3KIFA

The crystal structures of two fragments truncated from 5-bladed beta-propeller lectin, tachylectin-2 (lib1-b7-18 and lib2-d2-15)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
93
structure length
93
Chain Sequence
b'DSDNWMGRAKEIGNGGWDQFQFLFFDPNGYLYAVSNDKLYKASPPQSDTDNWIARATEIGSGGWSGFKFLFFHPNGYLYAVRGQRFYKALPPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-bladed beta-propeller lectin
publication title Metamorphic proteins mediate evolutionary transitions of structure
pubmed doi rcsb
source organism Synthetic construct
molecule tags Sugar binding protein
total genus 11
structure length 93
sequence length 93
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2009-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.650 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3kifA00
3KIHA 3KIFA
chains in the Genus database with same CATH superfamily
2R93I 1X0TA 1K8A1 1VLAA 3D2LA 2JIRA 1YUAA 3VMGA 5AN9F 1P9NA 3S17I 1NUIA 2Y0SA 2DE7A 2OZKA 4A3KI 4A3GI 5D1PA 2KI7B 5FLMI 1Q7Y2 1TWHI 3IF8A 2RIQA 3GCFA 1QVFZ 1L1OC 4E2WA 2GTHA 3M4OI 3F3PC 1KQSZ 4NBCA 2IZ4A 3KIHA 1JJ2Y 4RVFA 3CCRZ 3S1RI 1RO4A 2YADA 2VUMI 3S1MI 3CME1 4MD9A 3NFZA 2E9HA 2K5RA 3J80b 4HH4A 2M48A 1N8R1 4A93I 2JR6A 2R92I 2WAQA 2QLVB 3IFUA 4BY1I 1RQFA 5C4XI 1I3QI 1VQ61 1VQPZ 2E2JI 3NH4A 4Y52I 3G71Z 3I56Z 3D6WA 3LUSA 3G4S1 3GTPI 1I6HI 3GTLI 5C4JI 1S721 3S1QI 3FQMA 3OW2Z 2RHBA 2QA41 2W03A 3GTGI 5T64A 2E2HI 2F4OA 1VQLZ 2JA5I 5IT9b 3GTOI 1RNIA 3HOWI 2J6AA 2ZAEB 2NVQI 2QEXZ 2VPWA 1FDIA 1VQ41 1WJ2A 3ESWA 2OTLZ 3GTMS 3IX0A 2JIQA 4HGYA 4E30A 4NBEA 5FLXb 3CCS1 1K8A2 3K7AI 3KIFA 1W2BZ 2Q4ZA 4A3FI 3HOYI 1Y8CA 1QVGY 3T4NB 4RV9A 3HOVI 1YJ91 3RZOI 4EWCA 1YJN1 1QYPA 4NB9A 3CXCZ 3CCM1 4BXXI 4E2XA 1YIT1 1YI2Z 1M1K1 1TFIA 2VPZA 1YIJ1 3CD61 2BJOA 1NJI1 3S15I 2PMZA 1VQ71 2KPIA 4NBFA 3EEDA 3GKQA 3J81f 1WZNA 3CC71 2VPXA 2QA4Z 2IZ3A 3CC4Z 5LL6f 3NH5A 3CC21 4E2ZA 4A3BI 4QTUA 3CCE1 4NBBA 2PM9A 