3KIFA

The crystal structures of two fragments truncated from 5-bladed beta-propeller lectin, tachylectin-2 (lib1-b7-18 and lib2-d2-15)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
93
structure length
93
Chain Sequence
DSDNWMGRAKEIGNGGWDQFQFLFFDPNGYLYAVSNDKLYKASPPQSDTDNWIARATEIGSGGWSGFKFLFFHPNGYLYAVRGQRFYKALPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metamorphic proteins mediate evolutionary transitions of structure
pubmed doi rcsb
source organism Synthetic construct
molecule tags Sugar binding protein
molecule keywords 5-bladed beta-propeller lectin
total genus 11
structure length 93
sequence length 93
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2009-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.650 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3kifA00
3KIFA 3KIHA
chains in the Genus database with same CATH superfamily
2QR1B 5AN9F 2P3YA 3FQQA 1K732 3IR7A 1Q7Y2 2NVTI 3RZOI 3LUSA 3K7AI 1N8R2 1RNIA 1YJN1 1YITZ 1Q822 1ML8A 1ZB8A 3CCJZ 1I50I 1YJNZ 2K3RA 1AA6A 1Y8CA 1USPB 2VPYA 5LL6f 1KC82 3HOUI 3S1QI 2O4HA 1VQM1 3S1NI 1M1K1 5IT9f 1Z02A 4BBRI 2QRDB 4RVGA 4NB8A 4E33A 1Q16A 2IV2X 2E9HA 3GTLI 3J81b 1I3QI 3CCLZ 1WW9A 4A3MI 3CCVZ 3PO2I 1JJ2Y 5A2Qb 4Y52I 2VPXA 3CCQZ 1R9TI 1Z01A 1M902 2KPIA 5C4XI 5D1OA 1VQ6Z 2JR6A 3NH8A 1QF8A 3CCMZ 4BY1I 2RBLA 3CD61 3GTMS 4NFRA 3CCM1 3VB9A 2YADA 1VQL1 4QTUA 3HKZA 1VQN1 3TE5B 3KIHA 1WJ2A 4A3DI 1S721 1VQ8Z 2JA6I 3KIFA 3CMA1 3D2LA 1YHQ1 2OTL1 1K8A1 3G4SZ 2R92I 1QYPA 2PK7A 2PMZA 2OOYB 4S1TA 2VUMI 3IF8A 2IZ4A 1KD12 1YHQZ 3CCQ1 5C3EI 1Y1VI 2JA8I 4BBSI 1TWAI 1YJW1 5IP7I 1QVFZ 2RHBA 3OW2Y 1KD11 2RPRA 1WIIA 3CPWZ 1JJ2Z 2IZ3A 3MZLB 3GTGI 1VQO1 1DL6A 2E7ZA 2JIOA 3HOYI 3ESWA 3CMEZ 2JIQA 4E31A 2F4OA 3VMHA 2LIYA 1TFIA 4BXXI 2R7ZI 4NBFA 4NBCA 1YJ91 1NJI1 1Y1VS 4RS4A 1ZH1A 2DE6A 3IX0A 1YUAA 1YJ9Z 2NVYI 2ZAEB 2Q4ZA 1YIJZ 1NJI2 1K731 1P9NA 3I561 1WCMI 2O53A 3EEDA 2HF1A 1VQ9Z 4A3CI 4MH4A 2V8JA 