3KIFA

The crystal structures of two fragments truncated from 5-bladed beta-propeller lectin, tachylectin-2 (lib1-b7-18 and lib2-d2-15)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
93
structure length
93
Chain Sequence
DSDNWMGRAKEIGNGGWDQFQFLFFDPNGYLYAVSNDKLYKASPPQSDTDNWIARATEIGSGGWSGFKFLFFHPNGYLYAVRGQRFYKALPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metamorphic proteins mediate evolutionary transitions of structure
pubmed doi rcsb
source organism Synthetic construct
molecule tags Sugar binding protein
molecule keywords 5-bladed beta-propeller lectin
total genus 11
structure length 93
sequence length 93
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2009-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.650 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3kifA00
3KIFA 3KIHA
chains in the Genus database with same CATH superfamily
2JUBA 2JIRA 4AYBA 1YI2Z 3CD61 3CMEZ 4DQYB 2JNYA 3G71Z 1K731 4RV9A 1VQ71 1M1K1 3FQQA 5C4JI 1W2BZ 2O53A 3GCFA 3GTGI 1KD12 2QA41 2M48A 3H3VJ 2JA7I 3GTOI 1VQN1 3BG0B 1X0TA 3I56Z 2DE5A 4A3CI 2RPRA 4BY1I 2JA8I 1S72Z 1I3QI 1Z03A 1Q821 3D2LA 3CCUZ 4Y52I 2R7ZI 1SIWA 1KRLA 2LIYA 4NB8A 2V45A 3G711 1M1K2 1KQSZ 1Q822 4A93I 1VLAA 4A3LI 1QVGZ 1VQO1 2PMZA 1YUKA 2OTJZ 4BBRI 2Y0SA 2H85A 4RVDA 3J80b 1NUIA 2W03A 1N8R1 5CM2M 2LEXA 4Y7NI 2F4OA 3CCVZ 2JIOA 3NDJA 3GTMI 2HU9A 4A3DI 4A3FI 2OTLZ 1TFIA 5IT9b 2OTL1 1K8A1 1ZH1A 3CCL1 2OZKA 2O4HA 4A3II 3CCS1 1K8A2 1NP6A 2QKDA 5C4XI 2VUMI 3JAMf 2KI7B 2AKLA 3Q87A 2E2HI 3S1QI 4E32A 3CCJZ 4NBHA 1DL6A 1N8R2 3GTPI 3CPWZ 3G6EZ 1VQM1 4E2YA 2IZ3A 2G2KA 2E2JI 2VPWA 4BXXI 3EEDA 2NAPA 3CCE1 2E9HA 3QWUA 1ZB8A 1WJ2A 2QRCB 2I3CA 2RBLA 2NVQI 1AA6A 2YADA 2QEX1 3CCV1 5T64A 3OW2Y 1I50I 1VQ9Z 1VQ91 3LUSA 4MD8A 3S17I 2P28A 2K3RA 5T67A 2AYDA 4S1TA 2E7ZA 1TWFI 1KD11 4X6AI 3G4SZ 1QVFZ 1YITZ 1K732 3K7AI 1FDOA 5C44I 4E2XA 2KPIA 1W2BY 1WW9A 2YU9I 1VQ6Z 2NVTI 1Y1WI 1QVGY 5D1PA 1YUAA 1VQPZ 