1JWHC

Crystal structure of human protein kinase ck2 holoenzyme
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
200
structure length
200
Chain Sequence
EVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II, alpha chain
publication title Crystal structure of human protein kinase CK2: insights into basic properties of the CK2 holoenzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 43
structure length 200
sequence length 200
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 1jwhC01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1jwhC02
4NH1C 4DGLA 2M48A 4MD9A 4MD8A 2RT9A 2R6MA 3EEDA 2JMOA 1QF8A 4MD7A 1RQFA 2M6NA 1JWHC
chains in the Genus database with same CATH superfamily
4E32A 1VQ8Z 2OTLZ 1VQ7Z 2QEXZ 4EWCA 1NUIA 3M4OI 1Z03A 1YI2Z 3J81f 1YHQZ 5IT9f 1VQ51 3VMIA 4RVHA 3NH4A 1YIT1 1VQ41 3I561 2QRCB 1M901 1JJ2Z 2AKLA 4BY7I 2YADA 1Q861 2Y0SA 2NVXI 2I3CA 3NDJA 2QA4Z 2E2II 2WB1A 1KD12 2OTJZ 1WJ2A 2WAQA 4A3JI 3S1RI 1K9M1 2W03A 2AYDA 5T67A 3GTJI 1YJ9Z 3IFUA 3NFZA 2LEXA 4E2YA 4HGZA 1QVFY 4TNUA 3CC7Z 2JA8I 1M902 1N2FA 1VQO1 1Q862 3RZDI 4NBBA 3IR7A 3CC4Z 3I55Z 3G6E1 2Q4ZA 2M6NA 3TDHB 1RO4A 1NJI1 3H0GI 3CCU1 1YIJZ 2JIPA 3S2HI 3G4SZ 1Q7Y2 5D1OB 2DE5A 1PFTA 1I3QI 3CMEZ 3HOXI 1K9M2 4XX2A 2JA6I 4E2XA 3S14I 4RS4A 1USPB 4E2ZA 4BBSI 3NH8A 1Y1WI 1NP6A 3IF8A 1FDOA 4MONA 3BG0B 3TE5B 1VQPZ 3PO3I 3GTMI 1VQL1 1S7MA 3VMGA 4RVDA 4MD9A 3RZOI 1FDIA 5C4JI 2JIOA 1NJI2 3S15I 3F3FC 3NH5A 2R6MA 1Z01A 5D1PA 2JA5I 3G71Z 1VQMZ 1TWCI 5T6BA 2VUMI 2OOYB 2IZ4A 1WW9A 2QREB 5FLXf 3CXCY 4NB8A 1YUAA 5AN9F 2Q51A 3M3YI 3LUSA 2VUGA 2LIYA 1TWFI 4NFRA 2GTIA 1VQ81 1RLYA 4BBRI 1W2BZ 1ZH1A 2QEX1 1K731 3FQQA 2P3YA 1YI21 5CM2M 1KC82 1VQ6Z 3Q87A 3CCJ1 3CC2Z 4QTUA 1Y8CA 2B63I 3CCQZ 1YJNZ 3D2LA 3P5JB 3CCLZ 3MZKB 2K5RA 2RT9A 4MXUA 4Y52I 1K8A2 3HKZA 2OTJ1 1I50I 2JR6A 3GTKI 4BY1I 3MONA 4A3BI 3CD61 2DE6A 2JIRA 1K732 4MRIA 1KQSY 4E31A 1YJ91 3CXCZ 1ZB9A 2JNYA 3PO3S 5T64A 