3GTLI

Backtracked rna polymerase ii complex with 13mer with g<>u mismatch
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtlI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtlI02
2F4MA 2DE7A 3S15I 4NBDA 3H0GI 1RLYA 5C4JI 3HOXI 4A3II 4QTUA 4BY1I 2VUMI 3U50C 3S2DI 3S1RI 4BY7I 4A3CI 1PFTA 4MH4A 2NVYI 1TWHI 1Y1WI 2NVTI 3M4OI 2KPIA 3GTMS 4QTTA 1WCMI 2HF1A 2JA6I 4A3LI 4BBSI 1K83I 4NBEA 1Y1VS 3S1NI 3PO3I 5CM2M 3VB9A 3GTKI 1X3ZA 3EERA 1I3QI 3GKQA 1TWAI 1ML8A 5IP9I 3GTJI 2NVQI 2YU9I 3GTPI 1TWFI 4Y52I 4A3EI 1N2FA 3ESWA 3S16I 1DL6A 1QYPA 1RO4A 1LQLA 4NOZA 3M3YI 3I4MI 4XX2A 2E2II 4NBCA 3VMHA 2NVXI 3PO3S 3D6WA 2AKLA 3RZOI 3Q87A 3HOVI 4A3FI 2RBLA 3S2HI 1ZB9A 3GCFA 4Y7NI 3RZDI 3HOWI 1USPA 4BBRI 1R9TI 4A3BI 4NBAA 2PK7A 3LUSA 2BJOA 3S1QI 3HOYI 5FLMI 5C44I 2DE6A 4A93I 1YUAA 3HOUI 4NB8A 2J6AA 3H3VJ 3GTQI 2JA5I 2E2HI 1I6HI 3I07A 3FKII 1SFOI 3GTGI 3S17I 2B63I 2JR6A 3S14I 1TWGI 2R93I 3I4NI 3GTOI 2JA7I 2E2JI 1ZB8A 1NUIA 2JA8I 2P3YA 5IP7I 4X6AI 3HOZI 1TFIA 2R92I 3PO2I 3GTMI 4NBBA 1USPB 3VMGA 3GTLI 1TWCI 1I50I 1L1OC 3CQZI 4NBFA 3VMIA 4NBGA 1Y1VI 2R7ZI 4NB9A 2K5RA 5C3EI 4NBHA 4A3JI 4A3KI 4A3GI 2F4OA 3K7AI 2JS4A 2JNYA 1X3WA 5C4XI 4A3MI 4BXXI 1WW9A 3S1MI 1VLAA 4A3DI 2DE5A
chains in the Genus database with same CATH superfamily
2VPWA 1YJNZ 5C4JI 3HOXI 4A3CI 1VQK1 4MH4A 3J80f 1TWHI 1K9M2 3CC4Z 2QA4Z 1WCMI 2HF1A 2QKDA 3FQMA 1N8R1 1K83I 3PO3I 1YJ9Z 1I3QI 2RT9A 3KIFA 1YI2Z 3GTPI 3VTNA 1WIIA 1DL6A 3CXCY 1QYPA 2I3CA 3MONA 1YJWZ 2YADA 3D2LA 1VQMZ 1RO2A 3I4MI 5T64A 3D6WA 2V3VA 3J81f 1RNIA 3CC71 2OOXB 2OTL1 3Q87A 1RQFA 4Y7NI 1USPA 2VF1A 1R9TI 3CME1 5FLMI 5C44I 4A93I 4AYBA 3CCMZ 2JA5I 4MONA 2GTIA 1VQ71 2H85A 1NJI1 1VQ81 4S1TA 4TNUA 3I4NI 1WZNA 2EGTA 4MRIA 5D1OB 2M48A 4DQYB 3CCV1 3KIHA 3CMAZ 1ZB8A 1K8A1 5LL6f 1M1K2 1QVGY 2VPYA 1W2BZ 2QEX1 5IT9f 1Y8CA 1TFIA 2OTJ1 3GTMI 1QVGZ 1NP6A 1KRLA 1VQL1 1YIT1 1VQ91 3I56Z 3I551 5C3EI 4A3JI 1QVFY 4A3GI 1Q812 1WJ2A 4BXXI 1QVFZ 1K731 4NBDA 1RLYA 1Q822 4QTUA 2VUMI 3U50C 3CPWY 3S2DI 2W03A 4BY7I 3NH5A 2NVYI 2V8KA 3M4OI 1S721 3IR7A 4RVHA 2V8IA 2JA6I 3CPWZ 4A3LI 2PMZA 1Z03A 4DGLA 4BBSI 1Y1VS 3CCJZ 3G71Z 3TE5B 1YIJZ 1X3ZA 1Q7Y2 3D9XA 3GKQA 2LEXA 1VQN1 3CCR1 