1TWGI 1VQNZ 1YHQ1 3IR7A 3S1MI 2GU2A 2RHBA 3GTJI 1YHQZ 1RO4A 2JMOA 1VQ61 2IV2X 3FKII 2M6NA 3CXCZ 2JIPA 3CC41 4A3BI 2GTHA 3HKZA 1Q7Y2 3M3YI 1Y1VI 1Y1VS 3KIHA 1Q811 4HGZA 2OOYB 4A3MI 1I6HI 3BG1B 4RVFA 3GTQI 2W04A 4MONA 3CC7Z 5IT9f 3J7A4 5LL6f 2IZ4A 1KC82 3VTNA 3S1NI 2F4MA 2PM9A 1L1OC 2OTJ1 3I551 1YJNZ 1NJI2 2GTIA 2RIQA 4NBFA 1K9M1 4E30A 3J81b 2VPZA 2DE7A 2JS4A 2PK7A 3NFZA 3I4MI 1WZNA 3HOVI 4HH4A 4DK1A 4BY7I 2V3VA 1YIT1 1TWAI 3G4S1 1X3WA 3CCRZ 1S721 2QLVB 2LFUA 4NOZA 2JA6I 4RVHA 5AN9F 4DGLA 4E33A 3HOYI 1Q862 4EWCA 4E2ZA 2NVXI 1YI21 3CPWY 3S14I 3CQZI 2ZAEB 2VF1A 2R93I 3RZDI 3VMHA 3CC4Z 4QTTA 4MD7A 2OOXB 4A3GI 4RVGA 1QVFY 3CCU1 3S16I 1KQSY 3G6E1 3S15I 3CCQ1 3GTKI 2QR1B 4A3EI 1SFOI 3TDHB 1VQOZ 3OW2Z 1RQFA 5IP7I 3PO3I 3F3PC 1ZB9A 3HOUI 3CCR1 1PFTA 2JIQA 4HGYA 5C3EI 3IF8A 4NBGA 3TE5B 3CC2Z 1JJ2Y 3CD6Z 1TWHI 3GTLI 2DE6A 2EGTA 3GTMS 1M902 3VMIA 3S1RI 3RZOI 1VQ81 1VQK1 3VMGA 4NBDA 1RNIA 4E31A 4BBSI 3I55Z 3HOXI 4A3KI 1P9NA 3IFUA 3CXCY 2P3YA 3GKQA 2V8KA 2V8IA 1Y8CA 1USPB 4NBCA 4MH4A 3NH5A 1Z01A 2JR6A 2QA4Z 3KIFA 2QRDB 4XX2A 1K9M2 3CCSZ 4NBBA 1M901 2V8JA 2QREB 3PO2I 3CCEZ 1NJI1 3CCLZ 5D1OB 1QXFA 4NFRA 2Q51A 1KC81 5FLMI 4E2WA 3MONA 3HOWI 3J81f 1VQ51 3I4NI 2WB1A 1Z02A 3NDIA 3CCJ1 3CMA1 1S7MA 1VQKZ 2R6MA 1RLYA 3EERA 1VQP1 2RT9A 1Q812 1WCMI 2VPXA 1VQ4Z 4NB9A 1ML8A 5A2Qb 3S2HI 5D1OA 2JA5I 1QYPA 3P5JB 4RS4A 1YJW1 1RO0A 3CCM1 1VQL1 1X3ZA 1YIJ1 5A2Qf 1USPA 1N2FA 2E2II 1JJ2Z 3F3FC 1VQ5Z 3HOZI 3MZLB 1Q861 2JIMA 1LQLA 2J6AA 2QEXZ 5FLXb 4A3JI 1JWHC 3CCMZ 1VQLZ 5IP9I 1YJWZ 3CME1 2B63I 1K83I 3IX0A 1YIJZ 3U50C 4NBAA 5FLXf 2R92I 4QTUA 3PO3S 4MD9A 3I07A 1TWCI 1VQMZ 3H0GI 4NBEA 2K5RA 3JAMb 3CCQZ 3D6WA 2WAQA 3CMAZ 3CC71 3I561 4NH1C 4CL1A 1WIIA 3ESWA 3CC21 3NH8A 1YJ9Z 3D9XA 4MXUA 3T4NB 1R9TI 1VQ8Z 1VQ7Z 4MRIA 2NVYI 1YJ91 2VPYA 3NH4A 1Q7Y1 2VUGA 2Q4ZA 4TNUA 1VQ41 1FDIA 2HF1A 3J80f 3S2DI 1Q16A 1RO2A 3M4OI 3VB9A 3MZKB 5T6BA 1QF8A 1YJN1 3FQMA 2BJOA
