3GTLI

Backtracked rna polymerase ii complex with 13mer with g<>u mismatch
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtlI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtlI02
4A93I 4A3EI 4NBHA 5C4JI 2E2II 4BXXI 4BY1I 5C4XI 1ZB9A 3HOWI 1NUIA 5C3EI 3GTOI 3HOZI 3S1NI 3VMHA 2YU9I 4NBEA 3GTMS 3LUSA 2PK7A 2DE5A 4A3BI 3H3VJ 4BY7I 1L1OC 5C44I 4QTTA 3EERA 1RLYA 2DE7A 1DL6A 3RZDI 2P3YA 4A3MI 3VMGA 2F4MA 2J6AA 2JS4A 1USPA 4NBAA 3GTPI 2K5RA 4NOZA 1I6HI 3HOYI 1WW9A 1YUAA 3I07A 5IP9I 3S16I 2JNYA 2NVXI 2BJOA 4QTUA 1N2FA 4A3LI 4NBGA 4BBRI 4A3JI 1TWCI 4A3KI 2JA5I 3HOUI 2B63I 3GCFA 3GTKI 4A3GI 3Q87A 2F4OA 1VLAA 1ZB8A 4Y52I 4NBDA 3PO3I 3HOVI 1RO4A 5CM2M 4MH4A 3GTJI 3I4MI 3VMIA 1QYPA 2R7ZI 1LQLA 1Y1WI 3M3YI 2DE6A 2AKLA 3GTLI 2R93I 3K7AI 4NBBA 2HF1A 3GTQI 3S1MI 3S17I 3S2HI 1USPB 3S1RI 1TWAI 1TWHI 4X6AI 3S2DI 1Y1VI 2NVQI 2E2JI 4A3FI 4NB8A 3PO3S 3ESWA 2NVTI 3GTGI 2JA8I 3CQZI 1R9TI 3D6WA 4NBFA 3RZOI 3U50C 4BBSI 3VB9A 1TFIA 4XX2A 2NVYI 2JA7I 1I50I 1PFTA 2E2HI 1K83I 3HOXI 2VUMI 3S14I 1TWFI 3S1QI 1Y1VS 2RBLA 3PO2I 2JA6I 4NBCA 3GKQA 1X3WA 3I4NI 2JR6A 2KPIA 1WCMI 5IP7I 4A3II 3H0GI 1ML8A 2R92I 3GTMI 4Y7NI 3M4OI 1TWGI 4A3CI 1I3QI 5FLMI 4NB9A 1X3ZA 3S15I 3FKII 1SFOI 4A3DI
chains in the Genus database with same CATH superfamily
1S7MA 2OTLZ 1VQK1 4A93I 2V3VA 1YJWZ 3TE5B 4MXUA 5C4JI 1N8R1 4BXXI 4BY1I 3KIFA 3MZKB 1QVGY 2JMOA 1NUIA 5C3EI 1YI21 2YU9I 4NBEA 2DE5A 1KC81 1JJ2Z 2YADA 1VQO1 1L1OC 1S72Z 1RLYA 2DE7A 1DL6A 3RZDI 2P3YA 2VF1A 3GTPI 1YUAA 1VQ61 3CCSZ 1VQL1 1X0TA 1FDIA 2O53A 4DQYB 1VQ91 4NBGA 4A3JI 1TWCI 4MD8A 1K732 1ZH1A 2B63I 1YJ91 3Q87A 1RQFA 2F4OA 4NBDA 3PO3I 1QF8A 2OOYB 4MH4A 3I4MI 2JIQA 1QYPA 2R7ZI 3CC2Z 1Y1WI 4RVDA 2VPZA 4NBBA 3VTNA 3GTQI 3S2DI 3JAMb 4DGLA 2OTJZ 2JIPA 4A3FI 2JIOA 4NB8A 3CCVZ 3CC7Z 1RO2A 5A2Qf 1K8A2 3D6WA 2W03A 1QVGZ 1VQNZ 3U50C 2E2HI 1K83I 3HOXI 2VUMI 3S14I 1TWFI 3CD6Z 2RBLA 1QVFZ 3GKQA 1X3WA 2JR6A 2IZ3A 2QR1B 2RPRA 2I3CA 2R92I 1TWGI 5FLMI 2RHBA 3NDIA 4S1TA 4E2XA 3FKII 1SFOI 4A3DI 2VPWA 3T4NB 1VQ51 2IV2X 4E33A 3MZLB 1WZNA 2E2II 3CCR1 1SIWA 1YJNZ 3HOWI 4RV9A 3CCQ1 5T64A 3CMAZ 2Q51A 2AYDA 2Q4ZA 1Q7Y2 3CCE1 1VQP1 3BG1B 4MONA 4A3MI 2RT9A 5AN9F 1YIJ1 3I55Z 