5IP9I 2NVQI 1TWFI 4A3EI 2E7ZA 2JIPA 3NFZA 2GU2A 3EEDA 5A2Qf 2QREB 3M3YI 2E2II 4NBCA 3J80b 3JAMf 4E2YA 4RV9A 2RBLA 2JIOA 1K9M1 2WB1A 1ZB9A 3GCFA 1N8R2 2O53A 4E30A 1Q16A 4A3BI 2ZAEB 4NBAA 1KD12 1KC82 3LUSA 2BJOA 1YJN1 2DE6A 1YUKA 1YUAA 3H3VJ 3CC2Z 1YHQZ 3GTQI 3CC41 2E2HI 2QA41 3CXCZ 1SFOI 3BG0B 3S17I 1VQOZ 3CCUZ 2JR6A 2R93I 1YJ91 3J81b 3FQQA 2E2JI 1M902 2G2KA 2JA8I 2P28A 4DK1A 1Z02A 1YI21 4NFRA 5IP7I 4X6AI 3HOZI 3CCLZ 1RO0A 4RVFA 3HKZA 4NBBA 1USPB 1VQ4Z 1YJW1 1VQM1 3VMIA 1FDIA 4NB9A 2LFUA 2JNYA 4MXUA 2OZKA 5D1PA 1WW9A 2YU9I 1VLAA 3S15I 2QR1B 2Q51A 4A3II 1QF8A 1VQ5Z 4BY1I 1PFTA 3CCQZ 2NVTI 2KPIA 5T67A 4MD7A 1Z01A 5IT9b 4NBEA 1P9NA 3CCSZ 3S1NI 1M1K1 5CM2M 3CCM1 3GTKI 3G6EZ 1Q861 1ML8A 3MZKB 3G4SZ 2K3RA 2JUBA 4NH1C 1JWHC 4HH4A 2RHBA 1VQ6Z 1N2FA 3CMA1 3ESWA 4CL1A 2GTHA 3MZLB 3J7A4 1LQLA 2JIQA 1K732 3VMHA 5FLXf 3PO3S 2RPRA 2JMOA 3F3PC 1X0TA 3NH8A 3CCEZ 3CD6Z 4A3FI 5T6BA 3I561 1VQPZ 1VQKZ 4BBRI 2PK7A 4RS4A 3HOYI 3S1MI 3HOUI 4NB8A 3I07A 3FKII 3BG1B 2OOYB 5A2Qb 2B63I 3CCJ1 3G711 3S14I 1YIJ1 3CD61 2VUGA 3GTOI 2JA7I 3JAMb 2JIRA 1NUIA 3IX0A 3P5JB 4E32A 4E2ZA 4E2XA 4RVDA 3PO2I 4E33A 3CC7Z 2OTLZ 1L1OC 1ZH1A 3CQZI 3OW2Y 2PM9A 2R6MA 1SIWA 2JIMA 4NBGA 1Y1VI 2KI7B 2R7ZI 2VPZA 4NBHA 2V45A 4A3KI 1KD11 1KC81 3OW2Z 2JS4A 1X3WA 5C4XI 3CMEZ 4A3MI 4E31A 2DE5A 2F4MA 2DE7A 3H0GI 4RVGA 3S1RI 1JJ2Y 2IV2X 1Y1WI 1KQSY 3GTMS 4QTTA 1VQ7Z 1M901 1VQ8Z 1JJ2Z 1KQSZ 3NDJA 3CC21 3VB9A 1YHQ1 4MD8A 3EERA 4HGZA 3CCVZ 1TWAI 4EWCA 1VQO1 3CCU1 3GTJI 4HGYA 2QEXZ 4Y52I 1NJI2 2OTJZ 1FDOA 3S16I 1VQLZ 1RO4A 1QXFA 4NOZA 1YITZ 5D1OA 1VQ9Z 4XX2A 3CCL1 3I55Z 1K8A2 3T4NB 1AA6A 1S7MA 2NVXI 2AKLA 3RZOI 1VQ41 2M6NA 3NH4A 3HOVI 2WAQA 1W2BY 2E9HA 3S2HI 3RZDI 2Q4ZA 4MD9A 3HOWI 3QWUA 3TDHB 2NAPA 3IFUA 1Q862 1S72Z 2QRDB 2RIQA 2O4HA 2VPXA 3S1QI 3NDIA 1VQ51 2J6AA 3CCQ1 2LIYA 1I6HI 1Q811 2QLVB 3GTGI 2AYDA 1VQNZ 3CCRZ 1Q821 3CCS1 2Y0SA 1TWGI 3G6E1 5FLXb 2HU9A 2IZ3A 3G4S1 2P3YA 2V8JA 1VQ61 2R92I 3F3FC 1Q7Y1 5AN9F 2W04A 3VMGA 3GTLI 1I50I 1TWCI 4E2WA 4NBFA 2K5RA 2F4OA 3K7AI 2IZ4A 2QRCB 3CCE1 3IF8A 4A3DI 1VQP1
chains in the Genus database with same CATH topology
