3KIFA

The crystal structures of two fragments truncated from 5-bladed beta-propeller lectin, tachylectin-2 (lib1-b7-18 and lib2-d2-15)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
93
structure length
93
Chain Sequence
DSDNWMGRAKEIGNGGWDQFQFLFFDPNGYLYAVSNDKLYKASPPQSDTDNWIARATEIGSGGWSGFKFLFFHPNGYLYAVRGQRFYKALPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-bladed beta-propeller lectin
publication title Metamorphic proteins mediate evolutionary transitions of structure
pubmed doi rcsb
source organism Synthetic construct
molecule tags Sugar binding protein
total genus 11
structure length 93
sequence length 93
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2009-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.650 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3kifA00
3KIHA 3KIFA
chains in the Genus database with same CATH superfamily
4A3KI 1W2BZ 4NH1C 3BG1B 1TFIA 1YUKA 1VQ4Z 2K3RA 4RVFA 2OTJ1 5C3EI 3CC71 3I56Z 1VQP1 1VQOZ 1QVFZ 1ZB8A 1K83I 2E7ZA 2OOYB 4HGZA 2V3VA 1VQ51 3U50C 1K9M2 4A3GI 3HOVI 1FDOA 1Z01A 4EWCA 3CC21 1NUIA 3VB9A 1YJ9Z 2NVQI 1Q811 3P5JB 2F4MA 3S2DI 5D1PA 4E2XA 3D2LA 1VQLZ 3PO3S 2IZ3A 1VQ8Z 3CMAZ 1R9TI 2RPRA 2QLVB 3S2HI 3RZOI 1Z03A 1Q862 4E30A 5IP7I 2YADA 2M48A 2OTJZ 4RVGA 3GTLI 3IX0A 3CPWZ 2QEX1 1VQPZ 3S1MI 1M902 3M3YI 1RNIA 5IT9f 5T6BA 2QREB 1YJNZ 2GU2A 1TWGI 2VUGA 1VQ5Z 2DE5A 3HOUI 4CL1A 2JNYA 1KC82 1SIWA 4NFRA 1Y1VS 1TWCI 3IFUA 3CC2Z 4NBDA 2EGTA 4MH4A 3S14I 3CCS1 3HOZI 3D6WA 1VQ91 3NDJA 3CXCZ 2W04A 1ML8A 4NBBA 2GTIA 3J81f 3H3VJ 4MD9A 3OW2Z 4NOZA 4MD8A 2QA41 3NH4A 3CCMZ 1TWAI 1K731 3IR7A 2RBLA 2RT9A 1NJI1 1VQM1 2B63I 1JJ2Z 2PK7A 2DE7A 1KQSY 2V8JA 1K8A1 2QRCB 1S7MA 1Q16A 1KD11 2OTL1 2QEXZ 1WJ2A 5IP9I 3VMGA 1QVGZ 2O53A 3CCL1 2LEXA 1YIJ1 2NVXI 2J6AA 2JMOA 4A3DI 4MD7A 4A3JI 3CCSZ 3RZDI 1VQ9Z 3JAMf 2GTHA 4A3BI 3CCQ1 1P9NA 4NB8A 3GTQI 2QA4Z 3EEDA 1YI2Z 4NBFA 5FLMI 4E33A 1Q7Y2 3CD6Z 1TWFI 1VLAA 1M1K2 