4E33A 1N8R2 2DE6A 2OTJ1 3CMAZ 4A3EI 1VQNZ 1SIWA 1KRLA 3GTKI 1YJW1 4Y7NI 1PFTA 5CM2M 4NB8A 2JA8I 4NBDA 2P28A 1YHQZ 3Q87A 3S2HI 2RPRA 3EERA 3HOUI 1Y1VI 2G2KA 1NP6A 4A3CI 3VTNA 1VQ91 4MD8A 3GTQI 3J81b 4A3JI 3M3YI 2VPYA 2V45A 4BY7I 1VQO1 3HOZI 1YJNZ 4MH4A 3G6E1 1VQ81 3TDHB 4RVHA 3I4MI 3FQQA 2NAPA 1YIJZ 1QF8A 1R9TI 1VQ51 3NDJA 2Q51A 2GU2A 1X3ZA 1WIIA 2HU9A 3U50C 4A3LI 3H3VJ 1QVFY 1DL6A 3I55Z 4DGLA 1Q861 2JNYA 3IR7A 3I4NI 2F4MA 3CCJ1 2NVTI 4X6AI 3CCV1 3S14I 2AYDA 1VQM1 4NBGA 1M901 2QKDA 1Q821 3CC2Z 1KQSY 1M1K2 1LQLA 3CCQ1 4MD7A 1NJI2 5C3EI 1KC81 4A3DI 3CPWZ 2DE5A 3NDIA 2W04A 3MONA 4DK1A 5IP9I 3BG0B 1VQK1 2O53A 4NOZA 3CCL1 1TWAI 3NH8A 3JAMf 3CMEZ 2P3YA 3OW2Y 1Z03A 2V8IA 4MRIA 2RT9A 3F3FC 2AKLA 2E2II 4AYBA 2I3CA 4E31A 1KD11 3RZDI 1VQ6Z 2JS4A 2NVYI 3PO3I 1Q811 4QTTA 3GTJI 2QRDB 1ML8A 5T67A 3VMIA 2VF1A 1Y1VS 3G4SZ 1K9M1 1S72Z 1QXFA 3S2DI 2K3RA 1Q16A 4E2YA 1W2BY 1TWFI 4E32A 3BG1B 2QRCB 4NH1C 1JJ2Z 5C44I 4S1TA 1VQP1 1VQ4Z 3G711 3I561 1Z01A 2OOYB 2QREB 4NBHA 3CXCY 1Q862 1USPB 1AA6A 1K731 3CCSZ 1M902 2JIMA 2OOXB 3J80f 1VQL1 1Q822 1WW9A 1VQKZ 3MZKB 3CCLZ 2QEX1 1YJ9Z 3CQZI 4BBSI 2VUGA 2OTL1 3S1NI 3CCMZ 3QWUA 1YITZ 1KC82 4A3MI 3CCU1 2LFUA 3H0GI 1JWHC 3PO2I 3CD6Z 1ZB8A 2QR1B 4DQYB 4HGZA 4MXUA 1ZH1A 1RO0A 3I07A 2YU9I 1VQ7Z 1I50I 4BBRI 5IT9f 4CL1A 3CC7Z 2R6MA 1YI21 4TNUA 4RVGA 1Q7Y1 1TWCI 3CCEZ 2HF1A 3D9XA 5FLXf 2IV2X 2OTJZ 4RVDA 1RLYA 5A2Qf 1USPA 2V3VA 1KD12 1QVGZ 2WB1A 5D1OB 2JUBA 1YJWZ 1Q812 2PK7A 2E7ZA 1K9M2 1Y1WI 3PO3S 3CC41 2EGTA 4XX2A 3MZLB 1VQ9Z 3FKII 4MONA 2NVXI 2JA6I 3CMA1 1VQN1 2R7ZI 2V8JA 4A3II 1FDOA 4NFRA 1SFOI 1VQOZ 1ZB9A 3G6EZ 1VQ8Z 2B63I 3S16I 1WCMI 3CCUZ 1YHQ1 2JMOA 1RO2A 5A2Qb 5T6BA 3HOXI 4NBAA 1K732 4RS4A 1VQ5Z 1S7MA 3VB9A 3CCR1 2JIPA 3HKZA 2LIYA 3TE5B 3CCJZ 3CPWY 2V8KA 1Z02A 2H85A 3CCVZ 2RBLA 1VQMZ 1N2FA 2JIOA 1K83I 2LEXA 2O4HA 3J7A4 2GTIA 3GTMI 1X3WA 5D1OA 5IP7I 1YUKA 3VMHA 2JA7I 3JAMb 2M6NA 3CCQZ 3P5JB 1TWGI 3I551
