1VQ91

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq9100
1KC81 1YJWZ 3G4S1 1QVGZ 3G71Z 1KD12 3CPWZ 3CC71 2OTJ1 1VQ7Z 3CCQ1 1Q812 1VQ5Z 3G6E1 1W2BY 3CCV1 1KD11 1VQ6Z 3CC2Z 1VQ91 1VQ41 1YJ9Z 3CCUZ 1Q811 3I55Z 2QEX1 3CMEZ 3CCSZ 3CCJ1 1QVGY 3CMAZ 3CPWY 3CCEZ 3CC4Z 1VQPZ 1Q7Y1 1K732 1VQ8Z 3G711 1S72Z 1VQNZ 3CXCZ 1K9M2 1VQ51 1YITZ 3CCRZ 1K731 1VQ61 1YHQZ 3CC21 1YI2Z 1K8A2 1YJ91 1N8R2 1K9M1 3CCU1 3I551 1NJI2 3CME1 3I56Z 3CCS1 3CCMZ 3CMA1 3CCE1 3CC41 1K8A1 1VQP1 1JJ2Y 1N8R1 3CXCY 1Q862 1VQ81 1VQOZ 3CCLZ 1S721 3CD6Z 1YJW1 1NJI1 1Q822 1VQN1 3G4SZ 1YIJZ 1JJ2Z 3CCR1 3CC7Z 1VQ71 2OTLZ 1YHQ1 1YI21 1VQLZ 1M902 1Q821 3I561 1M1K2 1QVFZ 3CCM1 1VQMZ 2QEXZ 1M901 3CCL1 3CD61 1VQKZ 1YJNZ 2QA4Z 3OW2Z 1YIJ1 1M1K1 1YIT1 2OTL1 1VQL1 2OTJZ 3CCQZ 1Q861 1QVFY 3G6EZ 1Q7Y2 3CCVZ 1KC82 1VQ9Z 1W2BZ 1KQSY 1VQ4Z 1VQM1 3OW2Y 1VQK1 1YJN1 2QA41 3CCJZ 1VQO1 1KQSZ
chains in the Genus database with same CATH superfamily
1YJWZ 3G4S1 1QVGZ 3PO2I 2JIPA 4NB8A 3H0GI 3S1QI 3CCQ1 3FKII 1Q812 1VQ5Z 3GTLI 3HOZI 3MZLB 3CCV1 3FQQA 2G2KA 3NH4A 3VTNA 3CMEZ 2LFUA 4E2XA 3S15I 3CMAZ 3CPWY 2DE6A 3CCEZ 2F4MA 2GU2A 1VQPZ 2KPIA 2NAPA 1VLAA 2GTHA 3IF8A 3I07A 1VQNZ 1K9M2 2E2JI 2J6AA 4RV9A 5AN9F 2QREB 1YUAA 2NVYI 4X6AI 2KI7B 1YJ91 5IT9b 3D6WA 1I50I 2PMZA 3HOXI 1N8R1 3NDJA 3CXCY 3MZKB 3F3FC 3CD6Z 3NH8A 4MD7A 3G4SZ 1JJ2Z 3CCR1 2RBLA 4NBGA 1YHQ1 1VQLZ 3VB9A 3GTMI 3I561 3IR7A 4A3DI 1VQMZ 4NBEA 1X3WA 2PK7A 1YJNZ 5C3EI 3OW2Z 1YIJ1 4RVHA 3H3VJ 5A2Qf 4E2ZA 1SFOI 2E2HI 2M48A 2IV2X 2IZ4A 3TE5B 3G6EZ 1RO2A 2IZ3A 4HH4A 5LL6f 1Q7Y2 2JMOA 1FDOA 1VQ4Z 3GTMS 4E30A 3CQZI 2RT9A 1VQK1 1PFTA 1ZB9A 5C4JI 2OOXB 1AA6A 4NB9A 1Y1VI 3G71Z 1USPA 4QTUA 1W2BY 5IP7I 2NVXI 3TDHB 1KD11 1VQ6Z 3CC2Z 1VQ91 4E31A 2AKLA 2HF1A 4HGYA 3CCJ1 3GTOI 3CC4Z 1QXFA 1Q7Y1 1S72Z 1FDIA 1Y1VS 3GTPI 3QWUA 3GKQA 2V45A 1Y1WI 2EGTA 1N8R2 2JA5I 1Y8CA 4Y7NI 2ZAEB 2LIYA 4TNUA 3CCU1 3I551 2OOYB 1QF8A 3CCS1 4A3II 5IP9I 4BY1I 1TWAI 1NUIA 1ML8A 4A93I 1JJ2Y 3JAMf 2P3YA 3CCLZ 1Q862 5D1OB 1VQ81 4NFRA 1NJI1 4CL1A 2E7ZA 2WB1A 3K7AI 3FQMA 4E2YA 1VQ71 5D1PA 5A2Qb 2OTLZ 4BBSI 1YI21 1Q821 4NOZA 1LQLA 