3GTLI

Backtracked rna polymerase ii complex with 13mer with g<>u mismatch
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtlI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtlI02
2K5RA 3HOXI 4A3GI 1TWHI 2F4MA 4A93I 4A3FI 1ZB8A 1LQLA 1WCMI 4A3LI 2JS4A 2R92I 3HOUI 3EERA 1X3ZA 2DE7A 2P3YA 4MH4A 3GTLI 5CM2M 2R93I 3HOYI 3I07A 3H0GI 4NB8A 3RZOI 2YU9I 3VMHA 1ML8A 5C4JI 2R7ZI 1N2FA 4BY7I 3GTPI 2E2II 3CQZI 4A3EI 3GTKI 4QTTA 2B63I 4NBEA 4A3MI 4NBAA 4NOZA 3PO3S 5IP7I 1R9TI 4A3DI 4BXXI 4Y52I 3GTOI 3S16I 3S1QI 3GTJI 3S17I 1TWFI 1I6HI 3LUSA 4A3CI 2NVQI 1Y1VS 2JNYA 3VB9A 1RLYA 3VMGA 3S2HI 2JA6I 3U50C 3GTMS 4XX2A 3D6WA 2PK7A 3PO2I 2VUMI 2DE6A 2F4OA 1RO4A 2NVYI 4NBFA 2E2HI 3S14I 3ESWA 4X6AI 3I4MI 5C44I 1Y1WI 2JR6A 1QYPA 2HF1A 1WW9A 5IP9I 3I4NI 4A3JI 2NVXI 2KPIA 3HOVI 3M3YI 2RBLA 1TWCI 1USPB 3PO3I 4NBBA 3H3VJ 3S2DI 1NUIA 3FKII 1L1OC 2NVTI 3Q87A 2JA5I 2DE5A 4QTUA 4A3KI 3S15I 1TWAI 1I50I 3RZDI 3HOZI 4NBDA 1ZB9A 4NBCA 1Y1VI 2E2JI 1TWGI 4Y7NI 3GTQI 1TFIA 4NB9A 4NBHA 1SFOI 1USPA 2BJOA 3GKQA 4BBRI 1K83I 2JA8I 4NBGA 5C4XI 3GTMI 3S1MI 3VMIA 2AKLA 3S1RI 3M4OI 1X3WA 4BY1I 1PFTA 1DL6A 4BBSI 3GCFA 3HOWI 2JA7I 1YUAA 3S1NI 3K7AI 1I3QI 5C3EI 2J6AA 1VLAA 4A3II 5FLMI 3GTGI 4A3BI
chains in the Genus database with same CATH superfamily
3HOXI 2LEXA 1VQ4Z 4A3LI 3CCJZ 1QXFA 3HOUI 3EERA 4MRIA 3CCE1 1YJWZ 2P28A 3H0GI 2JIRA 1YI21 1QVFY 2W04A 5IT9b 2E7ZA 1KD12 1S721 4CL1A 4A3EI 2QEXZ 3PO3S 1X0TA 1R9TI 2PMZA 4A3DI 4BXXI 3S1QI 1ZH1A 3TDHB 3IF8A 3G4SZ 3NDJA 1VQ91 4RVHA 2Q4ZA 1YHQZ 5A2Qb 3VB9A 1RLYA 2IV2X 2QR1B 5FLXf 4DGLA 2K3RA 2JUBA 3GTMS 3D6WA 4E31A 2VUMI 3J80b 1Z01A 2GTHA 3CCUZ 3S14I 3FQQA 2GTIA 1M1K1 2KI7B 2OZKA 3CD6Z 2OTLZ 3F3PC 2NVXI 5LL6f 3PO3I 4NBBA 2EGTA 1NUIA 3Q87A 2GU2A 4QTUA 2Q51A 3S15I 2OTJZ 2E2JI 3GTQI 1VQ7Z 1TFIA 4NB9A 1NP6A 1YJN1 2ZAEB 2M6NA 1VQ81 1Y8CA 1Z03A 2JIMA 1USPA 4NFRA 3J81f 4BBRI 3GTMI 3S1MI 4NH1C 1VQN1 1Q7Y1 5AN9F 3NFZA 4BY1I 4E2WA 3GCFA 2JA7I 1YUAA 3CCRZ 4MXUA 2QRCB 3T4NB 1VQ6Z 1VLAA 5T64A 3CCVZ 4A3II 1YUKA 3VTNA 3JAMf 2F4MA 4A93I 3D9XA 1LQLA 1K9M1 4E33A 1M1K2 1Q16A 3CMEZ 1X3ZA 2P3YA 1WIIA 3G711 5FLXb 3HOYI 1WZNA 1RO0A 5T6BA 1YJ9Z 4HH4A 4NB8A 1VQL1 2YU9I 3VMHA 3I55Z 