1JWHC

Crystal structure of human protein kinase ck2 holoenzyme
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
200
structure length
200
Chain Sequence
EVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II, alpha chain
publication title Crystal structure of human protein kinase CK2: insights into basic properties of the CK2 holoenzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 43
structure length 200
sequence length 200
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 1jwhC01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1jwhC02
4MD7A 4MD9A 1JWHC 4NH1C 4DGLA 2R6MA 4MD8A 1QF8A 3EEDA 2JMOA 2RT9A 1RQFA 2M6NA 2M48A
chains in the Genus database with same CATH superfamily
2E2HI 4E33A 1SFOI 4E2YA 3M3YI 4A3CI 4BXXI 1JJ2Y 2V8IA 4A3DI 2B63I 1USPA 3NH5A 5T64A 3HOVI 2Q4ZA 3Q87A 1NP6A 3JAMb 2JA6I 5T6BA 3CCV1 5D1PA 1RO4A 3I07A 1YUAA 5FLMI 3G4SZ 1KRLA 5D1OB 1VQK1 5IT9b 5C44I 3CME1 3D9XA 3NDJA 1TWGI 1Q7Y1 2QKDA 2JS4A 1YJNZ 2R92I 3H0GI 1YHQ1 3KIFA 1VQ61 3ESWA 1WW9A 1YIJZ 1YJ9Z 1RO0A 3CCQ1 3GCFA 4RVFA 4E30A 1X0TA 2V45A 1VQ41 3D6WA 4NBFA 3NFZA 2QRDB 1YITZ 4MXUA 3CCU1 4NB8A 4NBDA 1YI2Z 3S2HI 3CCM1 1WZNA 1QVFZ 3I56Z 3EEDA 3T4NB 3MONA 4BBRI 3S2DI 5D1OA 3HOWI 1VQ81 1WIIA 1JWHC 1YUKA 1S7MA 5A2Qb 3FQMA 2NVQI 3CMA1 3CCVZ 4A3GI 3P5JB 2Y0SA 1Q7Y2 1K83I 1VQKZ 3RZOI 1Q862 4NBHA 1ML8A 2QR1B 3G711 4A3KI 1TFIA 3CMEZ 2DE6A 2V3VA 4S1TA 4MD8A 1Q812 4BY7I 3CD61 2BJOA 3S14I 3GTQI 2P28A 1YHQZ 1VQ6Z 1VQP1 1I3QI 3S1NI 5FLXb 1NJI2 3VTNA 2NAPA 2P3YA 1TWAI 4RS4A 3CCS1 1SIWA 1VQ4Z 1FDIA 2Q51A 1L1OC 2PM9A 3CCUZ 1I6HI 3BG0B 1ZB8A 1KQSY 3MZLB 2V8KA 2OTJ1 4QTTA 4A3FI 3HOZI 1I50I 1QYPA 2OOYB 3CCMZ 2OZKA 3GTGI 3VMIA 2DE7A 3CCJ1 5C4JI 1ZH1A 4NBCA 2LIYA 3GKQA 3NDIA 4A3LI 1M902 1VQN1 1VQ8Z 2R93I 3CPWZ 3J81f 2QEXZ 3CMAZ 1PFTA 1X3WA 3K7AI 1Z03A 1Z01A 3FKII 3IFUA 3M4OI 2QREB 3S1MI 3HOYI 1Q861 4NBAA 3CXCZ 4X6AI 2E2II 2JMOA 1DL6A 3G71Z 2DE5A 1ZB9A 4RV9A 3RZDI 