1VQ91

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq9100
3CCUZ 3I56Z 3CCS1 3CCU1 1K732 1K8A1 3I561 1VQNZ 1NJI1 1YJWZ 1YIJ1 3CC71 1N8R1 2OTLZ 1K9M1 1VQLZ 1N8R2 1YJ9Z 1VQL1 1YJ91 3CCQZ 1KD11 1Q7Y2 1QVFY 1JJ2Z 3CCQ1 1VQ8Z 1KD12 1VQ81 3CCJZ 3CCVZ 3CCJ1 1QVGZ 3CCV1 1YJNZ 2OTJZ 1YHQZ 1VQN1 1Q861 1YJN1 1K8A2 1VQMZ 3CC2Z 1YJW1 1NJI2 3CPWZ 1VQM1 3CC21 1VQ9Z 1VQPZ 3CMAZ 1VQ91 1W2BY 1VQP1 3OW2Y 2QEXZ 2OTL1 3G6EZ 1K9M2 2QEX1 3G6E1 1S72Z 3CC4Z 3CCRZ 3G71Z 3CC41 3CCLZ 3CXCZ 3CCR1 1KQSZ 1M901 3CCL1 1KC81 1M1K1 2OTJ1 1YHQ1 1Q862 1KC82 1YI2Z 1JJ2Y 1YI21 3CMA1 1Q821 1Q811 1QVGY 1Q812 3CD6Z 1VQ7Z 3CMEZ 1QVFZ 3CD61 1K731 1S721 3CME1 1VQ4Z 1VQ71 3G711 1VQ41 3G4SZ 1YIJZ 1M902 3CPWY 3G4S1 1VQ5Z 3CC7Z 1VQ51 1VQ6Z 1VQ61 1VQOZ 1M1K2 3I55Z 3CCEZ 1VQO1 1Q7Y1 3I551 3CCE1 2QA4Z 1YITZ 2QA41 1YIT1 1W2BZ 3CXCY 3OW2Z 1VQKZ 1KQSY 3CCMZ 1Q822 1VQK1 3CCM1 3CCSZ
chains in the Genus database with same CATH superfamily
4DGLA 3I56Z 3F3FC 3CCS1 3GTMI 3I561 3HOXI 1YIJ1 1USPA 3NH8A 4A3LI 1TFIA 1QYPA 1VLAA 3T4NB 2VPXA 4CL1A 2EGTA 1JJ2Z 1YUAA 1LQLA 1KD12 2V8KA 3H0GI 2F4OA 4TNUA 1WCMI 4NB8A 2VF1A 4RVFA 2DE7A 2V8JA 4RVGA 2OTJZ 1Q861 3VTNA 1VQMZ 1NJI2 1X3WA 3GTPI 4BXXI 3CPWZ 1VQM1 4DK1A 1VQ9Z 5CM2M 1VQ91 1W2BY 4NH1C 4QTUA 3NH5A 3G6EZ 3S1MI 1TWAI 1WZNA 4NBAA 3G6E1 3GTLI 2R93I 2OOYB 3IX0A 1KQSZ 2E2II 1M1K1 4E2WA 3HOWI 2K5RA 1YI2Z 2PK7A 4RS4A 1JJ2Y 1YI21 3KIHA 2JUBA 2QLVB 2M48A 1Q811 1X3ZA 3NDJA 2JIMA 1QXFA 4MD8A 3MONA 1VQ4Z 2Q4ZA 1VQ41 1JWHC 3CPWY 1VQ5Z 3CC7Z 2M6NA 1VQ51 3QWUA 3HOYI 5D1PA 1DL6A 5C44I 3I55Z 3S16I 3I551 2W03A 3MZKB 2BJOA 3RZOI 5IP9I 3CCMZ 1KQSY 3GKQA 2RBLA 3F3PC 3CCM1 2E2HI 2VPYA 1X0TA 1YJWZ 2JIQA 3LUSA 2JNYA 3BG1B 2JS4A 4E2YA 1K9M1 4NBDA 1VQLZ 2NAPA 1VQL1 3S1RI 2GTHA 2DE5A 4NBEA 1VQ8Z 4A3JI 3NDIA 1VQ81 4MD7A 3J80f 3CCJZ 4MONA 4XX2A 3CQZI 3CCJ1 2OOXB 3GTJI 1FDOA 5C4XI 1K8A2 3FKII 3CC2Z 4A3BI 3CC21 1VQPZ 1VQP1 2QEXZ 3ESWA 2LFUA 2QEX1 2NVQI 2JIPA 4A3EI 3G71Z 4BY1I 3CXCZ 4A93I 3KIFA 3D6WA 3TDHB 1KRLA 3D9XA 1ZH1A 3S17I 1P9NA 1L1OC 4RVHA 1Q16A 1KC81 2OTJ1 2JMOA 4NBFA 5T6BA 3S2DI 3J7A4 1Q821 4Y52I 1R9TI 2WAQA 