3GTMS 3CCMZ 2JIMA 3HOYI 2V45A 4A3GI 4NOZA 3VMHA 2PMZA 4MD7A 1Q7Y1 2V8KA 3I551 4A93I 4A3CI 2VPWA 5IP9I 3OW2Y 3G4S1 2VF1A 3S1MI 2RBLA 3BG1B 1S72Z 1VQNZ 1ML8A 3CME1 3PO2I 3CCRZ 3F3PC 3GTPI 3GTLI 1RQFA 3HOUI 1AA6A 3GCFA 3CMAZ 2VPZA 2NVTI 3S16I 4A3LI 3EEDA 1VQP1 3S17I 2H85A 1QYPA 1VQ4Z 3I56Z 2NVYI 3ESWA 5C3EI 3CCEZ 1ZB8A 2HF1A 2JA7I 2IZ3A 1QXFA 1R9TI 4NBGA 1X3ZA 2LFUA 4A3II 1VQM1 3GTGI 2G2KA 3S2DI 2O53A 1QVGY 2KPIA 3GTQI 1RO0A 1SIWA 4RVFA 5FLMI 4CL1A 4RVGA 4A3EI 3HOWI 3J7A4 4A3MI 1KC81 1QVFZ 4DK1A 4NBHA 1VQOZ 3I4MI 4NBCA 3I07A 1VQ61 2E9HA 2ZAEB 4DQYB 3KIFA 3T4NB 2F4MA 3J80b 1YJW1 3CCQ1 1YJN1 3CCUZ 1K8A1 5LL6f 3I4NI 5C44I 3CCL1 3HOVI 2OTL1 1VQ71 2V8JA 1Q822 1SFOI 1RNIA 1YHQ1 1X3WA 3J81b 2V3VA 1JJ2Y 1VQKZ 4NBEA 1QVGZ 1TWGI 3VTNA 4S1TA 3CCSZ 2M48A 2QA41 2E7ZA 2V8IA 2E2HI 2KI7B 3J80f 4BXXI 2DE7A 2R93I 1JWHC 4NH1C 1Z02A 1S721 4MD8A 1YUKA 1N8R2 1VQN1 3CCVZ 2JMOA 4A3KI 1KRLA 2RIQA 1TFIA 3EERA 4Y7NI 3CCR1 2HU9A 1VQ9Z 3CC71 4NB9A 2NVQI 3CMA1 3CC41 2YU9I 2RHBA 3CCJZ 1I6HI 1YIJ1 1K83I 3FKII 2QR1B 2GU2A 5A2Qb 3CCE1 2QKDA 2O4HA 4DGLA 2OOXB 4QTTA 4RV9A 3CPWY 3D9XA 1VQ5Z 3CD6Z 4E30A 2JS4A 2EGTA 1YITZ 4HGYA 1WCMI 1KQSZ 5IP7I 2GTHA 2PM9A 1QF8A 2NAPA 1Q811 3GTOI 3IX0A 1Y1VI 3S1NI 1VLAA 4E33A 3G711 2BJOA 3U50C 2VPXA 3JAMb 3GKQA 5D1OA 2F4OA 1Q821 4X6AI 5FLXb 5A2Qf 4MH4A 3OW2Z 1W2BY 1L1OC 1WZNA 1USPA 1WIIA 2PK7A 2QLVB 3K7AI 3HOZI 2OZKA 4A3FI 2VPYA 2E2JI 3CC21 3CPWZ 1Q812 1TWAI 3KIHA 3CQZI 1X0TA 3G6EZ 2QRDB 1LQLA 2RPRA 4NBFA 5C4XI 1VQK1 3VB9A 1M1K1 2IV2X 4HH4A 2JIQA 3NDIA 3CCS1 4AYBA 1TWHI 2R92I 3JAMf 2J6AA 1N8R1 5IT9b 2JUBA 4E2WA 2W04A 3MZLB 3H3VJ 2P28A 3CCV1 1VQLZ 3S1QI 1RO2A 4NBAA 1VQ91 3CCM1 2K3RA 1DL6A 1M1K2 3QWUA 4NBDA 2R7ZI 1Y1VS 3D6WA 4A3DI 1YJWZ 3FQMA 1P9NA 1Q16A 1KD11
chains in the Genus database with same CATH topology