1Q811 2LFUA 3GTPI 2I3CA 3EERA 2JIQA 1K732 3CD6Z 3OW2Z 2VPWA 1QVGZ 1R9TI 3IX0A 2E7ZA 3TE5B 1N2FA 1W2BZ 1Z02A 1VQPZ 1NJI1 2GTHA 1VQ71 2RIQA 2OTL1 4BY1I 2JUBA 3GTMI 2IZ3A 2NVXI 3LUSA 1RLYA 3CCL1 3CCSZ 2GTIA 4MH4A 4DGLA 2JNYA 3PO3I 3S15I 3BG1B 2VUGA 2YU9I 2OTJZ 4E32A 1WCMI 4A3EI 3GTMS 1M901 3CCJZ 3MZKB 2IZ4A 2RHBA 3S17I 1KC82 1VQNZ 5C4XI 3IR7A 3U50C 2RBLA 1QVFY 3PO3S 2JA8I 1TWFI 3J80f 4NB9A 1QF8A 2JR6A 1USPB 1KD12 2QLVB 1K9M1 2J6AA 1K731 1Q16A 4NBBA 2JA5I 3CC71 2WAQA 2VPYA 5IP9I 3CCQZ 4NFRA 3JAMf 5AN9F 3GTOI 2JA7I 5T67A 1YJ91 3G6E1 2OTLZ 1JJ2Z 3S16I 2K3RA 4E2WA 2M6NA 5IT9f 3CCLZ 3QWUA 2OOXB 4RVDA 4XX2A 4RVHA 1Q822 2EGTA 2O4HA 3NH8A 2ZAEB 4E2XA 3S1RI 2PMZA 2O53A 2RT9A 1WJ2A 2JIOA 1X3ZA 1VQ91 2G2KA 1P9NA 2AYDA 3GTLI 2R6MA 1KC81 2JIRA 3KIHA 3CCR1 1YJW1 4NBGA 2HF1A 1S721 3I551 4A3JI 3VMGA 1VQ51 4A3II 1FDOA 1VQM1 2LEXA 4A3BI 3D2LA 1Y8CA 1N8R2 3H3VJ 3I4NI 2M48A 4MD7A 3PO2I 1K9M2 1RO2A 3CCE1 1Y1WI 1K8A2 2HU9A 1VQO1 4A93I 2KI7B 1KD11 4BBSI 3CPWY 3HOXI 2W03A 3S1QI 4QTUA 4Y7NI 1VQL1 2RPRA 2VUMI 2W04A 2JIMA 3CC7Z 4HH4A 5LL6f 2QA41 2H85A 2VPZA 5A2Qf 3CXCY 4MD9A 3J81b 2F4MA 4E2ZA 3CC21 3G6EZ 3HOUI 3FQQA 3OW2Y 2JIPA 4CL1A 2QRCB 4DQYB 1TWHI 4RVGA 1Q821 1QVGY 1M1K1 1W2BY 3CC41 2YADA 1AA6A 1RNIA 2GU2A 2IV2X 3NH4A 4NH1C 1VQ9Z 5C3EI 3TDHB 5FLXf 2WB1A 3G4S1 4NBEA 4TNUA 3CCRZ 2KPIA 1YJWZ 3IF8A 3HKZA 2QEX1 1S72Z 3I55Z 4Y52I 1VQ5Z 1N8R1 1VQMZ 4A3MI 2NVYI 1Y1VI 3GTJI 4DK1A 1K8A1 3CCEZ 1YJN1 1QXFA 1VQOZ 2E2JI 2AKLA 4NOZA 4E31A 4HGZA 2VF1A 3GTKI 2PK7A 4EWCA 1VLAA 1VQLZ 2NVTI 1VQ7Z 1KQSZ 2E9HA 1YIJ1 5CM2M 2R7ZI 1LQLA 4MRIA 2QA4Z 1RQFA 2V8JA 4MONA 1Y1VS 3F3FC 2F4OA 3VB9A 4AYBA 3J7A4 1YIT1 3CC2Z 1TWCI 1YI21 1M1K2 3I4MI 1NUIA 2K5RA 3J80b 2VPXA 3F3PC 5IP7I 3I561 3CQZI 4HGYA 3VMHA 3CC4Z
chains in the Genus database with same CATH topology