chains in the Genus database with same CATH topology
2R93I 1X0TA 1K8A1 1VLAA 1YUAA 3VMGA 5AN9F 1P9NA 3S17I 1NUIA 2Y0SA 2DE7A 2OZKA 4A3KI 4A3GI 5D1PA 2KI7B 5FLMI 1Q7Y2 1TWHI 3IF8A 2RIQA 3GCFA 1QVFZ 1L1OC 4E2WA 2GTHA 3M4OI 3F3PC 1KQSZ 4NBCA 2IZ4A 3KIHA 1JJ2Y 4RVFA 3CCRZ 3S1RI 1RO4A 2YADA 2VUMI 3S1MI 3CME1 4MD9A 3NFZA 2E9HA 2K5RA 3J80b 4HH4A 2M48A 1N8R1 4A93I 2JR6A 2R92I 2WAQA 2QLVB 3IFUA 4BY1I 1RQFA 5C4XI 1I3QI 1VQ61 1VQPZ 2E2JI 3NH4A 4Y52I 3G71Z 3I56Z 3D6WA 3LUSA 3G4S1 3GTPI 1I6HI 3GTLI 5C4JI 1S721 3S1QI 3FQMA 3OW2Z 2RHBA 2QA41 2W03A 3GTGI 5T64A 2E2HI 2F4OA 1VQLZ 2JA5I 5IT9b 3GTOI 1RNIA 3HOWI 2J6AA 2ZAEB 2NVQI 2QEXZ 1VQ41 3ESWA 2OTLZ 3GTMS 3IX0A 4HGYA 4E30A 4NBEA 5FLXb 3CCS1 1K8A2 3K7AI 3KIFA 1W2BZ 2Q4ZA 4A3FI 3HOYI 1QVGY 3T4NB 4RV9A 3HOVI 1YJ91 3RZOI 4EWCA 1YJN1 1QYPA 4NB9A 3CXCZ 3CCM1 4BXXI 4E2XA 1YIT1 1YI2Z 1M1K1 1TFIA 1YIJ1 3CD61 2BJOA 1NJI1 3S15I 2PMZA 1VQ71 2KPIA 4NBFA 3EEDA 3GKQA 3J81f 3CC71 2QA4Z 2IZ3A 3CC4Z 5LL6f 3NH5A 3CC21 4E2ZA 4A3BI 4QTUA 3CCE1 4NBBA 2PM9A 4E33A 1N8R2 2DE6A 2OTJ1 3CMAZ 4A3EI 1VQNZ 1KRLA 3GTKI 1YJW1 4Y7NI 1PFTA 5CM2M 4NB8A 2JA8I 4NBDA 2P28A 1YHQZ 3Q87A 3S2HI 2RPRA 3EERA 3HOUI 1Y1VI 2G2KA 1NP6A 4A3CI 3VTNA 1VQ91 4MD8A 3GTQI 3J81b 4A3JI 3M3YI 4BY7I 1VQO1 3HOZI 1YJNZ 4MH4A 3G6E1 1VQ81 3TDHB 4RVHA 3I4MI 3FQQA 1YIJZ 1QF8A 1R9TI 1VQ51 3NDJA 2Q51A 2GU2A 1X3ZA 1WIIA 2HU9A 3U50C 4A3LI 3H3VJ 1QVFY 1DL6A 3I55Z 4DGLA 1Q861 2JNYA 3I4NI 2F4MA 3CCJ1 2NVTI 4X6AI 3CCV1 3S14I 1VQM1 4NBGA 1M901 2QKDA 1Q821 3CC2Z 1KQSY 1M1K2 1LQLA 3CCQ1 4MD7A 1NJI2 5C3EI 1KC81 4A3DI 3CPWZ 2DE5A 3NDIA 2W04A 3MONA 4DK1A 5IP9I 3BG0B 1VQK1 2O53A 4NOZA 3CCL1 1TWAI 3NH8A 3JAMf 3CMEZ 2P3YA 3OW2Y 1Z03A 2V8IA 4MRIA 2RT9A 3F3FC 2AKLA 2E2II 4AYBA 2I3CA 4E31A 1KD11 3RZDI 1VQ6Z 2JS4A 2NVYI 3PO3I 1Q811 4QTTA 3GTJI 2QRDB 1ML8A 5T67A 3VMIA 2VF1A 1Y1VS 3G4SZ 1K9M1 1S72Z 3S2DI 2K3RA 4E2YA 1W2BY 1TWFI 4E32A 3BG1B 2QRCB 4NH1C 1JJ2Z 5C44I 4S1TA 1VQP1 1VQ4Z 3G711 3I561 1Z01A 2OOYB 2QREB 