4E32A 1VQ8Z 2OTLZ 1VQ7Z 2QEXZ 4EWCA 1NUIA 3M4OI 1Z03A 1YI2Z 3J81f 1YHQZ 5IT9f 1VQ51 3VMIA 4RVHA 3NH4A 1YIT1 1VQ41 3I561 2QRCB 1M901 1JJ2Z 2AKLA 4BY7I 2YADA 1Q861 2Y0SA 2NVXI 2I3CA 3NDJA 2QA4Z 2E2II 2WB1A 1KD12 2OTJZ 2WAQA 4A3JI 3S1RI 1K9M1 2W03A 5T67A 3GTJI 1YJ9Z 3IFUA 3NFZA 4E2YA 4HGZA 1QVFY 4TNUA 3CC7Z 2JA8I 1M902 1N2FA 1VQO1 1Q862 3RZDI 4NBBA 3CC4Z 3I55Z 3G6E1 2Q4ZA 2M6NA 3TDHB 1RO4A 1NJI1 3H0GI 3CCU1 1YIJZ 3S2HI 3G4SZ 1Q7Y2 5D1OB 2DE5A 1PFTA 1I3QI 3CMEZ 3HOXI 1K9M2 4XX2A 2JA6I 4E2XA 3S14I 4RS4A 1USPB 4E2ZA 4BBSI 3NH8A 1Y1WI 1NP6A 3IF8A 4MONA 3BG0B 3TE5B 1VQPZ 3PO3I 3GTMI 1VQL1 1S7MA 3VMGA 4RVDA 4MD9A 3RZOI 5C4JI 1NJI2 3S15I 3F3FC 3NH5A 2R6MA 1Z01A 5D1PA 2JA5I 3G71Z 1VQMZ 1TWCI 5T6BA 2VUMI 2OOYB 2IZ4A 1WW9A 2QREB 5FLXf 3CXCY 4NB8A 1YUAA 5AN9F 2Q51A 3M3YI 3LUSA 2VUGA 2LIYA 1TWFI 4NFRA 2GTIA 1VQ81 1RLYA 4BBRI 1W2BZ 1ZH1A 2QEX1 1K731 3FQQA 2P3YA 1YI21 5CM2M 1KC82 1VQ6Z 3Q87A 3CCJ1 3CC2Z 4QTUA 2B63I 3CCQZ 1YJNZ 3P5JB 3CCLZ 3MZKB 2K5RA 2RT9A 4MXUA 4Y52I 1K8A2 3HKZA 2OTJ1 1I50I 2JR6A 3GTKI 4BY1I 3MONA 4A3BI 3CD61 2DE6A 1K732 4MRIA 1KQSY 4E31A 1YJ91 3CXCZ 1ZB9A 2JNYA 3PO3S 5T64A 3GTMS 3CCMZ 3HOYI 4A3GI 4NOZA 3VMHA 2PMZA 4MD7A 1Q7Y1 2V8KA 3I551 4A93I 4A3CI 5IP9I 3OW2Y 3G4S1 2VF1A 3S1MI 2RBLA 3BG1B 1S72Z 1VQNZ 1ML8A 3CME1 3PO2I 3CCRZ 3F3PC 3GTPI 3GTLI 1RQFA 3HOUI 3GCFA 3CMAZ 2NVTI 3S16I 4A3LI 3EEDA 1VQP1 3S17I 2H85A 1QYPA 1VQ4Z 3I56Z 2NVYI 3ESWA 5C3EI 3CCEZ 1ZB8A 2HF1A 2JA7I 2IZ3A 1R9TI 4NBGA 1X3ZA 2LFUA 4A3II 1VQM1 3GTGI 2G2KA 3S2DI 2O53A 1QVGY 2KPIA 3GTQI 1RO0A 4RVFA 5FLMI 4CL1A 4RVGA 4A3EI 3HOWI 3J7A4 4A3MI 1KC81 1QVFZ 4DK1A 4NBHA 1VQOZ 3I4MI 4NBCA 3I07A 1VQ61 2E9HA 2ZAEB 4DQYB 3KIFA 3T4NB 2F4MA 3J80b 1YJW1 3CCQ1 1YJN1 3CCUZ 1K8A1 5LL6f 3I4NI 5C44I 3CCL1 3HOVI 2OTL1 1VQ71 2V8JA 1Q822 1SFOI 1RNIA 1YHQ1 1X3WA 3J81b 1JJ2Y 1VQKZ 4NBEA 1QVGZ 1TWGI 3VTNA 4S1TA 3CCSZ 2M48A 2QA41 2V8IA 2E2HI 2KI7B 3J80f 4BXXI 2DE7A 2R93I 1JWHC 4NH1C 1Z02A 1S721 4MD8A 1YUKA 1N8R2 1VQN1 3CCVZ 2JMOA 4A3KI 1KRLA 2RIQA 1TFIA 3EERA 4Y7NI 3CCR1 2HU9A 1VQ9Z 3CC71 4NB9A 2NVQI 3CMA1 3CC41 