3S15I 3J81f 3PO3I 3EEDA 1Q812 1QVFZ 4NBCA 2GTIA 1RQFA 2RT9A 3RZDI 2JA5I 5LL6f 2QKDA 1M902 2NVXI 5FLXf 4NOZA 3FQMA 1VQ6Z 2J6AA 2E2JI 1VQ61 3S14I 2KI7B 1SFOI 4E33A 4BBRI 1TWHI 4HGYA 1RO4A 4X6AI 1NUIA 3I4MI 3CXCY 3OW2Z 1ZB9A 1Y1VI 2V3VA 3GTOI 3S2HI 4E32A 1SIWA 5D1OB 1K732 1VQNZ 3GTGI 1NJI1 3IFUA 3CC71 1QF8A 1N8R1 4EWCA 2OTLZ 1YJ9Z 5AN9F 2YU9I 1YJ91 2JA8I 1Q7Y2 1QVFY 5D1OA 2Y0SA 3I4NI 4MRIA 2F4MA 5IT9f 4A3KI 1QVGZ 2KPIA 2QRDB 1RLYA 2GU2A 1RO0A 1AA6A 1YJNZ 1YHQZ 2O4HA 1YJN1 2JA7I 3NH4A 3P5JB 5C3EI 1YJW1 2YADA 4E2ZA 3D2LA 3HKZA 3CMAZ 2OZKA 2VUGA 3OW2Y 2IZ3A 5FLMI 1K83I 3NFZA 1S72Z 4NFRA 3J80b 3CC4Z 2P28A 3CCRZ 3GTQI 3CC41 1PFTA 2NVYI 3CCR1 3CCLZ 3I07A 3CCL1 1N2FA 1FDIA 2AKLA 1TWCI 1Y8CA 4HGZA 1WIIA 2JR6A 4A3MI 1Q862 1KC82 3HOUI 1S7MA 2QR1B 1RO2A 4A3FI 4MD9A 3M3YI 2LEXA 1QVGY 5T67A 1VQ7Z 3CMEZ 2R6MA 1VQ71 3CME1 3G711 2H85A 1ML8A 3G4SZ 3BG0B 1YIJZ 2I3CA 3G4S1 1YUKA 2E9HA 3HOVI 1RNIA 1NP6A 3K7AI 2IV2X 4HH4A 1M1K2 1WJ2A 3CCEZ 1I50I 3M4OI 2K3RA 3CCE1 2HU9A 2QA4Z 2JIOA 1YITZ 5T64A 3IR7A 2QA41 4E30A 1YIT1 1VQKZ 3J81b 3GTMS 1VQK1 3Q87A 2E7ZA 3GTKI 3CCUZ 3GCFA 2VPWA 3CCU1 2WB1A 1K8A1 2RIQA 4RV9A 4Y7NI 5FLXb 2RHBA 2JA6I 1N8R2 1WW9A 5IP7I 3S1NI 1Z03A 3TE5B 3CCQZ 1KD11 3CCQ1 1I6HI 3CCVZ 4RVDA 3CCV1 2QRCB 4NB9A 4E31A 2JIRA 4MH4A 1VQN1 2PM9A 4DQYB 1Z02A 5A2Qb 2Q51A 4NBBA 4A3II 5A2Qf 2G2KA 3PO3S 3FQQA 2OTL1 1K9M2 2VPZA 4AYBA 3U50C 1TWFI 2PMZA 3S1QI 5IT9b 3H3VJ 4A3GI 1M901 1TWGI 3MZLB 4A3DI 2VUMI 3HOZI 2V8IA 2NVTI 1Z01A 4MXUA 5C4JI 2V45A 1YHQ1 2LIYA 3IF8A 3VB9A 3VMGA 1Y1VS 1Y1WI 2RPRA 4BY7I 3CMA1 1ZB8A 4NBHA 4NBGA 3JAMb 3JAMf 3CD6Z 2B63I 1K731 3CD61 1S721 2IZ4A 2AYDA 2W04A 3VMHA 1I3QI 2DE6A 2P3YA 3EERA 2O53A 2ZAEB 4E2XA 1VQOZ 1VQO1 3VMIA 1Q7Y1 2QREB 3PO2I 2R7ZI 2R92I 1USPB 1W2BZ 4S1TA 4BBSI 1Q822 2HF1A 4QTTA 4A3CI 3CCSZ
chains in the Genus database with same CATH topology