4NBHA 3CXCY 1Q862 1USPB 1K731 3CCSZ 1M902 2OOXB 3J80f 1VQL1 1Q822 1WW9A 1VQKZ 3MZKB 3CCLZ 2QEX1 1YJ9Z 3CQZI 4BBSI 2VUGA 2OTL1 3S1NI 3CCMZ 3QWUA 1YITZ 1KC82 4A3MI 3CCU1 2LFUA 3H0GI 1JWHC 3PO2I 3CD6Z 1ZB8A 2QR1B 4DQYB 4HGZA 4MXUA 1ZH1A 1RO0A 3I07A 2YU9I 1VQ7Z 1I50I 4BBRI 5IT9f 4CL1A 3CC7Z 2R6MA 1YI21 4TNUA 4RVGA 1Q7Y1 1TWCI 3CCEZ 2HF1A 3D9XA 5FLXf 2OTJZ 4RVDA 1RLYA 5A2Qf 1USPA 1KD12 1QVGZ 2WB1A 5D1OB 2JUBA 1YJWZ 1Q812 2PK7A 1K9M2 3PO3S 1Y1WI 3CC41 2EGTA 4XX2A 3MZLB 1VQ9Z 3FKII 4MONA 2NVXI 2JA6I 3CMA1 1VQN1 2R7ZI 2V8JA 4A3II 4NFRA 1SFOI 1VQOZ 1ZB9A 3G6EZ 1VQ8Z 2B63I 3S16I 1WCMI 3CCUZ 1YHQ1 2JMOA 1RO2A 5A2Qb 5T6BA 3HOXI 4NBAA 1K732 4RS4A 1VQ5Z 1S7MA 3VB9A 3CCR1 3HKZA 2LIYA 3TE5B 3CCJZ 3CPWY 2V8KA 1Z02A 2H85A 3CCVZ 2RBLA 1VQMZ 1N2FA 1K83I 2O4HA 3J7A4 2GTIA 3GTMI 1X3WA 5D1OA 5IP7I 1YUKA 3VMHA 2JA7I 3JAMb 2M6NA 3CCQZ 3P5JB 1TWGI 3I551
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KIH A;  3KIF A; 
#chains in the Genus database with same CATH topology
 2R93 I;  1X0T A;  1K8A 1;  1VLA A;  3D2L A;  2JIR A;  1YUA A;  3VMG A;  5AN9 F;  1P9N A;  3S17 I;  1NUI A;  2Y0S A;  2DE7 A;  2OZK A;  4A3K I;  4A3G I;  5D1P A;  2KI7 B;  5FLM I;  1Q7Y 2;  1TWH I;  3IF8 A;  2RIQ A;  3GCF A;  1QVF Z;  1L1O C;  4E2W A;  2GTH A;  3M4O I;  3F3P C;  1KQS Z;  4NBC A;  2IZ4 A;  3KIH A;  1JJ2 Y;  4RVF A;  3CCR Z;  3S1R I;  1RO4 A;  2YAD A;  2VUM I;  3S1M I;  3CME 1;  4MD9 A;  3NFZ A;  2E9H A;  2K5R A;  3J80 b;  4HH4 A;  2M48 A;  1N8R 1;  4A93 I;  2JR6 A;  2R92 I;  2WAQ A;  2QLV B;  3IFU A;  4BY1 I;  1RQF A;  5C4X I;  1I3Q I;  1VQ6 1;  1VQP Z;  2E2J I;  3NH4 A;  4Y52 I;  3G71 Z;  3I56 Z;  3D6W A;  3LUS A;  3G4S 1;  3GTP I;  1I6H I;  3GTL I;  5C4J I;  1S72 1;  3S1Q I;  3FQM A;  3OW2 Z;  2RHB A;  2QA4 1;  2W03 A;  3GTG I;  5T64 A;  2E2H I;  2F4O A;  1VQL Z;  2JA5 I;  5IT9 b;  3GTO I;  1RNI A;  3HOW I;  2J6A A;  2ZAE B;  2NVQ I;  2QEX Z;  2VPW A;  1FDI A;  1VQ4 1;  1WJ2 