2R7ZI 4BY7I 3CC71 1KQSZ 3BG0B 3GTKI 4QTTA 4NOZA 5IP7I 4Y52I 3CC21 3GTJI 3FQMA 2W03A 3S17I 1TWFI 4MD7A 3LUSA 2RPRA 2YADA 2JNYA 1Q7Y2 1YJW1 3U50C 4XX2A 2V8IA 1JWHC 2DE6A 2F4OA 2V8KA 4NBFA 3CCEZ 3ESWA 4X6AI 3I4MI 1YI2Z 1YIJ1 1K9M2 4HGYA 5IP9I 2KPIA 1S72Z 2IZ3A 1YIT1 3IX0A 1USPB 4MD8A 2JA5I 1YHQ1 3P5JB 3F3FC 1KC81 1TWAI 2M48A 1I50I 3CCS1 1VQ9Z 4NBDA 4NBCA 1TWGI 4Y7NI 3CCM1 2E9HA 3GKQA 1K83I 1FDOA 4HGZA 2Y0SA 1W2BZ 2JIOA 3CMA1 3S1RI 2O4HA 1Q821 3I561 4S1TA 3KIHA 4AYBA 3S1NI 2QLVB 3K7AI 3MZLB 1VQM1 3GTGI 4E30A 4A3BI 2K5RA 1VQK1 2OOYB 3D2LA 1QVGZ 1TWHI 4A3GI 2VPWA 1RNIA 3CC41 1P9NA 1WCMI 3CCQ1 3IFUA 1KQSY 4RVDA 2RT9A 2DE7A 4MH4A 5CM2M 3I07A 2NAPA 2OOXB 3TE5B 3RZOI 1ML8A 1NJI1 1YJNZ 5C4JI 1VQ8Z 2V8JA 1N2FA 3GTPI 3CQZI 1KC82 3CCL1 1VQO1 3G6E1 4A3MI 1VQNZ 4NBAA 1Q811 2LFUA 1K8A1 3GTOI 3S16I 2JIPA 4RS4A 1VQ51 4A3CI 4E2ZA 3J7A4 1Q822 1SIWA 2VF1A 3CPWY 3S2HI 3OW2Z 5A2Qf 1JJ2Z 2JA6I 2VUGA 2PK7A 1VQP1 3G71Z 1RO4A 5T67A 3I551 2JIQA 3IR7A 3KIFA 3BG1B 1Y1WI 1VQLZ 2QA41 2HF1A 1WW9A 2JMOA 3I4NI 4TNUA 1WJ2A 2V3VA 2QKDA 4A3JI 1VQ41 3HOVI 3CC7Z 2RBLA 3CCJ1 1RQFA 2H85A 1W2BY 3FKII 3CC2Z 1NJI2 2DE5A 3HOZI 3NH5A 3QWUA 2RHBA 3J81b 1M901 1Q812 4NBHA 1SFOI 1QVGY 1K8A2 2BJOA 2JA8I 3VMIA 2AKLA 2QEX1 1PFTA 3CPWZ 1DL6A 4BBSI 2RIQA 3JAMb 5C3EI 2J6AA 3G4S1 1YIJZ 5D1OB 3NDIA 1RO2A 2IZ4A 2AYDA 4RVGA 4A3FI 1ZB8A 2R6MA 1YITZ 1Q861 3CXCZ 2JS4A 2R92I 2VPZA 4E2YA 3GTLI 2R93I 3CCU1 4DQYB 3CCSZ 4MONA 4RV9A 2QRDB 3CCMZ 3CD61 1AA6A 2OTL1 2E2II 3OW2Y 2V45A 1JJ2Y 3CMAZ 4NBEA 1K731 2B63I 2VPYA 3NH4A 3I56Z 1M902 1I6HI 4DK1A 2QREB 1VQMZ 1QVFZ 2OTJ1 2NVQI 4E2XA 1Y1VS 5D1OA 1VQ71 1VQKZ 1QF8A 3MZKB 2I3CA 3VMGA 3CC4Z 1N8R1 2PM9A 3CCQZ 2G2KA 3PO2I 2NVYI 2E2HI 5IT9f 3CCR1 3EEDA 5C44I 3HKZA 1VQ61 2JR6A 1Q862 2WAQA 3CCV1 1QYPA 1Z02A 2HU9A 3M3YI 1KRLA 3CCLZ 1VQOZ 2WB1A 1TWCI 3G6EZ 2VPXA 3H3VJ 3S2DI 3CME1 1L1OC 1KD11 2NVTI 4E32A 4A3KI 3RZDI 1VQ5Z 1YJ91 1ZB9A 1Y1VI 3MONA 1K732 2LIYA 4RVFA 2O53A 3J80f 4NBGA 5C4XI 3CXCY 1VQPZ 1FDIA 1X3WA 3M4OI 4MD9A 1S7MA 3HOWI 4EWCA 5D1PA 3NH8A 1N8R2 1I3QI 2QA4Z 5FLMI
chains in the Genus database with same CATH topology