4NBAA 4NOZA 3D9XA 3CCM1 3HOYI 2K3RA 2EGTA 5IP9I 3S16I 3G71Z 1VQKZ 2BJOA 1VQ71 3CCL1 4RVGA 4A3LI 3G4S1 3CCJ1 5FLXb 3KIHA 2OTL1 1AA6A 3JAMf 4BBRI 4RVFA 4MRIA 1YJW1 1Q862 1QVFY 4A3GI 2E9HA 1YI2Z 1ZB8A 4Y52I 3VMIA 3BG0B 4RS4A 2RIQA 2AKLA 2PMZA 3QWUA 2P28A 5D1OA 3K7AI 2QRCB 3S2HI 3S1RI 1TWHI 4X6AI 1Y1VI 2NVQI 2QEX1 1VQ81 1M902 5T67A 1JWHC 2NVTI 3GTGI 1KD11 2JA8I 4NBFA 4BBSI 1Q822 2NVYI 1YJ9Z 1I50I 1WJ2A 3TDHB 4EWCA 1P9NA 2PM9A 3OW2Z 3I4NI 2KPIA 1WCMI 3CPWZ 3CME1 2G2KA 1YIT1 1I3QI 1Q861 2QKDA 4DK1A 3S15I 2WB1A 3I56Z 4A3EI 4NBHA 2OTJ1 5C4XI 1ZB9A 3CCV1 2VPXA 2M6NA 2NAPA 4HH4A 3CC71 1YHQZ 3CC41 3S1NI 3GTMS 3LUSA 1M1K2 2PK7A 1VQN1 4A3BI 5FLXf 3H3VJ 2GTHA 2ZAEB 5D1PA 1K731 4E2ZA 4E2YA 3VMGA 2F4MA 3CD61 2J6AA 1NP6A 2WAQA 4AYBA 1N8R2 1Q821 1WW9A 3CCUZ 2HU9A 4E32A 1VQM1 2JNYA 2NVXI 4CL1A 1Q812 2QA4Z 3MONA 1N2FA 2W04A 1KC82 1QXFA 3CCRZ 4A3KI 3HOUI 3OW2Y 1VLAA 3G6E1 3F3FC 3CPWY 1K8A1 1RO4A 5CM2M 3J81b 1VQPZ 3CMA1 1VQ4Z 4E31A 1LQLA 2DE6A 5IT9b 2V45A 1W2BZ 1FDOA 2HF1A 3J80b 1TWAI 2V8JA 2E2JI 2QREB 1Q16A 3I551 3NFZA 2M48A 3EEDA 3PO3S 1KQSY 1VQ7Z 3CCLZ 2KI7B 4HGYA 3CQZI 4RVHA 3IX0A 3CCJZ 3G711 2GTIA 3RZOI 1VQOZ 1RNIA 3VB9A 1PFTA 3NDJA 3S1QI 1Q811 2V8IA 1S721 2E7ZA 4NBCA 2OZKA 2JIRA 3IF8A 1VQ6Z 4A3CI 1Q7Y1 1VQLZ 2R6MA 4NB9A 3FQMA 2QEXZ 3NH8A 3CCS1 1VQ8Z 1VQ9Z 1WIIA 3P5JB 3J7A4 2O4HA 2Y0SA 3NH5A 2JIMA 2LEXA 3CXCZ 1YUKA 2H85A 3GTOI 2QRDB 3HOZI 3VMHA 1NJI2 1Z03A 4BY7I 1W2BY 5C44I 4QTTA 5D1OB 3EERA 2VUGA 3CC21 1Y8CA 5LL6f 3CMEZ 2JS4A 1USPA 1YITZ 2K5RA 3J81f 3IFUA 1I6HI 4TNUA 2LIYA 3I07A 5IT9f 3HKZA 4QTUA 1KQSZ 3J80f 1K9M2 3I561 4E2WA 1M901 2JA5I 3CC4Z 3GCFA 1KRLA 3GTKI 5T6BA 1JJ2Y 2V8KA 3HOVI 1YHQ1 2IZ4A 4NFRA 3GTJI 3M3YI 3F3PC 3GTLI 2JUBA 4E30A 2R93I 3D2LA 3S1MI 2QLVB 1VQ5Z 3S17I 1USPB 1NJI1 3CXCY 2LFUA 1VQMZ 3CCQZ 4NH1C 3ESWA 3CCU1 1YJN1 1R9TI 1RO0A 1Z01A 2QA41 3CCEZ 4MD7A 1TFIA 4XX2A 2VPYA 2JA7I 3G6EZ 2OOXB 3IR7A 1Y1VS 1YIJZ 3PO2I 2JA6I 1K9M1 3NH4A 5IP7I 4A3II 3FQQA 3H0GI 3CCMZ 1M1K1 1ML8A 3GTMI 1VQ41 4Y7NI 3M4OI 2GU2A 4MD9A 4HGZA 1KD12 1Z02A 1X3ZA 5A2Qb 3G4SZ
chains in the Genus database with same CATH topology