1K9M2 1VQMZ 2QA4Z 1S7MA 1RO2A 1VQ81 3CQZI 5IT9b 1VQ51 3GKQA 3CME1 3CXCZ 3CXCY 2QA41 4AYBA 3CCRZ 3H0GI 2HU9A 2V45A 2AYDA 1YJWZ 3S1RI 1NUIA 3JAMf 4DQYB 2V8IA 3S15I 1W2BY 4QTTA 4NBAA 4A3LI 1Q811 1RLYA 3VMGA 3CCL1 4DGLA 1VQ71 3NDIA 3OW2Z 2GU2A 3CPWY 2P28A 2K5RA 2NVQI 2QREB 5D1OB 3S14I 1VQK1 4NH1C 3CCS1 3F3PC 2Q51A 5A2Qf 3FKII 1K8A2 3QWUA 2GTHA 1K9M1 4NB9A 2R6MA 1VQKZ 1NP6A 2GTIA 3U50C 4TNUA 1X3WA 4BY7I 2QEXZ 2VPZA 2JIRA 4A3FI 4MXUA 3VMIA 4NOZA 1SIWA 1VQ7Z 1VQPZ 3D6WA 2OOXB 3CCU1 3CCJ1 1VQP1 3HOVI 1Q812 1RO0A 2OTLZ 3CCSZ 1Y1WI 1QVFY 1TWCI 5T6BA 1YI21 4A3JI 3CCR1 1K83I 2AKLA 2VUGA 2QEX1 3T4NB 2Y0SA 3G6E1 1YI2Z 2E2HI 1I6HI 4RVHA 1Z03A 3I4NI 4MD8A 3GTQI 1YIJ1 2I3CA 4XX2A 1SFOI 2NAPA 3J80b 2RIQA 2VPWA 4HGZA 2JMOA 5D1PA 2WB1A 3G71Z 1YIT1 1VQOZ 4E32A 3PO3I 2JNYA 4A3GI 3CC4Z 2E2II 1KQSY 4CL1A 5T67A 3S1MI 1LQLA 4MD7A 1M901 3CCUZ 3FQMA 3NFZA 1YUKA 3GTPI 2JA7I 1KRLA 3F3FC 4Y7NI 2WAQA 4NBDA 4NBGA 4E2WA 3CCE1 3S2HI 4RVFA 4E2XA 4NBEA 3GCFA 1Q7Y1 3MONA 1QVGY 1VQ91 2W04A 3PO3S 1QXFA 2EGTA 2PM9A 4MRIA 2NVXI 1VQ5Z 2OTJ1 3EERA 2J6AA 1N2FA 2M6NA 3S2DI 3D9XA 3M3YI 1Q862 3G6EZ 4RV9A 2RT9A 2YU9I 3P5JB 2R93I 3J81f 2DE5A 3S16I 3HOZI 3HOWI 2JUBA 4E2ZA 3JAMb 3G711 3BG0B 3CC7Z 2OZKA 1ZB9A 2M48A 5C4JI 1FDIA 4RVDA 1L1OC 1W2BZ 4HGYA 3I07A 3Q87A 2JIMA 4HH4A 1QVGZ 3CMAZ 3CC41 1TWHI 1X3ZA 3RZDI 1S72Z 4A3BI 5IP9I 3GTKI 2OTJZ 3MZKB 1WZNA 2E2JI 3CC2Z 3BG1B 3CC71 2LEXA 3J80f 2QLVB 2QRCB 2JS4A 4NBHA 3H3VJ 2F4MA 4X6AI 4MONA 4MD9A 3G4S1 1VQ4Z 2BJOA 3CD6Z 3NDJA 3NH5A 4E30A 3M4OI 1VQNZ 1PFTA 1RQFA 1USPA 2G2KA 4DK1A 1KQSZ 4EWCA 3J7A4 3CC21 1Q821 1VQ61 3I551 3GTMI 2QKDA 1N8R1 2KI7B 2H85A 2V8KA 1VQLZ 3CCV1 3I55Z 3GTJI 1M1K2 2LFUA 1VQ41 3VTNA 3TDHB 2DE7A 5FLXb 2V3VA 3GTOI 5C44I 1KC81 2B63I 4A3KI 3IFUA 5FLMI 1TWFI 3CCEZ 3S17I 1FDOA 4A3EI 3NH4A 1Q861 3I4MI 5FLXf 2JIPA 3HOXI 1RO4A 5CM2M 1JWHC 4NBBA 1VLAA 5T64A 2VF1A 4E2YA 2JA5I 1TWGI 1X0TA 2W03A 4A93I 4A3II 3I56Z
