3I551

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i55100
3CPWY 3G6E1 1W2BY 1K732 2OTLZ 1VQ41 1YJNZ 1JJ2Z 3CCJ1 3CCMZ 1QVFY 3CCQ1 1YJ91 1S721 3I55Z 1VQM1 1Q862 2OTJ1 1VQ4Z 1KC81 1Q7Y1 1Q7Y2 1KC82 3CCJZ 1VQ5Z 3CCL1 3CCVZ 1YI2Z 1Q811 1VQOZ 2OTL1 1M1K2 3CC21 1YJN1 1JJ2Y 3I56Z 1VQNZ 3OW2Z 3CCM1 1K8A1 3CCLZ 2QEXZ 3I551 2QA41 3G71Z 1K9M1 1K9M2 3CC2Z 1VQ51 3CD61 3CCV1 1YI21 1VQO1 1VQ8Z 3I561 3CC7Z 1VQN1 2QA4Z 3OW2Y 1VQ7Z 1YJWZ 3CD6Z 3G4SZ 2QEX1 1VQ9Z 1KQSZ 1Q812 3G711 3CCR1 1M901 3CMEZ 1KD11 1K8A2 1VQ81 1VQL1 3CC71 1YIJZ 1VQ6Z 1VQ71 3CCRZ 1YJW1 1KQSY 3G4S1 1VQ91 3CCUZ 3CMAZ 1VQLZ 3CC4Z 1YITZ 3CME1 3CCS1 1VQKZ 1NJI1 1NJI2 1YIJ1 1VQ61 1YHQ1 1VQPZ 1M902 1K731 3CXCZ 3CCSZ 1QVGY 3CCU1 1KD12 3CMA1 3CCEZ 3CC41 1YIT1 3G6EZ 1QVGZ 3CPWZ 1VQK1 1YHQZ 1W2BZ 1Q861 1Q821 1Q822 1N8R1 1N8R2 1VQP1 3CXCY 1QVFZ 3CCQZ 1YJ9Z 1S72Z 1M1K1 2OTJZ 1VQMZ 3CCE1
chains in the Genus database with same CATH superfamily
2JIMA 2JIRA 2DE7A 4E31A 2JUBA 5C3EI 2OTLZ 1I6HI 1YJNZ 3MZLB 1JJ2Z 1WCMI 4NBHA 3CCQ1 3JAMf 3I55Z 1RNIA 1NP6A 3TE5B 5A2Qb 1KC82 1TWFI 2AYDA 1QYPA 4NBCA 2YU9I 1YI2Z 5C44I 3VMIA 1USPB 1M1K2 3I56Z 4NBEA 1VQNZ 1Z03A 2V3VA 3OW2Z 4E2YA 3CCM1 3JAMb 3CCLZ 5CM2M 4NB8A 2VPZA 1K9M2 3CQZI 3HKZA 2JA8I 3S2HI 2K5RA 3CC7Z 4DGLA 3LUSA 1RO2A 3G4SZ 2DE5A 3G711 3CMEZ 4BBSI 3TDHB 1Z01A 1YIJZ 3D6WA 1VQ71 4A3EI 2V8KA 1VQ91 1X0TA 3HOXI 1NJI1 4MXUA 3H3VJ 4MD8A 3VMHA 2V45A 1VQ61 2OOYB 1VQPZ 1K731 3CXCZ 3CCSZ 4NH1C 3NFZA 1ZH1A 1WIIA 3M4OI 1QVGZ 3CPWZ 3NH5A 2VPYA 5T64A 2E2JI 1RQFA 1Q822 1N8R2 4RVFA 1FDIA 3CCQZ 3S2DI 4E30A 3CCE1 4EWCA 3G6E1 1TFIA 1W2BY 2QREB 2M48A 4BXXI 1K732 2P3YA 1VQ41 1QXFA 4HH4A 2QRCB 3CCMZ 1QVFY 1I3QI 1S721 1LQLA 2J6AA 1KC81 3GTQI 3FQMA 3CCJZ 