3HOXI 1VQ4Z 4A3LI 3CCJZ 3HOUI 3EERA 4MRIA 3CCE1 1YJWZ 2P28A 3H0GI 1YI21 1QVFY 2W04A 5IT9b 1KD12 1S721 4CL1A 4A3EI 2QEXZ 3PO3S 1X0TA 1R9TI 2PMZA 4A3DI 4BXXI 3S1QI 1ZH1A 3TDHB 3IF8A 3G4SZ 3NDJA 1VQ91 4RVHA 2Q4ZA 1YHQZ 5A2Qb 3VB9A 1RLYA 2QR1B 5FLXf 4DGLA 2K3RA 2JUBA 3GTMS 3D6WA 4E31A 2VUMI 3J80b 1Z01A 2GTHA 3CCUZ 3S14I 3FQQA 2GTIA 1M1K1 2KI7B 2OZKA 3CD6Z 2OTLZ 3F3PC 2NVXI 5LL6f 3PO3I 4NBBA 2EGTA 1NUIA 3Q87A 2GU2A 4QTUA 2Q51A 3S15I 2OTJZ 2E2JI 3GTQI 1VQ7Z 1TFIA 4NB9A 1NP6A 1YJN1 2ZAEB 2M6NA 1VQ81 1Z03A 1USPA 4NFRA 3J81f 4BBRI 3GTMI 3S1MI 4NH1C 1VQN1 1Q7Y1 5AN9F 3NFZA 4BY1I 4E2WA 3GCFA 2JA7I 1YUAA 3CCRZ 4MXUA 2QRCB 3T4NB 1VQ6Z 1VLAA 4A3II 5T64A 3CCVZ 1YUKA 3VTNA 3JAMf 2F4MA 4A93I 3D9XA 1LQLA 1K9M1 4E33A 1M1K2 3CMEZ 1X3ZA 2P3YA 1WIIA 3G711 5FLXb 3HOYI 1RO0A 5T6BA 1YJ9Z 4HH4A 4NB8A 1VQL1 2YU9I 3VMHA 3I55Z 2R7ZI 4BY7I 3CC71 1KQSZ 3BG0B 3GTKI 4QTTA 4NOZA 5IP7I 4Y52I 3CC21 3GTJI 3FQMA 2W03A 3S17I 1TWFI 4MD7A 3LUSA 2RPRA 2YADA 2JNYA 1Q7Y2 1YJW1 3U50C 4XX2A 2V8IA 1JWHC 2DE6A 2F4OA 2V8KA 4NBFA 3CCEZ 3ESWA 4X6AI 3I4MI 1YI2Z 1YIJ1 1K9M2 4HGYA 5IP9I 2KPIA 1S72Z 2IZ3A 1YIT1 3IX0A 1USPB 4MD8A 2JA5I 1YHQ1 3P5JB 3F3FC 1KC81 1TWAI 2M48A 1I50I 3CCS1 1VQ9Z 4NBDA 4NBCA 1TWGI 4Y7NI 3CCM1 2E9HA 3GKQA 1K83I 4HGZA 2Y0SA 1W2BZ 3CMA1 3S1RI 2O4HA 1Q821 3I561 4S1TA 3KIHA 4AYBA 3S1NI 2QLVB 3K7AI 3MZLB 1VQM1 3GTGI 4E30A 4A3BI 2K5RA 1VQK1 2OOYB 1QVGZ 1TWHI 4A3GI 1RNIA 3CC41 1P9NA 1WCMI 3CCQ1 3IFUA 1KQSY 4RVDA 2RT9A 2DE7A 4MH4A 5CM2M 3I07A 2OOXB 3TE5B 3RZOI 1ML8A 1NJI1 1YJNZ 5C4JI 1VQ8Z 2V8JA 1N2FA 3GTPI 3CQZI 1KC82 3CCL1 1VQO1 3G6E1 4A3MI 1VQNZ 4NBAA 1Q811 2LFUA 1K8A1 3GTOI 3S16I 4RS4A 1VQ51 4A3CI 4E2ZA 3J7A4 1Q822 2VF1A 3CPWY 3S2HI 3OW2Z 5A2Qf 1JJ2Z 2JA6I 2VUGA 2PK7A 1VQP1 3G71Z 1RO4A 5T67A 3I551 3KIFA 3BG1B 1Y1WI 1VQLZ 2QA41 2HF1A 1WW9A 2JMOA 3I4NI 4TNUA 2QKDA 4A3JI 1VQ41 3HOVI 3CC7Z 2RBLA 3CCJ1 1RQFA 2H85A 1W2BY 3FKII 3CC2Z 1NJI2 2DE5A 3HOZI 3NH5A 3QWUA 2RHBA 3J81b 1M901 1Q812 4NBHA 1SFOI 1QVGY 1K8A2 2BJOA 2JA8I 3VMIA 2AKLA 2QEX1 1PFTA 3CPWZ 1DL6A 4BBSI 2RIQA 3JAMb 5C3EI 2J6AA 3G4S1 1YIJZ 5D1OB 3NDIA 1RO2A 2IZ4A 4RVGA 4A3FI 1ZB8A 2R6MA 1YITZ 1Q861 3CXCZ 2JS4A 2R92I 4E2YA 3GTLI 2R93I 3CCU1 4DQYB 3CCSZ 4MONA 4RV9A 2QRDB 3CCMZ 3CD61 2OTL1 2E2II 3OW2Y 1JJ2Y 