A;  3ESW A;  2OTL Z;  3GTM S;  3IX0 A;  2JIQ A;  4HGY A;  4E30 A;  4NBE A;  5FLX b;  3CCS 1;  1K8A 2;  3K7A I;  3KIF A;  1W2B Z;  2Q4Z A;  4A3F I;  3HOY I;  1Y8C A;  1QVG Y;  3T4N B;  4RV9 A;  3HOV I;  1YJ9 1;  3RZO I;  4EWC A;  1YJN 1;  1QYP A;  4NB9 A;  3CXC Z;  3CCM 1;  4BXX I;  4E2X A;  1YIT 1;  1YI2 Z;  1M1K 1;  1TFI A;  2VPZ A;  1YIJ 1;  3CD6 1;  2BJO A;  1NJI 1;  3S15 I;  2PMZ A;  1VQ7 1;  2KPI A;  4NBF A;  3EED A;  3GKQ A;  3J81 f;  1WZN A;  3CC7 1;  2VPX A;  2QA4 Z;  2IZ3 A;  3CC4 Z;  5LL6 f;  3NH5 A;  3CC2 1;  4E2Z A;  4A3B I;  4QTU A;  3CCE 1;  4NBB A;  2PM9 A;  4E33 A;  1N8R 2;  2DE6 A;  2OTJ 1;  3CMA Z;  4A3E I;  1VQN Z;  1SIW A;  1KRL A;  3GTK I;  1YJW 1;  4Y7N I;  1PFT A;  5CM2 M;  4NB8 A;  2JA8 I;  4NBD A;  2P28 A;  1YHQ Z;  3Q87 A;  3S2H I;  2RPR A;  3EER A;  3HOU I;  1Y1V I;  2G2K A;  1NP6 A;  4A3C I;  3VTN A;  1VQ9 1;  4MD8 A;  3GTQ I;  3J81 b;  4A3J I;  3M3Y I;  2VPY A;  2V45 A;  4BY7 I;  1VQO 1;  3HOZ I;  1YJN Z;  4MH4 A;  3G6E 1;  1VQ8 1;  3TDH B;  4RVH A;  3I4M I;  3FQQ A;  2NAP A;  1YIJ Z;  1QF8 A;  1R9T I;  1VQ5 1;  3NDJ A;  2Q51 A;  2GU2 A;  1X3Z A;  1WII A;  2HU9 A;  3U50 C;  4A3L I;  3H3V J;  1QVF Y;  1DL6 A;  3I55 Z;  4DGL A;  1Q86 1;  2JNY A;  3IR7 A;  3I4N I;  2F4M A;  3CCJ 1;  2NVT I;  4X6A I;  3CCV 1;  3S14 I;  2AYD A;  1VQM 1;  4NBG A;  1M90 1;  2QKD A;  1Q82 1;  3CC2 Z;  1KQS Y;  1M1K 2;  1LQL A;  3CCQ 1;  4MD7 A;  1NJI 2;  5C3E I;  1KC8 1;  4A3D I;  3CPW Z;  2DE5 A;  3NDI A;  2W04 A;  3MON A;  4DK1 A;  5IP9 I;  3BG0 B;  1VQK 1;  2O53 A;  4NOZ A;  3CCL 1;  1TWA I;  3NH8 A;  3JAM f;  3CME Z;  2P3Y A;  3OW2 Y;  1Z03 A;  2V8I A;  4MRI A;  2RT9 A;  3F3F C;  2AKL A;  2E2I I;  4AYB A;  2I3C A;  4E31 A;  1KD1 1;  3RZD I;  1VQ6 Z;  2JS4 A;  2NVY I;  3PO3 I;  1Q81 1;  4QTT A;  3GTJ I;  2QRD B;  1ML8 A;  5T67 A;  3VMI A;  2VF1 A;  1Y1V S;  3G4S Z;  1K9M 1;  1S72 Z;  1QXF A;  3S2D I;  2K3R A;  1Q16 A;  4E2Y A;  