2JIPA 2PMZA 3GTOI 2B63I 5C4JI 1K83I 1JJ2Y 4A93I 1P9NA 3S17I 3MONA 2PK7A 2QA41 3G71Z 1K9M1 2V8JA 3CC2Z 2F4MA 2M6NA 3CCV1 2Q4ZA 1RO0A 1X3WA 3OW2Y 4A3DI 4XX2A 1VQ7Z 3CD6Z 1VQ9Z 1KQSZ 1ZB9A 2YADA 1M901 1WW9A 4E33A 3S1RI 4NBBA 2W03A 3IFUA 1VQL1 1VQ6Z 4NFRA 3F3PC 4MD7A 3CCRZ 4BY1I 2QLVB 2NVXI 2K3RA 4MD9A 4RVHA 3GCFA 3P5JB 3VB9A 3J81f 3S14I 2WB1A 2VUMI 1YHQ1 1M902 3IR7A 3CCU1 2GTHA 2NVQI 3CCEZ 3Q87A 3CC41 3G6EZ 3J81b 1YIT1 1VQK1 4MRIA 1TWCI 4S1TA 3ESWA 4NBAA 5FLMI 4AYBA 2R7ZI 1Q821 4NBDA 2G2KA 1N8R1 2QR1B 3CXCY 3RZDI 2JA5I 3S16I 1S72Z 3RZOI 3IX0A 1QVGY 3CPWY 3NDJA 2R92I 4RVDA 5D1OA 5C4XI 4HGYA 2NVTI 3D9XA 1I50I 1YJ91 1VQM1 5IT9f 1Q7Y2 2RPRA 3T4NB 3CCL1 3CCVZ 1Q811 2E2HI 2VUGA 3J7A4 3I4NI 1K8A1 3NDIA 5FLXf 1JWHC 2F4OA 1Z02A 2JIOA 2NAPA 3QWUA 1VQ51 3MZKB 1VQO1 4NOZA 1Y1WI 1L1OC 3BG0B 4HGZA 4Y52I 5FLXb 2QEX1 4A3II 1Q812 1WJ2A 2AKLA 3HOVI 1Y8CA 4E2WA 1S7MA 3S1NI 1K8A2 1VQ81 3HOZI 4E2XA 3HOWI 1N2FA 2JA7I 2Y0SA 4DQYB 1NUIA 4A3GI 2QKDA 2V8IA 3J80f 3GTLI 1YJW1 1KQSY 3GTPI 2I3CA 4TNUA 3CCUZ 2NVYI 4NB9A 4A3LI 3HOYI 3CC4Z 3KIHA 2OOXB 1YITZ 2KPIA 3CCS1 1VQKZ 1SFOI 2W04A 3IF8A 1YUKA 3EERA 2VPWA 2R93I 3J80b 5A2Qf 5IP7I 1Q16A 4NBFA 4A3CI 2JIQA 1AA6A 4BY7I 3CMA1 3HOUI 2QRDB 1R9TI 3GTJI 1Q861 2RHBA 2IZ3A 1USPA 2ZAEB 4DK1A 1SIWA 3D2LA 2EGTA 2IV2X 1YJ9Z 2LFUA 3S15I 1VQMZ 2OZKA 4A3KI 4NBGA 4E2ZA 3F3FC 3FKII 2RT9A 2JNYA 3CCJ1 2RIQA 2WAQA 1PFTA 3K7AI 2HU9A 2OTJ1 1Q862 5D1PA 1VQ4Z 3EEDA 1Q7Y1 1X3ZA 1VQ5Z 4MONA 5AN9F 2E9HA 2GU2A 1QF8A 1VQOZ 2OTL1 1WZNA 3CC21 4A3MI 1YJN1 2HF1A 4BBRI 4A3FI 2O4HA 3GTKI 4QTTA 3I4MI 3PO3I 1ML8A 2DE6A 2IZ4A 3H0GI 4CL1A 2QEXZ 3I551 2LEXA 3S1MI 2R6MA 3VMGA 3FQQA 4A3JI 2GTIA 3CD61 1KRLA 5D1OB 1YI21 1VQ8Z 2LIYA 3I561 1VQN1 2QA4Z 