3CMAZ 4NBEA 1K731 2B63I 3NH4A 3I56Z 1M902 1I6HI 4DK1A 2QREB 1VQMZ 1QVFZ 2OTJ1 2NVQI 4E2XA 1Y1VS 5D1OA 1VQ71 1VQKZ 1QF8A 3MZKB 2I3CA 3VMGA 3CC4Z 1N8R1 2PM9A 3CCQZ 2G2KA 3PO2I 2NVYI 2E2HI 5IT9f 3CCR1 3EEDA 5C44I 3HKZA 1VQ61 2JR6A 1Q862 2WAQA 3CCV1 1QYPA 1Z02A 2HU9A 3M3YI 1KRLA 3CCLZ 1VQOZ 2WB1A 1TWCI 3G6EZ 3H3VJ 3S2DI 3CME1 1L1OC 1KD11 2NVTI 4E32A 4A3KI 3RZDI 1VQ5Z 1YJ91 1ZB9A 1Y1VI 3MONA 1K732 2LIYA 4RVFA 2O53A 3J80f 4NBGA 5C4XI 3CXCY 1VQPZ 3M4OI 1X3WA 4MD9A 1S7MA 3HOWI 4EWCA 5D1PA 3NH8A 1N8R2 1I3QI 2QA4Z 5FLMI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5R A;  3HOX I;  4A3G I;  1TWH I;  2F4M A;  4A93 I;  4A3F I;  1ZB8 A;  1LQL A;  1WCM I;  4A3L I;  2JS4 A;  2R92 I;  3HOU I;  3EER A;  1X3Z A;  2DE7 A;  2P3Y A;  4MH4 A;  3GTL I;  5CM2 M;  2R93 I;  3HOY I;  3I07 A;  3H0G I;  4NB8 A;  3RZO I;  2YU9 I;  3VMH A;  1ML8 A;  5C4J I;  2R7Z I;  1N2F A;  4BY7 I;  3GTP I;  2E2I I;  3CQZ I;  4A3E I;  3GTK I;  4QTT A;  2B63 I;  4NBE A;  4A3M I;  4NBA A;  4NOZ A;  3PO3 S;  5IP7 I;  1R9T I;  4A3D I;  4BXX I;  4Y52 I;  3GTO I;  3S16 I;  3S1Q I;  3GTJ I;  3S17 I;  1TWF I;  1I6H I;  3LUS A;  4A3C I;  2NVQ I;  1Y1V S;  2JNY A;  3VB9 A;  1RLY A;  3VMG A;  3S2H I;  2JA6 I;  3U50 C;  3GTM S;  4XX2 A;  3D6W A;  2PK7 A;  3PO2 I;  2VUM I;  2DE6 A;  2F4O A;  1RO4 A;  2NVY I;  4NBF A;  2E2H I;  3S14 I;  3ESW A;  4X6A I;  3I4M I;  5C44 I;  1Y1W I;  2JR6 A;  1QYP A;  2HF1 A;  1WW9 A;  5IP9 I;  3I4N I;  4A3J I;  2NVX I;  2KPI A;  3HOV I;  3M3Y I;  2RBL A;  1TWC I;  1USP B;  3PO3 I;  4NBB A;  3H3V J;  3S2D I;  1NUI A;  3FKI I;  1L1O C;  2NVT I;  3Q87 A;  2JA5 I;  2DE5 A;  4QTU A;  4A3K I;  3S15 I;  1TWA I;  1I50 I;  3RZD I;  3HOZ I;  4NBD A;  1ZB9 A;  4NBC A;  1Y1V I;  2E2J I;  1TWG I;  4Y7N I;  3GTQ I;  1TFI A;  4NB9 A;  4NBH A;  1SFO I;  1USP A;  2BJO A;  3GKQ A;  4BBR I;  1K83 I;  2JA8 I;  4NBG A;  5C4X I;  3GTM I;  3S1M I;  3VMI A;  2AKL A;  3S1R I;  3M4O I;  1X3W A;  4BY1 I;  1PFT A;  1DL6 A;  4BBS I;  3GCF A;  3HOW I;  2JA7 I;  1YUA A;  3S1N I;  3K7A I;  1I3Q I;  5C3E I;  2J6A A;  1VLA A;  4A3I I;  5FLM I;  3GTG I;  4A3B I; 
#chains in the Genus database with same CATH topology