2YU9I 2RHBA 3CCJZ 1I6HI 1YIJ1 1K83I 3FKII 2QR1B 2GU2A 5A2Qb 3CCE1 2QKDA 2O4HA 4DGLA 2OOXB 4QTTA 4RV9A 3CPWY 3D9XA 1VQ5Z 3CD6Z 4E30A 2JS4A 2EGTA 1YITZ 4HGYA 1WCMI 1KQSZ 5IP7I 2GTHA 2PM9A 1QF8A 1Q811 3GTOI 3IX0A 1Y1VI 3S1NI 1VLAA 4E33A 3G711 2BJOA 3U50C 3JAMb 3GKQA 5D1OA 2F4OA 1Q821 4X6AI 5FLXb 5A2Qf 4MH4A 3OW2Z 1W2BY 1L1OC 1USPA 1WIIA 2PK7A 2QLVB 3K7AI 3HOZI 2OZKA 4A3FI 2E2JI 3CC21 3CPWZ 1Q812 1TWAI 3KIHA 3CQZI 1X0TA 3G6EZ 2QRDB 1LQLA 2RPRA 4NBFA 5C4XI 1VQK1 3VB9A 1M1K1 4HH4A 3NDIA 3CCS1 4AYBA 1TWHI 2R92I 3JAMf 2J6AA 1N8R1 5IT9b 2JUBA 4E2WA 2W04A 3MZLB 3H3VJ 2P28A 3CCV1 1VQLZ 3S1QI 1RO2A 4NBAA 1VQ91 3CCM1 2K3RA 1DL6A 1M1K2 3QWUA 4NBDA 2R7ZI 1Y1VS 3D6WA 4A3DI 1YJWZ 3FQMA 1P9NA 1KD11
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NH1 C;  4DGL A;  2M48 A;  4MD9 A;  4MD8 A;  2RT9 A;  2R6M A;  3EED A;  2JMO A;  1QF8 A;  4MD7 A;  1RQF A;  2M6N A;  1JWH C; 
#chains in the Genus database with same CATH topology
 4E32 A;  1VQ8 Z;  2OTL Z;  1VQ7 Z;  2QEX Z;  4EWC A;  1NUI A;  3M4O I;  1Z03 A;  1YI2 Z;  3J81 f;  1YHQ Z;  5IT9 f;  1VQ5 1;  3VMI A;  4RVH A;  3NH4 A;  1YIT 1;  1VQ4 1;  3I56 1;  2QRC B;  1M90 1;  1JJ2 Z;  2AKL A;  4BY7 I;  2YAD A;  1Q86 1;  2Y0S A;  2NVX I;  2I3C A;  3NDJ A;  2QA4 Z;  2E2I I;  2WB1 A;  1KD1 2;  2OTJ Z;  1WJ2 A;  2WAQ A;  4A3J I;  3S1R I;  1K9M 1;  2W03 A;  2AYD A;  5T67 A;  3GTJ I;  1YJ9 Z;  3IFU A;  3NFZ A;  2LEX A;  4E2Y A;  4HGZ A;  1QVF Y;  4TNU A;  3CC7 Z;  2JA8 I;  1M90 2;  1N2F A;  1VQO 1;  1Q86 2;  3RZD I;  4NBB A;  3IR7 A;  3CC4 Z;  3I55 Z;  3G6E 1;  2Q4Z A;  2M6N A;  3TDH B;  1RO4 A;  1NJI 1;  3H0G I;  3CCU 1;  1YIJ Z;  2JIP A;  3S2H I;  3G4S Z;  1Q7Y 2;  5D1O B;  2DE5 A;  1PFT A;  1I3Q I;  3CME Z;  3HOX I;  1K9M 2;  4XX2 A;  2JA6 I;  4E2X A;  3S14 I;  4RS4 A;  1USP B;  4E2Z A;  4BBS I;  3NH8 A;  1Y1W I;  1NP6 A;  3IF8 A;  1FDO A;  4MON A;  3BG0 B;  3TE5 B;  1VQP Z;  3PO3 I;  3GTM I;  1VQL 1;  