2E2HI 4E33A 1SFOI 4E2YA 3M3YI 4A3CI 4BXXI 1JJ2Y 2V8IA 4A3DI 2B63I 1USPA 3NH5A 5T64A 3HOVI 2Q4ZA 3Q87A 1NP6A 3JAMb 2JA6I 5T6BA 3CCV1 5D1PA 1RO4A 3I07A 1YUAA 5FLMI 3G4SZ 1KRLA 5D1OB 1VQK1 5IT9b 5C44I 3CME1 3D9XA 3NDJA 1TWGI 1Q7Y1 2QKDA 2JS4A 1YJNZ 2R92I 3H0GI 1YHQ1 3KIFA 1VQ61 3ESWA 1WW9A 1YIJZ 1YJ9Z 1RO0A 3CCQ1 3GCFA 4RVFA 4E30A 1X0TA 1VQ41 3D6WA 4NBFA 3NFZA 2QRDB 1YITZ 4MXUA 3CCU1 4NB8A 4NBDA 1YI2Z 3S2HI 3CCM1 1QVFZ 3I56Z 3EEDA 3T4NB 3MONA 4BBRI 3S2DI 5D1OA 3HOWI 1VQ81 1WIIA 1JWHC 1YUKA 1S7MA 5A2Qb 3FQMA 2NVQI 3CMA1 3CCVZ 4A3GI 3P5JB 2Y0SA 1Q7Y2 1K83I 1VQKZ 3RZOI 1Q862 4NBHA 1ML8A 2QR1B 3G711 4A3KI 1TFIA 3CMEZ 2DE6A 4S1TA 4MD8A 1Q812 4BY7I 3CD61 2BJOA 3S14I 3GTQI 2P28A 1YHQZ 1VQ6Z 1VQP1 1I3QI 3S1NI 5FLXb 1NJI2 3VTNA 2P3YA 1TWAI 4RS4A 3CCS1 1VQ4Z 2Q51A 1L1OC 2PM9A 3CCUZ 1I6HI 3BG0B 1ZB8A 1KQSY 3MZLB 2V8KA 2OTJ1 4QTTA 4A3FI 3HOZI 1I50I 1QYPA 2OOYB 3CCMZ 2OZKA 3GTGI 3VMIA 2DE7A 3CCJ1 5C4JI 1ZH1A 4NBCA 2LIYA 3GKQA 3NDIA 4A3LI 1M902 1VQN1 1VQ8Z 2R93I 3CPWZ 3J81f 2QEXZ 3CMAZ 1PFTA 1X3WA 3K7AI 1Z03A 1Z01A 3FKII 3IFUA 3M4OI 2QREB 3S1MI 3HOYI 1Q861 4NBAA 3CXCZ 4X6AI 2E2II 2JMOA 1DL6A 3G71Z 2DE5A 1ZB9A 4RV9A 3RZDI 1Q811 2LFUA 3GTPI 2I3CA 3EERA 1K732 3CD6Z 3OW2Z 1QVGZ 1R9TI 3IX0A 3TE5B 1N2FA 1W2BZ 1Z02A 1VQPZ 1NJI1 2GTHA 1VQ71 2RIQA 2OTL1 4BY1I 2JUBA 3GTMI 2IZ3A 2NVXI 3LUSA 1RLYA 3CCL1 3CCSZ 2GTIA 4MH4A 4DGLA 2JNYA 3PO3I 3S15I 3BG1B 2VUGA 2YU9I 2OTJZ 4E32A 1WCMI 4A3EI 3GTMS 1M901 3CCJZ 3MZKB 2IZ4A 2RHBA 3S17I 1KC82 1VQNZ 5C4XI 3U50C 2RBLA 1QVFY 3PO3S 2JA8I 1TWFI 3J80f 4NB9A 1QF8A 2JR6A 1USPB 1KD12 2QLVB 1K9M1 2J6AA 1K731 4NBBA 2JA5I 3CC71 2WAQA 5IP9I 3CCQZ 4NFRA 3JAMf 5AN9F 3GTOI 2JA7I 5T67A 1YJ91 3G6E1 2OTLZ 1JJ2Z 3S16I 2K3RA 4E2WA 2M6NA 5IT9f 3CCLZ 3QWUA 2OOXB 4RVDA 4XX2A 4RVHA 1Q822 2EGTA 2O4HA 3NH8A 2ZAEB 4E2XA 3S1RI 2PMZA 2O53A 2RT9A 1X3ZA 1VQ91 2G2KA 1P9NA 3GTLI 2R6MA 1KC81 3KIHA 3CCR1 1YJW1 4NBGA 2HF1A 1S721 3I551 4A3JI 3VMGA 1VQ51 4A3II 4A3BI 1VQM1 3H3VJ 1N8R2 3I4NI 2M48A 4MD7A 3PO2I 1K9M2 1RO2A 3CCE1 1Y1WI 1K8A2 2HU9A 1VQO1 4A93I 2KI7B 1KD11 4BBSI 3CPWY 