1S7MA 2OTLZ 1VQK1 4A93I 1YJWZ 3TE5B 4MXUA 5C4JI 1N8R1 4BXXI 4BY1I 3KIFA 3MZKB 1QVGY 2JMOA 1NUIA 5C3EI 1YI21 2YU9I 4NBEA 2DE5A 1KC81 1JJ2Z 2YADA 1VQO1 1L1OC 1S72Z 1RLYA 2DE7A 1DL6A 3RZDI 2P3YA 2VF1A 3GTPI 1YUAA 1VQ61 3CCSZ 1VQL1 1X0TA 2O53A 4DQYB 1VQ91 4NBGA 4A3JI 1TWCI 4MD8A 1K732 1ZH1A 2B63I 1YJ91 3Q87A 1RQFA 2F4OA 4NBDA 3PO3I 1QF8A 2OOYB 4MH4A 3I4MI 1QYPA 2R7ZI 3CC2Z 1Y1WI 4RVDA 4NBBA 3VTNA 3GTQI 3S2DI 3JAMb 4DGLA 2OTJZ 4A3FI 4NB8A 3CCVZ 3CC7Z 1RO2A 5A2Qf 1K8A2 3D6WA 2W03A 1QVGZ 1VQNZ 3U50C 2E2HI 1K83I 3HOXI 2VUMI 3S14I 1TWFI 3CD6Z 2RBLA 1QVFZ 3GKQA 1X3WA 2JR6A 2IZ3A 2QR1B 2RPRA 2I3CA 2R92I 1TWGI 5FLMI 2RHBA 3NDIA 4S1TA 4E2XA 3FKII 1SFOI 4A3DI 3T4NB 1VQ51 4E33A 3MZLB 2E2II 3CCR1 1YJNZ 3HOWI 4RV9A 3CCQ1 5T64A 3CMAZ 2Q51A 2Q4ZA 1Q7Y2 3CCE1 1VQP1 3BG1B 4MONA 4A3MI 2RT9A 5AN9F 1YIJ1 3I55Z 4NBAA 4NOZA 3D9XA 3CCM1 3HOYI 2K3RA 2EGTA 5IP9I 3S16I 3G71Z 1VQKZ 2BJOA 1VQ71 3CCL1 4RVGA 4A3LI 3G4S1 3CCJ1 5FLXb 3KIHA 2OTL1 3JAMf 4BBRI 4RVFA 4MRIA 1YJW1 1Q862 1QVFY 4A3GI 2E9HA 1YI2Z 1ZB8A 4Y52I 3VMIA 3BG0B 4RS4A 2RIQA 2AKLA 2PMZA 3QWUA 2P28A 5D1OA 3K7AI 2QRCB 3S2HI 3S1RI 1TWHI 4X6AI 1Y1VI 2NVQI 2QEX1 1VQ81 1M902 5T67A 1JWHC 2NVTI 3GTGI 1KD11 2JA8I 4NBFA 4BBSI 1Q822 2NVYI 1YJ9Z 1I50I 3TDHB 4EWCA 1P9NA 2PM9A 3OW2Z 3I4NI 2KPIA 1WCMI 3CPWZ 2G2KA 3CME1 1YIT1 1I3QI 1Q861 2QKDA 4DK1A 3S15I 2WB1A 3I56Z 4A3EI 4NBHA 2OTJ1 5C4XI 1ZB9A 3CCV1 2M6NA 3CC71 4HH4A 1YHQZ 3CC41 3S1NI 3GTMS 3LUSA 1M1K2 2PK7A 1VQN1 4A3BI 5FLXf 3H3VJ 2GTHA 2ZAEB 5D1PA 1K731 4E2ZA 4E2YA 3VMGA 2F4MA 3CD61 2J6AA 1NP6A 2WAQA 4AYBA 1N8R2 1Q821 1WW9A 3CCUZ 2HU9A 4E32A 1VQM1 2JNYA 2NVXI 4CL1A 1Q812 2QA4Z 3MONA 1N2FA 2W04A 1KC82 3CCRZ 4A3KI 3HOUI 3OW2Y 1VLAA 3G6E1 3F3FC 3CPWY 1K8A1 1RO4A 5CM2M 3J81b 1VQPZ 3CMA1 1VQ4Z 4E31A 1LQLA 2DE6A 5IT9b 1W2BZ 2HF1A 3J80b 1TWAI 2V8JA 2E2JI 2QREB 3I551 3NFZA 2M48A 3EEDA 3PO3S 1KQSY 1VQ7Z 3CCLZ 2KI7B 4HGYA 3CQZI 4RVHA 3IX0A 3CCJZ 3G711 2GTIA 3RZOI 1VQOZ 1RNIA 3VB9A 1PFTA 3NDJA 3S1QI 1Q811 2V8IA 1S721 4NBCA 2OZKA 3IF8A 1VQ6Z 4A3CI 1Q7Y1 1VQLZ 2R6MA 4NB9A 3FQMA 2QEXZ 3NH8A 3CCS1 1VQ8Z 1VQ9Z 1WIIA 3P5JB 3J7A4 2O4HA 2Y0SA 3NH5A 3CXCZ 1YUKA 2H85A 3GTOI 2QRDB 3HOZI 3VMHA 1NJI2 1Z03A 4BY7I 1W2BY 5C44I 4QTTA 5D1OB 3EERA 2VUGA 3CC21 5LL6f 3CMEZ 2JS4A 1USPA 