4S1TA 2R6MA 4AYBA 2JIOA 4MXUA 2Q51A 2HU9A 2JR6A 3CCM1 2B63I 2QKDA 2VPYA 3U50C 1M901 2JUBA 3D9XA 2QA4Z 4MRIA 2JA6I 4NBFA 1YIT1 2YU9I 3CCQZ 1Q861 5C4XI 3M4OI 1QVFY 5T67A 3S2DI 3BG0B 3J81f 3CCVZ 3F3PC 3GTJI 3S1MI 3I4NI 3VMGA 2O4HA 4NH1C 2QRDB 1VQO1 2QR1B 3I4MI 1RNIA 3HOUI 1KD12 3CPWZ 4A3EI 1YUKA 4NBDA 3PO3I 2OTJ1 3HOVI 1VQ7Z 3HKZA 1L1OC 1KRLA 2W04A 1X3ZA 1YJ9Z 2E2II 1K83I 4E2WA 4A3MI 1QVGY 1P9NA 1WCMI 2JA8I 1DL6A 1QYPA 3JAMb 3CXCZ 1VQ51 4NBAA 1YITZ 3CCRZ 3D2LA 2P28A 3PO3S 1K731 1TWGI 1ZB8A 1TWHI 1YHQZ 4BY7I 2O53A 3GTQI 1RLYA 1NJI2 1WW9A 3CME1 2E9HA 5T64A 3I56Z 1TWCI 3CMA1 3CCE1 1K8A1 1VQP1 3J80f 2VF1A 4MD8A 1R9TI 1VQOZ 3KIHA 1Q822 3GTKI 1VQN1 1YIJZ 3M3YI 4BXXI 1M902 3BG1B 3RZOI 2V8IA 3J81b 3CD61 4A3LI 1VQKZ 4A3GI 2VUGA 3NDIA 3ESWA 4DGLA 2JIQA 2F4OA 2M6NA 1M1K1 2DE5A 4RVDA 4A3BI 3S1RI 4EWCA 2JNYA 1VQL1 1USPB 4QTTA 2Q4ZA 3S2HI 4A3FI 4Y52I 1Z03A 1VQ9Z 1W2BZ 4RVFA 1Q16A 1VQM1 1TFIA 3S14I 3OW2Y 5FLXf 1I3QI 1YJN1 3CCJZ 4NBBA 2PM9A 3NH5A 1KQSZ 2YADA 1KC81 1RO4A 2V8KA 2RIQA 2JA7I 3EERA 1SIWA 3CC71 3G6E1 2R7ZI 2H85A 2NVTI 3GCFA 5CM2M 1VQ41 2VPXA 4A3CI 3CCUZ 1Q811 3I55Z 2VUMI 2JIRA 2VPWA 2QEX1 3EEDA 1ZH1A 3CCSZ 4RS4A 2JIMA 4A3JI 2WAQA 1K732 1VQ8Z 3G711 3S1NI 3J80b 2QLVB 3KIFA 1WJ2A 1JWHC 4RVGA 2K5RA 1I6HI 1VQ61 3IFUA 3CC21 1YI2Z 1WIIA 1K8A2 1TWFI 4E33A 2RPRA 1K9M1 2QRCB 3S17I 5T6BA 2I3CA 4XX2A 3CCMZ 2NVQI 3CC41 2OZKA 1S721 3T4NB 1YJW1 2R92I 2V3VA 2VPZA 2DE7A 3P5JB 3GTGI 3CC7Z 5IT9f 1Z02A 2GTIA 4MH4A 1N2FA 2RHBA 3LUSA 5C44I 3IX0A 1M1K2 1QVFZ 2LEXA 1NP6A 3RZDI 1WZNA 3MONA 5FLMI 5D1OA 2QEXZ 3HOYI 2AYDA 4MONA 4A3KI 3CCL1 3VMHA 3HOWI 2JS4A 1X0TA 4NBCA 5FLXb 4HGZA 4E32A 1RO0A 2R93I 3S16I 2OTL1 2OTJZ 2BJOA 4MD9A 3Q87A 2V8JA 2Y0SA 3NFZA 1KC82 2K3RA 2W03A 1KQSY 1S7MA 1Z01A 4BBRI 1RQFA 3J7A4 4DK1A 4DQYB 2QA41 4NBHA 3VMIA
chains in the Genus database with same CATH topology