chains in the Genus database with same CATH topology
2JUBA 4AYBA 1YI2Z 3CD61 3CMEZ 4DQYB 2JNYA 3G71Z 1K731 4RV9A 1VQ71 1M1K1 3FQQA 5C4JI 1W2BZ 2O53A 3GCFA 3GTGI 1KD12 2QA41 2M48A 3H3VJ 2JA7I 3GTOI 1VQN1 3BG0B 1X0TA 3I56Z 2DE5A 4A3CI 2RPRA 4BY1I 2JA8I 1S72Z 1I3QI 1Z03A 1Q821 3CCUZ 4Y52I 2R7ZI 1KRLA 2LIYA 4NB8A 3G711 1KQSZ 1M1K2 4A93I 1Q822 1VLAA 4A3LI 1QVGZ 1VQO1 2PMZA 1YUKA 2OTJZ 4BBRI 2Y0SA 2H85A 4RVDA 3J80b 1NUIA 2W03A 1N8R1 5CM2M 4Y7NI 2F4OA 3CCVZ 3NDJA 3GTMI 2HU9A 4A3DI 4A3FI 2OTLZ 1TFIA 5IT9b 2OTL1 1K8A1 1ZH1A 3CCL1 2OZKA 2O4HA 4A3II 3CCS1 1K8A2 1NP6A 2QKDA 5C4XI 2VUMI 3JAMf 2KI7B 2AKLA 3Q87A 2E2HI 3S1QI 4E32A 3CCJZ 4NBHA 1DL6A 1N8R2 3GTPI 3CPWZ 3G6EZ 1VQM1 4E2YA 2IZ3A 2G2KA 2E2JI 4BXXI 3EEDA 3CCE1 2E9HA 3QWUA 1ZB8A 2QRCB 2I3CA 2RBLA 2NVQI 2YADA 2QEX1 3CCV1 5T64A 3OW2Y 1I50I 1VQ9Z 1VQ91 3LUSA 4MD8A 3S17I 2P28A 2K3RA 5T67A 4S1TA 1TWFI 1KD11 4X6AI 3G4SZ 1QVFZ 1YITZ 1K732 3K7AI 5C44I 4E2XA 2KPIA 1W2BY 1WW9A 2YU9I 1VQ6Z 2NVTI 1Y1WI 1QVGY 5D1PA 1YUAA 1VQPZ 1TWGI 1VQNZ 1YHQ1 3S1MI 2GU2A 2RHBA 3GTJI 1YHQZ 1RO4A 2JMOA 1VQ61 3FKII 2M6NA 3CXCZ 3CC41 4A3BI 2GTHA 3HKZA 1Q7Y2 3M3YI 1Y1VI 1Y1VS 3KIHA 1Q811 4HGZA 2OOYB 4A3MI 1I6HI 3BG1B 4RVFA 3GTQI 2W04A 4MONA 3CC7Z 5IT9f 3J7A4 5LL6f 2IZ4A 1KC82 3VTNA 3S1NI 2F4MA 2PM9A 1L1OC 2OTJ1 3I551 1YJNZ 1NJI2 2GTIA 2RIQA 4NBFA 1K9M1 4E30A 3J81b 2DE7A 2JS4A 2PK7A 3NFZA 3I4MI 3HOVI 4HH4A 4DK1A 4BY7I 1YIT1 1TWAI 3G4S1 1X3WA 3CCRZ 1S721 2QLVB 2LFUA 4NOZA 2JA6I 4RVHA 5AN9F 4DGLA 4E33A 3HOYI 1Q862 4EWCA 4E2ZA 2NVXI 1YI21 3CPWY 3S14I 3CQZI 2ZAEB 2VF1A 2R93I 3RZDI 3VMHA 3CC4Z 4QTTA 4MD7A 2OOXB 4A3GI 4RVGA 1QVFY 3CCU1 3S16I 1KQSY 3G6E1 3S15I 3CCQ1 3GTKI 2QR1B 4A3EI 1SFOI 3TDHB 1VQOZ 3OW2Z 1RQFA 5IP7I 3PO3I 3F3PC 1ZB9A 3HOUI 3CCR1 1PFTA 4HGYA 5C3EI 3IF8A 4NBGA 3TE5B 3CC2Z 1JJ2Y 3CD6Z 1TWHI 3GTLI 2DE6A 2EGTA 3GTMS 1M902 3VMIA 3S1RI 3RZOI 1VQ81 1VQK1 3VMGA 4NBDA 1RNIA 4E31A 4BBSI 3I55Z 3HOXI 4A3KI 1P9NA 3IFUA 3CXCY 2P3YA 3GKQA 2V8KA 2V8IA 