4DGLA 3I56Z 3F3FC 3CCS1 3GTMI 3I561 3HOXI 1YIJ1 1USPA 3NH8A 4A3LI 1TFIA 1QYPA 1VLAA 3T4NB 4CL1A 2EGTA 1JJ2Z 1YUAA 1LQLA 1KD12 2V8KA 3H0GI 2F4OA 4TNUA 1WCMI 4NB8A 2VF1A 4RVFA 2DE7A 2V8JA 4RVGA 2OTJZ 1Q861 3VTNA 1VQMZ 1NJI2 1X3WA 3GTPI 4BXXI 3CPWZ 1VQM1 4DK1A 1VQ9Z 5CM2M 1VQ91 1W2BY 4NH1C 4QTUA 3NH5A 3G6EZ 3S1MI 1TWAI 4NBAA 3G6E1 3GTLI 2R93I 2OOYB 3IX0A 1KQSZ 2E2II 1M1K1 4E2WA 3HOWI 2K5RA 1YI2Z 2PK7A 4RS4A 1JJ2Y 1YI21 3KIHA 2JUBA 2QLVB 2M48A 1Q811 1X3ZA 3NDJA 4MD8A 3MONA 1VQ4Z 2Q4ZA 1VQ41 1JWHC 3CPWY 1VQ5Z 3CC7Z 2M6NA 1VQ51 3QWUA 3HOYI 5D1PA 1DL6A 5C44I 3I55Z 3S16I 3I551 2W03A 3MZKB 2BJOA 3RZOI 5IP9I 3CCMZ 1KQSY 3GKQA 2RBLA 3F3PC 3CCM1 2E2HI 1X0TA 1YJWZ 3LUSA 2JNYA 3BG1B 2JS4A 4E2YA 1K9M1 4NBDA 1VQLZ 1VQL1 3S1RI 2GTHA 2DE5A 4NBEA 1VQ8Z 4A3JI 3NDIA 1VQ81 4MD7A 3J80f 3CCJZ 4MONA 4XX2A 3CQZI 3CCJ1 2OOXB 3GTJI 5C4XI 1K8A2 3FKII 3CC2Z 4A3BI 3CC21 1VQPZ 1VQP1 2QEXZ 3ESWA 2LFUA 2QEX1 2NVQI 4A3EI 3G71Z 4BY1I 3CXCZ 4A93I 3KIFA 3D6WA 3TDHB 1KRLA 3D9XA 1ZH1A 3S17I 1P9NA 1L1OC 4RVHA 1KC81 2OTJ1 2JMOA 4NBFA 5T6BA 3S2DI 3J7A4 1Q821 4Y52I 1R9TI 2WAQA 3S15I 3J81f 3PO3I 3EEDA 1Q812 1QVFZ 4NBCA 2GTIA 1RQFA 2RT9A 3RZDI 2JA5I 5LL6f 2QKDA 1M902 2NVXI 5FLXf 4NOZA 3FQMA 1VQ6Z 2J6AA 2E2JI 1VQ61 3S14I 2KI7B 1SFOI 4E33A 4BBRI 1TWHI 4HGYA 1RO4A 4X6AI 1NUIA 3I4MI 3CXCY 3OW2Z 1ZB9A 1Y1VI 3GTOI 3S2HI 4E32A 5D1OB 1K732 1VQNZ 3GTGI 1NJI1 3IFUA 3CC71 1QF8A 1N8R1 4EWCA 2OTLZ 1YJ9Z 5AN9F 2YU9I 1YJ91 2JA8I 1Q7Y2 1QVFY 5D1OA 2Y0SA 3I4NI 4MRIA 2F4MA 5IT9f 4A3KI 1QVGZ 2KPIA 2QRDB 1RLYA 2GU2A 1RO0A 1YJNZ 1YHQZ 2O4HA 1YJN1 2JA7I 3NH4A 3P5JB 5C3EI 1YJW1 2YADA 4E2ZA 3HKZA 3CMAZ 2OZKA 2VUGA 3OW2Y 2IZ3A 5FLMI 1K83I 3NFZA 1S72Z 4NFRA 3J80b 3CC4Z 2P28A 3CCRZ 3GTQI 3CC41 1PFTA 2NVYI 3CCR1 3CCLZ 3I07A 3CCL1 1N2FA 2AKLA 1TWCI 4HGZA 1WIIA 2JR6A 4A3MI 1Q862 1KC82 3HOUI 1S7MA 2QR1B 1RO2A 4A3FI 4MD9A 3M3YI 1QVGY 5T67A 1VQ7Z 3CMEZ 2R6MA 1VQ71 3CME1 3G711 2H85A 1ML8A 3G4SZ 3BG0B 1YIJZ 2I3CA 3G4S1 1YUKA 2E9HA 3HOVI 1RNIA 1NP6A 3K7AI 4HH4A 1M1K2 3CCEZ 1I50I 3M4OI 2K3RA 3CCE1 2HU9A 2QA4Z 1YITZ 5T64A 2QA41 4E30A 1YIT1 1VQKZ 3J81b 3GTMS 1VQK1 3Q87A 3GTKI 3CCUZ 3GCFA 3CCU1 2WB1A 1K8A1 2RIQA 4RV9A 4Y7NI 5FLXb 2RHBA 2JA6I 1N8R2 1WW9A 5IP7I 3S1NI 1Z03A 3TE5B 3CCQZ 1KD11 3CCQ1 1I6HI 3CCVZ 4RVDA 3CCV1 2QRCB 4NB9A 4E31A 4MH4A 1VQN1 2PM9A 4DQYB 1Z02A 5A2Qb 2Q51A 4NBBA 4A3II 5A2Qf 