1YJWZ 3G4S1 1QVGZ 3PO2I 4NB8A 3H0GI 3S1QI 3CCQ1 3FKII 1Q812 1VQ5Z 3GTLI 3HOZI 3MZLB 3CCV1 3FQQA 2G2KA 3NH4A 3VTNA 3CMEZ 2LFUA 4E2XA 3S15I 3CMAZ 3CPWY 2DE6A 3CCEZ 2F4MA 2GU2A 1VQPZ 2KPIA 1VLAA 2GTHA 3IF8A 3I07A 1VQNZ 1K9M2 2E2JI 2J6AA 4RV9A 5AN9F 2QREB 1YUAA 2NVYI 4X6AI 2KI7B 1YJ91 5IT9b 3D6WA 1I50I 2PMZA 3HOXI 1N8R1 3NDJA 3CXCY 3MZKB 3F3FC 3CD6Z 3NH8A 4MD7A 3G4SZ 1JJ2Z 3CCR1 2RBLA 4NBGA 1YHQ1 1VQLZ 3VB9A 3GTMI 3I561 4A3DI 1VQMZ 4NBEA 1X3WA 2PK7A 1YJNZ 5C3EI 3OW2Z 1YIJ1 4RVHA 3H3VJ 5A2Qf 4E2ZA 1SFOI 2E2HI 2M48A 2IZ4A 3TE5B 3G6EZ 1RO2A 2IZ3A 4HH4A 5LL6f 1Q7Y2 2JMOA 1VQ4Z 3GTMS 4E30A 3CQZI 2RT9A 1VQK1 1PFTA 1ZB9A 5C4JI 2OOXB 4NB9A 1Y1VI 3G71Z 1USPA 4QTUA 1W2BY 5IP7I 2NVXI 3TDHB 1KD11 1VQ6Z 3CC2Z 1VQ91 4E31A 2AKLA 2HF1A 4HGYA 3CCJ1 3GTOI 3CC4Z 1Q7Y1 1S72Z 1Y1VS 3GTPI 3QWUA 3GKQA 1Y1WI 2EGTA 1N8R2 2JA5I 4Y7NI 2ZAEB 2LIYA 4TNUA 3CCU1 3I551 2OOYB 1QF8A 3CCS1 4A3II 5IP9I 4BY1I 1TWAI 1NUIA 1ML8A 4A93I 1JJ2Y 3JAMf 2P3YA 3CCLZ 1Q862 5D1OB 1VQ81 4NFRA 1NJI1 4CL1A 2WB1A 3K7AI 3FQMA 4E2YA 1VQ71 5D1PA 5A2Qb 2OTLZ 4BBSI 1YI21 1Q821 4NOZA 1LQLA 4S1TA 2R6MA 4AYBA 4MXUA 2Q51A 2HU9A 2JR6A 3CCM1 2B63I 2QKDA 3U50C 1M901 2JUBA 3D9XA 2QA4Z 4MRIA 2JA6I 4NBFA 1YIT1 2YU9I 3CCQZ 1Q861 5C4XI 3M4OI 1QVFY 5T67A 3S2DI 3BG0B 3J81f 3CCVZ 3F3PC 3GTJI 3S1MI 3I4NI 3VMGA 2O4HA 4NH1C 2QRDB 1VQO1 2QR1B 3I4MI 1RNIA 3HOUI 1KD12 3CPWZ 4A3EI 1YUKA 4NBDA 3PO3I 2OTJ1 3HOVI 1VQ7Z 3HKZA 1L1OC 1KRLA 2W04A 1X3ZA 1YJ9Z 2E2II 1K83I 4E2WA 4A3MI 1QVGY 1P9NA 1WCMI 2JA8I 1DL6A 1QYPA 3JAMb 3CXCZ 1VQ51 4NBAA 1YITZ 3CCRZ 2P28A 3PO3S 1K731 1TWGI 1ZB8A 1TWHI 1YHQZ 4BY7I 2O53A 3GTQI 1RLYA 1NJI2 1WW9A 3CME1 2E9HA 5T64A 3I56Z 1TWCI 3CMA1 3CCE1 1K8A1 1VQP1 3J80f 2VF1A 4MD8A 1R9TI 1VQOZ 3KIHA 1Q822 3GTKI 1VQN1 1YIJZ 3M3YI 4BXXI 1M902 3BG1B 3RZOI 2V8IA 3J81b 3CD61 4A3LI 1VQKZ 4A3GI 2VUGA 3NDIA 3ESWA 4DGLA 2F4OA 2M6NA 1M1K1 2DE5A 4RVDA 4A3BI 3S1RI 4EWCA 2JNYA 1VQL1 1USPB 4QTTA 2Q4ZA 3S2HI 4A3FI 4Y52I 1Z03A 1VQ9Z 1W2BZ 4RVFA 1VQM1 1TFIA 3S14I 3OW2Y 5FLXf 1I3QI 1YJN1 3CCJZ 4NBBA 2PM9A 3NH5A 1KQSZ 2YADA 1KC81 1RO4A 2V8KA 2RIQA 2JA7I 3EERA 3CC71 3G6E1 2R7ZI 2H85A 2NVTI 3GCFA 5CM2M 1VQ41 4A3CI 3CCUZ 1Q811 3I55Z 2VUMI 2QEX1 3EEDA 1ZH1A 3CCSZ 4RS4A 4A3JI 2WAQA 1K732 1VQ8Z 3G711 3S1NI 3J80b 2QLVB 3KIFA 1JWHC 4RVGA 2K5RA 1I6HI 1VQ61 3IFUA 3CC21 1YI2Z 1WIIA 1K8A2 1TWFI 4E33A 2RPRA 1K9M1 