2IZ4A 2JR6A 2QKDA 3J80b 3GTJI 3GTOI 3NH8A 2H85A 2VF1A 2QRDB 2JIRA 1Q822 1TWHI 1W2BY 2OTLZ 3F3FC 4HH4A 1QXFA 3NFZA 1N2FA 2E2II 1N8R1 5FLXb 1QVFY 5D1OB 2JS4A 2OOXB 3TE5B 1YIJZ 5IT9b 2YU9I 2WB1A 2AKLA 1PFTA 4E2YA 2O4HA 2JA8I 2ZAEB 1VQ61 3HOYI 2Q51A 2HU9A 4AYBA 3H0GI 3CCR1 1RQFA 5C44I 3MONA 3CC7Z 5D1OA 2VPYA 2E2HI 1VQN1 1YJW1 3PO2I 3M4OI 3CME1 3BG0B 2R7ZI 4MRIA 3T4NB 1RO4A 3I551 1Q812 1LQLA 3MZLB 2LFUA 4E32A 1AA6A 3FQMA 5LL6f 2M6NA 4A3MI 3CPWY 4MONA 2DE6A 3S1RI 3G711 1KQSZ 2Y0SA 2JUBA 3Q87A 2K5RA 3KIHA 2F4OA 2RIQA 1WW9A 1VQ6Z 2JIMA 5A2Qb 3CCRZ 3S16I 2JA7I 3VTNA 2NVYI 3VMHA 4NBAA 4RS4A 2P28A 3CXCY 1QF8A 3CMEZ 3CCV1 1Y8CA 2KPIA 1QYPA 4NBHA 2IV2X 3VMIA 3OW2Y 2JIOA 4QTTA 1K9M1 1I6HI 3MZKB 3CCU1 3I4MI 3NDIA 2BJOA 3I55Z 4Y52I 1YJ91 3QWUA 4RVHA 2V45A 1X3ZA 3NH5A 1WIIA 4BXXI 1JJ2Y 4A3LI 3EERA 1L1OC 3I07A 1K732 3S1QI 3FKII 2V8KA 2E2JI 3GTMI 1VQ81 1SFOI 1NJI2 4A3EI 3HKZA 1QVGY 1ZH1A 1VQMZ 5T67A 3KIFA 4BY7I 1RO0A 5C4JI 1RLYA 1K8A2 3G6E1 1Q861 4HGYA 1KD12 3LUSA 4QTUA 1M901 2NAPA 1I3QI 3CCVZ 1YJN1 2JIPA 4NBEA 1KRLA 1Z02A 3CCE1 3CCLZ 1KC81 1VQ71 3GTKI 3CCUZ 1VQK1 4RVDA 4TNUA 3IF8A 2VPZA 1WCMI 4MXUA 3S17I 1ZB9A 3K7AI 3D9XA 1JWHC 2LIYA 2R6MA 3ESWA 4E31A 4NBCA 2R92I 3CCJ1 3CCQZ 1FDIA 2E9HA 4A3FI 3J80f 1YUAA 3CCM1 5AN9F 3J81b 3J7A4 2V8IA 3CQZI 2JA5I 1YHQ1 1USPB 2OZKA 2PM9A 2I3CA 3G6EZ 4DQYB 4A3CI 2PMZA 4A93I 4DGLA 5FLXf 3S1NI 4A3II 2VPXA 1S721 1YIT1 1N8R2 1USPA 2RHBA 3CCEZ 1VQ7Z 2G2KA 4DK1A 1VQKZ 3G4S1 2VUMI 4S1TA 2QR1B 5CM2M 3FQQA 3CC41 3PO3I 4E2ZA 4Y7NI 2JA6I 1DL6A 1VQ41 2NVTI 4BBSI 4RV9A 3CCJZ 4E2WA 4NB9A 3I561 3GTMS 1NP6A 1VQO1 1YI21 1VQNZ 1YJWZ 3GCFA 3CD61 1X3WA 3JAMb 1Q7Y1 1RO2A 2JIQA 3HOWI 3HOXI 2HF1A 4BY1I 1M1K1 3GTGI 3S15I 1YHQZ 4X6AI 2W03A 5T64A 1X0TA 5C4XI 2Q4ZA 2R93I 2WAQA 1Y1VI 1Q821 3I4NI 1Y1WI 2P3YA 2AYDA 1S72Z 4XX2A 3F3PC 2VPWA 4NBGA 3TDHB 1YITZ 4BBRI 2KI7B 1WZNA 1VQL1 3G4SZ 1I50I 3G71Z 3GKQA 5A2Qf 3CMA1 3CC4Z 3GTPI