chains in the Genus database with same CATH topology
2QR1B 5AN9F 2P3YA 3FQQA 1K732 1Q7Y2 2NVTI 3RZOI 3LUSA 3K7AI 1N8R2 1RNIA 1YJN1 1YITZ 1Q822 1ML8A 1ZB8A 3CCJZ 1I50I 1YJNZ 2K3RA 1KC82 1USPB 5LL6f 3HOUI 3S1QI 2O4HA 1VQM1 3S1NI 1M1K1 5IT9f 1Z02A 4BBRI 2QRDB 4RVGA 4NB8A 4E33A 2E9HA 3GTLI 3J81b 1I3QI 3CCLZ 1WW9A 4A3MI 3CCVZ 3PO2I 1JJ2Y 5A2Qb 4Y52I 3CCQZ 1R9TI 1Z01A 1M902 2KPIA 5C4XI 5D1OA 1VQ6Z 2JR6A 3NH8A 1QF8A 3CCMZ 4BY1I 2RBLA 3CD61 3GTMS 4NFRA 3CCM1 3VB9A 2YADA 1VQL1 4QTUA 3HKZA 1VQN1 3TE5B 3KIHA 4A3DI 1S721 1VQ8Z 2JA6I 3KIFA 3CMA1 1YHQ1 2OTL1 1K8A1 3G4SZ 2R92I 1QYPA 2PK7A 2PMZA 2OOYB 4S1TA 2VUMI 3IF8A 2IZ4A 1KD12 1YHQZ 3CCQ1 5C3EI 1Y1VI 2JA8I 4BBSI 1TWAI 1YJW1 5IP7I 1QVFZ 2RHBA 3OW2Y 1KD11 2RPRA 1WIIA 3CPWZ 1JJ2Z 2IZ3A 3MZLB 3GTGI 1VQO1 1DL6A 3HOYI 3ESWA 3CMEZ 4E31A 2F4OA 3VMHA 2LIYA 1TFIA 4BXXI 2R7ZI 4NBFA 4NBCA 1YJ91 1NJI1 1Y1VS 4RS4A 1ZH1A 2DE6A 3IX0A 1YUAA 1YJ9Z 2NVYI 2ZAEB 2Q4ZA 1YIJZ 1NJI2 1K731 1P9NA 3I561 1WCMI 2O53A 3EEDA 2HF1A 1VQ9Z 4A3CI 4MH4A 2V8JA 1K9M2 1VQMZ 2QA4Z 1S7MA 1RO2A 1VQ81 3CQZI 5IT9b 1VQ51 3GKQA 3CME1 3CXCZ 3CXCY 2QA41 4AYBA 3CCRZ 3H0GI 2HU9A 1YJWZ 3S1RI 1NUIA 3JAMf 4DQYB 2V8IA 3S15I 1W2BY 4QTTA 4NBAA 4A3LI 1Q811 1RLYA 3VMGA 3CCL1 4DGLA 1VQ71 3NDIA 3OW2Z 2GU2A 3CPWY 2P28A 2K5RA 2NVQI 2QREB 5D1OB 3S14I 1VQK1 4NH1C 3CCS1 3F3PC 2Q51A 5A2Qf 3FKII 1K8A2 3QWUA 2GTHA 1K9M1 4NB9A 2R6MA 1VQKZ 1NP6A 2GTIA 3U50C 4TNUA 1X3WA 4BY7I 2QEXZ 4A3FI 4MXUA 3VMIA 4NOZA 1VQ7Z 1VQPZ 3D6WA 2OOXB 3CCU1 3CCJ1 1VQP1 3HOVI 1Q812 1RO0A 2OTLZ 3CCSZ 1Y1WI 1QVFY 1TWCI 5T6BA 1YI21 4A3JI 3CCR1 1K83I 2AKLA 2VUGA 2QEX1 3T4NB 2Y0SA 3G6E1 1YI2Z 2E2HI 1I6HI 4RVHA 1Z03A 3I4NI 4MD8A 3GTQI 1YIJ1 1SFOI 2I3CA 4XX2A 3J80b 2RIQA 4HGZA 2JMOA 5D1PA 2WB1A 3G71Z 1YIT1 1VQOZ 4E32A 3PO3I 2JNYA 4A3GI 3CC4Z 2E2II 1KQSY 4CL1A 5T67A 3S1MI 1LQLA 4MD7A 1M901 3CCUZ 3FQMA 3NFZA 1YUKA 3GTPI 2JA7I 1KRLA 3F3FC 4Y7NI 2WAQA 4NBDA 4NBGA 4E2WA 3CCE1 3S2HI 4RVFA 4E2XA 4NBEA 3GCFA 1Q7Y1 3MONA 1QVGY 