1YITZ 2K5RA 3J81f 3IFUA 1I6HI 4TNUA 2LIYA 3I07A 5IT9f 3HKZA 4QTUA 1KQSZ 3J80f 1K9M2 3I561 4E2WA 1M901 2JA5I 3CC4Z 3GCFA 1KRLA 3GTKI 5T6BA 1JJ2Y 2V8KA 3HOVI 1YHQ1 2IZ4A 4NFRA 3GTJI 3M3YI 3F3PC 3GTLI 2JUBA 4E30A 2R93I 3S1MI 2QLVB 1VQ5Z 3S17I 1USPB 1NJI1 3CXCY 2LFUA 1VQMZ 3CCQZ 4NH1C 3ESWA 3CCU1 1YJN1 1R9TI 1RO0A 1Z01A 2QA41 3CCEZ 4MD7A 1TFIA 4XX2A 2JA7I 3G6EZ 2OOXB 1Y1VS 1YIJZ 3PO2I 2JA6I 1K9M1 3NH4A 5IP7I 4A3II 3FQQA 3H0GI 3CCMZ 1M1K1 1ML8A 3GTMI 1VQ41 4Y7NI 3M4OI 2GU2A 4MD9A 4HGZA 1KD12 1Z02A 1X3ZA 5A2Qb 3G4SZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A93 I;  4A3E I;  4NBH A;  5C4J I;  2E2I I;  4BXX I;  4BY1 I;  5C4X I;  1ZB9 A;  3HOW I;  1NUI A;  5C3E I;  3GTO I;  3HOZ I;  3S1N I;  3VMH A;  2YU9 I;  4NBE A;  3GTM S;  3LUS A;  2PK7 A;  2DE5 A;  4A3B I;  3H3V J;  4BY7 I;  1L1O C;  5C44 I;  4QTT A;  3EER A;  1RLY A;  2DE7 A;  1DL6 A;  3RZD I;  2P3Y A;  4A3M I;  3VMG A;  2F4M A;  2J6A A;  2JS4 A;  1USP A;  4NBA A;  3GTP I;  2K5R A;  4NOZ A;  1I6H I;  3HOY I;  1WW9 A;  1YUA A;  3I07 A;  5IP9 I;  3S16 I;  2JNY A;  2NVX I;  2BJO A;  4QTU A;  1N2F A;  4A3L I;  4NBG A;  4BBR I;  4A3J I;  1TWC I;  4A3K I;  2JA5 I;  3HOU I;  2B63 I;  3GCF A;  3GTK I;  4A3G I;  3Q87 A;  2F4O A;  1VLA A;  1ZB8 A;  4Y52 I;  4NBD A;  3PO3 I;  3HOV I;  1RO4 A;  5CM2 M;  4MH4 A;  3GTJ I;  3I4M I;  3VMI A;  1QYP A;  2R7Z I;  1LQL A;  1Y1W I;  3M3Y I;  2DE6 A;  2AKL A;  3GTL I;  2R93 I;  3K7A I;  4NBB A;  2HF1 A;  3GTQ I;  3S1M I;  3S17 I;  3S2H I;  1USP B;  3S1R I;  1TWA I;  1TWH I;  4X6A I;  3S2D I;  1Y1V I;  2NVQ I;  2E2J I;  4A3F I;  4NB8 A;  3PO3 S;  3ESW A;  2NVT I;  3GTG I;  2JA8 I;  3CQZ I;  1R9T I;  3D6W A;  4NBF A;  3RZO I;  3U50 C;  4BBS I;  3VB9 A;  1TFI A;  4XX2 A;  2NVY I;  2JA7 I;  1I50 I;  1PFT A;  2E2H I;  1K83 I;  3HOX I;  2VUM I;  3S14 I;  1TWF I;  3S1Q I;  1Y1V S;  2RBL A;  3PO2 I;  2JA6 I;  4NBC A;  3GKQ A;  1X3W A;  3I4N I;  2JR6 A;  2KPI A;  1WCM I;  5IP7 I;  4A3I I;  3H0G I;  1ML8 A;  2R92 I;  3GTM I;  4Y7N I;  3M4O I;  1TWG I;  4A3C I;  1I3Q I;  5FLM I;  4NB9 A;  1X3Z A;  3S15 I;  3FKI I;  1SFO I;  4A3D I; 
#chains in the Genus database with same CATH topology