chains in the Genus database with same CATH topology
4A3KI 1W2BZ 4NH1C 3BG1B 1TFIA 1YUKA 1VQ4Z 2K3RA 4RVFA 2OTJ1 5C3EI 3CC71 3I56Z 1VQP1 1VQOZ 1QVFZ 1ZB8A 1K83I 2OOYB 4HGZA 1VQ51 3U50C 1K9M2 4A3GI 3HOVI 1Z01A 4EWCA 3CC21 1NUIA 3VB9A 1YJ9Z 2NVQI 1Q811 3P5JB 2F4MA 3S2DI 5D1PA 4E2XA 1VQLZ 3PO3S 2IZ3A 1VQ8Z 3CMAZ 1R9TI 2RPRA 2QLVB 3S2HI 3RZOI 1Z03A 1Q862 4E30A 5IP7I 2YADA 2M48A 2OTJZ 4RVGA 3GTLI 3IX0A 3CPWZ 2QEX1 1VQPZ 3S1MI 1M902 3M3YI 1RNIA 5IT9f 5T6BA 2QREB 1YJNZ 2GU2A 1TWGI 2VUGA 1VQ5Z 2DE5A 3HOUI 4CL1A 2JNYA 1KC82 4NFRA 1Y1VS 1TWCI 3IFUA 3CC2Z 4NBDA 2EGTA 4MH4A 3S14I 3CCS1 3HOZI 3D6WA 1VQ91 3NDJA 3CXCZ 2W04A 1ML8A 4NBBA 2GTIA 3J81f 3H3VJ 4MD9A 3OW2Z 4NOZA 4MD8A 2QA41 3NH4A 3CCMZ 1TWAI 1K731 2RBLA 2RT9A 1NJI1 1VQM1 2B63I 1JJ2Z 2PK7A 2DE7A 1KQSY 2V8JA 1K8A1 2QRCB 1S7MA 1KD11 2OTL1 2QEXZ 5IP9I 3VMGA 1QVGZ 2O53A 3CCL1 1YIJ1 2NVXI 2J6AA 2JMOA 4A3DI 4MD7A 4A3JI 3CCSZ 3RZDI 1VQ9Z 3JAMf 2GTHA 4A3BI 3CCQ1 1P9NA 4NB8A 3GTQI 2QA4Z 3EEDA 1YI2Z 4NBFA 5FLMI 4E33A 1Q7Y2 3CD6Z 1TWFI 1VLAA 1M1K2 2IZ4A 2JR6A 2QKDA 3J80b 3GTJI 3GTOI 3NH8A 2H85A 2VF1A 2QRDB 1Q822 1TWHI 1W2BY 2OTLZ 3F3FC 4HH4A 3NFZA 1N2FA 2E2II 1N8R1 5FLXb 1QVFY 5D1OB 2JS4A 2OOXB 3TE5B 1YIJZ 5IT9b 2YU9I 2WB1A 2AKLA 1PFTA 4E2YA 2O4HA 2JA8I 2ZAEB 1VQ61 3HOYI 2Q51A 2HU9A 4AYBA 3H0GI 3CCR1 1RQFA 5C44I 3MONA 3CC7Z 5D1OA 2E2HI 1VQN1 1YJW1 3PO2I 3M4OI 3CME1 3BG0B 2R7ZI 4MRIA 3T4NB 1RO4A 3I551 1Q812 1LQLA 3MZLB 2LFUA 4E32A 3FQMA 5LL6f 2M6NA 4A3MI 3CPWY 4MONA 2DE6A 3S1RI 3G711 1KQSZ 2Y0SA 2JUBA 3Q87A 2K5RA 3KIHA 2F4OA 2RIQA 1WW9A 1VQ6Z 5A2Qb 3CCRZ 3S16I 2JA7I 3VTNA 2NVYI 3VMHA 4NBAA 4RS4A 2P28A 3CXCY 1QF8A 3CMEZ 3CCV1 2KPIA 1QYPA 4NBHA 3VMIA 3OW2Y 4QTTA 1K9M1 1I6HI 3MZKB 3CCU1 3I4MI 3NDIA 2BJOA 3I55Z 4Y52I 1YJ91 3QWUA 4RVHA 1X3ZA 3NH5A 1WIIA 4BXXI 1JJ2Y 4A3LI 3EERA 1L1OC 3I07A 1K732 3S1QI 3FKII 2V8KA 2E2JI 3GTMI 1VQ81 1SFOI 1NJI2 4A3EI 3HKZA 1QVGY 1ZH1A 1VQMZ 5T67A 3KIFA 4BY7I 1RO0A 5C4JI 1RLYA 1K8A2 3G6E1 1Q861 4HGYA 