1USPB 4NBCA 4MH4A 3NH5A 1Z01A 2JR6A 2QA4Z 3KIFA 2QRDB 4XX2A 1K9M2 3CCSZ 4NBBA 1M901 2V8JA 2QREB 3PO2I 3CCEZ 1NJI1 3CCLZ 5D1OB 4NFRA 2Q51A 1KC81 5FLMI 4E2WA 3MONA 3HOWI 3J81f 1VQ51 3I4NI 2WB1A 1Z02A 3NDIA 3CCJ1 3CMA1 1S7MA 1VQKZ 2R6MA 1RLYA 3EERA 1VQP1 2RT9A 1Q812 1WCMI 1VQ4Z 4NB9A 1ML8A 5A2Qb 3S2HI 5D1OA 2JA5I 1QYPA 3P5JB 4RS4A 1YJW1 1RO0A 3CCM1 1VQL1 1X3ZA 1YIJ1 5A2Qf 1USPA 1N2FA 2E2II 1JJ2Z 3F3FC 1VQ5Z 3HOZI 3MZLB 1Q861 1LQLA 2J6AA 2QEXZ 5FLXb 4A3JI 1JWHC 3CCMZ 1VQLZ 5IP9I 1YJWZ 3CME1 2B63I 1K83I 3IX0A 1YIJZ 3U50C 4NBAA 5FLXf 2R92I 4QTUA 3PO3S 4MD9A 3I07A 1TWCI 1VQMZ 3H0GI 4NBEA 2K5RA 3JAMb 3CCQZ 3D6WA 2WAQA 3CMAZ 3CC71 3I561 4NH1C 4CL1A 1WIIA 3ESWA 3CC21 3NH8A 1YJ9Z 3D9XA 4MXUA 3T4NB 1R9TI 1VQ8Z 1VQ7Z 4MRIA 2NVYI 1YJ91 3NH4A 1Q7Y1 2VUGA 2Q4ZA 4TNUA 1VQ41 3J80f 2HF1A 3S2DI 1RO2A 3M4OI 3VB9A 3MZKB 5T6BA 1QF8A 1YJN1 3FQMA 2BJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KIF A;  3KIH A; 
#chains in the Genus database with same CATH topology
 2JUB A;  2JIR A;  4AYB A;  1YI2 Z;  3CD6 1;  3CME Z;  4DQY B;  2JNY A;  3G71 Z;  1K73 1;  4RV9 A;  1VQ7 1;  1M1K 1;  3FQQ A;  5C4J I;  1W2B Z;  2O53 A;  3GCF A;  3GTG I;  1KD1 2;  2QA4 1;  2M48 A;  3H3V J;  2JA7 I;  3GTO I;  1VQN 1;  3BG0 B;  1X0T A;  3I56 Z;  2DE5 A;  4A3C I;  2RPR A;  4BY1 I;  2JA8 I;  1S72 Z;  1I3Q I;  1Z03 A;  1Q82 1;  3D2L A;  3CCU Z;  4Y52 I;  2R7Z I;  1SIW A;  1KRL A;  2LIY A;  4NB8 A;  2V45 A;  3G71 1;  1M1K 2;  1KQS Z;  1Q82 2;  4A93 I;  1VLA A;  4A3L I;  1QVG Z;  1VQO 1;  2PMZ A;  1YUK A;  2OTJ Z;  4BBR I;  2Y0S A;  2H85 A;  4RVD A;  3J80 b;  1NUI A;  2W03 A;  1N8R 1;  5CM2 M;  2LEX A;  4Y7N I;  2F4O A;  3CCV Z;  2JIO A;  3NDJ A;  3GTM I;  2HU9 A;  4A3D I;  4A3F I;  2OTL Z;  1TFI A;  5IT9 b;  2OTL 1;  1K8A 1;  1ZH1 A;  3CCL 1;  2OZK A;  2O4H A;  4A3I I;  3CCS 1;  1K8A 2;  1NP6 A;  2QKD A;  5C4X I;  2VUM I;  3JAM f;  2KI7 B;  2AKL A;  3Q87 A;  2E2H I;  3S1Q I;  4E32 