1YJNZ 5C4JI 3HOXI 4A3CI 1VQK1 4MH4A 3J80f 1TWHI 1K9M2 3CC4Z 2QA4Z 1WCMI 2HF1A 2QKDA 3FQMA 1N8R1 1K83I 3PO3I 1YJ9Z 1I3QI 2RT9A 3KIFA 1YI2Z 3GTPI 3VTNA 1WIIA 1DL6A 3CXCY 1QYPA 2I3CA 3MONA 1YJWZ 2YADA 1VQMZ 1RO2A 3I4MI 5T64A 3D6WA 3J81f 1RNIA 3CC71 2OOXB 2OTL1 3Q87A 1RQFA 4Y7NI 1USPA 2VF1A 1R9TI 3CME1 5FLMI 5C44I 4A93I 4AYBA 3CCMZ 2JA5I 4MONA 2GTIA 1VQ71 2H85A 1NJI1 1VQ81 4S1TA 4TNUA 3I4NI 4MRIA 2EGTA 5D1OB 2M48A 4DQYB 3CCV1 3KIHA 3CMAZ 1ZB8A 1K8A1 5LL6f 1M1K2 1QVGY 1W2BZ 2QEX1 5IT9f 1TFIA 2OTJ1 3GTMI 1QVGZ 1NP6A 1KRLA 1VQL1 1YIT1 1VQ91 3I56Z 3I551 5C3EI 4A3JI 1QVFY 4A3GI 1Q812 4BXXI 1QVFZ 1K731 4NBDA 1RLYA 1Q822 4QTUA 2VUMI 3U50C 3CPWY 3S2DI 2W03A 4BY7I 3NH5A 2NVYI 2V8KA 3M4OI 1S721 4RVHA 2V8IA 2JA6I 3CPWZ 4A3LI 2PMZA 1Z03A 4DGLA 4BBSI 1Y1VS 3CCJZ 3G71Z 3TE5B 1YIJZ 1X3ZA 1Q7Y2 3D9XA 3GKQA 1VQN1 3CCR1 5IP9I 2NVQI 1TWFI 4A3EI 3NFZA 2GU2A 3EEDA 5A2Qf 2QREB 3M3YI 2E2II 4NBCA 3J80b 3JAMf 4E2YA 4RV9A 2RBLA 1K9M1 2WB1A 1ZB9A 3GCFA 1N8R2 2O53A 4E30A 4A3BI 2ZAEB 4NBAA 1KD12 1KC82 3LUSA 2BJOA 1YJN1 2DE6A 1YUKA 1YUAA 3H3VJ 3CC2Z 1YHQZ 3GTQI 3CC41 2E2HI 2QA41 3CXCZ 1SFOI 3BG0B 3S17I 1VQOZ 3CCUZ 2JR6A 2R93I 1YJ91 3J81b 3FQQA 2E2JI 1M902 2G2KA 2JA8I 2P28A 4DK1A 1Z02A 1YI21 4NFRA 5IP7I 4X6AI 3HOZI 3CCLZ 1RO0A 4RVFA 3HKZA 4NBBA 1USPB 1VQ4Z 1YJW1 1VQM1 3VMIA 4NB9A 2LFUA 2JNYA 4MXUA 2OZKA 5D1PA 1WW9A 2YU9I 1VLAA 3S15I 2QR1B 2Q51A 4A3II 1QF8A 1VQ5Z 4BY1I 1PFTA 3CCQZ 2NVTI 2KPIA 5T67A 4MD7A 1Z01A 5IT9b 4NBEA 1P9NA 3CCSZ 3S1NI 1M1K1 5CM2M 3CCM1 3GTKI 3G6EZ 1Q861 1ML8A 3MZKB 3G4SZ 2K3RA 2JUBA 4NH1C 1JWHC 4HH4A 2RHBA 1VQ6Z 1N2FA 3CMA1 3ESWA 4CL1A 2GTHA 3MZLB 3J7A4 1LQLA 1K732 3VMHA 5FLXf 3PO3S 2RPRA 2JMOA 3F3PC 1X0TA 3NH8A 3CCEZ 3CD6Z 4A3FI 5T6BA 3I561 1VQPZ 1VQKZ 4BBRI 2PK7A 4RS4A 3HOYI 3S1MI 3HOUI 4NB8A 3I07A 3FKII 3BG1B 2OOYB 5A2Qb 2B63I 3CCJ1 3G711 3S14I 1YIJ1 3CD61 2VUGA 3GTOI 2JA7I 3JAMb 1NUIA 3IX0A 3P5JB 4E32A 4E2ZA 4E2XA 4RVDA 3PO2I 4E33A 3CC7Z 2OTLZ 1L1OC 1ZH1A 3CQZI 3OW2Y 2PM9A 2R6MA 4NBGA 1Y1VI 2KI7B 2R7ZI 4NBHA 4A3KI 1KD11 1KC81 3OW2Z 2JS4A 1X3WA 5C4XI 3CMEZ 4A3MI 4E31A 2DE5A 2F4MA 2DE7A 3H0GI 4RVGA 3S1RI 1JJ2Y 1Y1WI 1KQSY 3GTMS 4QTTA 1VQ7Z 1M901 1VQ8Z 1JJ2Z 1KQSZ 3NDJA 3CC21 3VB9A 1YHQ1 4MD8A 3EERA 4HGZA 3CCVZ 1TWAI 4EWCA 1VQO1 3CCU1 