 1S7M A;  2OTL Z;  1VQK 1;  4A93 I;  2V3V A;  1YJW Z;  3TE5 B;  4MXU A;  5C4J I;  1N8R 1;  4BXX I;  4BY1 I;  3KIF A;  3MZK B;  1QVG Y;  2JMO A;  1NUI A;  5C3E I;  1YI2 1;  2YU9 I;  4NBE A;  2DE5 A;  1KC8 1;  1JJ2 Z;  2YAD A;  1VQO 1;  1L1O C;  1S72 Z;  1RLY A;  2DE7 A;  1DL6 A;  3RZD I;  2P3Y A;  2VF1 A;  3GTP I;  1YUA A;  1VQ6 1;  3CCS Z;  1VQL 1;  1X0T A;  1FDI A;  2O53 A;  4DQY B;  1VQ9 1;  4NBG A;  4A3J I;  1TWC I;  4MD8 A;  1K73 2;  1ZH1 A;  2B63 I;  1YJ9 1;  3Q87 A;  1RQF A;  2F4O A;  4NBD A;  3PO3 I;  1QF8 A;  2OOY B;  4MH4 A;  3I4M I;  2JIQ A;  1QYP A;  2R7Z I;  3CC2 Z;  1Y1W I;  4RVD A;  2VPZ A;  4NBB A;  3VTN A;  3GTQ I;  3S2D I;  3JAM b;  4DGL A;  2OTJ Z;  2JIP A;  4A3F I;  2JIO A;  4NB8 A;  3CCV Z;  3CC7 Z;  1RO2 A;  5A2Q f;  1K8A 2;  3D6W A;  2W03 A;  1QVG Z;  1VQN Z;  3U50 C;  2E2H I;  1K83 I;  3HOX I;  2VUM I;  3S14 I;  1TWF I;  3CD6 Z;  2RBL A;  1QVF Z;  3GKQ A;  1X3W A;  2JR6 A;  2IZ3 A;  2QR1 B;  2RPR A;  2I3C A;  2R92 I;  1TWG I;  5FLM I;  2RHB A;  3NDI A;  4S1T A;  4E2X A;  3FKI I;  1SFO I;  4A3D I;  2VPW A;  3T4N B;  1VQ5 1;  2IV2 X;  4E33 A;  3MZL B;  1WZN A;  2E2I I;  3CCR 1;  1SIW A;  1YJN Z;  3HOW I;  4RV9 A;  3CCQ 1;  5T64 A;  3CMA Z;  2Q51 A;  2AYD A;  2Q4Z A;  1Q7Y 2;  3CCE 1;  1VQP 1;  3BG1 B;  4MON A;  4A3M I;  2RT9 A;  5AN9 F;  1YIJ 1;  3I55 Z;  4NBA A;  4NOZ A;  3D9X A;  3CCM 1;  3HOY I;  2K3R A;  2EGT A;  5IP9 I;  3S16 I;  3G71 Z;  1VQK Z;  2BJO A;  1VQ7 1;  3CCL 1;  4RVG A;  4A3L I;  3G4S 1;  3CCJ 1;  5FLX b;  3KIH A;  2OTL 1;  1AA6 A;  3JAM f;  4BBR I;  4RVF A;  4MRI A;  1YJW 1;  1Q86 2;  1QVF Y;  4A3G I;  2E9H A;  1YI2 Z;  1ZB8 A;  4Y52 I;  3VMI A;  3BG0 B;  4RS4 A;  2RIQ A;  2AKL A;  2PMZ A;  3QWU A;  2P28 A;  5D1O A;  3K7A I;  2QRC B;  3S2H I;  3S1R I;  1TWH I;  4X6A I;  1Y1V I;  2NVQ I;  2QEX 1;  1VQ8 1;  1M90 2;  5T67 A;  1JWH C;  2NVT I;  3GTG I;  1KD1 1;  2JA8 I;  4NBF A;  4BBS I;  1Q82 2;  2NVY I;  1YJ9 Z;  1I50 I;  1WJ2 A;  3TDH B;  4EWC A;  1P9N A;  2PM9 A;  3OW2 Z;  3I4N I;  2KPI A;  1WCM I;  3CPW Z;  3CME 1;  2G2K A;  1YIT 1;  1I3Q I;  1Q86 1;  2QKD A;  4DK1 A;  3S15 I;  2WB1 A;  3I56 Z;  4A3E I;  4NBH A;  2OTJ 