2G2KA 3PO3S 3FQQA 2OTL1 1K9M2 4AYBA 3U50C 1TWFI 2PMZA 3S1QI 5IT9b 3H3VJ 4A3GI 1M901 1TWGI 3MZLB 4A3DI 2VUMI 3HOZI 2V8IA 2NVTI 1Z01A 4MXUA 5C4JI 1YHQ1 2LIYA 3IF8A 3VB9A 3VMGA 1Y1VS 1Y1WI 2RPRA 4BY7I 3CMA1 1ZB8A 4NBHA 4NBGA 3JAMb 3JAMf 3CD6Z 2B63I 1K731 3CD61 1S721 2IZ4A 2W04A 3VMHA 1I3QI 2DE6A 2P3YA 3EERA 2O53A 2ZAEB 4E2XA 1VQOZ 1VQO1 3VMIA 1Q7Y1 2QREB 3PO2I 2R7ZI 2R92I 1USPB 1W2BZ 4S1TA 4BBSI 1Q822 2HF1A 4QTTA 4A3CI 3CCSZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU Z;  3I56 Z;  3CCS 1;  3CCU 1;  1K73 2;  1K8A 1;  3I56 1;  1VQN Z;  1NJI 1;  1YJW Z;  1YIJ 1;  3CC7 1;  1N8R 1;  2OTL Z;  1K9M 1;  1VQL Z;  1N8R 2;  1YJ9 Z;  1VQL 1;  1YJ9 1;  3CCQ Z;  1KD1 1;  1Q7Y 2;  1QVF Y;  1JJ2 Z;  3CCQ 1;  1VQ8 Z;  1KD1 2;  1VQ8 1;  3CCJ Z;  3CCV Z;  3CCJ 1;  1QVG Z;  3CCV 1;  1YJN Z;  2OTJ Z;  1YHQ Z;  1VQN 1;  1Q86 1;  1YJN 1;  1K8A 2;  1VQM Z;  3CC2 Z;  1YJW 1;  1NJI 2;  3CPW Z;  1VQM 1;  3CC2 1;  1VQ9 Z;  1VQP Z;  3CMA Z;  1VQ9 1;  1W2B Y;  1VQP 1;  3OW2 Y;  2QEX Z;  2OTL 1;  3G6E Z;  1K9M 2;  2QEX 1;  3G6E 1;  1S72 Z;  3CC4 Z;  3CCR Z;  3G71 Z;  3CC4 1;  3CCL Z;  3CXC Z;  3CCR 1;  1KQS Z;  1M90 1;  3CCL 1;  1KC8 1;  1M1K 1;  2OTJ 1;  1YHQ 1;  1Q86 2;  1KC8 2;  1YI2 Z;  1JJ2 Y;  1YI2 1;  3CMA 1;  1Q82 1;  1Q81 1;  1QVG Y;  1Q81 2;  3CD6 Z;  1VQ7 Z;  3CME Z;  1QVF Z;  3CD6 1;  1K73 1;  1S72 1;  3CME 1;  1VQ4 Z;  1VQ7 1;  3G71 1;  1VQ4 1;  3G4S Z;  1YIJ Z;  1M90 2;  3CPW Y;  3G4S 1;  1VQ5 Z;  3CC7 Z;  1VQ5 1;  1VQ6 Z;  1VQ6 1;  1VQO Z;  1M1K 2;  3I55 Z;  3CCE Z;  1VQO 1;  1Q7Y 1;  3I55 1;  3CCE 1;  2QA4 Z;  1YIT Z;  2QA4 1;  1YIT 1;  1W2B Z;  3CXC Y;  3OW2 Z;  1VQK Z;  1KQS Y;  3CCM Z;  1Q82 2;  1VQK 1;  3CCM 1;  3CCS Z; 
#chains in the Genus database with same CATH topology
 4DGL A;  3I56 Z;  3F3F C;  3CCS 1;  3GTM I;  3I56 1;  3HOX I;  1YIJ 1;  1USP A;  3NH8 A;  4A3L I;  1TFI A;  1QYP A;  1VLA A;  3T4N B;  2VPX A;  4CL1 A;  2EGT A;  1JJ2 Z;  1YUA A;  1LQL A;  1KD1 2;  2V8K A;  3H0G I;  2F4O A;  4TNU A;  1WCM I;  4NB8 A;  2VF1 A;  4RVF A;  2DE7 A;  2V8J A;  4RVG A;  2OTJ Z;  1Q86 1;  