3HOXI 2W03A 3S1QI 4QTUA 4Y7NI 1VQL1 2RPRA 2VUMI 2W04A 3CC7Z 4HH4A 5LL6f 2QA41 2H85A 5A2Qf 3CXCY 4MD9A 3J81b 2F4MA 4E2ZA 3CC21 3G6EZ 3HOUI 3FQQA 3OW2Y 4CL1A 2QRCB 4DQYB 1TWHI 4RVGA 1Q821 1QVGY 1M1K1 1W2BY 3CC41 2YADA 1RNIA 2GU2A 3NH4A 4NH1C 1VQ9Z 5C3EI 3TDHB 5FLXf 2WB1A 3G4S1 4NBEA 4TNUA 3CCRZ 2KPIA 1YJWZ 3IF8A 3HKZA 2QEX1 1S72Z 3I55Z 4Y52I 1VQ5Z 1N8R1 1VQMZ 4A3MI 2NVYI 1Y1VI 3GTJI 4DK1A 1K8A1 3CCEZ 1YJN1 1VQOZ 2E2JI 2AKLA 4NOZA 4E31A 4HGZA 2VF1A 3GTKI 2PK7A 4EWCA 1VLAA 1VQLZ 2NVTI 1VQ7Z 1KQSZ 2E9HA 1YIJ1 5CM2M 2R7ZI 1LQLA 4MRIA 2QA4Z 1RQFA 2V8JA 4MONA 1Y1VS 3F3FC 2F4OA 3VB9A 4AYBA 3J7A4 1YIT1 3CC2Z 1TWCI 1YI21 1M1K2 3I4MI 1NUIA 2K5RA 3J80b 3F3PC 5IP7I 3I561 3CQZI 4HGYA 3VMHA 3CC4Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MD7 A;  4MD9 A;  1JWH C;  4NH1 C;  4DGL A;  2R6M A;  4MD8 A;  1QF8 A;  3EED A;  2JMO A;  2RT9 A;  1RQF A;  2M6N A;  2M48 A; 
#chains in the Genus database with same CATH topology
 2E2H I;  4E33 A;  1SFO I;  4E2Y A;  3M3Y I;  4A3C I;  4BXX I;  1JJ2 Y;  2V8I A;  4A3D I;  2B63 I;  1USP A;  3NH5 A;  5T64 A;  3HOV I;  2Q4Z A;  3Q87 A;  1NP6 A;  3JAM b;  2JA6 I;  5T6B A;  3CCV 1;  5D1P A;  1RO4 A;  3I07 A;  1YUA A;  5FLM I;  3G4S Z;  1KRL A;  5D1O B;  1VQK 1;  5IT9 b;  5C44 I;  3CME 1;  3D9X A;  3NDJ A;  1TWG I;  1Q7Y 1;  2QKD A;  2JS4 A;  1YJN Z;  2R92 I;  3H0G I;  1YHQ 1;  3KIF A;  1VQ6 1;  3ESW A;  1WW9 A;  1YIJ Z;  1YJ9 Z;  1RO0 A;  3CCQ 1;  3GCF A;  4RVF A;  4E30 A;  1X0T A;  2V45 A;  1VQ4 1;  3D6W A;  4NBF A;  3NFZ A;  2QRD B;  1YIT Z;  4MXU A;  3CCU 1;  4NB8 A;  4NBD A;  1YI2 Z;  3S2H I;  3CCM 1;  1WZN A;  1QVF Z;  3I56 Z;  3EED A;  3T4N B;  3MON A;  4BBR I;  3S2D I;  5D1O A;  3HOW I;  1VQ8 1;  1WII A;  1JWH C;  1YUK A;  1S7M A;  5A2Q b;  3FQM A;  2NVQ I;  3CMA 1;  3CCV Z;  4A3G I;  3P5J B;  2Y0S A;  1Q7Y 2;  1K83 I;  1VQK Z;  3RZO I;  1Q86 2;  4NBH A;  1ML8 A;  2QR1 B;  3G71 1;  4A3K I;  1TFI A;  