1;  5C4X I;  1ZB9 A;  3CCV 1;  2VPX A;  2M6N A;  2NAP A;  4HH4 A;  3CC7 1;  1YHQ Z;  3CC4 1;  3S1N I;  3GTM S;  3LUS A;  1M1K 2;  2PK7 A;  1VQN 1;  4A3B I;  5FLX f;  3H3V J;  2GTH A;  2ZAE B;  5D1P A;  1K73 1;  4E2Z A;  4E2Y A;  3VMG A;  2F4M A;  3CD6 1;  2J6A A;  1NP6 A;  2WAQ A;  4AYB A;  1N8R 2;  1Q82 1;  1WW9 A;  3CCU Z;  2HU9 A;  4E32 A;  1VQM 1;  2JNY A;  2NVX I;  4CL1 A;  1Q81 2;  2QA4 Z;  3MON A;  1N2F A;  2W04 A;  1KC8 2;  1QXF A;  3CCR Z;  4A3K I;  3HOU I;  3OW2 Y;  1VLA A;  3G6E 1;  3F3F C;  3CPW Y;  1K8A 1;  1RO4 A;  5CM2 M;  3J81 b;  1VQP Z;  3CMA 1;  1VQ4 Z;  4E31 A;  1LQL A;  2DE6 A;  5IT9 b;  2V45 A;  1W2B Z;  1FDO A;  2HF1 A;  3J80 b;  1TWA I;  2V8J A;  2E2J I;  2QRE B;  1Q16 A;  3I55 1;  3NFZ A;  2M48 A;  3EED A;  3PO3 S;  1KQS Y;  1VQ7 Z;  3CCL Z;  2KI7 B;  4HGY A;  3CQZ I;  4RVH A;  3IX0 A;  3CCJ Z;  3G71 1;  2GTI A;  3RZO I;  1VQO Z;  1RNI A;  3VB9 A;  1PFT A;  3NDJ A;  3S1Q I;  1Q81 1;  2V8I A;  1S72 1;  2E7Z A;  4NBC A;  2OZK A;  2JIR A;  3IF8 A;  1VQ6 Z;  4A3C I;  1Q7Y 1;  1VQL Z;  2R6M A;  4NB9 A;  3FQM A;  2QEX Z;  3NH8 A;  3CCS 1;  1VQ8 Z;  1VQ9 Z;  1WII A;  3P5J B;  3J7A 4;  2O4H A;  2Y0S A;  3NH5 A;  2JIM A;  2LEX A;  3CXC Z;  1YUK A;  2H85 A;  3GTO I;  2QRD B;  3HOZ I;  3VMH A;  1NJI 2;  1Z03 A;  4BY7 I;  1W2B Y;  5C44 I;  4QTT A;  5D1O B;  3EER A;  2VUG A;  3CC2 1;  1Y8C A;  5LL6 f;  3CME Z;  2JS4 A;  1USP A;  1YIT Z;  2K5R A;  3J81 f;  3IFU A;  1I6H I;  4TNU A;  2LIY A;  3I07 A;  5IT9 f;  3HKZ A;  4QTU A;  1KQS Z;  3J80 f;  1K9M 2;  3I56 1;  4E2W A;  1M90 1;  2JA5 I;  3CC4 Z;  3GCF A;  1KRL A;  3GTK I;  5T6B A;  1JJ2 Y;  2V8K A;  3HOV I;  1YHQ 1;  2IZ4 A;  4NFR A;  3GTJ I;  3M3Y I;  3F3P C;  3GTL I;  2JUB A;  4E30 A;  2R93 I;  3D2L A;  3S1M I;  2QLV B;  1VQ5 Z;  3S17 I;  1USP B;  1NJI 1;  3CXC Y;  2LFU A;  1VQM Z;  3CCQ Z;  4NH1 C;  3ESW A;  3CCU 1;  1YJN 1;  1R9T I;  1RO0 A;  1Z01 A;  2QA4 1;  3CCE Z;  4MD7 A;  1TFI A;  4XX2 A;  2VPY A;  2JA7 I;  3G6E Z;  2OOX B;  3IR7 A;  1Y1V S;  1YIJ Z;  3PO2 I;  2JA6 I;  1K9M 1;  3NH4 A;  5IP7 I;  4A3I I;  3FQQ A;  3H0G I;  3CCM Z;  1M1K 1;  1ML8 A;  3GTM I;  1VQ4 1;  4Y7N I;  3M4O I;  2GU2 A;  4MD9 A;  4HGZ A;  1KD1 2;  1Z02 A;  1X3Z A;  5A2Q b;  3G4S Z; 