3VTN A;  1VQM Z;  1NJI 2;  1X3W A;  3GTP I;  4BXX I;  3CPW Z;  1VQM 1;  4DK1 A;  1VQ9 Z;  5CM2 M;  1VQ9 1;  1W2B Y;  4NH1 C;  4QTU A;  3NH5 A;  3G6E Z;  3S1M I;  1TWA I;  1WZN A;  4NBA A;  3G6E 1;  3GTL I;  2R93 I;  2OOY B;  3IX0 A;  1KQS Z;  2E2I I;  1M1K 1;  4E2W A;  3HOW I;  2K5R A;  1YI2 Z;  2PK7 A;  4RS4 A;  1JJ2 Y;  1YI2 1;  3KIH A;  2JUB A;  2QLV B;  2M48 A;  1Q81 1;  1X3Z A;  3NDJ A;  2JIM A;  1QXF A;  4MD8 A;  3MON A;  1VQ4 Z;  2Q4Z A;  1VQ4 1;  1JWH C;  3CPW Y;  1VQ5 Z;  3CC7 Z;  2M6N A;  1VQ5 1;  3QWU A;  3HOY I;  5D1P A;  1DL6 A;  5C44 I;  3I55 Z;  3S16 I;  3I55 1;  2W03 A;  3MZK B;  2BJO A;  3RZO I;  5IP9 I;  3CCM Z;  1KQS Y;  3GKQ A;  2RBL A;  3F3P C;  3CCM 1;  2E2H I;  2VPY A;  1X0T A;  1YJW Z;  2JIQ A;  3LUS A;  2JNY A;  3BG1 B;  2JS4 A;  4E2Y A;  1K9M 1;  4NBD A;  1VQL Z;  2NAP A;  1VQL 1;  3S1R I;  2GTH A;  2DE5 A;  4NBE A;  1VQ8 Z;  4A3J I;  3NDI A;  1VQ8 1;  4MD7 A;  3J80 f;  3CCJ Z;  4MON A;  4XX2 A;  3CQZ I;  3CCJ 1;  2OOX B;  3GTJ I;  1FDO A;  5C4X I;  1K8A 2;  3FKI I;  3CC2 Z;  4A3B I;  3CC2 1;  1VQP Z;  1VQP 1;  2QEX Z;  3ESW A;  2LFU A;  2QEX 1;  2NVQ I;  2JIP A;  4A3E I;  3G71 Z;  4BY1 I;  3CXC Z;  4A93 I;  3KIF A;  3D6W A;  3TDH B;  1KRL A;  3D9X A;  1ZH1 A;  3S17 I;  1P9N A;  1L1O C;  4RVH A;  1Q16 A;  1KC8 1;  2OTJ 1;  2JMO A;  4NBF A;  5T6B A;  3S2D I;  3J7A 4;  1Q82 1;  4Y52 I;  1R9T I;  2WAQ A;  3S15 I;  3J81 f;  3PO3 I;  3EED A;  1Q81 2;  1QVF Z;  4NBC A;  2GTI A;  1RQF A;  2RT9 A;  3RZD I;  2JA5 I;  5LL6 f;  2QKD A;  1M90 2;  2NVX I;  5FLX f;  4NOZ A;  3FQM A;  1VQ6 Z;  2J6A A;  2E2J I;  1VQ6 1;  3S14 I;  2KI7 B;  1SFO I;  4E33 A;  4BBR I;  1TWH I;  4HGY A;  1RO4 A;  4X6A I;  1NUI A;  3I4M I;  3CXC Y;  3OW2 Z;  1ZB9 A;  1Y1V I;  2V3V A;  3GTO I;  3S2H I;  4E32 A;  1SIW A;  5D1O B;  1K73 2;  1VQN Z;  3GTG I;  1NJI 1;  3IFU A;  3CC7 1;  1QF8 A;  1N8R 1;  4EWC A;  2OTL Z;  1YJ9 Z;  5AN9 F;  2YU9 I;  1YJ9 1;  2JA8 I;  1Q7Y 2;  1QVF Y;  5D1O A;  2Y0S A;  3I4N I;  4MRI A;  2F4M A;  5IT9 f;  4A3K I;  1QVG Z;  2KPI A;  2QRD B;  1RLY A;  2GU2 A;  1RO0 A;  