A;  3CCJ Z;  4NBH A;  1DL6 A;  1N8R 2;  3GTP I;  3CPW Z;  3G6E Z;  1VQM 1;  4E2Y A;  2IZ3 A;  2G2K A;  2E2J I;  2VPW A;  4BXX I;  3EED A;  2NAP A;  3CCE 1;  2E9H A;  3QWU A;  1ZB8 A;  1WJ2 A;  2QRC B;  2I3C A;  2RBL A;  2NVQ I;  1AA6 A;  2YAD A;  2QEX 1;  3CCV 1;  5T64 A;  3OW2 Y;  1I50 I;  1VQ9 Z;  1VQ9 1;  3LUS A;  4MD8 A;  3S17 I;  2P28 A;  2K3R A;  5T67 A;  2AYD A;  4S1T A;  2E7Z A;  1TWF I;  1KD1 1;  4X6A I;  3G4S Z;  1QVF Z;  1YIT Z;  1K73 2;  3K7A I;  1FDO A;  5C44 I;  4E2X A;  2KPI A;  1W2B Y;  1WW9 A;  2YU9 I;  1VQ6 Z;  2NVT I;  1Y1W I;  1QVG Y;  5D1P A;  1YUA A;  1VQP Z;  1TWG I;  1VQN Z;  1YHQ 1;  3IR7 A;  3S1M I;  2GU2 A;  2RHB A;  3GTJ I;  1YHQ Z;  1RO4 A;  2JMO A;  1VQ6 1;  2IV2 X;  3FKI I;  2M6N A;  3CXC Z;  2JIP A;  3CC4 1;  4A3B I;  2GTH A;  3HKZ A;  1Q7Y 2;  3M3Y I;  1Y1V I;  1Y1V S;  3KIH A;  1Q81 1;  4HGZ A;  2OOY B;  4A3M I;  1I6H I;  3BG1 B;  4RVF A;  3GTQ I;  2W04 A;  4MON A;  3CC7 Z;  5IT9 f;  3J7A 4;  5LL6 f;  2IZ4 A;  1KC8 2;  3VTN A;  3S1N I;  2F4M A;  2PM9 A;  1L1O C;  2OTJ 1;  3I55 1;  1YJN Z;  1NJI 2;  2GTI A;  2RIQ A;  4NBF A;  1K9M 1;  4E30 A;  3J81 b;  2VPZ A;  2DE7 A;  2JS4 A;  2PK7 A;  3NFZ A;  3I4M I;  1WZN A;  3HOV I;  4HH4 A;  4DK1 A;  4BY7 I;  2V3V A;  1YIT 1;  1TWA I;  3G4S 1;  1X3W A;  3CCR Z;  1S72 1;  2QLV B;  2LFU A;  4NOZ A;  2JA6 I;  4RVH A;  5AN9 F;  4DGL A;  4E33 A;  3HOY I;  1Q86 2;  4EWC A;  4E2Z A;  2NVX I;  1YI2 1;  3CPW Y;  3S14 I;  3CQZ I;  2ZAE B;  2VF1 A;  2R93 I;  3RZD I;  3VMH A;  3CC4 Z;  4QTT A;  4MD7 A;  2OOX B;  4A3G I;  4RVG A;  1QVF Y;  3CCU 1;  3S16 I;  1KQS Y;  3G6E 1;  3S15 I;  3CCQ 1;  3GTK I;  2QR1 B;  4A3E I;  1SFO I;  3TDH B;  1VQO Z;  3OW2 Z;  1RQF A;  5IP7 I;  3PO3 I;  3F3P C;  1ZB9 A;  3HOU I;  3CCR 1;  1PFT A;  2JIQ A;  4HGY A;  5C3E I;  3IF8 A;  4NBG A;  3TE5 B;  3CC2 Z;  1JJ2 Y;  3CD6 Z;  1TWH I;  3GTL I;  2DE6 A;  2EGT A;  3GTM S;  1M90 2;  3VMI A;  3S1R I;  