#chains in the Genus database with same CATH homology
 1S7M A;  2OTL Z;  1VQK 1;  4A93 I;  1YJW Z;  3TE5 B;  4MXU A;  5C4J I;  1N8R 1;  4BXX I;  4BY1 I;  3KIF A;  3MZK B;  1QVG Y;  2JMO A;  1NUI A;  5C3E I;  1YI2 1;  2YU9 I;  4NBE A;  2DE5 A;  1KC8 1;  1JJ2 Z;  2YAD A;  1VQO 1;  1L1O C;  1S72 Z;  1RLY A;  2DE7 A;  1DL6 A;  3RZD I;  2P3Y A;  2VF1 A;  3GTP I;  1YUA A;  1VQ6 1;  3CCS Z;  1VQL 1;  1X0T A;  2O53 A;  4DQY B;  1VQ9 1;  4NBG A;  4A3J I;  1TWC I;  4MD8 A;  1K73 2;  1ZH1 A;  2B63 I;  1YJ9 1;  3Q87 A;  1RQF A;  2F4O A;  4NBD A;  3PO3 I;  1QF8 A;  2OOY B;  4MH4 A;  3I4M I;  1QYP A;  2R7Z I;  3CC2 Z;  1Y1W I;  4RVD A;  4NBB A;  3VTN A;  3GTQ I;  3S2D I;  3JAM b;  4DGL A;  2OTJ Z;  4A3F I;  4NB8 A;  3CCV Z;  3CC7 Z;  1RO2 A;  5A2Q f;  1K8A 2;  3D6W A;  2W03 A;  1QVG Z;  1VQN Z;  3U50 C;  2E2H I;  1K83 I;  3HOX I;  2VUM I;  3S14 I;  1TWF I;  3CD6 Z;  2RBL A;  1QVF Z;  3GKQ A;  1X3W A;  2JR6 A;  2IZ3 A;  2QR1 B;  2RPR A;  2I3C A;  2R92 I;  1TWG I;  5FLM I;  2RHB A;  3NDI A;  4S1T A;  4E2X A;  3FKI I;  1SFO I;  4A3D I;  3T4N B;  1VQ5 1;  4E33 A;  3MZL B;  2E2I I;  3CCR 1;  1YJN Z;  3HOW I;  4RV9 A;  3CCQ 1;  5T64 A;  3CMA Z;  2Q51 A;  2Q4Z A;  1Q7Y 2;  3CCE 1;  1VQP 1;  3BG1 B;  4MON A;  4A3M I;  2RT9 A;  5AN9 F;  1YIJ 1;  3I55 Z;  4NBA A;  4NOZ A;  3D9X A;  3CCM 1;  3HOY I;  2K3R A;  2EGT A;  5IP9 I;  3S16 I;  3G71 Z;  1VQK Z;  2BJO A;  1VQ7 1;  3CCL 1;  4RVG A;  4A3L I;  3G4S 1;  3CCJ 1;  5FLX b;  3KIH A;  2OTL 1;  3JAM f;  4BBR I;  4RVF A;  4MRI A;  1YJW 1;  1Q86 2;  1QVF Y;  4A3G I;  2E9H A;  1YI2 Z;  1ZB8 A;  4Y52 I;  3VMI A;  3BG0 B;  4RS4 A;  2RIQ A;  2AKL A;  2PMZ A;  3QWU A;  2P28 A;  5D1O A;  3K7A I;  2QRC B;  3S2H I;  3S1R I;  1TWH I;  4X6A I;  1Y1V I;  2NVQ I;  2QEX 1;  1VQ8 1;  1M90 2;  5T67 A;  1JWH C;  2NVT I;  3GTG I;  1KD1 1;  2JA8 I;  4NBF A;  4BBS I;  1Q82 2;  2NVY I;  1YJ9 Z;  1I50 I;  3TDH B;  4EWC A;  1P9N A;  2PM9 A;  3OW2 Z;  3I4N I;  2KPI A;  1WCM I;  3CPW Z;  2G2K A;  3CME 1;  1YIT 1;  1I3Q I;  1Q86 1;  2QKD A;  4DK1 A;  3S15 I;  2WB1 A;  3I56 Z;  4A3E I;  4NBH A;  