3GTGI 3NH8A 1FDOA 5T67A 4E32A 1YJWZ 3S1QI 1YUAA 1Y1VI 4A3BI 3CCR1 2VPXA 3NH4A 3PO2I 1TWAI 1KD11 2Q51A 4RV9A 5IT9b 3PO3S 2VF1A 3CC71 2H85A 3G4S1 1DL6A 3M3YI 3VTNA 3CMAZ 2BJOA 5T6BA 1VQLZ 3GTMI 3CME1 3I07A 2E2II 2E7ZA 1VLAA 1NJI2 4RVGA 4Y7NI 1YIJ1 1RO4A 2JMOA 4X6AI 1Y1VS 2PM9A 4MH4A 2RBLA 1KD12 5LL6f 2JR6A 1TWHI 1YHQZ 2JA6I 1W2BZ 3GKQA 2O53A 1RLYA 4QTUA 3KIFA 3U50C 1ZB8A 3BG1B 2P28A 1VQP1 4RS4A 1QVFZ 3GTMS 1M1K1 2JS4A 5IP9I 2OTJZ 2KI7B 1TWGI
chains in the Genus database with same CATH topology
2DE7A 4E31A 2JUBA 5C3EI 2OTLZ 1I6HI 1YJNZ 3MZLB 1JJ2Z 1WCMI 4NBHA 3CCQ1 3JAMf 3I55Z 1RNIA 1NP6A 3TE5B 5A2Qb 1KC82 1TWFI 1QYPA 4NBCA 2YU9I 1YI2Z 5C44I 3VMIA 1USPB 1M1K2 3I56Z 4NBEA 1VQNZ 1Z03A 3OW2Z 4E2YA 3CCM1 3JAMb 3CCLZ 5CM2M 4NB8A 1K9M2 3CQZI 3HKZA 2JA8I 3S2HI 2K5RA 3CC7Z 4DGLA 3LUSA 1RO2A 3G4SZ 2DE5A 3G711 3CMEZ 4BBSI 3TDHB 1Z01A 1YIJZ 3D6WA 1VQ71 4A3EI 2V8KA 1VQ91 1X0TA 3HOXI 1NJI1 4MXUA 3H3VJ 4MD8A 3VMHA 1VQ61 2OOYB 1VQPZ 1K731 3CXCZ 3CCSZ 4NH1C 3NFZA 1ZH1A 1WIIA 3M4OI 1QVGZ 3CPWZ 3NH5A 5T64A 2E2JI 1RQFA 1Q822 1N8R2 4RVFA 3CCQZ 3S2DI 4E30A 3CCE1 4EWCA 3G6E1 1TFIA 1W2BY 2QREB 2M48A 4BXXI 1K732 2P3YA 1VQ41 4HH4A 2QRCB 3CCMZ 1QVFY 1I3QI 1S721 1LQLA 2J6AA 1KC81 3GTQI 3FQMA 3CCJZ 2PMZA 3GTOI 2B63I 5C4JI 1K83I 1JJ2Y 4A93I 1P9NA 3S17I 3MONA 2PK7A 2QA41 3G71Z 1K9M1 2V8JA 3CC2Z 2F4MA 2M6NA 3CCV1 2Q4ZA 1RO0A 1X3WA 3OW2Y 4A3DI 4XX2A 1VQ7Z 3CD6Z 1VQ9Z 1KQSZ 1ZB9A 2YADA 1M901 1WW9A 4E33A 3S1RI 4NBBA 2W03A 3IFUA 1VQL1 1VQ6Z 4NFRA 3F3PC 4MD7A 3CCRZ 4BY1I 2QLVB 2NVXI 2K3RA 4MD9A 4RVHA 3GCFA 3P5JB 3VB9A 3J81f 3S14I 2WB1A 2VUMI 1YHQ1 1M902 3CCU1 2GTHA 2NVQI 3CCEZ 3Q87A 3CC41 3G6EZ 3J81b 1YIT1 1VQK1 4MRIA 1TWCI 4S1TA 3ESWA 4NBAA 5FLMI 4AYBA 2R7ZI 