2QRCB 3S17I 5T6BA 2I3CA 4XX2A 3CCMZ 2NVQI 3CC41 2OZKA 1S721 3T4NB 1YJW1 2R92I 2DE7A 3P5JB 3GTGI 3CC7Z 5IT9f 1Z02A 2GTIA 4MH4A 1N2FA 2RHBA 3LUSA 5C44I 3IX0A 1M1K2 1QVFZ 1NP6A 3RZDI 3MONA 5FLMI 5D1OA 2QEXZ 3HOYI 4MONA 4A3KI 3CCL1 3VMHA 3HOWI 2JS4A 1X0TA 4NBCA 5FLXb 4HGZA 4E32A 1RO0A 2R93I 3S16I 2OTL1 2OTJZ 2BJOA 4MD9A 3Q87A 2V8JA 2Y0SA 3NFZA 1KC82 2K3RA 2W03A 1KQSY 1S7MA 1Z01A 4BBRI 1RQFA 3J7A4 4DK1A 4DQYB 2QA41 4NBHA 3VMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 1;  1YJW Z;  3G4S 1;  1QVG Z;  3G71 Z;  1KD1 2;  3CPW Z;  3CC7 1;  2OTJ 1;  1VQ7 Z;  3CCQ 1;  1Q81 2;  1VQ5 Z;  3G6E 1;  1W2B Y;  3CCV 1;  1KD1 1;  1VQ6 Z;  3CC2 Z;  1VQ9 1;  1VQ4 1;  1YJ9 Z;  3CCU Z;  1Q81 1;  3I55 Z;  2QEX 1;  3CME Z;  3CCS Z;  3CCJ 1;  1QVG Y;  3CMA Z;  3CPW Y;  3CCE Z;  3CC4 Z;  1VQP Z;  1Q7Y 1;  1K73 2;  1VQ8 Z;  3G71 1;  1S72 Z;  1VQN Z;  3CXC Z;  1K9M 2;  1VQ5 1;  1YIT Z;  3CCR Z;  1K73 1;  1VQ6 1;  1YHQ Z;  3CC2 1;  1YI2 Z;  1K8A 2;  1YJ9 1;  1N8R 2;  1K9M 1;  3CCU 1;  3I55 1;  1NJI 2;  3CME 1;  3I56 Z;  3CCS 1;  3CCM Z;  3CMA 1;  3CCE 1;  3CC4 1;  1K8A 1;  1VQP 1;  1JJ2 Y;  1N8R 1;  3CXC Y;  1Q86 2;  1VQ8 1;  1VQO Z;  3CCL Z;  1S72 1;  3CD6 Z;  1YJW 1;  1NJI 1;  1Q82 2;  1VQN 1;  3G4S Z;  1YIJ Z;  1JJ2 Z;  3CCR 1;  3CC7 Z;  1VQ7 1;  2OTL Z;  1YHQ 1;  1YI2 1;  1VQL Z;  1M90 2;  1Q82 1;  3I56 1;  1M1K 2;  1QVF Z;  3CCM 1;  1VQM Z;  2QEX Z;  1M90 1;  3CCL 1;  3CD6 1;  1VQK Z;  1YJN Z;  2QA4 Z;  3OW2 Z;  1YIJ 1;  1M1K 1;  1YIT 1;  2OTL 1;  1VQL 1;  2OTJ Z;  3CCQ Z;  1Q86 1;  1QVF Y;  3G6E Z;  1Q7Y 2;  3CCV Z;  1KC8 2;  1VQ9 Z;  1W2B Z;  1KQS Y;  1VQ4 Z;  1VQM 1;  3OW2 Y;  1VQK 1;  1YJN 1;  2QA4 1;  3CCJ Z;  1VQO 1;  1KQS Z; 
#chains in the Genus database with same CATH topology
 1YJW Z;  3G4S 1;  1QVG Z;  3PO2 I;  2JIP A;  4NB8 A;  3H0G I;  3S1Q I;  3CCQ 1;  3FKI I;  1Q81 2;  1VQ5 Z;  3GTL I;  3HOZ I;  3MZL B;  3CCV 1;  3FQQ A;  2G2K A;  3NH4 A;  3VTN A;  3CME Z;  2LFU A;  4E2X A;  3S15 I;  3CMA Z;  3CPW Y;  2DE6 A;  3CCE Z;  2F4M A;  2GU2 A;  1VQP Z;  2KPI A;  2NAP A;  1VLA A;  2GTH A;  3IF8 