1VQ91 2W04A 3PO3S 2EGTA 2PM9A 4MRIA 2NVXI 1VQ5Z 2OTJ1 3EERA 2J6AA 1N2FA 2M6NA 3S2DI 3D9XA 3M3YI 1Q862 3G6EZ 4RV9A 2RT9A 2YU9I 3P5JB 2R93I 3J81f 2DE5A 3S16I 3HOZI 3HOWI 2JUBA 4E2ZA 3JAMb 3G711 3BG0B 3CC7Z 2OZKA 1ZB9A 2M48A 5C4JI 4RVDA 1L1OC 1W2BZ 4HGYA 3I07A 3Q87A 4HH4A 1QVGZ 3CMAZ 3CC41 1TWHI 1X3ZA 3RZDI 1S72Z 4A3BI 5IP9I 3GTKI 2OTJZ 3MZKB 2E2JI 3CC2Z 3BG1B 3CC71 3J80f 2QLVB 2QRCB 2JS4A 4NBHA 3H3VJ 2F4MA 4X6AI 4MONA 4MD9A 3G4S1 1VQ4Z 2BJOA 3CD6Z 3NDJA 3NH5A 4E30A 3M4OI 1VQNZ 1PFTA 1RQFA 1USPA 2G2KA 4DK1A 1KQSZ 4EWCA 3J7A4 3CC21 1Q821 1VQ61 3I551 3GTMI 2QKDA 1N8R1 2KI7B 2H85A 2V8KA 1VQLZ 3CCV1 3I55Z 3GTJI 1M1K2 2LFUA 1VQ41 3VTNA 3TDHB 2DE7A 5FLXb 3GTOI 5C44I 1KC81 2B63I 4A3KI 3IFUA 5FLMI 1TWFI 3CCEZ 3S17I 4A3EI 3NH4A 1Q861 3I4MI 5FLXf 3HOXI 1RO4A 5CM2M 1JWHC 4NBBA 1VLAA 5T64A 2VF1A 4E2YA 2JA5I 1TWGI 1X0TA 2W03A 4A93I 4A3II 3I56Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KIF A;  3KIH A; 
#chains in the Genus database with same CATH topology
 2QR1 B;  5AN9 F;  2P3Y A;  3FQQ A;  1K73 2;  3IR7 A;  1Q7Y 2;  2NVT I;  3RZO I;  3LUS A;  3K7A I;  1N8R 2;  1RNI A;  1YJN 1;  1YIT Z;  1Q82 2;  1ML8 A;  1ZB8 A;  3CCJ Z;  1I50 I;  1YJN Z;  2K3R A;  1AA6 A;  1Y8C A;  1USP B;  2VPY A;  5LL6 f;  1KC8 2;  3HOU I;  3S1Q I;  2O4H A;  1VQM 1;  3S1N I;  1M1K 1;  5IT9 f;  1Z02 A;  4BBR I;  2QRD B;  4RVG A;  4NB8 A;  4E33 A;  1Q16 A;  2IV2 X;  2E9H A;  3GTL I;  3J81 b;  1I3Q I;  3CCL Z;  1WW9 A;  4A3M I;  3CCV Z;  3PO2 I;  1JJ2 Y;  5A2Q b;  4Y52 I;  2VPX A;  3CCQ Z;  1R9T I;  1Z01 A;  1M90 2;  2KPI A;  5C4X I;  5D1O A;  1VQ6 Z;  2JR6 A;  3NH8 A;  1QF8 A;  3CCM Z;  4BY1 I;  2RBL A;  3CD6 1;  3GTM S;  4NFR A;  3CCM 1;  3VB9 A;  2YAD A;  1VQL 1;  4QTU A;  3HKZ A;  1VQN 1;  3TE5 B;  3KIH A;  1WJ2 A;  4A3D I;  1S72 1;  1VQ8 Z;  2JA6 I;  3KIF A;  3CMA 1;  3D2L A;  1YHQ 1;  2OTL 1;  1K8A 1;  3G4S Z;  2R92 I;  1QYP A;  2PK7 A;  2PMZ A;  2OOY B;  4S1T A;  2VUM