1Q821 4NBDA 2G2KA 1N8R1 2QR1B 3CXCY 3RZDI 2JA5I 3S16I 1S72Z 3RZOI 3IX0A 1QVGY 3CPWY 3NDJA 2R92I 4RVDA 5D1OA 5C4XI 4HGYA 2NVTI 3D9XA 1I50I 1YJ91 1VQM1 5IT9f 1Q7Y2 2RPRA 3T4NB 3CCL1 3CCVZ 1Q811 2E2HI 2VUGA 3J7A4 3I4NI 1K8A1 3NDIA 5FLXf 1JWHC 2F4OA 1Z02A 3QWUA 1VQ51 3MZKB 1VQO1 4NOZA 1Y1WI 1L1OC 3BG0B 4HGZA 4Y52I 5FLXb 2QEX1 4A3II 1Q812 2AKLA 3HOVI 4E2WA 1S7MA 3S1NI 1K8A2 1VQ81 3HOZI 4E2XA 3HOWI 1N2FA 2JA7I 2Y0SA 4DQYB 1NUIA 4A3GI 2QKDA 2V8IA 3J80f 3GTLI 1YJW1 1KQSY 3GTPI 2I3CA 4TNUA 3CCUZ 2NVYI 4NB9A 4A3LI 3HOYI 3CC4Z 3KIHA 2OOXB 1YITZ 2KPIA 3CCS1 1VQKZ 1SFOI 2W04A 3IF8A 1YUKA 3EERA 2R93I 3J80b 5A2Qf 5IP7I 4NBFA 4A3CI 4BY7I 3CMA1 3HOUI 2QRDB 1R9TI 3GTJI 1Q861 2RHBA 2IZ3A 1USPA 2ZAEB 4DK1A 2EGTA 1YJ9Z 2LFUA 3S15I 1VQMZ 2OZKA 4A3KI 4NBGA 4E2ZA 3F3FC 3FKII 2RT9A 2JNYA 3CCJ1 2RIQA 2WAQA 1PFTA 3K7AI 2HU9A 2OTJ1 1Q862 5D1PA 1VQ4Z 3EEDA 1Q7Y1 1X3ZA 1VQ5Z 4MONA 5AN9F 2E9HA 2GU2A 1QF8A 1VQOZ 2OTL1 3CC21 4A3MI 1YJN1 2HF1A 4BBRI 4A3FI 2O4HA 3GTKI 4QTTA 3I4MI 3PO3I 1ML8A 2DE6A 2IZ4A 3H0GI 4CL1A 2QEXZ 3I551 3S1MI 2R6MA 3VMGA 3FQQA 4A3JI 2GTIA 3CD61 1KRLA 5D1OB 1YI21 1VQ8Z 2LIYA 3I561 1VQN1 2QA4Z 3GTGI 3NH8A 5T67A 4E32A 1YJWZ 3S1QI 1YUAA 1Y1VI 4A3BI 3CCR1 3NH4A 3PO2I 1TWAI 1KD11 2Q51A 4RV9A 5IT9b 3PO3S 2VF1A 3CC71 2H85A 3G4S1 1DL6A 3M3YI 3VTNA 3CMAZ 2BJOA 5T6BA 1VQLZ 3GTMI 3CME1 3I07A 2E2II 1NJI2 1VLAA 4RVGA 4Y7NI 1YIJ1 1RO4A 2JMOA 4X6AI 1Y1VS 2PM9A 4MH4A 2RBLA 1KD12 5LL6f 2JR6A 1TWHI 1YHQZ 2JA6I 1W2BZ 3GKQA 2O53A 1RLYA 4QTUA 3KIFA 3U50C 1ZB8A 3BG1B 2P28A 1VQP1 4RS4A 1QVFZ 3GTMS 1M1K1 2JS4A 5IP9I 2OTJZ 2KI7B 1TWGI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW Y;  3G6E 1;  1W2B Y;  1K73 2;  2OTL Z;  1VQ4 1;  1YJN Z;  1JJ2 Z;  3CCJ 