3RZO I;  1VQ8 1;  1VQK 1;  3VMG A;  4NBD A;  1RNI A;  4E31 A;  4BBS I;  3I55 Z;  3HOX I;  4A3K I;  1P9N A;  3IFU A;  3CXC Y;  2P3Y A;  3GKQ A;  2V8K A;  2V8I A;  1Y8C A;  1USP B;  4NBC A;  4MH4 A;  3NH5 A;  1Z01 A;  2JR6 A;  2QA4 Z;  3KIF A;  2QRD B;  4XX2 A;  1K9M 2;  3CCS Z;  4NBB A;  1M90 1;  2V8J A;  2QRE B;  3PO2 I;  3CCE Z;  1NJI 1;  3CCL Z;  5D1O B;  1QXF A;  4NFR A;  2Q51 A;  1KC8 1;  5FLM I;  4E2W A;  3MON A;  3HOW I;  3J81 f;  1VQ5 1;  3I4N I;  2WB1 A;  1Z02 A;  3NDI A;  3CCJ 1;  3CMA 1;  1S7M A;  1VQK Z;  2R6M A;  1RLY A;  3EER A;  1VQP 1;  2RT9 A;  1Q81 2;  1WCM I;  2VPX A;  1VQ4 Z;  4NB9 A;  1ML8 A;  5A2Q b;  3S2H I;  5D1O A;  2JA5 I;  1QYP A;  3P5J B;  4RS4 A;  1YJW 1;  1RO0 A;  3CCM 1;  1VQL 1;  1X3Z A;  1YIJ 1;  5A2Q f;  1USP A;  1N2F A;  2E2I I;  1JJ2 Z;  3F3F C;  1VQ5 Z;  3HOZ I;  3MZL B;  1Q86 1;  2JIM A;  1LQL A;  2J6A A;  2QEX Z;  5FLX b;  4A3J I;  1JWH C;  3CCM Z;  1VQL Z;  5IP9 I;  1YJW Z;  3CME 1;  2B63 I;  1K83 I;  3IX0 A;  1YIJ Z;  3U50 C;  4NBA A;  5FLX f;  2R92 I;  4QTU A;  3PO3 S;  4MD9 A;  3I07 A;  1TWC I;  1VQM Z;  3H0G I;  4NBE A;  2K5R A;  3JAM b;  3CCQ Z;  3D6W A;  2WAQ A;  3CMA Z;  3CC7 1;  3I56 1;  4NH1 C;  4CL1 A;  1WII A;  3ESW A;  3CC2 1;  3NH8 A;  1YJ9 Z;  3D9X A;  4MXU A;  3T4N B;  1R9T I;  1VQ8 Z;  1VQ7 Z;  4MRI A;  2NVY I;  1YJ9 1;  2VPY A;  3NH4 A;  1Q7Y 1;  2VUG A;  2Q4Z A;  4TNU A;  1VQ4 1;  1FDI A;  2HF1 A;  3J80 f;  3S2D I;  1Q16 A;  1RO2 A;  3M4O I;  3VB9 A;  3MZK B;  5T6B A;  1QF8 A;  1YJN 1;  3FQM A;  2BJO A; 
#chains in the Genus database with same CATH homology
 2JUB A;  4AYB A;  1YI2 Z;  3CD6 1;  3CME Z;  4DQY B;  2JNY A;  3G71 Z;  1K73 1;  4RV9 A;  1VQ7 1;  1M1K 1;  3FQQ A;  5C4J I;  1W2B Z;  2O53 A;  3GCF A;  3GTG I;  1KD1 2;  2QA4 1;  2M48 A;  3H3V J;  2JA7 I;  3GTO I;  1VQN 1;  3BG0 B;  1X0T A;  3I56 Z;  2DE5 A;  4A3C I;  2RPR A;  4BY1 I;  2JA8 I;  1S72 Z;  1I3Q I;  1Z03 A;  1Q82 