3GTJI 4HGYA 2QEXZ 4Y52I 1NJI2 2OTJZ 3S16I 1VQLZ 1RO4A 4NOZA 1YITZ 5D1OA 1VQ9Z 4XX2A 3CCL1 3I55Z 1K8A2 3T4NB 2NVXI 1S7MA 2AKLA 3RZOI 1VQ41 2M6NA 3NH4A 3HOVI 2WAQA 1W2BY 2E9HA 3S2HI 3RZDI 2Q4ZA 4MD9A 3HOWI 3QWUA 3TDHB 3IFUA 1Q862 1S72Z 2QRDB 2RIQA 2O4HA 3S1QI 3NDIA 1VQ51 2J6AA 3CCQ1 2LIYA 1I6HI 1Q811 2QLVB 3GTGI 1VQNZ 3CCRZ 1Q821 3CCS1 2Y0SA 1TWGI 3G6E1 5FLXb 2HU9A 2IZ3A 3G4S1 2P3YA 2V8JA 1VQ61 2R92I 3F3FC 1Q7Y1 5AN9F 2W04A 3VMGA 3GTLI 1I50I 1TWCI 4E2WA 4NBFA 2K5RA 2F4OA 3K7AI 2IZ4A 2QRCB 3CCE1 3IF8A 4A3DI 1VQP1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4M A;  2DE7 A;  3S15 I;  4NBD A;  3H0G I;  1RLY A;  5C4J I;  3HOX I;  4A3I I;  4QTU A;  4BY1 I;  2VUM I;  3U50 C;  3S2D I;  3S1R I;  4BY7 I;  4A3C I;  1PFT A;  4MH4 A;  2NVY I;  1TWH I;  1Y1W I;  2NVT I;  3M4O I;  2KPI A;  3GTM S;  4QTT A;  1WCM I;  2HF1 A;  2JA6 I;  4A3L I;  4BBS I;  1K83 I;  4NBE A;  1Y1V S;  3S1N I;  3PO3 I;  5CM2 M;  3VB9 A;  3GTK I;  1X3Z A;  3EER A;  1I3Q I;  3GKQ A;  1TWA I;  1ML8 A;  5IP9 I;  3GTJ I;  2NVQ I;  2YU9 I;  3GTP I;  1TWF I;  4Y52 I;  4A3E I;  1N2F A;  3ESW A;  3S16 I;  1DL6 A;  1QYP A;  1RO4 A;  1LQL A;  4NOZ A;  3M3Y I;  3I4M I;  4XX2 A;  2E2I I;  4NBC A;  3VMH A;  2NVX I;  3PO3 S;  3D6W A;  2AKL A;  3RZO I;  3Q87 A;  3HOV I;  4A3F I;  2RBL A;  3S2H I;  1ZB9 A;  3GCF A;  4Y7N I;  3RZD I;  3HOW I;  1USP A;  4BBR I;  1R9T I;  4A3B I;  4NBA A;  2PK7 A;  3LUS A;  2BJO A;  3S1Q I;  3HOY I;  5FLM I;  5C44 I;  2DE6 A;  4A93 I;  1YUA A;  3HOU I;  4NB8 A;  2J6A A;  3H3V J;  3GTQ I;  2JA5 I;  2E2H I;  1I6H I;  3I07 A;  3FKI I;  1SFO I;  3GTG I;  3S17 I;  2B63 I;  2JR6 A;  3S14 I;  1TWG I;  2R93 I;  3I4N I;  3GTO I;  2JA7 I;  2E2J I;  1ZB8 A;  1NUI A;  2JA8 I;  2P3Y A;  5IP7 I;  4X6A I;  3HOZ I;  1TFI A;  2R92 I;  3PO2 I;  3GTM I;  4NBB A;  1USP B;  3VMG A;  3GTL I;  1TWC I;  1I50 I;  1L1O C;  3CQZ I;  4NBF A;  3VMI A;  4NBG A;  1Y1V I;  2R7Z I;  4NB9 A;  2K5R A;  5C3E I;  4NBH A;  4A3J I;  4A3K I;  4A3G I;  2F4O A;  3K7A I;  2JS4 A;  2JNY A;  1X3W A;  5C4X I;  4A3M I;  4BXX I;  1WW9 A;  3S1M I;  1VLA A;  4A3D I;  2DE5 A; 
#chains in the Genus database with same CATH topology