 3HOX I;  2LEX A;  1VQ4 Z;  4A3L I;  3CCJ Z;  1QXF A;  3HOU I;  3EER A;  4MRI A;  3CCE 1;  1YJW Z;  2P28 A;  3H0G I;  2JIR A;  1YI2 1;  1QVF Y;  2W04 A;  5IT9 b;  2E7Z A;  1KD1 2;  1S72 1;  4CL1 A;  4A3E I;  2QEX Z;  3PO3 S;  1X0T A;  1R9T I;  2PMZ A;  4A3D I;  4BXX I;  3S1Q I;  1ZH1 A;  3TDH B;  3IF8 A;  3G4S Z;  3NDJ A;  1VQ9 1;  4RVH A;  2Q4Z A;  1YHQ Z;  5A2Q b;  3VB9 A;  1RLY A;  2IV2 X;  2QR1 B;  5FLX f;  4DGL A;  2K3R A;  2JUB A;  3GTM S;  3D6W A;  4E31 A;  2VUM I;  3J80 b;  1Z01 A;  2GTH A;  3CCU Z;  3S14 I;  3FQQ A;  2GTI A;  1M1K 1;  2KI7 B;  2OZK A;  3CD6 Z;  2OTL Z;  3F3P C;  2NVX I;  5LL6 f;  3PO3 I;  4NBB A;  2EGT A;  1NUI A;  3Q87 A;  2GU2 A;  4QTU A;  2Q51 A;  3S15 I;  2OTJ Z;  2E2J I;  3GTQ I;  1VQ7 Z;  1TFI A;  4NB9 A;  1NP6 A;  1YJN 1;  2ZAE B;  2M6N A;  1VQ8 1;  1Y8C A;  1Z03 A;  2JIM A;  1USP A;  4NFR A;  3J81 f;  4BBR I;  3GTM I;  3S1M I;  4NH1 C;  1VQN 1;  1Q7Y 1;  5AN9 F;  3NFZ A;  4BY1 I;  4E2W A;  3GCF A;  2JA7 I;  1YUA A;  3CCR Z;  4MXU A;  2QRC B;  3T4N B;  1VQ6 Z;  1VLA A;  5T64 A;  3CCV Z;  4A3I I;  1YUK A;  3VTN A;  3JAM f;  2F4M A;  4A93 I;  3D9X A;  1LQL A;  1K9M 1;  4E33 A;  1M1K 2;  1Q16 A;  3CME Z;  1X3Z A;  2P3Y A;  1WII A;  3G71 1;  5FLX b;  3HOY I;  1WZN A;  1RO0 A;  5T6B A;  1YJ9 Z;  4HH4 A;  4NB8 A;  1VQL 1;  2YU9 I;  3VMH A;  3I55 Z;  2R7Z I;  4BY7 I;  3CC7 1;  1KQS Z;  3BG0 B;  3GTK I;  4QTT A;  4NOZ A;  5IP7 I;  4Y52 I;  3CC2 1;  3GTJ I;  3FQM A;  2W03 A;  3S17 I;  1TWF I;  4MD7 A;  3LUS A;  2RPR A;  2YAD A;  2JNY A;  1Q7Y 2;  1YJW 1;  3U50 C;  4XX2 A;  2V8I A;  1JWH C;  2DE6 A;  2F4O A;  2V8K A;  4NBF A;  3CCE Z;  3ESW A;  4X6A I;  3I4M I;  1YI2 Z;  1YIJ 1;  1K9M 2;  4HGY A;  5IP9 I;  2KPI A;  1S72 Z;  2IZ3 A;  1YIT 1;  3IX0 A;  1USP B;  4MD8 A;  2JA5 I;  1YHQ 1;  3P5J B;  3F3F C;  1KC8 1;  1TWA I;  2M48 A;  1I50 I;  3CCS 1;  1VQ9 Z;  4NBD A;  4NBC A;  1TWG I;  4Y7N I;  3CCM 1;  2E9H A;  3GKQ A;  1K83 I;  1FDO A;  4HGZ A;  2Y0S A;  1W2B Z;  2JIO A;  3CMA 1;  3S1R I;  2O4H A;  1Q82 1;  3I56 1;  4S1T A;  3KIH A;  4AYB A;  3S1N I;  2QLV B;  3K7A I;  3MZL B;  1VQM 1;  3GTG I;  4E30 A;  4A3B I;  2K5R A;  1VQK 1;  2OOY B;  