I;  3IF8 A;  2IZ4 A;  1KD1 2;  1YHQ Z;  3CCQ 1;  5C3E I;  1Y1V I;  2JA8 I;  4BBS I;  1TWA I;  1YJW 1;  5IP7 I;  1QVF Z;  2RHB A;  3OW2 Y;  1KD1 1;  2RPR A;  1WII A;  3CPW Z;  1JJ2 Z;  2IZ3 A;  3MZL B;  3GTG I;  1VQO 1;  1DL6 A;  2E7Z A;  2JIO A;  3HOY I;  3ESW A;  3CME Z;  2JIQ A;  4E31 A;  2F4O A;  3VMH A;  2LIY A;  1TFI A;  4BXX I;  2R7Z I;  4NBF A;  4NBC A;  1YJ9 1;  1NJI 1;  1Y1V S;  4RS4 A;  1ZH1 A;  2DE6 A;  3IX0 A;  1YUA A;  1YJ9 Z;  2NVY I;  2ZAE B;  2Q4Z A;  1YIJ Z;  1NJI 2;  1K73 1;  1P9N A;  3I56 1;  1WCM I;  2O53 A;  3EED A;  2HF1 A;  1VQ9 Z;  4A3C I;  4MH4 A;  2V8J A;  1K9M 2;  1VQM Z;  2QA4 Z;  1S7M A;  1RO2 A;  1VQ8 1;  3CQZ I;  5IT9 b;  1VQ5 1;  3GKQ A;  3CME 1;  3CXC Z;  3CXC Y;  2QA4 1;  4AYB A;  3CCR Z;  3H0G I;  2HU9 A;  2V45 A;  2AYD A;  1YJW Z;  3S1R I;  1NUI A;  3JAM f;  4DQY B;  2V8I A;  3S15 I;  1W2B Y;  4QTT A;  4NBA A;  4A3L I;  1Q81 1;  1RLY A;  3VMG A;  3CCL 1;  4DGL A;  1VQ7 1;  3NDI A;  3OW2 Z;  2GU2 A;  3CPW Y;  2P28 A;  2K5R A;  2NVQ I;  2QRE B;  5D1O B;  3S14 I;  1VQK 1;  4NH1 C;  3CCS 1;  3F3P C;  2Q51 A;  5A2Q f;  3FKI I;  1K8A 2;  3QWU A;  2GTH A;  1K9M 1;  4NB9 A;  2R6M A;  1VQK Z;  1NP6 A;  2GTI A;  3U50 C;  4TNU A;  1X3W A;  4BY7 I;  2QEX Z;  2VPZ A;  2JIR A;  4A3F I;  4MXU A;  3VMI A;  4NOZ A;  1SIW A;  1VQ7 Z;  1VQP Z;  3D6W A;  2OOX B;  3CCU 1;  3CCJ 1;  1VQP 1;  3HOV I;  1Q81 2;  1RO0 A;  2OTL Z;  3CCS Z;  1Y1W I;  1QVF Y;  1TWC I;  5T6B A;  1YI2 1;  4A3J I;  3CCR 1;  1K83 I;  2AKL A;  2VUG A;  2QEX 1;  3T4N B;  2Y0S A;  3G6E 1;  1YI2 Z;  2E2H I;  1I6H I;  4RVH A;  1Z03 A;  3I4N I;  4MD8 A;  3GTQ I;  1YIJ 1;  2I3C A;  4XX2 A;  1SFO I;  2NAP A;  3J80 b;  2RIQ A;  2VPW A;  4HGZ A;  2JMO A;  5D1P A;  2WB1 A;  3G71 Z;  1YIT 1;  1VQO Z;  4E32 A;  3PO3 I;  2JNY A;  4A3G I;  3CC4 Z;  2E2I I;  1KQS Y;  4CL1 A;  5T67 A;  3S1M I;  1LQL A;  4MD7 A;  1M90 1;  3CCU Z;  3FQM A;  3NFZ A;  1YUK A;  3GTP I;  2JA7 