 2VPW A;  1YJN Z;  5C4J I;  3HOX I;  4A3C I;  1VQK 1;  4MH4 A;  3J80 f;  1TWH I;  1K9M 2;  3CC4 Z;  2QA4 Z;  1WCM I;  2HF1 A;  2QKD A;  3FQM A;  1N8R 1;  1K83 I;  3PO3 I;  1YJ9 Z;  1I3Q I;  2RT9 A;  3KIF A;  1YI2 Z;  3GTP I;  3VTN A;  1WII A;  1DL6 A;  3CXC Y;  1QYP A;  2I3C A;  3MON A;  1YJW Z;  2YAD A;  3D2L A;  1VQM Z;  1RO2 A;  3I4M I;  5T64 A;  3D6W A;  2V3V A;  3J81 f;  1RNI A;  3CC7 1;  2OOX B;  2OTL 1;  3Q87 A;  1RQF A;  4Y7N I;  1USP A;  2VF1 A;  1R9T I;  3CME 1;  5FLM I;  5C44 I;  4A93 I;  4AYB A;  3CCM Z;  2JA5 I;  4MON A;  2GTI A;  1VQ7 1;  2H85 A;  1NJI 1;  1VQ8 1;  4S1T A;  4TNU A;  3I4N I;  1WZN A;  2EGT A;  4MRI A;  5D1O B;  2M48 A;  4DQY B;  3CCV 1;  3KIH A;  3CMA Z;  1ZB8 A;  1K8A 1;  5LL6 f;  1M1K 2;  1QVG Y;  2VPY A;  1W2B Z;  2QEX 1;  5IT9 f;  1Y8C A;  1TFI A;  2OTJ 1;  3GTM I;  1QVG Z;  1NP6 A;  1KRL A;  1VQL 1;  1YIT 1;  1VQ9 1;  3I56 Z;  3I55 1;  5C3E I;  4A3J I;  1QVF Y;  4A3G I;  1Q81 2;  1WJ2 A;  4BXX I;  1QVF Z;  1K73 1;  4NBD A;  1RLY A;  1Q82 2;  4QTU A;  2VUM I;  3U50 C;  3CPW Y;  3S2D I;  2W03 A;  4BY7 I;  3NH5 A;  2NVY I;  2V8K A;  3M4O I;  1S72 1;  3IR7 A;  4RVH A;  2V8I A;  2JA6 I;  3CPW Z;  4A3L I;  2PMZ A;  1Z03 A;  4DGL A;  4BBS I;  1Y1V S;  3CCJ Z;  3G71 Z;  3TE5 B;  1YIJ Z;  1X3Z A;  1Q7Y 2;  3D9X A;  3GKQ A;  2LEX A;  1VQN 1;  3CCR 1;  5IP9 I;  2NVQ I;  1TWF I;  4A3E I;  2E7Z A;  2JIP A;  3NFZ A;  2GU2 A;  3EED A;  5A2Q f;  2QRE B;  3M3Y I;  2E2I I;  4NBC A;  3J80 b;  3JAM f;  4E2Y A;  4RV9 A;  2RBL A;  2JIO A;  1K9M 1;  2WB1 A;  1ZB9 A;  3GCF A;  1N8R 2;  2O53 A;  4E30 A;  1Q16 A;  4A3B I;  2ZAE B;  4NBA A;  1KD1 2;  1KC8 2;  3LUS A;  2BJO A;  1YJN 1;  2DE6 A;  1YUK A;  1YUA A;  3H3V J;  3CC2 Z;  1YHQ Z;  3GTQ I;  3CC4 1;  2E2H I;  2QA4 1;  3CXC Z;  1SFO I;  3BG0 B;  3S17 I;  1VQO Z;  3CCU Z;  2JR6 A;  2R93 I;  1YJ9 1;  3J81 b;  3FQQ A;  2E2J I;  1M90 2;  2G2K A;  2JA8 I;  2P28 A;  4DK1 A;  1Z02 A;  1YI2 1;  4NFR A;  5IP7 I;  4X6A I;  3HOZ I;  3CCL Z;  1RO0 A;  4RVF A;  3HKZ A;  4NBB A;  1USP B;  1VQ4 Z;  1YJW 1;  1VQM 1;  3VMI A;  1FDI A;  4NB9 A;  2LFU A;  2JNY A;  4MXU A;  2OZK A;  5D1P A;  1WW9 A;  2YU9 I;  1VLA