3D2L A;  1QVG Z;  1TWH I;  4A3G I;  2VPW A;  1RNI A;  3CC4 1;  1P9N A;  1WCM I;  3CCQ 1;  3IFU A;  1KQS Y;  4RVD A;  2RT9 A;  2DE7 A;  4MH4 A;  5CM2 M;  3I07 A;  2NAP A;  2OOX B;  3TE5 B;  3RZO I;  1ML8 A;  1NJI 1;  1YJN Z;  5C4J I;  1VQ8 Z;  2V8J A;  1N2F A;  3GTP I;  3CQZ I;  1KC8 2;  3CCL 1;  1VQO 1;  3G6E 1;  4A3M I;  1VQN Z;  4NBA A;  1Q81 1;  2LFU A;  1K8A 1;  3GTO I;  3S16 I;  2JIP A;  4RS4 A;  1VQ5 1;  4A3C I;  4E2Z A;  3J7A 4;  1Q82 2;  1SIW A;  2VF1 A;  3CPW Y;  3S2H I;  3OW2 Z;  5A2Q f;  1JJ2 Z;  2JA6 I;  2VUG A;  2PK7 A;  1VQP 1;  3G71 Z;  1RO4 A;  5T67 A;  3I55 1;  2JIQ A;  3IR7 A;  3KIF A;  3BG1 B;  1Y1W I;  1VQL Z;  2QA4 1;  2HF1 A;  1WW9 A;  2JMO A;  3I4N I;  4TNU A;  1WJ2 A;  2V3V A;  2QKD A;  4A3J I;  1VQ4 1;  3HOV I;  3CC7 Z;  2RBL A;  3CCJ 1;  1RQF A;  2H85 A;  1W2B Y;  3FKI I;  3CC2 Z;  1NJI 2;  2DE5 A;  3HOZ I;  3NH5 A;  3QWU A;  2RHB A;  3J81 b;  1M90 1;  1Q81 2;  4NBH A;  1SFO I;  1QVG Y;  1K8A 2;  2BJO A;  2JA8 I;  3VMI A;  2AKL A;  2QEX 1;  1PFT A;  3CPW Z;  1DL6 A;  4BBS I;  2RIQ A;  3JAM b;  5C3E I;  2J6A A;  3G4S 1;  1YIJ Z;  5D1O B;  3NDI A;  1RO2 A;  2IZ4 A;  2AYD A;  4RVG A;  4A3F I;  1ZB8 A;  2R6M A;  1YIT Z;  1Q86 1;  3CXC Z;  2JS4 A;  2R92 I;  2VPZ A;  4E2Y A;  3GTL I;  2R93 I;  3CCU 1;  4DQY B;  3CCS Z;  4MON A;  4RV9 A;  2QRD B;  3CCM Z;  3CD6 1;  1AA6 A;  2OTL 1;  2E2I I;  3OW2 Y;  2V45 A;  1JJ2 Y;  3CMA Z;  4NBE A;  1K73 1;  2B63 I;  2VPY A;  3NH4 A;  3I56 Z;  1M90 2;  1I6H I;  4DK1 A;  2QRE B;  1VQM Z;  1QVF Z;  2OTJ 1;  2NVQ I;  4E2X A;  1Y1V S;  5D1O A;  1VQ7 1;  1VQK Z;  1QF8 A;  3MZK B;  2I3C A;  3VMG A;  3CC4 Z;  1N8R 1;  2PM9 A;  3CCQ Z;  2G2K A;  3PO2 I;  2NVY I;  2E2H I;  5IT9 f;  3CCR 1;  3EED A;  5C44 I;  3HKZ A;  1VQ6 1;  2JR6 A;  1Q86 2;  2WAQ A;  3CCV 1;  1QYP A;  1Z02 A;  2HU9 A;  3M3Y I;  1KRL A;  3CCL Z;  1VQO Z;  2WB1 A;  1TWC I;  3G6E Z;  2VPX A;  3H3V J;  3S2D I;  3CME 1;  1L1O C;  1KD1 1;  2NVT I;  4E32 A;  4A3K I;  3RZD I;  1VQ5 Z;  1YJ9 1;  1ZB9 A;  1Y1V I;  3MON A;  1K73 2;  2LIY A;  4RVF A;  2O53 A;  3J80 f;  4NBG A;  5C4X I;  3CXC Y;  1VQP Z;  1FDI A;  1X3W A;  3M4O I;  4MD9 A;  1S7M A;  3HOW I;  4EWC A;  5D1P A;  3NH8 A;  1N8R 2;  1I3Q I;  2QA4 Z;  5FLM I; 