1S7M A;  3VMG A;  4RVD A;  4MD9 A;  3RZO I;  1FDI A;  5C4J I;  2JIO A;  1NJI 2;  3S15 I;  3F3F C;  3NH5 A;  2R6M A;  1Z01 A;  5D1P A;  2JA5 I;  3G71 Z;  1VQM Z;  1TWC I;  5T6B A;  2VUM I;  2OOY B;  2IZ4 A;  1WW9 A;  2QRE B;  5FLX f;  3CXC Y;  4NB8 A;  1YUA A;  5AN9 F;  2Q51 A;  3M3Y I;  3LUS A;  2VUG A;  2LIY A;  1TWF I;  4NFR A;  2GTI A;  1VQ8 1;  1RLY A;  4BBR I;  1W2B Z;  1ZH1 A;  2QEX 1;  1K73 1;  3FQQ A;  2P3Y A;  1YI2 1;  5CM2 M;  1KC8 2;  1VQ6 Z;  3Q87 A;  3CCJ 1;  3CC2 Z;  4QTU A;  1Y8C A;  2B63 I;  3CCQ Z;  1YJN Z;  3D2L A;  3P5J B;  3CCL Z;  3MZK B;  2K5R A;  2RT9 A;  4MXU A;  4Y52 I;  1K8A 2;  3HKZ A;  2OTJ 1;  1I50 I;  2JR6 A;  3GTK I;  4BY1 I;  3MON A;  4A3B I;  3CD6 1;  2DE6 A;  2JIR A;  1K73 2;  4MRI A;  1KQS Y;  4E31 A;  1YJ9 1;  3CXC Z;  1ZB9 A;  2JNY A;  3PO3 S;  5T64 A;  3GTM S;  3CCM Z;  2JIM A;  3HOY I;  2V45 A;  4A3G I;  4NOZ A;  3VMH A;  2PMZ A;  4MD7 A;  1Q7Y 1;  2V8K A;  3I55 1;  4A93 I;  4A3C I;  2VPW A;  5IP9 I;  3OW2 Y;  3G4S 1;  2VF1 A;  3S1M I;  2RBL A;  3BG1 B;  1S72 Z;  1VQN Z;  1ML8 A;  3CME 1;  3PO2 I;  3CCR Z;  3F3P C;  3GTP I;  3GTL I;  1RQF A;  3HOU I;  1AA6 A;  3GCF A;  3CMA Z;  2VPZ A;  2NVT I;  3S16 I;  4A3L I;  3EED A;  1VQP 1;  3S17 I;  2H85 A;  1QYP A;  1VQ4 Z;  3I56 Z;  2NVY I;  3ESW A;  5C3E I;  3CCE Z;  1ZB8 A;  2HF1 A;  2JA7 I;  2IZ3 A;  1QXF A;  1R9T I;  4NBG A;  1X3Z A;  2LFU A;  4A3I I;  1VQM 1;  3GTG I;  2G2K A;  3S2D I;  2O53 A;  1QVG Y;  2KPI A;  3GTQ I;  1RO0 A;  1SIW A;  4RVF A;  5FLM I;  4CL1 A;  4RVG A;  4A3E I;  3HOW I;  3J7A 4;  4A3M I;  1KC8 1;  1QVF Z;  4DK1 A;  4NBH A;  1VQO Z;  3I4M I;  4NBC A;  3I07 A;  1VQ6 1;  2E9H A;  2ZAE B;  4DQY B;  3KIF A;  3T4N B;  2F4M A;  3J80 b;  1YJW 1;  3CCQ 1;  1YJN 1;  3CCU Z;  1K8A 1;  5LL6 f;  3I4N I;  5C44 I;  3CCL 1;  3HOV I;  2OTL 1;  1VQ7 1;  2V8J A;  1Q82 2;  1SFO I;  1RNI A;  1YHQ 1;  1X3W A;  3J81 b;  2V3V A;  1JJ2 Y;  1VQK Z;  