A;  3S15 I;  2QR1 B;  2Q51 A;  4A3I I;  1QF8 A;  1VQ5 Z;  4BY1 I;  1PFT A;  3CCQ Z;  2NVT I;  2KPI A;  5T67 A;  4MD7 A;  1Z01 A;  5IT9 b;  4NBE A;  1P9N A;  3CCS Z;  3S1N I;  1M1K 1;  5CM2 M;  3CCM 1;  3GTK I;  3G6E Z;  1Q86 1;  1ML8 A;  3MZK B;  3G4S Z;  2K3R A;  2JUB A;  4NH1 C;  1JWH C;  4HH4 A;  2RHB A;  1VQ6 Z;  1N2F A;  3CMA 1;  3ESW A;  4CL1 A;  2GTH A;  3MZL B;  3J7A 4;  1LQL A;  2JIQ A;  1K73 2;  3VMH A;  5FLX f;  3PO3 S;  2RPR A;  2JMO A;  3F3P C;  1X0T A;  3NH8 A;  3CCE Z;  3CD6 Z;  4A3F I;  5T6B A;  3I56 1;  1VQP Z;  1VQK Z;  4BBR I;  2PK7 A;  4RS4 A;  3HOY I;  3S1M I;  3HOU I;  4NB8 A;  3I07 A;  3FKI I;  3BG1 B;  2OOY B;  5A2Q b;  2B63 I;  3CCJ 1;  3G71 1;  3S14 I;  1YIJ 1;  3CD6 1;  2VUG A;  3GTO I;  2JA7 I;  3JAM b;  2JIR A;  1NUI A;  3IX0 A;  3P5J B;  4E32 A;  4E2Z A;  4E2X A;  4RVD A;  3PO2 I;  4E33 A;  3CC7 Z;  2OTL Z;  1L1O C;  1ZH1 A;  3CQZ I;  3OW2 Y;  2PM9 A;  2R6M A;  1SIW A;  2JIM A;  4NBG A;  1Y1V I;  2KI7 B;  2R7Z I;  2VPZ A;  4NBH A;  2V45 A;  4A3K I;  1KD1 1;  1KC8 1;  3OW2 Z;  2JS4 A;  1X3W A;  5C4X I;  3CME Z;  4A3M I;  4E31 A;  2DE5 A;  2F4M A;  2DE7 A;  3H0G I;  4RVG A;  3S1R I;  1JJ2 Y;  2IV2 X;  1Y1W I;  1KQS Y;  3GTM S;  4QTT A;  1VQ7 Z;  1M90 1;  1VQ8 Z;  1JJ2 Z;  1KQS Z;  3NDJ A;  3CC2 1;  3VB9 A;  1YHQ 1;  4MD8 A;  3EER A;  4HGZ A;  3CCV Z;  1TWA I;  4EWC A;  1VQO 1;  3CCU 1;  3GTJ I;  4HGY A;  2QEX Z;  4Y52 I;  1NJI 2;  2OTJ Z;  1FDO A;  3S16 I;  1VQL Z;  1RO4 A;  1QXF A;  4NOZ A;  1YIT Z;  5D1O A;  1VQ9 Z;  4XX2 A;  3CCL 1;  3I55 Z;  1K8A 2;  3T4N B;  1AA6 A;  1S7M A;  2NVX I;  2AKL A;  3RZO I;  1VQ4 1;  2M6N A;  3NH4 A;  3HOV I;  2WAQ A;  1W2B Y;  2E9H A;  3S2H I;  3RZD I;  2Q4Z A;  4MD9 A;  3HOW I;  3QWU A;  3TDH B;  2NAP A;  3IFU A;  1Q86 2;  1S72 Z;  2QRD B;  2RIQ A;  2O4H A;  2VPX A;  3S1Q I;  3NDI A;  1VQ5 1;  2J6A A;  3CCQ 1;  2LIY A;  1I6H I;  1Q81 1;  2QLV B;  3GTG I;  2AYD A;  1VQN Z;  3CCR Z;  1Q82 1;  3CCS 1;  2Y0S A;  1TWG I;  3G6E 1;  5FLX b;  2HU9 A;  2IZ3 A;  3G4S 1;  2P3Y A;  2V8J A;  1VQ6 1;  2R92 I;  3F3F C;  1Q7Y 1;  5AN9 F;  2W04 A;  3VMG A;  3GTL I;  1I50 I;  1TWC I;  4E2W A;  4NBF A;  2K5R A;  2F4O A;  3K7A I;  2IZ4 A;  2QRC B;  3CCE 1;  3IF8 A;  4A3D I;  1VQP 1; 