1;  3CCM Z;  1QVF Y;  3CCQ 1;  1YJ9 1;  1S72 1;  3I55 Z;  1VQM 1;  1Q86 2;  2OTJ 1;  1VQ4 Z;  1KC8 1;  1Q7Y 1;  1Q7Y 2;  1KC8 2;  3CCJ Z;  1VQ5 Z;  3CCL 1;  3CCV Z;  1YI2 Z;  1Q81 1;  1VQO Z;  2OTL 1;  1M1K 2;  3CC2 1;  1YJN 1;  1JJ2 Y;  3I56 Z;  1VQN Z;  3OW2 Z;  3CCM 1;  1K8A 1;  3CCL Z;  2QEX Z;  3I55 1;  2QA4 1;  3G71 Z;  1K9M 1;  1K9M 2;  3CC2 Z;  1VQ5 1;  3CD6 1;  3CCV 1;  1YI2 1;  1VQO 1;  1VQ8 Z;  3I56 1;  3CC7 Z;  1VQN 1;  2QA4 Z;  3OW2 Y;  1VQ7 Z;  1YJW Z;  3CD6 Z;  3G4S Z;  2QEX 1;  1VQ9 Z;  1KQS Z;  1Q81 2;  3G71 1;  3CCR 1;  1M90 1;  3CME Z;  1KD1 1;  1K8A 2;  1VQ8 1;  1VQL 1;  3CC7 1;  1YIJ Z;  1VQ6 Z;  1VQ7 1;  3CCR Z;  1YJW 1;  1KQS Y;  3G4S 1;  1VQ9 1;  3CCU Z;  3CMA Z;  1VQL Z;  3CC4 Z;  1YIT Z;  3CME 1;  3CCS 1;  1VQK Z;  1NJI 1;  1NJI 2;  1YIJ 1;  1VQ6 1;  1YHQ 1;  1VQP Z;  1M90 2;  1K73 1;  3CXC Z;  3CCS Z;  1QVG Y;  3CCU 1;  1KD1 2;  3CMA 1;  3CCE Z;  3CC4 1;  1YIT 1;  3G6E Z;  1QVG Z;  3CPW Z;  1VQK 1;  1YHQ Z;  1W2B Z;  1Q86 1;  1Q82 1;  1Q82 2;  1N8R 1;  1N8R 2;  1VQP 1;  3CXC Y;  1QVF Z;  3CCQ Z;  1YJ9 Z;  1S72 Z;  1M1K 1;  2OTJ Z;  1VQM Z;  3CCE 1; 
#chains in the Genus database with same CATH topology
 2JIM A;  2JIR A;  2DE7 A;  4E31 A;  2JUB A;  5C3E I;  2OTL Z;  1I6H I;  1YJN Z;  3MZL B;  1JJ2 Z;  1WCM I;  4NBH A;  3CCQ 1;  3JAM f;  3I55 Z;  1RNI A;  1NP6 A;  3TE5 B;  5A2Q b;  1KC8 2;  1TWF I;  2AYD A;  1QYP A;  4NBC A;  2YU9 I;  1YI2 Z;  5C44 I;  3VMI A;  1USP B;  1M1K 2;  3I56 Z;  4NBE A;  1VQN Z;  1Z03 A;  2V3V A;  3OW2 Z;  4E2Y A;  3CCM 1;  3JAM b;  3CCL Z;  5CM2 M;  4NB8 A;  2VPZ A;  1K9M 2;  3CQZ I;  3HKZ A;  2JA8 I;  3S2H I;  2K5R A;  3CC7 Z;  4DGL A;  3LUS A;  1RO2 A;  3G4S Z;  2DE5 