4NBE A;  1QVG Z;  1TWG I;  3VTN A;  4S1T A;  3CCS Z;  2M48 A;  2QA4 1;  2E7Z A;  2V8I A;  2E2H I;  2KI7 B;  3J80 f;  4BXX I;  2DE7 A;  2R93 I;  1JWH C;  4NH1 C;  1Z02 A;  1S72 1;  4MD8 A;  1YUK A;  1N8R 2;  1VQN 1;  3CCV Z;  2JMO A;  4A3K I;  1KRL A;  2RIQ A;  1TFI A;  3EER A;  4Y7N I;  3CCR 1;  2HU9 A;  1VQ9 Z;  3CC7 1;  4NB9 A;  2NVQ I;  3CMA 1;  3CC4 1;  2YU9 I;  2RHB A;  3CCJ Z;  1I6H I;  1YIJ 1;  1K83 I;  3FKI I;  2QR1 B;  2GU2 A;  5A2Q b;  3CCE 1;  2QKD A;  2O4H A;  4DGL A;  2OOX B;  4QTT A;  4RV9 A;  3CPW Y;  3D9X A;  1VQ5 Z;  3CD6 Z;  4E30 A;  2JS4 A;  2EGT A;  1YIT Z;  4HGY A;  1WCM I;  1KQS Z;  5IP7 I;  2GTH A;  2PM9 A;  1QF8 A;  2NAP A;  1Q81 1;  3GTO I;  3IX0 A;  1Y1V I;  3S1N I;  1VLA A;  4E33 A;  3G71 1;  2BJO A;  3U50 C;  2VPX A;  3JAM b;  3GKQ A;  5D1O A;  2F4O A;  1Q82 1;  4X6A I;  5FLX b;  5A2Q f;  4MH4 A;  3OW2 Z;  1W2B Y;  1L1O C;  1WZN A;  1USP A;  1WII A;  2PK7 A;  2QLV B;  3K7A I;  3HOZ I;  2OZK A;  4A3F I;  2VPY A;  2E2J I;  3CC2 1;  3CPW Z;  1Q81 2;  1TWA I;  3KIH A;  3CQZ I;  1X0T A;  3G6E Z;  2QRD B;  1LQL A;  2RPR A;  4NBF A;  5C4X I;  1VQK 1;  3VB9 A;  1M1K 1;  2IV2 X;  4HH4 A;  2JIQ A;  3NDI A;  3CCS 1;  4AYB A;  1TWH I;  2R92 I;  3JAM f;  2J6A A;  1N8R 1;  5IT9 b;  2JUB A;  4E2W A;  2W04 A;  3MZL B;  3H3V J;  2P28 A;  3CCV 1;  1VQL Z;  3S1Q I;  1RO2 A;  4NBA A;  1VQ9 1;  3CCM 1;  2K3R A;  1DL6 A;  1M1K 2;  3QWU A;  4NBD A;  2R7Z I;  1Y1V S;  3D6W A;  4A3D I;  1YJW Z;  3FQM A;  1P9N A;  1Q16 A;  1KD1 1; 
#chains in the Genus database with same CATH homology
 4E32 A;  1VQ8 Z;  2OTL Z;  1VQ7 Z;  2QEX Z;  4EWC A;  1NUI A;  3M4O I;  1Z03 A;  1YI2 Z;  3J81 f;  1YHQ Z;  5IT9 f;  1VQ5 1;  3VMI A;  4RVH A;  3NH4 A;  1YIT 1;  1VQ4 1;  3I56 1;  2QRC B;  1M90 1;  1JJ2 Z;  2AKL A;  4BY7 I;  2YAD A;  1Q86 1;  2Y0S A;  2NVX I;  2I3C A;  3NDJ A;  2QA4 Z;  2E2I I;  2WB1 A;  1KD1 2;  2OTJ Z;  2WAQ A;  4A3J I;  3S1R