1KD12 3LUSA 4QTUA 1M901 1I3QI 3CCVZ 1YJN1 4NBEA 1KRLA 1Z02A 3CCE1 3CCLZ 1KC81 1VQ71 3GTKI 3CCUZ 1VQK1 4RVDA 4TNUA 3IF8A 1WCMI 4MXUA 3S17I 1ZB9A 3K7AI 3D9XA 1JWHC 2LIYA 2R6MA 3ESWA 4E31A 4NBCA 2R92I 3CCJ1 3CCQZ 2E9HA 4A3FI 3J80f 1YUAA 3CCM1 5AN9F 3J81b 3J7A4 2V8IA 3CQZI 2JA5I 1YHQ1 1USPB 2OZKA 2PM9A 2I3CA 3G6EZ 4DQYB 4A3CI 2PMZA 4A93I 4DGLA 5FLXf 3S1NI 4A3II 1S721 1YIT1 1N8R2 1USPA 2RHBA 3CCEZ 1VQ7Z 2G2KA 4DK1A 1VQKZ 3G4S1 2VUMI 4S1TA 2QR1B 5CM2M 3FQQA 3CC41 3PO3I 4E2ZA 4Y7NI 2JA6I 1DL6A 1VQ41 2NVTI 4BBSI 4RV9A 3CCJZ 4E2WA 4NB9A 3I561 3GTMS 1NP6A 1VQO1 1YI21 1VQNZ 1YJWZ 3GCFA 3CD61 1X3WA 3JAMb 1Q7Y1 1RO2A 3HOWI 3HOXI 2HF1A 4BY1I 1M1K1 3GTGI 3S15I 1YHQZ 4X6AI 2W03A 5T64A 1X0TA 5C4XI 2Q4ZA 2R93I 2WAQA 1Y1VI 1Q821 3I4NI 1Y1WI 2P3YA 1S72Z 4XX2A 3F3PC 4NBGA 3TDHB 1YITZ 4BBRI 2KI7B 1VQL1 3G4SZ 1I50I 3G71Z 3GKQA 5A2Qf 3CMA1 3CC4Z 3GTPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KIH A;  3KIF A; 
#chains in the Genus database with same CATH topology
 4A3K I;  1W2B Z;  4NH1 C;  3BG1 B;  1TFI A;  1YUK A;  1VQ4 Z;  2K3R A;  4RVF A;  2OTJ 1;  5C3E I;  3CC7 1;  3I56 Z;  1VQP 1;  1VQO Z;  1QVF Z;  1ZB8 A;  1K83 I;  2E7Z A;  2OOY B;  4HGZ A;  2V3V A;  1VQ5 1;  3U50 C;  1K9M 2;  4A3G I;  3HOV I;  1FDO A;  1Z01 A;  4EWC A;  3CC2 1;  1NUI A;  3VB9 A;  1YJ9 Z;  2NVQ I;  1Q81 1;  3P5J B;  2F4M A;  3S2D I;  5D1P A;  4E2X A;  3D2L A;  1VQL Z;  3PO3 S;  2IZ3 A;  1VQ8 Z;  3CMA Z;  1R9T I;  2RPR A;  2QLV B;  3S2H I;  3RZO I;  1Z03 A;  1Q86 2;  4E30 A;  5IP7 I;  2YAD A;  2M48 A;  2OTJ Z;  4RVG A;  3GTL I;  3IX0 A;  3CPW Z;  2QEX 1;  1VQP Z;  3S1M I;  1M90 2;  3M3Y I;  1RNI A;  5IT9 f;  5T6B A;  2QRE B;  1YJN Z;  2GU2 A;  1TWG I;  2VUG A;  1VQ5 Z;  2DE5 A;  3HOU I;  4CL1 A;  2JNY A;  1KC8 2;  1SIW A;  4NFR A;  1Y1V S;  1TWC I;  3IFU A;  3CC2 Z;  4NBD A;  2EGT A;  4MH4 A;  3S14 I;  3CCS 1;  3HOZ I;  3D6W A;  1VQ9 1;  3NDJ A;  3CXC Z;  2W04 A;  1ML8 A;  4NBB