1;  3CCU Z;  4Y52 I;  2R7Z I;  1KRL A;  2LIY A;  4NB8 A;  3G71 1;  1KQS Z;  1M1K 2;  4A93 I;  1Q82 2;  1VLA A;  4A3L I;  1QVG Z;  1VQO 1;  2PMZ A;  1YUK A;  2OTJ Z;  4BBR I;  2Y0S A;  2H85 A;  4RVD A;  3J80 b;  1NUI A;  2W03 A;  1N8R 1;  5CM2 M;  4Y7N I;  2F4O A;  3CCV Z;  3NDJ A;  3GTM I;  2HU9 A;  4A3D I;  4A3F I;  2OTL Z;  1TFI A;  5IT9 b;  2OTL 1;  1K8A 1;  1ZH1 A;  3CCL 1;  2OZK A;  2O4H A;  4A3I I;  3CCS 1;  1K8A 2;  1NP6 A;  2QKD A;  5C4X I;  2VUM I;  3JAM f;  2KI7 B;  2AKL A;  3Q87 A;  2E2H I;  3S1Q I;  4E32 A;  3CCJ Z;  4NBH A;  1DL6 A;  1N8R 2;  3GTP I;  3CPW Z;  3G6E Z;  1VQM 1;  4E2Y A;  2IZ3 A;  2G2K A;  2E2J I;  4BXX I;  3EED A;  3CCE 1;  2E9H A;  3QWU A;  1ZB8 A;  2QRC B;  2I3C A;  2RBL A;  2NVQ I;  2YAD A;  2QEX 1;  3CCV 1;  5T64 A;  3OW2 Y;  1I50 I;  1VQ9 Z;  1VQ9 1;  3LUS A;  4MD8 A;  3S17 I;  2P28 A;  2K3R A;  5T67 A;  4S1T A;  1TWF I;  1KD1 1;  4X6A I;  3G4S Z;  1QVF Z;  1YIT Z;  1K73 2;  3K7A I;  5C44 I;  4E2X A;  2KPI A;  1W2B Y;  1WW9 A;  2YU9 I;  1VQ6 Z;  2NVT I;  1Y1W I;  1QVG Y;  5D1P A;  1YUA A;  1VQP Z;  1TWG I;  1VQN Z;  1YHQ 1;  3S1M I;  2GU2 A;  2RHB A;  3GTJ I;  1YHQ Z;  1RO4 A;  2JMO A;  1VQ6 1;  3FKI I;  2M6N A;  3CXC Z;  3CC4 1;  4A3B I;  2GTH A;  3HKZ A;  1Q7Y 2;  3M3Y I;  1Y1V I;  1Y1V S;  3KIH A;  1Q81 1;  4HGZ A;  2OOY B;  4A3M I;  1I6H I;  3BG1 B;  4RVF A;  3GTQ I;  2W04 A;  4MON A;  3CC7 Z;  5IT9 f;  3J7A 4;  5LL6 f;  2IZ4 A;  1KC8 2;  3VTN A;  3S1N I;  2F4M A;  2PM9 A;  1L1O C;  2OTJ 1;  3I55 1;  1YJN Z;  1NJI 2;  2GTI A;  2RIQ A;  4NBF A;  1K9M 1;  4E30 A;  3J81 b;  2DE7 A;  2JS4 A;  2PK7 A;  3NFZ A;  3I4M I;  3HOV I;  4HH4 A;  4DK1 A;  4BY7 I;  1YIT 1;  1TWA I;  3G4S 1;  1X3W A;  3CCR Z;  1S72 1;  2QLV B;  2LFU A;  4NOZ A;  2JA6 I;  4RVH A;  5AN9 F;  4DGL A;  4E33 A;  3HOY I;  1Q86 2;  4EWC A;  4E2Z A;  2NVX I;  1YI2 1;  3CPW Y;  3S14 I;  3CQZ I;  2ZAE B;  2VF1 A;  2R93 I;  3RZD I;  3VMH A;  