3CME Z;  2DE6 A;  2V3V A;  4S1T A;  4MD8 A;  1Q81 2;  4BY7 I;  3CD6 1;  2BJO A;  3S14 I;  3GTQ I;  2P28 A;  1YHQ Z;  1VQ6 Z;  1VQP 1;  1I3Q I;  3S1N I;  5FLX b;  1NJI 2;  3VTN A;  2NAP A;  2P3Y A;  1TWA I;  4RS4 A;  3CCS 1;  1SIW A;  1VQ4 Z;  1FDI A;  2Q51 A;  1L1O C;  2PM9 A;  3CCU Z;  1I6H I;  3BG0 B;  1ZB8 A;  1KQS Y;  3MZL B;  2V8K A;  2OTJ 1;  4QTT A;  4A3F I;  3HOZ I;  1I50 I;  1QYP A;  2OOY B;  3CCM Z;  2OZK A;  3GTG I;  3VMI A;  2DE7 A;  3CCJ 1;  5C4J I;  1ZH1 A;  4NBC A;  2LIY A;  3GKQ A;  3NDI A;  4A3L I;  1M90 2;  1VQN 1;  1VQ8 Z;  2R93 I;  3CPW Z;  3J81 f;  2QEX Z;  3CMA Z;  1PFT A;  1X3W A;  3K7A I;  1Z03 A;  1Z01 A;  3FKI I;  3IFU A;  3M4O I;  2QRE B;  3S1M I;  3HOY I;  1Q86 1;  4NBA A;  3CXC Z;  4X6A I;  2E2I I;  2JMO A;  1DL6 A;  3G71 Z;  2DE5 A;  1ZB9 A;  4RV9 A;  3RZD I;  1Q81 1;  2LFU A;  3GTP I;  2I3C A;  3EER A;  2JIQ A;  1K73 2;  3CD6 Z;  3OW2 Z;  2VPW A;  1QVG Z;  1R9T I;  3IX0 A;  2E7Z A;  3TE5 B;  1N2F A;  1W2B Z;  1Z02 A;  1VQP Z;  1NJI 1;  2GTH A;  1VQ7 1;  2RIQ A;  2OTL 1;  4BY1 I;  2JUB A;  3GTM I;  2IZ3 A;  2NVX I;  3LUS A;  1RLY A;  3CCL 1;  3CCS Z;  2GTI A;  4MH4 A;  4DGL A;  2JNY A;  3PO3 I;  3S15 I;  3BG1 B;  2VUG A;  2YU9 I;  2OTJ Z;  4E32 A;  1WCM I;  4A3E I;  3GTM S;  1M90 1;  3CCJ Z;  3MZK B;  2IZ4 A;  2RHB A;  3S17 I;  1KC8 2;  1VQN Z;  5C4X I;  3IR7 A;  3U50 C;  2RBL A;  1QVF Y;  3PO3 S;  2JA8 I;  1TWF I;  3J80 f;  4NB9 A;  1QF8 A;  2JR6 A;  1USP B;  1KD1 2;  2QLV B;  1K9M 1;  2J6A A;  1K73 1;  1Q16 A;  4NBB A;  2JA5 I;  3CC7 1;  2WAQ A;  2VPY A;  5IP9 I;  3CCQ Z;  4NFR A;  3JAM f;  5AN9 F;  3GTO I;  2JA7 I;  5T67 A;  1YJ9 1;  3G6E 1;  2OTL Z;  1JJ2 Z;  3S16 I;  2K3R A;  4E2W A;  2M6N A;  5IT9 f;  3CCL Z;  3QWU A;  2OOX B;  4RVD A;  4XX2 A;  4RVH A;  1Q82 2;  2EGT A;  2O4H A;  3NH8 A;  2ZAE B;  4E2X A;  3S1R I;  2PMZ A;  2O53 A;  2RT9 A;  1WJ2 A;  2JIO A;  1X3Z A;  1VQ9 1;  2G2K A;  1P9N A;  