A;  2GTI A;  3J81 f;  3H3V J;  4MD9 A;  3OW2 Z;  4NOZ A;  4MD8 A;  2QA4 1;  3NH4 A;  3CCM Z;  1TWA I;  1K73 1;  3IR7 A;  2RBL A;  2RT9 A;  1NJI 1;  1VQM 1;  2B63 I;  1JJ2 Z;  2PK7 A;  2DE7 A;  1KQS Y;  2V8J A;  1K8A 1;  2QRC B;  1S7M A;  1Q16 A;  1KD1 1;  2OTL 1;  2QEX Z;  1WJ2 A;  5IP9 I;  3VMG A;  1QVG Z;  2O53 A;  3CCL 1;  2LEX A;  1YIJ 1;  2NVX I;  2J6A A;  2JMO A;  4A3D I;  4MD7 A;  4A3J I;  3CCS Z;  3RZD I;  1VQ9 Z;  3JAM f;  2GTH A;  4A3B I;  3CCQ 1;  1P9N A;  4NB8 A;  3GTQ I;  2QA4 Z;  3EED A;  1YI2 Z;  4NBF A;  5FLM I;  4E33 A;  1Q7Y 2;  3CD6 Z;  1TWF I;  1VLA A;  1M1K 2;  2IZ4 A;  2JR6 A;  2QKD A;  3J80 b;  3GTJ I;  3GTO I;  3NH8 A;  2H85 A;  2VF1 A;  2QRD B;  2JIR A;  1Q82 2;  1TWH I;  1W2B Y;  2OTL Z;  3F3F C;  4HH4 A;  1QXF A;  3NFZ A;  1N2F A;  2E2I I;  1N8R 1;  5FLX b;  1QVF Y;  5D1O B;  2JS4 A;  2OOX B;  3TE5 B;  1YIJ Z;  5IT9 b;  2YU9 I;  2WB1 A;  2AKL A;  1PFT A;  4E2Y A;  2O4H A;  2JA8 I;  2ZAE B;  1VQ6 1;  3HOY I;  2Q51 A;  2HU9 A;  4AYB A;  3H0G I;  3CCR 1;  1RQF A;  5C44 I;  3MON A;  3CC7 Z;  5D1O A;  2VPY A;  2E2H I;  1VQN 1;  1YJW 1;  3PO2 I;  3M4O I;  3CME 1;  3BG0 B;  2R7Z I;  4MRI A;  3T4N B;  1RO4 A;  3I55 1;  1Q81 2;  1LQL A;  3MZL B;  2LFU A;  4E32 A;  1AA6 A;  3FQM A;  5LL6 f;  2M6N A;  4A3M I;  3CPW Y;  4MON A;  2DE6 A;  3S1R I;  3G71 1;  1KQS Z;  2Y0S A;  2JUB A;  3Q87 A;  2K5R A;  3KIH A;  2F4O A;  2RIQ A;  1WW9 A;  1VQ6 Z;  2JIM A;  5A2Q b;  3CCR Z;  3S16 I;  2JA7 I;  3VTN A;  2NVY I;  3VMH A;  4NBA A;  4RS4 A;  2P28 A;  3CXC Y;  1QF8 A;  3CME Z;  3CCV 1;  1Y8C A;  2KPI A;  1QYP A;  4NBH A;  2IV2 X;  3VMI A;  3OW2 Y;  2JIO A;  4QTT A;  1K9M 1;  1I6H I;  3MZK B;  3CCU 1;  3I4M I;  3NDI A;  2BJO A;  3I55 Z;  4Y52 I;  1YJ9 1;  3QWU A;  4RVH A;  2V45 A;  1X3Z A;  3NH5 A;  1WII A;  4BXX I;  1JJ2 Y;  4A3L I;  3EER A;  1L1O C;  3I07 A;  1K73 2;  3S1Q I;  3FKI I;  2V8K A;  2E2J I;  3GTM I;  1VQ8 1;  1SFO I;  