO2 I;  1RQF A;  1N2F A;  1NJI 2;  1VQ9 Z;  4A3F I;  3J81 f;  3S16 I;  2K3R A;  2E2H I;  2QLV B;  2GTH A;  4A93 I;  2WB1 A;  2F4O A;  4A3J I;  3CCL 1;  2YAD A;  4RVD A;  3I4N I;  3GTG I;  4A3I I;  3CC7 1;  1Q82 1;  1YI2 Z;  5A2Q b;  1YIT Z;  1ZB8 A;  3KIF A;  2DE7 A;  3CCR Z;  3D6W A;  2OZK A;  4DQY B;  5AN9 F;  4NBC A;  2H85 A;  3BG1 B;  3CCQ Z;  3Q87 A;  3I07 A;  3GKQ A;  3K7A I;  3G6E Z;  3CC4 Z;  3IF8 A;  1K8A 2;  1TWA I;  2OTJ Z;  3J80 b;  3GTO I;  2VUM I;  4BY1 I;  2VF1 A;  5IT9 b;  3CD6 Z;  1VQP 1;  1KQS Y;  3GTL I;  1YI2 1;  4NH1 C;  3CXC Z;  1YIT 1;  5C44 I;  4NBA A;  1VQN Z;  3GTM S;  2P28 A;  3S1Q I;  1WCM I;  3CCR 1;  4NBF A;  2W03 A;  1KRL A;  1Q86 2;  2WAQ A;  3CPW Z;  1TWG I;  5C4X I;  3CCU Z;  3HOU I;  3S17 I;  2QKD A;  3I56 1;  1X0T A;  4E31 A;  3CCQ 1;  3G6E 1;  3CC4 1;  5IP9 I;  1K8A 1;  4RV9 A;  1WII A;  4A3G I;  2OTJ 1;  1S72 Z;  3CMA Z;  3CME Z;  1N8R 1;  1PFT A;  4E2Y A;  3CD6 1;  1K73 2;  3G71 1;  2B63 I;  1KD1 2;  3NH4 A;  2BJO A;  1VQN 1;  2E9H A;  5D1O A;  3EER A;  5T64 A;  1VQL Z;  1YUK A;  1QVF Y;  1YJW Z;  3CQZ I;  4MD8 A;  1Q81 2;  2Q4Z A;  1YIJ Z;  1LQL A;  3HKZ A;  3GTP I;  3CCU 1;  2EGT A;  2KPI A;  4TNU A;  3F3F C;  1USP B;  2M48 A;  4NB9 A;  2IZ4 A;  1JJ2 Z;  3G4S Z;  2LFU A;  1KC8 1;  1TWF I;  3D9X A;  4DK1 A;  1S72 1;  1VQK Z;  3CME 1;  3CMA 1;  3TDH B;  4E32 A;  1KD1 1;  2P3Y A;  1VQ8 Z;  1P9N A;  2RHB A;  1VQL 1;  1YJW 1;  4E2X A;  3J81 b;  1X3W A;  1K83 I;  1YIJ 1;  2W04 A;  1RO2 A;  2OTL Z;  1USP A;  2RIQ A;  1TFI A;  2Y0S A;  3G4S 1;  4E2W A;  2J6A A;  4BBR I;  1I50 I;  1VQK 1;  3HOY I;  1VQ7 Z;  1RLY A;  2DE5 A;  2Q51 A;  1VQP Z;  2QEX Z;  3VB9 A;  1VQ8 1;  2GU2 A;  2OOX B;  3MZL B;  3NDJ A;  1VQ6 1;  3KIH A;  4A3B I;  5T67 A;  3BG0 B;  3HOZ I;  2RPR A;  1RO0 A;  1I3Q I;  1KQS Z;  3VMH A;  3CCM Z;  3TE5 B;  4AYB A;  2LIY A;  3CCV Z;  2OTL 1;  4MRI A;  4BBS I;  1RO4 A;  3NFZ A;  3I56 Z;  3S1R I;  3S2H I;  2JNY A;  2E2I I;  2JUB