A;  3I07 A;  1VQN Z;  1K9M 2;  2E2J I;  2J6A A;  4RV9 A;  5AN9 F;  2QRE B;  1YUA A;  2NVY I;  4X6A I;  2KI7 B;  1YJ9 1;  5IT9 b;  3D6W A;  1I50 I;  2PMZ A;  3HOX I;  1N8R 1;  3NDJ A;  3CXC Y;  3MZK B;  3F3F C;  3CD6 Z;  3NH8 A;  4MD7 A;  3G4S Z;  1JJ2 Z;  3CCR 1;  2RBL A;  4NBG A;  1YHQ 1;  1VQL Z;  3VB9 A;  3GTM I;  3I56 1;  3IR7 A;  4A3D I;  1VQM Z;  4NBE A;  1X3W A;  2PK7 A;  1YJN Z;  5C3E I;  3OW2 Z;  1YIJ 1;  4RVH A;  3H3V J;  5A2Q f;  4E2Z A;  1SFO I;  2E2H I;  2M48 A;  2IV2 X;  2IZ4 A;  3TE5 B;  3G6E Z;  1RO2 A;  2IZ3 A;  4HH4 A;  5LL6 f;  1Q7Y 2;  2JMO A;  1FDO A;  1VQ4 Z;  3GTM S;  4E30 A;  3CQZ I;  2RT9 A;  1VQK 1;  1PFT A;  1ZB9 A;  5C4J I;  2OOX B;  1AA6 A;  4NB9 A;  1Y1V I;  3G71 Z;  1USP A;  4QTU A;  1W2B Y;  5IP7 I;  2NVX I;  3TDH B;  1KD1 1;  1VQ6 Z;  3CC2 Z;  1VQ9 1;  4E31 A;  2AKL A;  2HF1 A;  4HGY A;  3CCJ 1;  3GTO I;  3CC4 Z;  1QXF A;  1Q7Y 1;  1S72 Z;  1FDI A;  1Y1V S;  3GTP I;  3QWU A;  3GKQ A;  2V45 A;  1Y1W I;  2EGT A;  1N8R 2;  2JA5 I;  1Y8C A;  4Y7N I;  2ZAE B;  2LIY A;  4TNU A;  3CCU 1;  3I55 1;  2OOY B;  1QF8 A;  3CCS 1;  4A3I I;  5IP9 I;  4BY1 I;  1TWA I;  1NUI A;  1ML8 A;  4A93 I;  1JJ2 Y;  3JAM f;  2P3Y A;  3CCL Z;  1Q86 2;  5D1O B;  1VQ8 1;  4NFR A;  1NJI 1;  4CL1 A;  2E7Z A;  2WB1 A;  3K7A I;  3FQM A;  4E2Y A;  1VQ7 1;  5D1P A;  5A2Q b;  2OTL Z;  4BBS I;  1YI2 1;  1Q82 1;  4NOZ A;  1LQL A;  4S1T A;  2R6M A;  4AYB A;  2JIO A;  4MXU A;  2Q51 A;  2HU9 A;  2JR6 A;  3CCM 1;  2B63 I;  2QKD A;  2VPY A;  3U50 C;  1M90 1;  2JUB A;  3D9X A;  2QA4 Z;  4MRI A;  2JA6 I;  4NBF A;  1YIT 1;  2YU9 I;  3CCQ Z;  1Q86 1;  5C4X I;  3M4O I;  1QVF Y;  5T67 A;  3S2D I;  3BG0 B;  3J81 f;  3CCV Z;  3F3P C;  3GTJ I;  3S1M I;  3I4N I;  3VMG A;  2O4H A;  4NH1 C;  2QRD B;  1VQO 1;  2QR1 B;  3I4M I;  1RNI A;  3HOU I;  1KD1 2;  3CPW Z;  4A3E I;  1YUK A;  4NBD A;  3PO3 I;  2OTJ 1;  3HOV I;  1VQ7 Z;  3HKZ A;  1L1O C;  1KRL A;  2W04 A;  1X3Z A;  1YJ9 Z;  2E2I I;  1K83 I;  4E2W A;  4A3M I;  1QVG Y;  1P9N A;  1WCM I;  2JA8 I;  1DL6 A;  1QYP A;  3JAM b;  3CXC Z;  1VQ5 1;  4NBA A;  