2AYD A;  3GTL I;  2R6M A;  1KC8 1;  2JIR A;  3KIH A;  3CCR 1;  1YJW 1;  4NBG A;  2HF1 A;  1S72 1;  3I55 1;  4A3J I;  3VMG A;  1VQ5 1;  4A3I I;  1FDO A;  1VQM 1;  2LEX A;  4A3B I;  3D2L A;  1Y8C A;  1N8R 2;  3H3V J;  3I4N I;  2M48 A;  4MD7 A;  3PO2 I;  1K9M 2;  1RO2 A;  3CCE 1;  1Y1W I;  1K8A 2;  2HU9 A;  1VQO 1;  4A93 I;  2KI7 B;  1KD1 1;  4BBS I;  3CPW Y;  3HOX I;  2W03 A;  3S1Q I;  4QTU A;  4Y7N I;  1VQL 1;  2RPR A;  2VUM I;  2W04 A;  2JIM A;  3CC7 Z;  4HH4 A;  5LL6 f;  2QA4 1;  2H85 A;  2VPZ A;  5A2Q f;  3CXC Y;  4MD9 A;  3J81 b;  2F4M A;  4E2Z A;  3CC2 1;  3G6E Z;  3HOU I;  3FQQ A;  3OW2 Y;  2JIP A;  4CL1 A;  2QRC B;  4DQY B;  1TWH I;  4RVG A;  1Q82 1;  1QVG Y;  1M1K 1;  1W2B Y;  3CC4 1;  2YAD A;  1AA6 A;  1RNI A;  2GU2 A;  2IV2 X;  3NH4 A;  4NH1 C;  1VQ9 Z;  5C3E I;  3TDH B;  5FLX f;  2WB1 A;  3G4S 1;  4NBE A;  4TNU A;  3CCR Z;  2KPI A;  1YJW Z;  3IF8 A;  3HKZ A;  2QEX 1;  1S72 Z;  3I55 Z;  4Y52 I;  1VQ5 Z;  1N8R 1;  1VQM Z;  4A3M I;  2NVY I;  1Y1V I;  3GTJ I;  4DK1 A;  1K8A 1;  3CCE Z;  1YJN 1;  1QXF A;  1VQO Z;  2E2J I;  2AKL A;  4NOZ A;  4E31 A;  4HGZ A;  2VF1 A;  3GTK I;  2PK7 A;  4EWC A;  1VLA A;  1VQL Z;  2NVT I;  1VQ7 Z;  1KQS Z;  2E9H A;  1YIJ 1;  5CM2 M;  2R7Z I;  1LQL A;  4MRI A;  2QA4 Z;  1RQF A;  2V8J A;  4MON A;  1Y1V S;  3F3F C;  2F4O A;  3VB9 A;  4AYB A;  3J7A 4;  1YIT 1;  3CC2 Z;  1TWC I;  1YI2 1;  1M1K 2;  3I4M I;  1NUI A;  2K5R A;  3J80 b;  2VPX A;  3F3P C;  5IP7 I;  3I56 1;  3CQZ I;  4HGY A;  3VMH A;  3CC4 Z; 
#chains in the Genus database with same CATH homology
 2E2H I;  4E33 A;  1SFO I;  4E2Y A;  3M3Y I;  4A3C I;  4BXX I;  1JJ2 Y;  2V8I A;  4A3D I;  2B63 I;  1USP A;  3NH5 A;  5T64 A;  3HOV I;  2Q4Z A;  3Q87 A;  1NP6 A;  3JAM b;  2JA6 I;  5T6B A;  3CCV 1;  5D1P A;  1RO4 A;  3I07 A;  1YUA A;  5FLM I;  3G4S Z;  1KRL A;  5D1O B;  1VQK 1;  5IT9 b;  5C44 I;  3CME 1;  3D9X A;  3NDJ A;  1TWG I;  1Q7Y 1;  2QKD