#chains in the Genus database with same CATH homology
 1YJN Z;  5C4J I;  3HOX I;  4A3C I;  1VQK 1;  4MH4 A;  3J80 f;  1TWH I;  1K9M 2;  3CC4 Z;  2QA4 Z;  1WCM I;  2HF1 A;  2QKD A;  3FQM A;  1N8R 1;  1K83 I;  3PO3 I;  1YJ9 Z;  1I3Q I;  2RT9 A;  3KIF A;  1YI2 Z;  3GTP I;  3VTN A;  1WII A;  1DL6 A;  3CXC Y;  1QYP A;  2I3C A;  3MON A;  1YJW Z;  2YAD A;  1VQM Z;  1RO2 A;  3I4M I;  5T64 A;  3D6W A;  3J81 f;  1RNI A;  3CC7 1;  2OOX B;  2OTL 1;  3Q87 A;  1RQF A;  4Y7N I;  1USP A;  2VF1 A;  1R9T I;  3CME 1;  5FLM I;  5C44 I;  4A93 I;  4AYB A;  3CCM Z;  2JA5 I;  4MON A;  2GTI A;  1VQ7 1;  2H85 A;  1NJI 1;  1VQ8 1;  4S1T A;  4TNU A;  3I4N I;  4MRI A;  2EGT A;  5D1O B;  2M48 A;  4DQY B;  3CCV 1;  3KIH A;  3CMA Z;  1ZB8 A;  1K8A 1;  5LL6 f;  1M1K 2;  1QVG Y;  1W2B Z;  2QEX 1;  5IT9 f;  1TFI A;  2OTJ 1;  3GTM I;  1QVG Z;  1NP6 A;  1KRL A;  1VQL 1;  1YIT 1;  1VQ9 1;  3I56 Z;  3I55 1;  5C3E I;  4A3J I;  1QVF Y;  4A3G I;  1Q81 2;  4BXX I;  1QVF Z;  1K73 1;  4NBD A;  1RLY A;  1Q82 2;  4QTU A;  2VUM I;  3U50 C;  3CPW Y;  3S2D I;  2W03 A;  4BY7 I;  3NH5 A;  2NVY I;  2V8K A;  3M4O I;  1S72 1;  4RVH A;  2V8I A;  2JA6 I;  3CPW Z;  4A3L I;  2PMZ A;  1Z03 A;  4DGL A;  4BBS I;  1Y1V S;  3CCJ Z;  3G71 Z;  3TE5 B;  1YIJ Z;  1X3Z A;  1Q7Y 2;  3D9X A;  3GKQ A;  1VQN 1;  3CCR 1;  5IP9 I;  2NVQ I;  1TWF I;  4A3E I;  3NFZ A;  2GU2 A;  3EED A;  5A2Q f;  2QRE B;  3M3Y I;  2E2I I;  4NBC A;  3J80 b;  3JAM f;  4E2Y A;  4RV9 A;  2RBL A;  1K9M 1;  2WB1 A;  1ZB9 A;  3GCF A;  1N8R 2;  2O53 A;  4E30 A;  4A3B I;  2ZAE B;  4NBA A;  1KD1 2;  1KC8 2;  3LUS A;  2BJO A;  1YJN 1;  2DE6 A;  1YUK A;  1YUA A;  3H3V J;  3CC2 Z;  1YHQ Z;  3GTQ I;  3CC4 1;  2E2H I;  2QA4 1;  3CXC Z;  1SFO I;  3BG0 B;  3S17 I;  1VQO Z;  3CCU Z;  2JR6 A;  2R93 I;  1YJ9 1;  3J81 b;  3FQQ A;  2E2J I;  1M90 2;  2G2K A;  2JA8 I;  2P28 A;  4DK1 A;  1Z02 A;  1YI2 1;  4NFR A;  5IP7 I;  4X6A I;  3HOZ I;  3CCL Z;  1RO0 A;  4RVF A;  3HKZ A;  4NBB A;  1USP B;  1VQ4 Z;  1YJW 1;  1VQM 1;  3VMI A;  4NB9 A;  2LFU A;  2JNY A;  4MXU A;  2OZK A;  5D1P A;  1WW9 A;  2YU9 I;  1VLA A;  