1YIT Z;  3CCR Z;  3D2L A;  2P28 A;  3PO3 S;  1K73 1;  1TWG I;  1ZB8 A;  1TWH I;  1YHQ Z;  4BY7 I;  2O53 A;  3GTQ I;  1RLY A;  1NJI 2;  1WW9 A;  3CME 1;  2E9H A;  5T64 A;  3I56 Z;  1TWC I;  3CMA 1;  3CCE 1;  1K8A 1;  1VQP 1;  3J80 f;  2VF1 A;  4MD8 A;  1R9T I;  1VQO Z;  3KIH A;  1Q82 2;  3GTK I;  1VQN 1;  1YIJ Z;  3M3Y I;  4BXX I;  1M90 2;  3BG1 B;  3RZO I;  2V8I A;  3J81 b;  3CD6 1;  4A3L I;  1VQK Z;  4A3G I;  2VUG A;  3NDI A;  3ESW A;  4DGL A;  2JIQ A;  2F4O A;  2M6N A;  1M1K 1;  2DE5 A;  4RVD A;  4A3B I;  3S1R I;  4EWC A;  2JNY A;  1VQL 1;  1USP B;  4QTT A;  2Q4Z A;  3S2H I;  4A3F I;  4Y52 I;  1Z03 A;  1VQ9 Z;  1W2B Z;  4RVF A;  1Q16 A;  1VQM 1;  1TFI A;  3S14 I;  3OW2 Y;  5FLX f;  1I3Q I;  1YJN 1;  3CCJ Z;  4NBB A;  2PM9 A;  3NH5 A;  1KQS Z;  2YAD A;  1KC8 1;  1RO4 A;  2V8K A;  2RIQ A;  2JA7 I;  3EER A;  1SIW A;  3CC7 1;  3G6E 1;  2R7Z I;  2H85 A;  2NVT I;  3GCF A;  5CM2 M;  1VQ4 1;  2VPX A;  4A3C I;  3CCU Z;  1Q81 1;  3I55 Z;  2VUM I;  2JIR A;  2VPW A;  2QEX 1;  3EED A;  1ZH1 A;  3CCS Z;  4RS4 A;  2JIM A;  4A3J I;  2WAQ A;  1K73 2;  1VQ8 Z;  3G71 1;  3S1N I;  3J80 b;  2QLV B;  3KIF A;  1WJ2 A;  1JWH C;  4RVG A;  2K5R A;  1I6H I;  1VQ6 1;  3IFU A;  3CC2 1;  1YI2 Z;  1WII A;  1K8A 2;  1TWF I;  4E33 A;  2RPR A;  1K9M 1;  2QRC B;  3S17 I;  5T6B A;  2I3C A;  4XX2 A;  3CCM Z;  2NVQ I;  3CC4 1;  2OZK A;  1S72 1;  3T4N B;  1YJW 1;  2R92 I;  2V3V A;  2VPZ A;  2DE7 A;  3P5J B;  3GTG I;  3CC7 Z;  5IT9 f;  1Z02 A;  2GTI A;  4MH4 A;  1N2F A;  2RHB A;  3LUS A;  5C44 I;  3IX0 A;  1M1K 2;  1QVF Z;  2LEX A;  1NP6 A;  3RZD I;  1WZN A;  3MON A;  5FLM I;  5D1O A;  2QEX Z;  3HOY I;  2AYD A;  4MON A;  4A3K I;  3CCL 1;  3VMH A;  3HOW I;  2JS4 A;  1X0T A;  4NBC A;  5FLX b;  4HGZ A;  4E32 A;  1RO0 A;  2R93 I;  3S16 I;  2OTL 1;  2OTJ Z;  2BJO A;  4MD9 A;  3Q87 A;  2V8J A;  2Y0S A;  3NFZ A;  1KC8 2;  2K3R A;  2W03 A;  1KQS Y;  1S7M A;  1Z01 A;  4BBR I;  1RQF A;  3J7A 4;  4DK1 A;  4DQY B;  2QA4 1;  4NBH A;  3VMI A; 
#chains in the Genus database with same CATH homology