1W2B Y;  1TWF I;  4E32 A;  3BG1 B;  2QRC B;  4NH1 C;  1JJ2 Z;  5C44 I;  4S1T A;  1VQP 1;  1VQ4 Z;  3G71 1;  3I56 1;  1Z01 A;  2OOY B;  2QRE B;  4NBH A;  3CXC Y;  1Q86 2;  1USP B;  1AA6 A;  1K73 1;  3CCS Z;  1M90 2;  2JIM A;  2OOX B;  3J80 f;  1VQL 1;  1Q82 2;  1WW9 A;  1VQK Z;  3MZK B;  3CCL Z;  2QEX 1;  1YJ9 Z;  3CQZ I;  4BBS I;  2VUG A;  2OTL 1;  3S1N I;  3CCM Z;  3QWU A;  1YIT Z;  1KC8 2;  4A3M I;  3CCU 1;  2LFU A;  3H0G I;  1JWH C;  3PO2 I;  3CD6 Z;  1ZB8 A;  2QR1 B;  4DQY B;  4HGZ A;  4MXU A;  1ZH1 A;  1RO0 A;  3I07 A;  2YU9 I;  1VQ7 Z;  1I50 I;  4BBR I;  5IT9 f;  4CL1 A;  3CC7 Z;  2R6M A;  1YI2 1;  4TNU A;  4RVG A;  1Q7Y 1;  1TWC I;  3CCE Z;  2HF1 A;  3D9X A;  5FLX f;  2IV2 X;  2OTJ Z;  4RVD A;  1RLY A;  5A2Q f;  1USP A;  2V3V A;  1KD1 2;  1QVG Z;  2WB1 A;  5D1O B;  2JUB A;  1YJW Z;  1Q81 2;  2PK7 A;  2E7Z A;  1K9M 2;  1Y1W I;  3PO3 S;  3CC4 1;  2EGT A;  4XX2 A;  3MZL B;  1VQ9 Z;  3FKI I;  4MON A;  2NVX I;  2JA6 I;  3CMA 1;  1VQN 1;  2R7Z I;  2V8J A;  4A3I I;  1FDO A;  4NFR A;  1SFO I;  1VQO Z;  1ZB9 A;  3G6E Z;  1VQ8 Z;  2B63 I;  3S16 I;  1WCM I;  3CCU Z;  1YHQ 1;  2JMO A;  1RO2 A;  5A2Q b;  5T6B A;  3HOX I;  4NBA A;  1K73 2;  4RS4 A;  1VQ5 Z;  1S7M A;  3VB9 A;  3CCR 1;  2JIP A;  3HKZ A;  2LIY A;  3TE5 B;  3CCJ Z;  3CPW Y;  2V8K A;  1Z02 A;  2H85 A;  3CCV Z;  2RBL A;  1VQM Z;  1N2F A;  2JIO A;  1K83 I;  2LEX A;  2O4H A;  3J7A 4;  2GTI A;  3GTM I;  1X3W A;  5D1O A;  5IP7 I;  1YUK A;  3VMH A;  2JA7 I;  3JAM b;  2M6N A;  3CCQ Z;  3P5J B;  1TWG I;  3I55 1; 
#chains in the Genus database with same CATH homology
 2R93 I;  1X0T A;  1K8A 1;  1VLA A;  1YUA A;  3VMG A;  5AN9 F;  1P9N A;  3S17 I;  1NUI A;  2Y0S A;  2DE7 A;  2OZK A;  4A3K I;  4A3G I;  5D1P A;  2KI7 B;  5FLM I;  1Q7Y 2;  1TWH I;  3IF8 A;  2RIQ A;  3GCF A;  1QVF Z;  1L1O C;  4E2W A;  2GTH A;  3M4O I;  3F3P C;  1KQS Z;  4NBC A;  2IZ4 A;  3KIH A;  1JJ2 Y;  4RVF A;  3CCR Z;  3S1R