1NJI 2;  4A3E I;  3HKZ A;  1QVG Y;  1ZH1 A;  1VQM Z;  5T67 A;  3KIF A;  4BY7 I;  1RO0 A;  5C4J I;  1RLY A;  1K8A 2;  3G6E 1;  1Q86 1;  4HGY A;  1KD1 2;  3LUS A;  4QTU A;  1M90 1;  2NAP A;  1I3Q I;  3CCV Z;  1YJN 1;  2JIP A;  4NBE A;  1KRL A;  1Z02 A;  3CCE 1;  3CCL Z;  1KC8 1;  1VQ7 1;  3GTK I;  3CCU Z;  1VQK 1;  4RVD A;  4TNU A;  3IF8 A;  2VPZ A;  1WCM I;  4MXU A;  3S17 I;  1ZB9 A;  3K7A I;  3D9X A;  1JWH C;  2LIY A;  2R6M A;  3ESW A;  4E31 A;  4NBC A;  2R92 I;  3CCJ 1;  3CCQ Z;  1FDI A;  2E9H A;  4A3F I;  3J80 f;  1YUA A;  3CCM 1;  5AN9 F;  3J81 b;  3J7A 4;  2V8I A;  3CQZ I;  2JA5 I;  1YHQ 1;  1USP B;  2OZK A;  2PM9 A;  2I3C A;  3G6E Z;  4DQY B;  4A3C I;  2PMZ A;  4A93 I;  4DGL A;  5FLX f;  3S1N I;  4A3I I;  2VPX A;  1S72 1;  1YIT 1;  1N8R 2;  1USP A;  2RHB A;  3CCE Z;  1VQ7 Z;  2G2K A;  4DK1 A;  1VQK Z;  3G4S 1;  2VUM I;  4S1T A;  2QR1 B;  5CM2 M;  3FQQ A;  3CC4 1;  3PO3 I;  4E2Z A;  4Y7N I;  2JA6 I;  1DL6 A;  1VQ4 1;  2NVT I;  4BBS I;  4RV9 A;  3CCJ Z;  4E2W A;  4NB9 A;  3I56 1;  3GTM S;  1NP6 A;  1VQO 1;  1YI2 1;  1VQN Z;  1YJW Z;  3GCF A;  3CD6 1;  1X3W A;  3JAM b;  1Q7Y 1;  1RO2 A;  2JIQ A;  3HOW I;  3HOX I;  2HF1 A;  4BY1 I;  1M1K 1;  3GTG I;  3S15 I;  1YHQ Z;  4X6A I;  2W03 A;  5T64 A;  1X0T A;  5C4X I;  2Q4Z A;  2R93 I;  2WAQ A;  1Y1V I;  1Q82 1;  3I4N I;  1Y1W I;  2P3Y A;  2AYD A;  1S72 Z;  4XX2 A;  3F3P C;  2VPW A;  4NBG A;  3TDH B;  1YIT Z;  4BBR I;  2KI7 B;  1WZN A;  1VQL 1;  3G4S Z;  1I50 I;  3G71 Z;  3GKQ A;  5A2Q f;  3CMA 1;  3CC4 Z;  3GTP I; 
#chains in the Genus database with same CATH homology
 4A3K I;  1W2B Z;  4NH1 C;  3BG1 B;  1TFI A;  1YUK A;  1VQ4 Z;  2K3R A;  4RVF A;  2OTJ 1;  5C3E I;  3CC7 1;  3I56 Z;  1VQP 1;  1VQO Z;  1QVF Z;  1ZB8 A;  1K83 I;  2OOY B;  4HGZ A;  1VQ5 1;  3U50 C;  1K9M 2;  4A3G I;  3HOV I;  1Z01 A;  4EWC A;  3CC2 1;  1NUI A;  3VB9 A;  1YJ9 Z;  2NVQ I;  1Q81 1;  3P5J B;  2F4M A;  3S2D I;  5D1P