I;  1KRL A;  3F3F C;  4Y7N I;  2WAQ A;  4NBD A;  4NBG A;  4E2W A;  3CCE 1;  3S2H I;  4RVF A;  4E2X A;  4NBE A;  3GCF A;  1Q7Y 1;  3MON A;  1QVG Y;  1VQ9 1;  2W04 A;  3PO3 S;  1QXF A;  2EGT A;  2PM9 A;  4MRI A;  2NVX I;  1VQ5 Z;  2OTJ 1;  3EER A;  2J6A A;  1N2F A;  2M6N A;  3S2D I;  3D9X A;  3M3Y I;  1Q86 2;  3G6E Z;  4RV9 A;  2RT9 A;  2YU9 I;  3P5J B;  2R93 I;  3J81 f;  2DE5 A;  3S16 I;  3HOZ I;  3HOW I;  2JUB A;  4E2Z A;  3JAM b;  3G71 1;  3BG0 B;  3CC7 Z;  2OZK A;  1ZB9 A;  2M48 A;  5C4J I;  1FDI A;  4RVD A;  1L1O C;  1W2B Z;  4HGY A;  3I07 A;  3Q87 A;  2JIM A;  4HH4 A;  1QVG Z;  3CMA Z;  3CC4 1;  1TWH I;  1X3Z A;  3RZD I;  1S72 Z;  4A3B I;  5IP9 I;  3GTK I;  2OTJ Z;  3MZK B;  1WZN A;  2E2J I;  3CC2 Z;  3BG1 B;  3CC7 1;  2LEX A;  3J80 f;  2QLV B;  2QRC B;  2JS4 A;  4NBH A;  3H3V J;  2F4M A;  4X6A I;  4MON A;  4MD9 A;  3G4S 1;  1VQ4 Z;  2BJO A;  3CD6 Z;  3NDJ A;  3NH5 A;  4E30 A;  3M4O I;  1VQN Z;  1PFT A;  1RQF A;  1USP A;  2G2K A;  4DK1 A;  1KQS Z;  4EWC A;  3J7A 4;  3CC2 1;  1Q82 1;  1VQ6 1;  3I55 1;  3GTM I;  2QKD A;  1N8R 1;  2KI7 B;  2H85 A;  2V8K A;  1VQL Z;  3CCV 1;  3I55 Z;  3GTJ I;  1M1K 2;  2LFU A;  1VQ4 1;  3VTN A;  3TDH B;  2DE7 A;  5FLX b;  2V3V A;  3GTO I;  5C44 I;  1KC8 1;  2B63 I;  4A3K I;  3IFU A;  5FLM I;  1TWF I;  3CCE Z;  3S17 I;  1FDO A;  4A3E I;  3NH4 A;  1Q86 1;  3I4M I;  5FLX f;  2JIP A;  3HOX I;  1RO4 A;  5CM2 M;  1JWH C;  4NBB A;  1VLA A;  5T64 A;  2VF1 A;  4E2Y A;  2JA5 I;  1TWG I;  1X0T A;  2W03 A;  4A93 I;  4A3I I;  3I56 Z; 
#chains in the Genus database with same CATH homology
 2QR1 B;  5AN9 F;  2P3Y A;  3FQQ A;  1K73 2;  1Q7Y 2;  2NVT I;  3RZO I;  3LUS A;  3K7A I;  1N8R 2;  1RNI A;  1YJN 1;  1YIT Z;  1Q82 2;  1ML8 A;  1ZB8 A;  3CCJ Z;  1I50 I;  1YJN Z;  2K3R A;  1KC8 2;  1USP B;  5LL6 f;  3HOU I;  3S1Q I;  2O4H A;  1VQM 1;  3S1N I;  1M1K 1;  5IT9 f;  1Z02 A;  4BBR I;  2QRD B;  4RVG A;  4NB8 A;  4E33 