#chains in the Genus database with same CATH homology
 3HOX I;  1VQ4 Z;  4A3L I;  3CCJ Z;  3HOU I;  3EER A;  4MRI A;  3CCE 1;  1YJW Z;  2P28 A;  3H0G I;  1YI2 1;  1QVF Y;  2W04 A;  5IT9 b;  1KD1 2;  1S72 1;  4CL1 A;  4A3E I;  2QEX Z;  3PO3 S;  1X0T A;  1R9T I;  2PMZ A;  4A3D I;  4BXX I;  3S1Q I;  1ZH1 A;  3TDH B;  3IF8 A;  3G4S Z;  3NDJ A;  1VQ9 1;  4RVH A;  2Q4Z A;  1YHQ Z;  5A2Q b;  3VB9 A;  1RLY A;  2QR1 B;  5FLX f;  4DGL A;  2K3R A;  2JUB A;  3GTM S;  3D6W A;  4E31 A;  2VUM I;  3J80 b;  1Z01 A;  2GTH A;  3CCU Z;  3S14 I;  3FQQ A;  2GTI A;  1M1K 1;  2KI7 B;  2OZK A;  3CD6 Z;  2OTL Z;  3F3P C;  2NVX I;  5LL6 f;  3PO3 I;  4NBB A;  2EGT A;  1NUI A;  3Q87 A;  2GU2 A;  4QTU A;  2Q51 A;  3S15 I;  2OTJ Z;  2E2J I;  3GTQ I;  1VQ7 Z;  1TFI A;  4NB9 A;  1NP6 A;  1YJN 1;  2ZAE B;  2M6N A;  1VQ8 1;  1Z03 A;  1USP A;  4NFR A;  3J81 f;  4BBR I;  3GTM I;  3S1M I;  4NH1 C;  1VQN 1;  1Q7Y 1;  5AN9 F;  3NFZ A;  4BY1 I;  4E2W A;  3GCF A;  2JA7 I;  1YUA A;  3CCR Z;  4MXU A;  2QRC B;  3T4N B;  1VQ6 Z;  1VLA A;  4A3I I;  5T64 A;  3CCV Z;  1YUK A;  3VTN A;  3JAM f;  2F4M A;  4A93 I;  3D9X A;  1LQL A;  1K9M 1;  4E33 A;  1M1K 2;  3CME Z;  1X3Z A;  2P3Y A;  1WII A;  3G71 1;  5FLX b;  3HOY I;  1RO0 A;  5T6B A;  1YJ9 Z;  4HH4 A;  4NB8 A;  1VQL 1;  2YU9 I;  3VMH A;  3I55 Z;  2R7Z I;  4BY7 I;  3CC7 1;  1KQS Z;  3BG0 B;  3GTK I;  4QTT A;  4NOZ A;  5IP7 I;  4Y52 I;  3CC2 1;  3GTJ I;  3FQM A;  2W03 A;  3S17 I;  1TWF I;  4MD7 A;  3LUS A;  2RPR A;  2YAD A;  2JNY A;  1Q7Y 2;  1YJW 1;  3U50 C;  4XX2 A;  2V8I A;  1JWH C;  2DE6 A;  2F4O A;  2V8K A;  4NBF A;  3CCE Z;  3ESW A;  4X6A I;  3I4M I;  1YI2 Z;  1YIJ 1;  1K9M 2;  4HGY A;  5IP9 I;  2KPI A;  1S72 Z;  2IZ3 A;  1YIT 1;  3IX0 A;  1USP B;  4MD8 A;  2JA5 I;  1YHQ 1;  3P5J B;  3F3F C;  1KC8 1;  1TWA I;  2M48 A;  1I50 I;  3CCS 1;  1VQ9 Z;  4NBD A;  4NBC A;  1TWG I;  4Y7N I;  3CCM 1;  2E9H A;  3GKQ A;  1K83 I;  4HGZ A;  2Y0S A;  1W2B Z;  3CMA 1;  3S1R I;  2O4H A;  1Q82 1;  3I56 1;  4S1T A;  3KIH A;  4AYB A;  3S1N I;  2QLV B;  3K7A I;  3MZL B;  1VQM 1;  3GTG I;  4E30 A;  4A3B I;  