A;  4E2X A;  1VQL Z;  3PO3 S;  2IZ3 A;  1VQ8 Z;  3CMA Z;  1R9T I;  2RPR A;  2QLV B;  3S2H I;  3RZO I;  1Z03 A;  1Q86 2;  4E30 A;  5IP7 I;  2YAD A;  2M48 A;  2OTJ Z;  4RVG A;  3GTL I;  3IX0 A;  3CPW Z;  2QEX 1;  1VQP Z;  3S1M I;  1M90 2;  3M3Y I;  1RNI A;  5IT9 f;  5T6B A;  2QRE B;  1YJN Z;  2GU2 A;  1TWG I;  2VUG A;  1VQ5 Z;  2DE5 A;  3HOU I;  4CL1 A;  2JNY A;  1KC8 2;  4NFR A;  1Y1V S;  1TWC I;  3IFU A;  3CC2 Z;  4NBD A;  2EGT A;  4MH4 A;  3S14 I;  3CCS 1;  3HOZ I;  3D6W A;  1VQ9 1;  3NDJ A;  3CXC Z;  2W04 A;  1ML8 A;  4NBB A;  2GTI A;  3J81 f;  3H3V J;  4MD9 A;  3OW2 Z;  4NOZ A;  4MD8 A;  2QA4 1;  3NH4 A;  3CCM Z;  1TWA I;  1K73 1;  2RBL A;  2RT9 A;  1NJI 1;  1VQM 1;  2B63 I;  1JJ2 Z;  2PK7 A;  2DE7 A;  1KQS Y;  2V8J A;  1K8A 1;  2QRC B;  1S7M A;  1KD1 1;  2OTL 1;  2QEX Z;  5IP9 I;  3VMG A;  1QVG Z;  2O53 A;  3CCL 1;  1YIJ 1;  2NVX I;  2J6A A;  2JMO A;  4A3D I;  4MD7 A;  4A3J I;  3CCS Z;  3RZD I;  1VQ9 Z;  3JAM f;  2GTH A;  4A3B I;  3CCQ 1;  1P9N A;  4NB8 A;  3GTQ I;  2QA4 Z;  3EED A;  1YI2 Z;  4NBF A;  5FLM I;  4E33 A;  1Q7Y 2;  3CD6 Z;  1TWF I;  1VLA A;  1M1K 2;  2IZ4 A;  2JR6 A;  2QKD A;  3J80 b;  3GTJ I;  3GTO I;  3NH8 A;  2H85 A;  2VF1 A;  2QRD B;  1Q82 2;  1TWH I;  1W2B Y;  2OTL Z;  3F3F C;  4HH4 A;  3NFZ A;  1N2F A;  2E2I I;  1N8R 1;  5FLX b;  1QVF Y;  5D1O B;  2JS4 A;  2OOX B;  3TE5 B;  1YIJ Z;  5IT9 b;  2YU9 I;  2WB1 A;  2AKL A;  1PFT A;  4E2Y A;  2O4H A;  2JA8 I;  2ZAE B;  1VQ6 1;  3HOY I;  2Q51 A;  2HU9 A;  4AYB A;  3H0G I;  3CCR 1;  1RQF A;  5C44 I;  3MON A;  3CC7 Z;  5D1O A;  2E2H I;  1VQN 1;  1YJW 1;  3PO2 I;  3M4O I;  3CME 1;  3BG0 B;  2R7Z I;  4MRI A;  3T4N B;  1RO4 A;  3I55 1;  1Q81 2;  1LQL A;  3MZL B;  2LFU A;  4E32 A;  3FQM A;  5LL6 f;  2M6N A;  4A3M I;  3CPW Y;  4MON A;  2DE6 A;  3S1R I;  3G71 1;  1KQS Z;  2Y0S A;  2JUB A;  3Q87 A;  2K5R A;  3KIH A;  2F4O A;  2RIQ A;  1WW9 A;  1VQ6 Z;  5A2Q b;  3CCR Z;  3S16 I;  