A;  3VMG A;  3JAM b;  1W2B Y;  1SFO I;  4E33 A;  1VQ7 1;  3ESW A;  3I55 Z;  5FLX b;  1N8R 2;  3G71 Z;  2QEX 1;  4QTT A;  2QR1 B;  2PMZ A;  4MD9 A;  5D1O B;  1YJN Z;  3GTQ I;  2NVY I;  1Z02 A;  1S7M A;  3CCM 1;  1YHQ 1;  3CCV 1;  3M3Y I;  1Z03 A;  1Y1W I;  3H0G I;  3CCJ Z;  4A3K I;  3GCF A;  1QVF Z;  1M1K 1;  1X3Z A;  3MZK B;  2GTI A;  4MON A;  5IT9 f;  1KC8 2;  1QYP A;  3I55 1;  1JWH C;  1NP6 A;  1NUI A;  5C3E I;  4NBG A;  2F4M A;  2G2K A;  2KI7 B;  1YJN 1;  3NH5 A;  1ZH1 A;  5LL6 f;  4A3L I;  1M90 1;  2AKL A;  3J7A 4;  4A3E I;  3CCJ 1;  1YJ9 Z;  2JR6 A;  4MXU A;  3S2D I;  1L1O C;  3I4M I;  3FKI I;  2IZ3 A;  2JA6 I;  4RS4 A;  2HU9 A;  2DE6 A;  3OW2 Y;  3EED A;  4A3D I;  1RNI A;  3S1M I;  1VQ6 Z;  3S15 I;  5FLM I;  2NVT I;  2R93 I;  3VMI A;  3FQM A;  1ML8 A;  2R7Z I;  2V8I A;  2PM9 A;  2JA8 I;  3FQQ A;  2PK7 A;  4HGY A;  3QWU A;  2JA5 I;  2QRC B;  1YJ9 1;  2V8J A;  1TWC I;  2O4H A;  1QVG Y;  4RVF A;  1VQM Z;  1Q7Y 1;  2QRD B;  4NBE A;  2NVQ I;  1W2B Z;  1VQ5 Z;  3S14 I;  4A3C I;  3HOX I;  1VQ4 1;  1YHQ Z;  4NFR A;  1WW9 A;  3CCE Z;  5C4J I;  2QA4 Z;  3NH8 A;  1DL6 A;  3LUS A;  1M1K 2;  4MH4 A;  1VQM 1;  3H3V J;  5A2Q f;  4NBH A;  5CM2 M;  2O53 A;  1NJI 1;  2K5R A;  1VQ9 1;  1YUA A;  1QF8 A;  2OOY B;  2I3C A;  4XX2 A;  3RZD I;  4HGZ A;  1VQ5 1;  3CCS Z;  3NDI A;  3T4N B;  2RBL A;  1M90 2;  1K9M 2;  2RT9 A;  4QTU A;  1ZB9 A;  3HOV I;  3CCE 1;  5D1P A;  3VTN A;  2QA4 1;  3JAM f;  3J80 f;  3GTM I;  3CC2 Z;  5FLX f;  4Y52 I;  4A3M I;  2VUG A;  3MON A;  4BY7 I;  3CCS 1;  4NOZ A;  1VQO Z;  3S1N I;  3OW2 Z;  3CXC Y;  1K9M 1;  3GTJ I;  4E30 A;  2E2J I;  3GTK I;  4MD7 A;  3CC2 1;  1TWH I;  4RVH A;  3CPW Y;  4DGL A;  3P5J B;  5T6B A;  4BXX I;  1Z01 A;  1I6H I;  1Q7Y 2;  3IFU A;  4RVG A;  3F3P C;  1VLA A;  4CL1 A;  4Y7N I;  4S1T A;  2ZAE B;  1Q86 1;  2R6M A;  2V8K A;  1QVG Z;  1VQO 1;  1Y1V I;  4E2Z A;  4X6A I;  1VQ4 Z;  1Y1V S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...