A;  2JS4 A;  1YJN Z;  2R92 I;  3H0G I;  1YHQ 1;  3KIF A;  1VQ6 1;  3ESW A;  1WW9 A;  1YIJ Z;  1YJ9 Z;  1RO0 A;  3CCQ 1;  3GCF A;  4RVF A;  4E30 A;  1X0T A;  1VQ4 1;  3D6W A;  4NBF A;  3NFZ A;  2QRD B;  1YIT Z;  4MXU A;  3CCU 1;  4NB8 A;  4NBD A;  1YI2 Z;  3S2H I;  3CCM 1;  1QVF Z;  3I56 Z;  3EED A;  3T4N B;  3MON A;  4BBR I;  3S2D I;  5D1O A;  3HOW I;  1VQ8 1;  1WII A;  1JWH C;  1YUK A;  1S7M A;  5A2Q b;  3FQM A;  2NVQ I;  3CMA 1;  3CCV Z;  4A3G I;  3P5J B;  2Y0S A;  1Q7Y 2;  1K83 I;  1VQK Z;  3RZO I;  1Q86 2;  4NBH A;  1ML8 A;  2QR1 B;  3G71 1;  4A3K I;  1TFI A;  3CME Z;  2DE6 A;  4S1T A;  4MD8 A;  1Q81 2;  4BY7 I;  3CD6 1;  2BJO A;  3S14 I;  3GTQ I;  2P28 A;  1YHQ Z;  1VQ6 Z;  1VQP 1;  1I3Q I;  3S1N I;  5FLX b;  1NJI 2;  3VTN A;  2P3Y A;  1TWA I;  4RS4 A;  3CCS 1;  1VQ4 Z;  2Q51 A;  1L1O C;  2PM9 A;  3CCU Z;  1I6H I;  3BG0 B;  1ZB8 A;  1KQS Y;  3MZL B;  2V8K A;  2OTJ 1;  4QTT A;  4A3F I;  3HOZ I;  1I50 I;  1QYP A;  2OOY B;  3CCM Z;  2OZK A;  3GTG I;  3VMI A;  2DE7 A;  3CCJ 1;  5C4J I;  1ZH1 A;  4NBC A;  2LIY A;  3GKQ A;  3NDI A;  4A3L I;  1M90 2;  1VQN 1;  1VQ8 Z;  2R93 I;  3CPW Z;  3J81 f;  2QEX Z;  3CMA Z;  1PFT A;  1X3W A;  3K7A I;  1Z03 A;  1Z01 A;  3FKI I;  3IFU A;  3M4O I;  2QRE B;  3S1M I;  3HOY I;  1Q86 1;  4NBA A;  3CXC Z;  4X6A I;  2E2I I;  2JMO A;  1DL6 A;  3G71 Z;  2DE5 A;  1ZB9 A;  4RV9 A;  3RZD I;  1Q81 1;  2LFU A;  3GTP I;  2I3C A;  3EER A;  1K73 2;  3CD6 Z;  3OW2 Z;  1QVG Z;  1R9T I;  3IX0 A;  3TE5 B;  1N2F A;  1W2B Z;  1Z02 A;  1VQP Z;  1NJI 1;  2GTH A;  1VQ7 1;  2RIQ A;  2OTL 1;  4BY1 I;  2JUB A;  3GTM I;  2IZ3 A;  2NVX I;  3LUS A;  1RLY A;  3CCL 1;  3CCS Z;  2GTI A;  4MH4 A;  4DGL A;  2JNY A;  3PO3 I;  3S15 I;  3BG1 B;  2VUG A;  2YU9 I;  2OTJ Z;  4E32 A;  1WCM I;  4A3E I;  3GTM S;  1M90 1;  3CCJ Z;  3MZK B;  2IZ4 A;  2RHB A;  3S17 I;  1KC8 2;  1VQN Z;  5C4X I;  3U50 C;  2RBL A;  1QVF Y;  3PO3 S;  2JA8 I;  