2K5R A;  1VQK 1;  2OOY B;  1QVG Z;  1TWH I;  4A3G I;  1RNI A;  3CC4 1;  1P9N A;  1WCM I;  3CCQ 1;  3IFU A;  1KQS Y;  4RVD A;  2RT9 A;  2DE7 A;  4MH4 A;  5CM2 M;  3I07 A;  2OOX B;  3TE5 B;  3RZO I;  1ML8 A;  1NJI 1;  1YJN Z;  5C4J I;  1VQ8 Z;  2V8J A;  1N2F A;  3GTP I;  3CQZ I;  1KC8 2;  3CCL 1;  1VQO 1;  3G6E 1;  4A3M I;  1VQN Z;  4NBA A;  1Q81 1;  2LFU A;  1K8A 1;  3GTO I;  3S16 I;  4RS4 A;  1VQ5 1;  4A3C I;  4E2Z A;  3J7A 4;  1Q82 2;  2VF1 A;  3CPW Y;  3S2H I;  3OW2 Z;  5A2Q f;  1JJ2 Z;  2JA6 I;  2VUG A;  2PK7 A;  1VQP 1;  3G71 Z;  1RO4 A;  5T67 A;  3I55 1;  3KIF A;  3BG1 B;  1Y1W I;  1VQL Z;  2QA4 1;  2HF1 A;  1WW9 A;  2JMO A;  3I4N I;  4TNU A;  2QKD A;  4A3J I;  1VQ4 1;  3HOV I;  3CC7 Z;  2RBL A;  3CCJ 1;  1RQF A;  2H85 A;  1W2B Y;  3FKI I;  3CC2 Z;  1NJI 2;  2DE5 A;  3HOZ I;  3NH5 A;  3QWU A;  2RHB A;  3J81 b;  1M90 1;  1Q81 2;  4NBH A;  1SFO I;  1QVG Y;  1K8A 2;  2BJO A;  2JA8 I;  3VMI A;  2AKL A;  2QEX 1;  1PFT A;  3CPW Z;  1DL6 A;  4BBS I;  2RIQ A;  3JAM b;  5C3E I;  2J6A A;  3G4S 1;  1YIJ Z;  5D1O B;  3NDI A;  1RO2 A;  2IZ4 A;  4RVG A;  4A3F I;  1ZB8 A;  2R6M A;  1YIT Z;  1Q86 1;  3CXC Z;  2JS4 A;  2R92 I;  4E2Y A;  3GTL I;  2R93 I;  3CCU 1;  4DQY B;  3CCS Z;  4MON A;  4RV9 A;  2QRD B;  3CCM Z;  3CD6 1;  2OTL 1;  2E2I I;  3OW2 Y;  1JJ2 Y;  3CMA Z;  4NBE A;  1K73 1;  2B63 I;  3NH4 A;  3I56 Z;  1M90 2;  1I6H I;  4DK1 A;  2QRE B;  1VQM Z;  1QVF Z;  2OTJ 1;  2NVQ I;  4E2X A;  1Y1V S;  5D1O A;  1VQ7 1;  1VQK Z;  1QF8 A;  3MZK B;  2I3C A;  3VMG A;  3CC4 Z;  1N8R 1;  2PM9 A;  3CCQ Z;  2G2K A;  3PO2 I;  2NVY I;  2E2H I;  5IT9 f;  3CCR 1;  3EED A;  5C44 I;  3HKZ A;  1VQ6 1;  2JR6 A;  1Q86 2;  2WAQ A;  3CCV 1;  1QYP A;  1Z02 A;  2HU9 A;  3M3Y I;  1KRL A;  3CCL Z;  1VQO Z;  2WB1 A;  1TWC I;  3G6E Z;  3H3V J;  3S2D I;  3CME 1;  1L1O C;  1KD1 1;  2NVT I;  4E32 A;  4A3K I;  3RZD I;  1VQ5 Z;  1YJ9 1;  1ZB9 A;  1Y1V I;  3MON A;  1K73 2;  2LIY A;  4RVF A;  2O53 A;  3J80 f;  4NBG A;  5C4X I;  3CXC Y;  1VQP Z;  3M4O I;  1X3W A;  4MD9 A;  1S7M A;  3HOW I;  4EWC A;  5D1P A;  3NH8 A;  1N8R 2;  1I3Q I;  2QA4 Z;  5FLM I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...