A;  2E9H A;  3GTL I;  3J81 b;  1I3Q I;  3CCL Z;  1WW9 A;  4A3M I;  3CCV Z;  3PO2 I;  1JJ2 Y;  5A2Q b;  4Y52 I;  3CCQ Z;  1R9T I;  1Z01 A;  1M90 2;  2KPI A;  5C4X I;  5D1O A;  1VQ6 Z;  2JR6 A;  3NH8 A;  1QF8 A;  3CCM Z;  4BY1 I;  2RBL A;  3CD6 1;  3GTM S;  4NFR A;  3CCM 1;  3VB9 A;  2YAD A;  1VQL 1;  4QTU A;  3HKZ A;  1VQN 1;  3TE5 B;  3KIH A;  4A3D I;  1S72 1;  1VQ8 Z;  2JA6 I;  3KIF A;  3CMA 1;  1YHQ 1;  2OTL 1;  1K8A 1;  3G4S Z;  2R92 I;  1QYP A;  2PK7 A;  2PMZ A;  2OOY B;  4S1T A;  2VUM I;  3IF8 A;  2IZ4 A;  1KD1 2;  1YHQ Z;  3CCQ 1;  5C3E I;  1Y1V I;  2JA8 I;  4BBS I;  1TWA I;  1YJW 1;  5IP7 I;  1QVF Z;  2RHB A;  3OW2 Y;  1KD1 1;  2RPR A;  1WII A;  3CPW Z;  1JJ2 Z;  2IZ3 A;  3MZL B;  3GTG I;  1VQO 1;  1DL6 A;  3HOY I;  3ESW A;  3CME Z;  4E31 A;  2F4O A;  3VMH A;  2LIY A;  1TFI A;  4BXX I;  2R7Z I;  4NBF A;  4NBC A;  1YJ9 1;  1NJI 1;  1Y1V S;  4RS4 A;  1ZH1 A;  2DE6 A;  3IX0 A;  1YUA A;  1YJ9 Z;  2NVY I;  2ZAE B;  2Q4Z A;  1YIJ Z;  1NJI 2;  1K73 1;  1P9N A;  3I56 1;  1WCM I;  2O53 A;  3EED A;  2HF1 A;  1VQ9 Z;  4A3C I;  4MH4 A;  2V8J A;  1K9M 2;  1VQM Z;  2QA4 Z;  1S7M A;  1RO2 A;  1VQ8 1;  3CQZ I;  5IT9 b;  1VQ5 1;  3GKQ A;  3CME 1;  3CXC Z;  3CXC Y;  2QA4 1;  4AYB A;  3CCR Z;  3H0G I;  2HU9 A;  1YJW Z;  3S1R I;  1NUI A;  3JAM f;  4DQY B;  2V8I A;  3S15 I;  1W2B Y;  4QTT A;  4NBA A;  4A3L I;  1Q81 1;  1RLY A;  3VMG A;  3CCL 1;  4DGL A;  1VQ7 1;  3NDI A;  3OW2 Z;  2GU2 A;  3CPW Y;  2P28 A;  2K5R A;  2NVQ I;  2QRE B;  5D1O B;  3S14 I;  1VQK 1;  4NH1 C;  3CCS 1;  3F3P C;  2Q51 A;  5A2Q f;  3FKI I;  1K8A 2;  3QWU A;  2GTH A;  1K9M 1;  4NB9 A;  2R6M A;  1VQK Z;  1NP6 A;  2GTI A;  3U50 C;  4TNU A;  1X3W A;  4BY7 I;  2QEX Z;  4A3F I;  4MXU A;  3VMI A;  4NOZ A;  1VQ7 Z;  1VQP Z;  3D6W A;  2OOX B;  3CCU 1;  3CCJ 1;  1VQP 1;  3HOV I;  1Q81 2;  1RO0 A;  2OTL Z;  3CCS Z;  1Y1W I;  1QVF Y;  1TWC I;  5T6B A;  1YI2 1;  4A3J I;  3CCR 1;  1K83 I;  