1AA6 A;  1YJN Z;  1YHQ Z;  2O4H A;  1YJN 1;  2JA7 I;  3NH4 A;  3P5J B;  5C3E I;  1YJW 1;  2YAD A;  4E2Z A;  3D2L A;  3HKZ A;  3CMA Z;  2OZK A;  2VUG A;  3OW2 Y;  2IZ3 A;  5FLM I;  1K83 I;  3NFZ A;  1S72 Z;  4NFR A;  3J80 b;  3CC4 Z;  2P28 A;  3CCR Z;  3GTQ I;  3CC4 1;  1PFT A;  2NVY I;  3CCR 1;  3CCL Z;  3I07 A;  3CCL 1;  1N2F A;  1FDI A;  2AKL A;  1TWC I;  1Y8C A;  4HGZ A;  1WII A;  2JR6 A;  4A3M I;  1Q86 2;  1KC8 2;  3HOU I;  1S7M A;  2QR1 B;  1RO2 A;  4A3F I;  4MD9 A;  3M3Y I;  2LEX A;  1QVG Y;  5T67 A;  1VQ7 Z;  3CME Z;  2R6M A;  1VQ7 1;  3CME 1;  3G71 1;  2H85 A;  1ML8 A;  3G4S Z;  3BG0 B;  1YIJ Z;  2I3C A;  3G4S 1;  1YUK A;  2E9H A;  3HOV I;  1RNI A;  1NP6 A;  3K7A I;  2IV2 X;  4HH4 A;  1M1K 2;  1WJ2 A;  3CCE Z;  1I50 I;  3M4O I;  2K3R A;  3CCE 1;  2HU9 A;  2QA4 Z;  2JIO A;  1YIT Z;  5T64 A;  3IR7 A;  2QA4 1;  4E30 A;  1YIT 1;  1VQK Z;  3J81 b;  3GTM S;  1VQK 1;  3Q87 A;  2E7Z A;  3GTK I;  3CCU Z;  3GCF A;  2VPW A;  3CCU 1;  2WB1 A;  1K8A 1;  2RIQ A;  4RV9 A;  4Y7N I;  5FLX b;  2RHB A;  2JA6 I;  1N8R 2;  1WW9 A;  5IP7 I;  3S1N I;  1Z03 A;  3TE5 B;  3CCQ Z;  1KD1 1;  3CCQ 1;  1I6H I;  3CCV Z;  4RVD A;  3CCV 1;  2QRC B;  4NB9 A;  4E31 A;  2JIR A;  4MH4 A;  1VQN 1;  2PM9 A;  4DQY B;  1Z02 A;  5A2Q b;  2Q51 A;  4NBB A;  4A3I I;  5A2Q f;  2G2K A;  3PO3 S;  3FQQ A;  2OTL 1;  1K9M 2;  2VPZ A;  4AYB A;  3U50 C;  1TWF I;  2PMZ A;  3S1Q I;  5IT9 b;  3H3V J;  4A3G I;  1M90 1;  1TWG I;  3MZL B;  4A3D I;  2VUM I;  3HOZ I;  2V8I A;  2NVT I;  1Z01 A;  4MXU A;  5C4J I;  2V45 A;  1YHQ 1;  2LIY A;  3IF8 A;  3VB9 A;  3VMG A;  1Y1V S;  1Y1W I;  2RPR A;  4BY7 I;  3CMA 1;  1ZB8 A;  4NBH A;  4NBG A;  3JAM b;  3JAM f;  3CD6 Z;  2B63 I;  1K73 1;  3CD6 1;  1S72 1;  2IZ4 A;  2AYD A;  2W04 A;  3VMH A;  1I3Q I;  2DE6 A;  2P3Y A;  3EER A;  2O53 A;  2ZAE B;  4E2X A;  1VQO Z;  1VQO 1;  3VMI A;  1Q7Y 1;  2QRE B;  3PO2 I;  2R7Z I;  2R92 I;  1USP B;  1W2B Z;  4S1T A;  4BBS I;  1Q82 2;  2HF1 A;  4QTT A;  4A3C I;  3CCS Z; 
#chains in the Genus database with same CATH homology