 1YJW Z;  3G4S 1;  1QVG Z;  3PO2 I;  4NB8 A;  3H0G I;  3S1Q I;  3CCQ 1;  3FKI I;  1Q81 2;  1VQ5 Z;  3GTL I;  3HOZ I;  3MZL B;  3CCV 1;  3FQQ A;  2G2K A;  3NH4 A;  3VTN A;  3CME Z;  2LFU A;  4E2X A;  3S15 I;  3CMA Z;  3CPW Y;  2DE6 A;  3CCE Z;  2F4M A;  2GU2 A;  1VQP Z;  2KPI A;  1VLA A;  2GTH A;  3IF8 A;  3I07 A;  1VQN Z;  1K9M 2;  2E2J I;  2J6A A;  4RV9 A;  5AN9 F;  2QRE B;  1YUA A;  2NVY I;  4X6A I;  2KI7 B;  1YJ9 1;  5IT9 b;  3D6W A;  1I50 I;  2PMZ A;  3HOX I;  1N8R 1;  3NDJ A;  3CXC Y;  3MZK B;  3F3F C;  3CD6 Z;  3NH8 A;  4MD7 A;  3G4S Z;  1JJ2 Z;  3CCR 1;  2RBL A;  4NBG A;  1YHQ 1;  1VQL Z;  3VB9 A;  3GTM I;  3I56 1;  4A3D I;  1VQM Z;  4NBE A;  1X3W A;  2PK7 A;  1YJN Z;  5C3E I;  3OW2 Z;  1YIJ 1;  4RVH A;  3H3V J;  5A2Q f;  4E2Z A;  1SFO I;  2E2H I;  2M48 A;  2IZ4 A;  3TE5 B;  3G6E Z;  1RO2 A;  2IZ3 A;  4HH4 A;  5LL6 f;  1Q7Y 2;  2JMO A;  1VQ4 Z;  3GTM S;  4E30 A;  3CQZ I;  2RT9 A;  1VQK 1;  1PFT A;  1ZB9 A;  5C4J I;  2OOX B;  4NB9 A;  1Y1V I;  3G71 Z;  1USP A;  4QTU A;  1W2B Y;  5IP7 I;  2NVX I;  3TDH B;  1KD1 1;  1VQ6 Z;  3CC2 Z;  1VQ9 1;  4E31 A;  2AKL A;  2HF1 A;  4HGY A;  3CCJ 1;  3GTO I;  3CC4 Z;  1Q7Y 1;  1S72 Z;  1Y1V S;  3GTP I;  3QWU A;  3GKQ A;  1Y1W I;  2EGT A;  1N8R 2;  2JA5 I;  4Y7N I;  2ZAE B;  2LIY A;  4TNU A;  3CCU 1;  3I55 1;  2OOY B;  1QF8 A;  3CCS 1;  4A3I I;  5IP9 I;  4BY1 I;  1TWA I;  1NUI A;  1ML8 A;  4A93 I;  1JJ2 Y;  3JAM f;  2P3Y A;  3CCL Z;  1Q86 2;  5D1O B;  1VQ8 1;  4NFR A;  1NJI 1;  4CL1 A;  2WB1 A;  3K7A I;  3FQM A;  4E2Y A;  1VQ7 1;  5D1P A;  5A2Q b;  2OTL Z;  4BBS I;  1YI2 1;  1Q82 1;  4NOZ A;  1LQL A;  4S1T A;  2R6M A;  4AYB A;  4MXU A;  2Q51 A;  2HU9 A;  2JR6 A;  3CCM 1;  2B63 I;  2QKD A;  3U50 C;  1M90 1;  2JUB A;  3D9X A;  2QA4 Z;  4MRI A;  2JA6 I;  4NBF A;  1YIT 1;  2YU9 I;  3CCQ Z;  1Q86 1;  5C4X I;  3M4O I;  1QVF Y;  5T67 A;  3S2D I;  3BG0 B;  3J81 f;  3CCV Z;  3F3P C;  3GTJ I;  3S1M I;  3I4N I;  3VMG A;  2O4H A;  4NH1 C;  2QRD B;  1VQO 1;  2QR1 B;  3I4M I;  1RNI A;  3HOU I;  1KD1 2;  3CPW Z;  4A3E I;  1YUK A;  4NBD A;  3PO3 I;  2OTJ 1;  3HOV I;  1VQ7 Z;  3HKZ A;  1L1O