2OTJ 1;  5C4X I;  1ZB9 A;  3CCV 1;  2M6N A;  3CC7 1;  4HH4 A;  1YHQ Z;  3CC4 1;  3S1N I;  3GTM S;  3LUS A;  1M1K 2;  2PK7 A;  1VQN 1;  4A3B I;  5FLX f;  3H3V J;  2GTH A;  2ZAE B;  5D1P A;  1K73 1;  4E2Z A;  4E2Y A;  3VMG A;  2F4M A;  3CD6 1;  2J6A A;  1NP6 A;  2WAQ A;  4AYB A;  1N8R 2;  1Q82 1;  1WW9 A;  3CCU Z;  2HU9 A;  4E32 A;  1VQM 1;  2JNY A;  2NVX I;  4CL1 A;  1Q81 2;  2QA4 Z;  3MON A;  1N2F A;  2W04 A;  1KC8 2;  3CCR Z;  4A3K I;  3HOU I;  3OW2 Y;  1VLA A;  3G6E 1;  3F3F C;  3CPW Y;  1K8A 1;  1RO4 A;  5CM2 M;  3J81 b;  1VQP Z;  3CMA 1;  1VQ4 Z;  4E31 A;  1LQL A;  2DE6 A;  5IT9 b;  1W2B Z;  2HF1 A;  3J80 b;  1TWA I;  2V8J A;  2E2J I;  2QRE B;  3I55 1;  3NFZ A;  2M48 A;  3EED A;  3PO3 S;  1KQS Y;  1VQ7 Z;  3CCL Z;  2KI7 B;  4HGY A;  3CQZ I;  4RVH A;  3IX0 A;  3CCJ Z;  3G71 1;  2GTI A;  3RZO I;  1VQO Z;  1RNI A;  3VB9 A;  1PFT A;  3NDJ A;  3S1Q I;  1Q81 1;  2V8I A;  1S72 1;  4NBC A;  2OZK A;  3IF8 A;  1VQ6 Z;  4A3C I;  1Q7Y 1;  1VQL Z;  2R6M A;  4NB9 A;  3FQM A;  2QEX Z;  3NH8 A;  3CCS 1;  1VQ8 Z;  1VQ9 Z;  1WII A;  3P5J B;  3J7A 4;  2O4H A;  2Y0S A;  3NH5 A;  3CXC Z;  1YUK A;  2H85 A;  3GTO I;  2QRD B;  3HOZ I;  3VMH A;  1NJI 2;  1Z03 A;  4BY7 I;  1W2B Y;  5C44 I;  4QTT A;  5D1O B;  3EER A;  2VUG A;  3CC2 1;  5LL6 f;  3CME Z;  2JS4 A;  1USP A;  1YIT Z;  2K5R A;  3J81 f;  3IFU A;  1I6H I;  4TNU A;  2LIY A;  3I07 A;  5IT9 f;  3HKZ A;  4QTU A;  1KQS Z;  3J80 f;  1K9M 2;  3I56 1;  4E2W A;  1M90 1;  2JA5 I;  3CC4 Z;  3GCF A;  1KRL A;  3GTK I;  5T6B A;  1JJ2 Y;  2V8K A;  3HOV I;  1YHQ 1;  2IZ4 A;  4NFR A;  3GTJ I;  3M3Y I;  3F3P C;  3GTL I;  2JUB A;  4E30 A;  2R93 I;  3S1M I;  2QLV B;  1VQ5 Z;  3S17 I;  1USP B;  1NJI 1;  3CXC Y;  2LFU A;  1VQM Z;  3CCQ Z;  4NH1 C;  3ESW A;  3CCU 1;  1YJN 1;  1R9T I;  1RO0 A;  1Z01 A;  2QA4 1;  3CCE Z;  4MD7 A;  1TFI A;  4XX2 A;  2JA7 I;  3G6E Z;  2OOX B;  1Y1V S;  1YIJ Z;  3PO2 I;  2JA6 I;  1K9M 1;  3NH4 A;  5IP7 I;  4A3I I;  3FQQ A;  3H0G I;  3CCM Z;  1M1K 1;  1ML8 A;  3GTM I;  1VQ4 1;  4Y7N I;  3M4O I;  2GU2 A;  4MD9 A;  4HGZ A;  1KD1 2;  1Z02 A;  1X3Z A;  5A2Q b;  3G4S Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...