I;  1RO4 A;  2YAD A;  2VUM I;  3S1M I;  3CME 1;  4MD9 A;  3NFZ A;  2E9H A;  2K5R A;  3J80 b;  4HH4 A;  2M48 A;  1N8R 1;  4A93 I;  2JR6 A;  2R92 I;  2WAQ A;  2QLV B;  3IFU A;  4BY1 I;  1RQF A;  5C4X I;  1I3Q I;  1VQ6 1;  1VQP Z;  2E2J I;  3NH4 A;  4Y52 I;  3G71 Z;  3I56 Z;  3D6W A;  3LUS A;  3G4S 1;  3GTP I;  1I6H I;  3GTL I;  5C4J I;  1S72 1;  3S1Q I;  3FQM A;  3OW2 Z;  2RHB A;  2QA4 1;  2W03 A;  3GTG I;  5T64 A;  2E2H I;  2F4O A;  1VQL Z;  2JA5 I;  5IT9 b;  3GTO I;  1RNI A;  3HOW I;  2J6A A;  2ZAE B;  2NVQ I;  2QEX Z;  1VQ4 1;  3ESW A;  2OTL Z;  3GTM S;  3IX0 A;  4HGY A;  4E30 A;  4NBE A;  5FLX b;  3CCS 1;  1K8A 2;  3K7A I;  3KIF A;  1W2B Z;  2Q4Z A;  4A3F I;  3HOY I;  1QVG Y;  3T4N B;  4RV9 A;  3HOV I;  1YJ9 1;  3RZO I;  4EWC A;  1YJN 1;  1QYP A;  4NB9 A;  3CXC Z;  3CCM 1;  4BXX I;  4E2X A;  1YIT 1;  1YI2 Z;  1M1K 1;  1TFI A;  1YIJ 1;  3CD6 1;  2BJO A;  1NJI 1;  3S15 I;  2PMZ A;  1VQ7 1;  2KPI A;  4NBF A;  3EED A;  3GKQ A;  3J81 f;  3CC7 1;  2QA4 Z;  2IZ3 A;  3CC4 Z;  5LL6 f;  3NH5 A;  3CC2 1;  4E2Z A;  4A3B I;  4QTU A;  3CCE 1;  4NBB A;  2PM9 A;  4E33 A;  1N8R 2;  2DE6 A;  2OTJ 1;  3CMA Z;  4A3E I;  1VQN Z;  1KRL A;  3GTK I;  1YJW 1;  4Y7N I;  1PFT A;  5CM2 M;  4NB8 A;  2JA8 I;  4NBD A;  2P28 A;  1YHQ Z;  3Q87 A;  3S2H I;  2RPR A;  3EER A;  3HOU I;  1Y1V I;  2G2K A;  1NP6 A;  4A3C I;  3VTN A;  1VQ9 1;  4MD8 A;  3GTQ I;  3J81 b;  4A3J I;  3M3Y I;  4BY7 I;  1VQO 1;  3HOZ I;  1YJN Z;  4MH4 A;  3G6E 1;  1VQ8 1;  3TDH B;  4RVH A;  3I4M I;  3FQQ A;  1YIJ Z;  1QF8 A;  1R9T I;  1VQ5 1;  3NDJ A;  2Q51 A;  2GU2 A;  1X3Z A;  1WII A;  2HU9 A;  3U50 C;  4A3L I;  3H3V J;  1QVF Y;  1DL6 A;  3I55 Z;  4DGL A;  1Q86 1;  2JNY A;  3I4N I;  2F4M A;  3CCJ 1;  2NVT I;  4X6A I;  3CCV 1;  3S14 I;  1VQM 1;  4NBG A;  1M90 1;  2QKD A;  1Q82 1;  3CC2 Z;  1KQS Y;  1M1K 2;  1LQL A;  3CCQ 1;  4MD7 A;  1NJI 2;  5C3E I;  1KC8 1;  4A3D I;  3CPW Z;  2DE5 A;  3NDI A;  