2JA7 I;  3VTN A;  2NVY I;  3VMH A;  4NBA A;  4RS4 A;  2P28 A;  3CXC Y;  1QF8 A;  3CME Z;  3CCV 1;  2KPI A;  1QYP A;  4NBH A;  3VMI A;  3OW2 Y;  4QTT A;  1K9M 1;  1I6H I;  3MZK B;  3CCU 1;  3I4M I;  3NDI A;  2BJO A;  3I55 Z;  4Y52 I;  1YJ9 1;  3QWU A;  4RVH A;  1X3Z A;  3NH5 A;  1WII A;  4BXX I;  1JJ2 Y;  4A3L I;  3EER A;  1L1O C;  3I07 A;  1K73 2;  3S1Q I;  3FKI I;  2V8K A;  2E2J I;  3GTM I;  1VQ8 1;  1SFO I;  1NJI 2;  4A3E I;  3HKZ A;  1QVG Y;  1ZH1 A;  1VQM Z;  5T67 A;  3KIF A;  4BY7 I;  1RO0 A;  5C4J I;  1RLY A;  1K8A 2;  3G6E 1;  1Q86 1;  4HGY A;  1KD1 2;  3LUS A;  4QTU A;  1M90 1;  1I3Q I;  3CCV Z;  1YJN 1;  4NBE A;  1KRL A;  1Z02 A;  3CCE 1;  3CCL Z;  1KC8 1;  1VQ7 1;  3GTK I;  3CCU Z;  1VQK 1;  4RVD A;  4TNU A;  3IF8 A;  1WCM I;  4MXU A;  3S17 I;  1ZB9 A;  3K7A I;  3D9X A;  1JWH C;  2LIY A;  2R6M A;  3ESW A;  4E31 A;  4NBC A;  2R92 I;  3CCJ 1;  3CCQ Z;  2E9H A;  4A3F I;  3J80 f;  1YUA A;  3CCM 1;  5AN9 F;  3J81 b;  3J7A 4;  2V8I A;  3CQZ I;  2JA5 I;  1YHQ 1;  1USP B;  2OZK A;  2PM9 A;  2I3C A;  3G6E Z;  4DQY B;  4A3C I;  2PMZ A;  4A93 I;  4DGL A;  5FLX f;  3S1N I;  4A3I I;  1S72 1;  1YIT 1;  1N8R 2;  1USP A;  2RHB A;  3CCE Z;  1VQ7 Z;  2G2K A;  4DK1 A;  1VQK Z;  3G4S 1;  2VUM I;  4S1T A;  2QR1 B;  5CM2 M;  3FQQ A;  3CC4 1;  3PO3 I;  4E2Z A;  4Y7N I;  2JA6 I;  1DL6 A;  1VQ4 1;  2NVT I;  4BBS I;  4RV9 A;  3CCJ Z;  4E2W A;  4NB9 A;  3I56 1;  3GTM S;  1NP6 A;  1VQO 1;  1YI2 1;  1VQN Z;  1YJW Z;  3GCF A;  3CD6 1;  1X3W A;  3JAM b;  1Q7Y 1;  1RO2 A;  3HOW I;  3HOX I;  2HF1 A;  4BY1 I;  1M1K 1;  3GTG I;  3S15 I;  1YHQ Z;  4X6A I;  2W03 A;  5T64 A;  1X0T A;  5C4X I;  2Q4Z A;  2R93 I;  2WAQ A;  1Y1V I;  1Q82 1;  3I4N I;  1Y1W I;  2P3Y A;  1S72 Z;  4XX2 A;  3F3P C;  4NBG A;  3TDH B;  1YIT Z;  4BBR I;  2KI7 B;  1VQL 1;  3G4S Z;  1I50 I;  3G71 Z;  3GKQ A;  5A2Q f;  3CMA 1;  3CC4 Z;  3GTP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...