2AKL A;  2VUG A;  2QEX 1;  3T4N B;  2Y0S A;  3G6E 1;  1YI2 Z;  2E2H I;  1I6H I;  4RVH A;  1Z03 A;  3I4N I;  4MD8 A;  3GTQ I;  1YIJ 1;  1SFO I;  2I3C A;  4XX2 A;  3J80 b;  2RIQ A;  4HGZ A;  2JMO A;  5D1P A;  2WB1 A;  3G71 Z;  1YIT 1;  1VQO Z;  4E32 A;  3PO3 I;  2JNY A;  4A3G I;  3CC4 Z;  2E2I I;  1KQS Y;  4CL1 A;  5T67 A;  3S1M I;  1LQL A;  4MD7 A;  1M90 1;  3CCU Z;  3FQM A;  3NFZ A;  1YUK A;  3GTP I;  2JA7 I;  1KRL A;  3F3F C;  4Y7N I;  2WAQ A;  4NBD A;  4NBG A;  4E2W A;  3CCE 1;  3S2H I;  4RVF A;  4E2X A;  4NBE A;  3GCF A;  1Q7Y 1;  3MON A;  1QVG Y;  1VQ9 1;  2W04 A;  3PO3 S;  2EGT A;  2PM9 A;  4MRI A;  2NVX I;  1VQ5 Z;  2OTJ 1;  3EER A;  2J6A A;  1N2F A;  2M6N A;  3S2D I;  3D9X A;  3M3Y I;  1Q86 2;  3G6E Z;  4RV9 A;  2RT9 A;  2YU9 I;  3P5J B;  2R93 I;  3J81 f;  2DE5 A;  3S16 I;  3HOZ I;  3HOW I;  2JUB A;  4E2Z A;  3JAM b;  3G71 1;  3BG0 B;  3CC7 Z;  2OZK A;  1ZB9 A;  2M48 A;  5C4J I;  4RVD A;  1L1O C;  1W2B Z;  4HGY A;  3I07 A;  3Q87 A;  4HH4 A;  1QVG Z;  3CMA Z;  3CC4 1;  1TWH I;  1X3Z A;  3RZD I;  1S72 Z;  4A3B I;  5IP9 I;  3GTK I;  2OTJ Z;  3MZK B;  2E2J I;  3CC2 Z;  3BG1 B;  3CC7 1;  3J80 f;  2QLV B;  2QRC B;  2JS4 A;  4NBH A;  3H3V J;  2F4M A;  4X6A I;  4MON A;  4MD9 A;  3G4S 1;  1VQ4 Z;  2BJO A;  3CD6 Z;  3NDJ A;  3NH5 A;  4E30 A;  3M4O I;  1VQN Z;  1PFT A;  1RQF A;  1USP A;  2G2K A;  4DK1 A;  1KQS Z;  4EWC A;  3J7A 4;  3CC2 1;  1Q82 1;  1VQ6 1;  3I55 1;  3GTM I;  2QKD A;  1N8R 1;  2KI7 B;  2H85 A;  2V8K A;  1VQL Z;  3CCV 1;  3I55 Z;  3GTJ I;  1M1K 2;  2LFU A;  1VQ4 1;  3VTN A;  3TDH B;  2DE7 A;  5FLX b;  3GTO I;  5C44 I;  1KC8 1;  2B63 I;  4A3K I;  3IFU A;  5FLM I;  1TWF I;  3CCE Z;  3S17 I;  4A3E I;  3NH4 A;  1Q86 1;  3I4M I;  5FLX f;  3HOX I;  1RO4 A;  5CM2 M;  1JWH C;  4NBB A;  1VLA A;  5T64 A;  2VF1 A;  4E2Y A;  2JA5 I;  1TWG I;  1X0T A;  2W03 A;  4A93 I;  4A3I I;  3I56 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...