3CC4 Z;  4QTT A;  4MD7 A;  2OOX B;  4A3G I;  4RVG A;  1QVF Y;  3CCU 1;  3S16 I;  1KQS Y;  3G6E 1;  3S15 I;  3CCQ 1;  3GTK I;  2QR1 B;  4A3E I;  1SFO I;  3TDH B;  1VQO Z;  3OW2 Z;  1RQF A;  5IP7 I;  3PO3 I;  3F3P C;  1ZB9 A;  3HOU I;  3CCR 1;  1PFT A;  4HGY A;  5C3E I;  3IF8 A;  4NBG A;  3TE5 B;  3CC2 Z;  1JJ2 Y;  3CD6 Z;  1TWH I;  3GTL I;  2DE6 A;  2EGT A;  3GTM S;  1M90 2;  3VMI A;  3S1R I;  3RZO I;  1VQ8 1;  1VQK 1;  3VMG A;  4NBD A;  1RNI A;  4E31 A;  4BBS I;  3I55 Z;  3HOX I;  4A3K I;  1P9N A;  3IFU A;  3CXC Y;  2P3Y A;  3GKQ A;  2V8K A;  2V8I A;  1USP B;  4NBC A;  4MH4 A;  3NH5 A;  1Z01 A;  2JR6 A;  2QA4 Z;  3KIF A;  2QRD B;  4XX2 A;  1K9M 2;  3CCS Z;  4NBB A;  1M90 1;  2V8J A;  2QRE B;  3PO2 I;  3CCE Z;  1NJI 1;  3CCL Z;  5D1O B;  4NFR A;  2Q51 A;  1KC8 1;  5FLM I;  4E2W A;  3MON A;  3HOW I;  3J81 f;  1VQ5 1;  3I4N I;  2WB1 A;  1Z02 A;  3NDI A;  3CCJ 1;  3CMA 1;  1S7M A;  1VQK Z;  2R6M A;  1RLY A;  3EER A;  1VQP 1;  2RT9 A;  1Q81 2;  1WCM I;  1VQ4 Z;  4NB9 A;  1ML8 A;  5A2Q b;  3S2H I;  5D1O A;  2JA5 I;  1QYP A;  3P5J B;  4RS4 A;  1YJW 1;  1RO0 A;  3CCM 1;  1VQL 1;  1X3Z A;  1YIJ 1;  5A2Q f;  1USP A;  1N2F A;  2E2I I;  1JJ2 Z;  3F3F C;  1VQ5 Z;  3HOZ I;  3MZL B;  1Q86 1;  1LQL A;  2J6A A;  2QEX Z;  5FLX b;  4A3J I;  1JWH C;  3CCM Z;  1VQL Z;  5IP9 I;  1YJW Z;  3CME 1;  2B63 I;  1K83 I;  3IX0 A;  1YIJ Z;  3U50 C;  4NBA A;  5FLX f;  2R92 I;  4QTU A;  3PO3 S;  4MD9 A;  3I07 A;  1TWC I;  1VQM Z;  3H0G I;  4NBE A;  2K5R A;  3JAM b;  3CCQ Z;  3D6W A;  2WAQ A;  3CMA Z;  3CC7 1;  3I56 1;  4NH1 C;  4CL1 A;  1WII A;  3ESW A;  3CC2 1;  3NH8 A;  1YJ9 Z;  3D9X A;  4MXU A;  3T4N B;  1R9T I;  1VQ8 Z;  1VQ7 Z;  4MRI A;  2NVY I;  1YJ9 1;  3NH4 A;  1Q7Y 1;  2VUG A;  2Q4Z A;  4TNU A;  1VQ4 1;  3J80 f;  2HF1 A;  3S2D I;  1RO2 A;  3M4O I;  3VB9 A;  3MZK B;  5T6B A;  1QF8 A;  1YJN 1;  3FQM A;  2BJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...