2W04 A;  3MON A;  4DK1 A;  5IP9 I;  3BG0 B;  1VQK 1;  2O53 A;  4NOZ A;  3CCL 1;  1TWA I;  3NH8 A;  3JAM f;  3CME Z;  2P3Y A;  3OW2 Y;  1Z03 A;  2V8I A;  4MRI A;  2RT9 A;  3F3F C;  2AKL A;  2E2I I;  4AYB A;  2I3C A;  4E31 A;  1KD1 1;  3RZD I;  1VQ6 Z;  2JS4 A;  2NVY I;  3PO3 I;  1Q81 1;  4QTT A;  3GTJ I;  2QRD B;  1ML8 A;  5T67 A;  3VMI A;  2VF1 A;  1Y1V S;  3G4S Z;  1K9M 1;  1S72 Z;  3S2D I;  2K3R A;  4E2Y A;  1W2B Y;  1TWF I;  4E32 A;  3BG1 B;  2QRC B;  4NH1 C;  1JJ2 Z;  5C44 I;  4S1T A;  1VQP 1;  1VQ4 Z;  3G71 1;  3I56 1;  1Z01 A;  2OOY B;  2QRE B;  4NBH A;  3CXC Y;  1Q86 2;  1USP B;  1K73 1;  3CCS Z;  1M90 2;  2OOX B;  3J80 f;  1VQL 1;  1Q82 2;  1WW9 A;  1VQK Z;  3MZK B;  3CCL Z;  2QEX 1;  1YJ9 Z;  3CQZ I;  4BBS I;  2VUG A;  2OTL 1;  3S1N I;  3CCM Z;  3QWU A;  1YIT Z;  1KC8 2;  4A3M I;  3CCU 1;  2LFU A;  3H0G I;  1JWH C;  3PO2 I;  3CD6 Z;  1ZB8 A;  2QR1 B;  4DQY B;  4HGZ A;  4MXU A;  1ZH1 A;  1RO0 A;  3I07 A;  2YU9 I;  1VQ7 Z;  1I50 I;  4BBR I;  5IT9 f;  4CL1 A;  3CC7 Z;  2R6M A;  1YI2 1;  4TNU A;  4RVG A;  1Q7Y 1;  1TWC I;  3CCE Z;  2HF1 A;  3D9X A;  5FLX f;  2OTJ Z;  4RVD A;  1RLY A;  5A2Q f;  1USP A;  1KD1 2;  1QVG Z;  2WB1 A;  5D1O B;  2JUB A;  1YJW Z;  1Q81 2;  2PK7 A;  1K9M 2;  3PO3 S;  1Y1W I;  3CC4 1;  2EGT A;  4XX2 A;  3MZL B;  1VQ9 Z;  3FKI I;  4MON A;  2NVX I;  2JA6 I;  3CMA 1;  1VQN 1;  2R7Z I;  2V8J A;  4A3I I;  4NFR A;  1SFO I;  1VQO Z;  1ZB9 A;  3G6E Z;  1VQ8 Z;  2B63 I;  3S16 I;  1WCM I;  3CCU Z;  1YHQ 1;  2JMO A;  1RO2 A;  5A2Q b;  5T6B A;  3HOX I;  4NBA A;  1K73 2;  4RS4 A;  1VQ5 Z;  1S7M A;  3VB9 A;  3CCR 1;  3HKZ A;  2LIY A;  3TE5 B;  3CCJ Z;  3CPW Y;  2V8K A;  1Z02 A;  2H85 A;  3CCV Z;  2RBL A;  1VQM Z;  1N2F A;  1K83 I;  2O4H A;  3J7A 4;  2GTI A;  3GTM I;  1X3W A;  5D1O A;  5IP7 I;  1YUK A;  3VMH A;  2JA7 I;  3JAM b;  2M6N A;  3CCQ Z;  3P5J B;  1TWG I;  3I55 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...