I;  1K9M 1;  2W03 A;  5T67 A;  3GTJ I;  1YJ9 Z;  3IFU A;  3NFZ A;  4E2Y A;  4HGZ A;  1QVF Y;  4TNU A;  3CC7 Z;  2JA8 I;  1M90 2;  1N2F A;  1VQO 1;  1Q86 2;  3RZD I;  4NBB A;  3CC4 Z;  3I55 Z;  3G6E 1;  2Q4Z A;  2M6N A;  3TDH B;  1RO4 A;  1NJI 1;  3H0G I;  3CCU 1;  1YIJ Z;  3S2H I;  3G4S Z;  1Q7Y 2;  5D1O B;  2DE5 A;  1PFT A;  1I3Q I;  3CME Z;  3HOX I;  1K9M 2;  4XX2 A;  2JA6 I;  4E2X A;  3S14 I;  4RS4 A;  1USP B;  4E2Z A;  4BBS I;  3NH8 A;  1Y1W I;  1NP6 A;  3IF8 A;  4MON A;  3BG0 B;  3TE5 B;  1VQP Z;  3PO3 I;  3GTM I;  1VQL 1;  1S7M A;  3VMG A;  4RVD A;  4MD9 A;  3RZO I;  5C4J I;  1NJI 2;  3S15 I;  3F3F C;  3NH5 A;  2R6M A;  1Z01 A;  5D1P A;  2JA5 I;  3G71 Z;  1VQM Z;  1TWC I;  5T6B A;  2VUM I;  2OOY B;  2IZ4 A;  1WW9 A;  2QRE B;  5FLX f;  3CXC Y;  4NB8 A;  1YUA A;  5AN9 F;  2Q51 A;  3M3Y I;  3LUS A;  2VUG A;  2LIY A;  1TWF I;  4NFR A;  2GTI A;  1VQ8 1;  1RLY A;  4BBR I;  1W2B Z;  1ZH1 A;  2QEX 1;  1K73 1;  3FQQ A;  2P3Y A;  1YI2 1;  5CM2 M;  1KC8 2;  1VQ6 Z;  3Q87 A;  3CCJ 1;  3CC2 Z;  4QTU A;  2B63 I;  3CCQ Z;  1YJN Z;  3P5J B;  3CCL Z;  3MZK B;  2K5R A;  2RT9 A;  4MXU A;  4Y52 I;  1K8A 2;  3HKZ A;  2OTJ 1;  1I50 I;  2JR6 A;  3GTK I;  4BY1 I;  3MON A;  4A3B I;  3CD6 1;  2DE6 A;  1K73 2;  4MRI A;  1KQS Y;  4E31 A;  1YJ9 1;  3CXC Z;  1ZB9 A;  2JNY A;  3PO3 S;  5T64 A;  3GTM S;  3CCM Z;  3HOY I;  4A3G I;  4NOZ A;  3VMH A;  2PMZ A;  4MD7 A;  1Q7Y 1;  2V8K A;  3I55 1;  4A93 I;  4A3C I;  5IP9 I;  3OW2 Y;  3G4S 1;  2VF1 A;  3S1M I;  2RBL A;  3BG1 B;  1S72 Z;  1VQN Z;  1ML8 A;  3CME 1;  3PO2 I;  3CCR Z;  3F3P C;  3GTP I;  3GTL I;  1RQF A;  3HOU I;  3GCF A;  3CMA Z;  2NVT I;  3S16 I;  4A3L I;  3EED A;  1VQP 1;  3S17 I;  2H85 A;  1QYP A;  1VQ4 Z;  3I56 Z;  2NVY I;  3ESW A;  5C3E I;  3CCE Z;  1ZB8 A;  2HF1 A;  2JA7 I;  2IZ3 A;  1R9T I;  4NBG A;  1X3Z A;  2LFU A;  4A3I I;  1VQM 1;  3GTG I;  2G2K A;  3S2D I;  2O53 A;  1QVG Y;  2KPI A;  