 4DGL A;  3I56 Z;  3F3F C;  3CCS 1;  3GTM I;  3I56 1;  3HOX I;  1YIJ 1;  1USP A;  3NH8 A;  4A3L I;  1TFI A;  1QYP A;  1VLA A;  3T4N B;  4CL1 A;  2EGT A;  1JJ2 Z;  1YUA A;  1LQL A;  1KD1 2;  2V8K A;  3H0G I;  2F4O A;  4TNU A;  1WCM I;  4NB8 A;  2VF1 A;  4RVF A;  2DE7 A;  2V8J A;  4RVG A;  2OTJ Z;  1Q86 1;  3VTN A;  1VQM Z;  1NJI 2;  1X3W A;  3GTP I;  4BXX I;  3CPW Z;  1VQM 1;  4DK1 A;  1VQ9 Z;  5CM2 M;  1VQ9 1;  1W2B Y;  4NH1 C;  4QTU A;  3NH5 A;  3G6E Z;  3S1M I;  1TWA I;  4NBA A;  3G6E 1;  3GTL I;  2R93 I;  2OOY B;  3IX0 A;  1KQS Z;  2E2I I;  1M1K 1;  4E2W A;  3HOW I;  2K5R A;  1YI2 Z;  2PK7 A;  4RS4 A;  1JJ2 Y;  1YI2 1;  3KIH A;  2JUB A;  2QLV B;  2M48 A;  1Q81 1;  1X3Z A;  3NDJ A;  4MD8 A;  3MON A;  1VQ4 Z;  2Q4Z A;  1VQ4 1;  1JWH C;  3CPW Y;  1VQ5 Z;  3CC7 Z;  2M6N A;  1VQ5 1;  3QWU A;  3HOY I;  5D1P A;  1DL6 A;  5C44 I;  3I55 Z;  3S16 I;  3I55 1;  2W03 A;  3MZK B;  2BJO A;  3RZO I;  5IP9 I;  3CCM Z;  1KQS Y;  3GKQ A;  2RBL A;  3F3P C;  3CCM 1;  2E2H I;  1X0T A;  1YJW Z;  3LUS A;  2JNY A;  3BG1 B;  2JS4 A;  4E2Y A;  1K9M 1;  4NBD A;  1VQL Z;  1VQL 1;  3S1R I;  2GTH A;  2DE5 A;  4NBE A;  1VQ8 Z;  4A3J I;  3NDI A;  1VQ8 1;  4MD7 A;  3J80 f;  3CCJ Z;  4MON A;  4XX2 A;  3CQZ I;  3CCJ 1;  2OOX B;  3GTJ I;  5C4X I;  1K8A 2;  3FKI I;  3CC2 Z;  4A3B I;  3CC2 1;  1VQP Z;  1VQP 1;  2QEX Z;  3ESW A;  2LFU A;  2QEX 1;  2NVQ I;  4A3E I;  3G71 Z;  4BY1 I;  3CXC Z;  4A93 I;  3KIF A;  3D6W A;  3TDH B;  1KRL A;  3D9X A;  1ZH1 A;  3S17 I;  1P9N A;  1L1O C;  4RVH A;  1KC8 1;  2OTJ 1;  2JMO A;  4NBF A;  5T6B A;  3S2D I;  3J7A 4;  1Q82 1;  4Y52 I;  1R9T I;  2WAQ A;  3S15 I;  3J81 f;  3PO3 I;  3EED A;  1Q81 2;  1QVF Z;  4NBC A;  2GTI A;  1RQF A;  2RT9 A;  3RZD I;  2JA5 I;  5LL6 f;  2QKD A;  1M90 2;  2NVX I;  5FLX f;  4NOZ A;  3FQM A;  1VQ6 Z;  2J6A A;  2E2J I;  1VQ6 1;  3S14 I;  2KI7 B;  1SFO I;  4E33 A;  4BBR I;  1TWH I;  4HGY A;  1RO4 A;  4X6A I;  1NUI A;  3I4M I;  3CXC Y;  3OW2 Z;  1ZB9 A;  1Y1V I;  3GTO I;  3S2H I;  4E32 A;  5D1O B;  1K73 2;  1VQN Z;  3GTG I;  1NJI 1;  3IFU A;  3CC7 1;  1QF8 A;  1N8R 1;  4EWC A;  2OTL Z;  1YJ9 