C;  1KRL A;  2W04 A;  1X3Z A;  1YJ9 Z;  2E2I I;  1K83 I;  4E2W A;  4A3M I;  1QVG Y;  1P9N A;  1WCM I;  2JA8 I;  1DL6 A;  1QYP A;  3JAM b;  3CXC Z;  1VQ5 1;  4NBA A;  1YIT Z;  3CCR Z;  2P28 A;  3PO3 S;  1K73 1;  1TWG I;  1ZB8 A;  1TWH I;  1YHQ Z;  4BY7 I;  2O53 A;  3GTQ I;  1RLY A;  1NJI 2;  1WW9 A;  3CME 1;  2E9H A;  5T64 A;  3I56 Z;  1TWC I;  3CMA 1;  3CCE 1;  1K8A 1;  1VQP 1;  3J80 f;  2VF1 A;  4MD8 A;  1R9T I;  1VQO Z;  3KIH A;  1Q82 2;  3GTK I;  1VQN 1;  1YIJ Z;  3M3Y I;  4BXX I;  1M90 2;  3BG1 B;  3RZO I;  2V8I A;  3J81 b;  3CD6 1;  4A3L I;  1VQK Z;  4A3G I;  2VUG A;  3NDI A;  3ESW A;  4DGL A;  2F4O A;  2M6N A;  1M1K 1;  2DE5 A;  4RVD A;  4A3B I;  3S1R I;  4EWC A;  2JNY A;  1VQL 1;  1USP B;  4QTT A;  2Q4Z A;  3S2H I;  4A3F I;  4Y52 I;  1Z03 A;  1VQ9 Z;  1W2B Z;  4RVF A;  1VQM 1;  1TFI A;  3S14 I;  3OW2 Y;  5FLX f;  1I3Q I;  1YJN 1;  3CCJ Z;  4NBB A;  2PM9 A;  3NH5 A;  1KQS Z;  2YAD A;  1KC8 1;  1RO4 A;  2V8K A;  2RIQ A;  2JA7 I;  3EER A;  3CC7 1;  3G6E 1;  2R7Z I;  2H85 A;  2NVT I;  3GCF A;  5CM2 M;  1VQ4 1;  4A3C I;  3CCU Z;  1Q81 1;  3I55 Z;  2VUM I;  2QEX 1;  3EED A;  1ZH1 A;  3CCS Z;  4RS4 A;  4A3J I;  2WAQ A;  1K73 2;  1VQ8 Z;  3G71 1;  3S1N I;  3J80 b;  2QLV B;  3KIF A;  1JWH C;  4RVG A;  2K5R A;  1I6H I;  1VQ6 1;  3IFU A;  3CC2 1;  1YI2 Z;  1WII A;  1K8A 2;  1TWF I;  4E33 A;  2RPR A;  1K9M 1;  2QRC B;  3S17 I;  5T6B A;  2I3C A;  4XX2 A;  3CCM Z;  2NVQ I;  3CC4 1;  2OZK A;  1S72 1;  3T4N B;  1YJW 1;  2R92 I;  2DE7 A;  3P5J B;  3GTG I;  3CC7 Z;  5IT9 f;  1Z02 A;  2GTI A;  4MH4 A;  1N2F A;  2RHB A;  3LUS A;  5C44 I;  3IX0 A;  1M1K 2;  1QVF Z;  1NP6 A;  3RZD I;  3MON A;  5FLM I;  5D1O A;  2QEX Z;  3HOY I;  4MON A;  4A3K I;  3CCL 1;  3VMH A;  3HOW I;  2JS4 A;  1X0T A;  4NBC A;  5FLX b;  4HGZ A;  4E32 A;  1RO0 A;  2R93 I;  3S16 I;  2OTL 1;  2OTJ Z;  2BJO A;  4MD9 A;  3Q87 A;  2V8J A;  2Y0S A;  3NFZ A;  1KC8 2;  2K3R A;  2W03 A;  1KQS Y;  1S7M A;  1Z01 A;  4BBR I;  1RQF A;  3J7A 4;  4DK1 A;  4DQY B;  2QA4 1;  4NBH A;  3VMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...