3GTQ I;  1RO0 A;  4RVF A;  5FLM I;  4CL1 A;  4RVG A;  4A3E I;  3HOW I;  3J7A 4;  4A3M I;  1KC8 1;  1QVF Z;  4DK1 A;  4NBH A;  1VQO Z;  3I4M I;  4NBC A;  3I07 A;  1VQ6 1;  2E9H A;  2ZAE B;  4DQY B;  3KIF A;  3T4N B;  2F4M A;  3J80 b;  1YJW 1;  3CCQ 1;  1YJN 1;  3CCU Z;  1K8A 1;  5LL6 f;  3I4N I;  5C44 I;  3CCL 1;  3HOV I;  2OTL 1;  1VQ7 1;  2V8J A;  1Q82 2;  1SFO I;  1RNI A;  1YHQ 1;  1X3W A;  3J81 b;  1JJ2 Y;  1VQK Z;  4NBE A;  1QVG Z;  1TWG I;  3VTN A;  4S1T A;  3CCS Z;  2M48 A;  2QA4 1;  2V8I A;  2E2H I;  2KI7 B;  3J80 f;  4BXX I;  2DE7 A;  2R93 I;  1JWH C;  4NH1 C;  1Z02 A;  1S72 1;  4MD8 A;  1YUK A;  1N8R 2;  1VQN 1;  3CCV Z;  2JMO A;  4A3K I;  1KRL A;  2RIQ A;  1TFI A;  3EER A;  4Y7N I;  3CCR 1;  2HU9 A;  1VQ9 Z;  3CC7 1;  4NB9 A;  2NVQ I;  3CMA 1;  3CC4 1;  2YU9 I;  2RHB A;  3CCJ Z;  1I6H I;  1YIJ 1;  1K83 I;  3FKI I;  2QR1 B;  2GU2 A;  5A2Q b;  3CCE 1;  2QKD A;  2O4H A;  4DGL A;  2OOX B;  4QTT A;  4RV9 A;  3CPW Y;  3D9X A;  1VQ5 Z;  3CD6 Z;  4E30 A;  2JS4 A;  2EGT A;  1YIT Z;  4HGY A;  1WCM I;  1KQS Z;  5IP7 I;  2GTH A;  2PM9 A;  1QF8 A;  1Q81 1;  3GTO I;  3IX0 A;  1Y1V I;  3S1N I;  1VLA A;  4E33 A;  3G71 1;  2BJO A;  3U50 C;  3JAM b;  3GKQ A;  5D1O A;  2F4O A;  1Q82 1;  4X6A I;  5FLX b;  5A2Q f;  4MH4 A;  3OW2 Z;  1W2B Y;  1L1O C;  1USP A;  1WII A;  2PK7 A;  2QLV B;  3K7A I;  3HOZ I;  2OZK A;  4A3F I;  2E2J I;  3CC2 1;  3CPW Z;  1Q81 2;  1TWA I;  3KIH A;  3CQZ I;  1X0T A;  3G6E Z;  2QRD B;  1LQL A;  2RPR A;  4NBF A;  5C4X I;  1VQK 1;  3VB9 A;  1M1K 1;  4HH4 A;  3NDI A;  3CCS 1;  4AYB A;  1TWH I;  2R92 I;  3JAM f;  2J6A A;  1N8R 1;  5IT9 b;  2JUB A;  4E2W A;  2W04 A;  3MZL B;  3H3V J;  2P28 A;  3CCV 1;  1VQL Z;  3S1Q I;  1RO2 A;  4NBA A;  1VQ9 1;  3CCM 1;  2K3R A;  1DL6 A;  1M1K 2;  3QWU A;  4NBD A;  2R7Z I;  1Y1V S;  3D6W A;  4A3D I;  1YJW Z;  3FQM A;  1P9N A;  1KD1 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...