Z;  5AN9 F;  2YU9 I;  1YJ9 1;  2JA8 I;  1Q7Y 2;  1QVF Y;  5D1O A;  2Y0S A;  3I4N I;  4MRI A;  2F4M A;  5IT9 f;  4A3K I;  1QVG Z;  2KPI A;  2QRD B;  1RLY A;  2GU2 A;  1RO0 A;  1YJN Z;  1YHQ Z;  2O4H A;  1YJN 1;  2JA7 I;  3NH4 A;  3P5J B;  5C3E I;  1YJW 1;  2YAD A;  4E2Z A;  3HKZ A;  3CMA Z;  2OZK A;  2VUG A;  3OW2 Y;  2IZ3 A;  5FLM I;  1K83 I;  3NFZ A;  1S72 Z;  4NFR A;  3J80 b;  3CC4 Z;  2P28 A;  3CCR Z;  3GTQ I;  3CC4 1;  1PFT A;  2NVY I;  3CCR 1;  3CCL Z;  3I07 A;  3CCL 1;  1N2F A;  2AKL A;  1TWC I;  4HGZ A;  1WII A;  2JR6 A;  4A3M I;  1Q86 2;  1KC8 2;  3HOU I;  1S7M A;  2QR1 B;  1RO2 A;  4A3F I;  4MD9 A;  3M3Y I;  1QVG Y;  5T67 A;  1VQ7 Z;  3CME Z;  2R6M A;  1VQ7 1;  3CME 1;  3G71 1;  2H85 A;  1ML8 A;  3G4S Z;  3BG0 B;  1YIJ Z;  2I3C A;  3G4S 1;  1YUK A;  2E9H A;  3HOV I;  1RNI A;  1NP6 A;  3K7A I;  4HH4 A;  1M1K 2;  3CCE Z;  1I50 I;  3M4O I;  2K3R A;  3CCE 1;  2HU9 A;  2QA4 Z;  1YIT Z;  5T64 A;  2QA4 1;  4E30 A;  1YIT 1;  1VQK Z;  3J81 b;  3GTM S;  1VQK 1;  3Q87 A;  3GTK I;  3CCU Z;  3GCF A;  3CCU 1;  2WB1 A;  1K8A 1;  2RIQ A;  4RV9 A;  4Y7N I;  5FLX b;  2RHB A;  2JA6 I;  1N8R 2;  1WW9 A;  5IP7 I;  3S1N I;  1Z03 A;  3TE5 B;  3CCQ Z;  1KD1 1;  3CCQ 1;  1I6H I;  3CCV Z;  4RVD A;  3CCV 1;  2QRC B;  4NB9 A;  4E31 A;  4MH4 A;  1VQN 1;  2PM9 A;  4DQY B;  1Z02 A;  5A2Q b;  2Q51 A;  4NBB A;  4A3I I;  5A2Q f;  2G2K A;  3PO3 S;  3FQQ A;  2OTL 1;  1K9M 2;  4AYB A;  3U50 C;  1TWF I;  2PMZ A;  3S1Q I;  5IT9 b;  3H3V J;  4A3G I;  1M90 1;  1TWG I;  3MZL B;  4A3D I;  2VUM I;  3HOZ I;  2V8I A;  2NVT I;  1Z01 A;  4MXU A;  5C4J I;  1YHQ 1;  2LIY A;  3IF8 A;  3VB9 A;  3VMG A;  1Y1V S;  1Y1W I;  2RPR A;  4BY7 I;  3CMA 1;  1ZB8 A;  4NBH A;  4NBG A;  3JAM b;  3JAM f;  3CD6 Z;  2B63 I;  1K73 1;  3CD6 1;  1S72 1;  2IZ4 A;  2W04 A;  3VMH A;  1I3Q I;  2DE6 A;  2P3Y A;  3EER A;  2O53 A;  2ZAE B;  4E2X A;  1VQO Z;  1VQO 1;  3VMI A;  1Q7Y 1;  2QRE B;  3PO2 I;  2R7Z I;  2R92 I;  1USP B;  1W2B Z;  4S1T A;  4BBS I;  1Q82 2;  2HF1 A;  4QTT A;  4A3C I;  3CCS Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...