3S15 I;  2QR1 B;  2Q51 A;  4A3I I;  1QF8 A;  1VQ5 Z;  4BY1 I;  1PFT A;  3CCQ Z;  2NVT I;  2KPI A;  5T67 A;  4MD7 A;  1Z01 A;  5IT9 b;  4NBE A;  1P9N A;  3CCS Z;  3S1N I;  1M1K 1;  5CM2 M;  3CCM 1;  3GTK I;  3G6E Z;  1Q86 1;  1ML8 A;  3MZK B;  3G4S Z;  2K3R A;  2JUB A;  4NH1 C;  1JWH C;  4HH4 A;  2RHB A;  1VQ6 Z;  1N2F A;  3CMA 1;  3ESW A;  4CL1 A;  2GTH A;  3MZL B;  3J7A 4;  1LQL A;  1K73 2;  3VMH A;  5FLX f;  3PO3 S;  2RPR A;  2JMO A;  3F3P C;  1X0T A;  3NH8 A;  3CCE Z;  3CD6 Z;  4A3F I;  5T6B A;  3I56 1;  1VQP Z;  1VQK Z;  4BBR I;  2PK7 A;  4RS4 A;  3HOY I;  3S1M I;  3HOU I;  4NB8 A;  3I07 A;  3FKI I;  3BG1 B;  2OOY B;  5A2Q b;  2B63 I;  3CCJ 1;  3G71 1;  3S14 I;  1YIJ 1;  3CD6 1;  2VUG A;  3GTO I;  2JA7 I;  3JAM b;  1NUI A;  3IX0 A;  3P5J B;  4E32 A;  4E2Z A;  4E2X A;  4RVD A;  3PO2 I;  4E33 A;  3CC7 Z;  2OTL Z;  1L1O C;  1ZH1 A;  3CQZ I;  3OW2 Y;  2PM9 A;  2R6M A;  4NBG A;  1Y1V I;  2KI7 B;  2R7Z I;  4NBH A;  4A3K I;  1KD1 1;  1KC8 1;  3OW2 Z;  2JS4 A;  1X3W A;  5C4X I;  3CME Z;  4A3M I;  4E31 A;  2DE5 A;  2F4M A;  2DE7 A;  3H0G I;  4RVG A;  3S1R I;  1JJ2 Y;  1Y1W I;  1KQS Y;  3GTM S;  4QTT A;  1VQ7 Z;  1M90 1;  1VQ8 Z;  1JJ2 Z;  1KQS Z;  3NDJ A;  3CC2 1;  3VB9 A;  1YHQ 1;  4MD8 A;  3EER A;  4HGZ A;  3CCV Z;  1TWA I;  4EWC A;  1VQO 1;  3CCU 1;  3GTJ I;  4HGY A;  2QEX Z;  4Y52 I;  1NJI 2;  2OTJ Z;  3S16 I;  1VQL Z;  1RO4 A;  4NOZ A;  1YIT Z;  5D1O A;  1VQ9 Z;  4XX2 A;  3CCL 1;  3I55 Z;  1K8A 2;  3T4N B;  2NVX I;  1S7M A;  2AKL A;  3RZO I;  1VQ4 1;  2M6N A;  3NH4 A;  3HOV I;  2WAQ A;  1W2B Y;  2E9H A;  3S2H I;  3RZD I;  2Q4Z A;  4MD9 A;  3HOW I;  3QWU A;  3TDH B;  3IFU A;  1Q86 2;  1S72 Z;  2QRD B;  2RIQ A;  2O4H A;  3S1Q I;  3NDI A;  1VQ5 1;  2J6A A;  3CCQ 1;  2LIY A;  1I6H I;  1Q81 1;  2QLV B;  3GTG I;  1VQN Z;  3CCR Z;  1Q82 1;  3CCS 1;  2Y0S A;  1TWG I;  3G6E 1;  5FLX b;  2HU9 A;  2IZ3 A;  3G4S 1;  2P3Y A;  2V8J A;  1VQ6 1;  2R92 I;  3F3F C;  1Q7Y 1;  5AN9 F;  2W04 A;  3VMG A;  3GTL I;  1I50 I;  1TWC I;  4E2W A;  4NBF A;  2K5R A;  2F4O A;  3K7A I;  2IZ4 A;  2QRC B;  3CCE 1;  3IF8 A;  4A3D I;  1VQP 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...