1TWF I;  3J80 f;  4NB9 A;  1QF8 A;  2JR6 A;  1USP B;  1KD1 2;  2QLV B;  1K9M 1;  2J6A A;  1K73 1;  4NBB A;  2JA5 I;  3CC7 1;  2WAQ A;  5IP9 I;  3CCQ Z;  4NFR A;  3JAM f;  5AN9 F;  3GTO I;  2JA7 I;  5T67 A;  1YJ9 1;  3G6E 1;  2OTL Z;  1JJ2 Z;  3S16 I;  2K3R A;  4E2W A;  2M6N A;  5IT9 f;  3CCL Z;  3QWU A;  2OOX B;  4RVD A;  4XX2 A;  4RVH A;  1Q82 2;  2EGT A;  2O4H A;  3NH8 A;  2ZAE B;  4E2X A;  3S1R I;  2PMZ A;  2O53 A;  2RT9 A;  1X3Z A;  1VQ9 1;  2G2K A;  1P9N A;  3GTL I;  2R6M A;  1KC8 1;  3KIH A;  3CCR 1;  1YJW 1;  4NBG A;  2HF1 A;  1S72 1;  3I55 1;  4A3J I;  3VMG A;  1VQ5 1;  4A3I I;  4A3B I;  1VQM 1;  3H3V J;  1N8R 2;  3I4N I;  2M48 A;  4MD7 A;  3PO2 I;  1K9M 2;  1RO2 A;  3CCE 1;  1Y1W I;  1K8A 2;  2HU9 A;  1VQO 1;  4A93 I;  2KI7 B;  1KD1 1;  4BBS I;  3CPW Y;  3HOX I;  2W03 A;  3S1Q I;  4QTU A;  4Y7N I;  1VQL 1;  2RPR A;  2VUM I;  2W04 A;  3CC7 Z;  4HH4 A;  5LL6 f;  2QA4 1;  2H85 A;  5A2Q f;  3CXC Y;  4MD9 A;  3J81 b;  2F4M A;  4E2Z A;  3CC2 1;  3G6E Z;  3HOU I;  3FQQ A;  3OW2 Y;  4CL1 A;  2QRC B;  4DQY B;  1TWH I;  4RVG A;  1Q82 1;  1QVG Y;  1M1K 1;  1W2B Y;  3CC4 1;  2YAD A;  1RNI A;  2GU2 A;  3NH4 A;  4NH1 C;  1VQ9 Z;  5C3E I;  3TDH B;  5FLX f;  2WB1 A;  3G4S 1;  4NBE A;  4TNU A;  3CCR Z;  2KPI A;  1YJW Z;  3IF8 A;  3HKZ A;  2QEX 1;  1S72 Z;  3I55 Z;  4Y52 I;  1VQ5 Z;  1N8R 1;  1VQM Z;  4A3M I;  2NVY I;  1Y1V I;  3GTJ I;  4DK1 A;  1K8A 1;  3CCE Z;  1YJN 1;  1VQO Z;  2E2J I;  2AKL A;  4NOZ A;  4E31 A;  4HGZ A;  2VF1 A;  3GTK I;  2PK7 A;  4EWC A;  1VLA A;  1VQL Z;  2NVT I;  1VQ7 Z;  1KQS Z;  2E9H A;  1YIJ 1;  5CM2 M;  2R7Z I;  1LQL A;  4MRI A;  2QA4 Z;  1RQF A;  2V8J A;  4MON A;  1Y1V S;  3F3F C;  2F4O A;  3VB9 A;  4AYB A;  3J7A 4;  1YIT 1;  3CC2 Z;  1TWC I;  1YI2 1;  1M1K 2;  3I4M I;  1NUI A;  2K5R A;  3J80 b;  3F3P C;  5IP7 I;  3I56 1;  3CQZ I;  4HGY A;  3VMH A;  3CC4 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...