A;  3G71 1;  3CME Z;  4BBS I;  3TDH B;  1Z01 A;  1YIJ Z;  3D6W A;  1VQ7 1;  4A3E I;  2V8K A;  1VQ9 1;  1X0T A;  3HOX I;  1NJI 1;  4MXU A;  3H3V J;  4MD8 A;  3VMH A;  2V45 A;  1VQ6 1;  2OOY B;  1VQP Z;  1K73 1;  3CXC Z;  3CCS Z;  4NH1 C;  3NFZ A;  1ZH1 A;  1WII A;  3M4O I;  1QVG Z;  3CPW Z;  3NH5 A;  2VPY A;  5T64 A;  2E2J I;  1RQF A;  1Q82 2;  1N8R 2;  4RVF A;  1FDI A;  3CCQ Z;  3S2D I;  4E30 A;  3CCE 1;  4EWC A;  3G6E 1;  1TFI A;  1W2B Y;  2QRE B;  2M48 A;  4BXX I;  1K73 2;  2P3Y A;  1VQ4 1;  1QXF A;  4HH4 A;  2QRC B;  3CCM Z;  1QVF Y;  1I3Q I;  1S72 1;  1LQL A;  2J6A A;  1KC8 1;  3GTQ I;  3FQM A;  3CCJ Z;  2JIP A;  2PMZ A;  3GTO I;  2B63 I;  5C4J I;  1K83 I;  1JJ2 Y;  4A93 I;  1P9N A;  3S17 I;  3MON A;  2PK7 A;  2QA4 1;  3G71 Z;  1K9M 1;  2V8J A;  3CC2 Z;  2F4M A;  2M6N A;  3CCV 1;  2Q4Z A;  1RO0 A;  1X3W A;  3OW2 Y;  4A3D I;  4XX2 A;  1VQ7 Z;  3CD6 Z;  1VQ9 Z;  1KQS Z;  1ZB9 A;  2YAD A;  1M90 1;  1WW9 A;  4E33 A;  3S1R I;  4NBB A;  2W03 A;  3IFU A;  1VQL 1;  1VQ6 Z;  4NFR A;  3F3P C;  4MD7 A;  3CCR Z;  4BY1 I;  2QLV B;  2NVX I;  2K3R A;  4MD9 A;  4RVH A;  3GCF A;  3P5J B;  3VB9 A;  3J81 f;  3S14 I;  2WB1 A;  2VUM I;  1YHQ 1;  1M90 2;  3IR7 A;  3CCU 1;  2GTH A;  2NVQ I;  3CCE Z;  3Q87 A;  3CC4 1;  3G6E Z;  3J81 b;  1YIT 1;  1VQK 1;  4MRI A;  1TWC I;  4S1T A;  3ESW A;  4NBA A;  5FLM I;  4AYB A;  2R7Z I;  1Q82 1;  4NBD A;  2G2K A;  1N8R 1;  2QR1 B;  3CXC Y;  3RZD I;  2JA5 I;  3S16 I;  1S72 Z;  3RZO I;  3IX0 A;  1QVG Y;  3CPW Y;  3NDJ A;  2R92 I;  4RVD A;  5D1O A;  5C4X I;  4HGY A;  2NVT I;  3D9X A;  1I50 I;  1YJ9 1;  1VQM 1;  5IT9 f;  1Q7Y 2;  2RPR A;  3T4N B;  3CCL 1;  3CCV Z;  1Q81 1;  2E2H I;  2VUG A;  3J7A 4;  3I4N I;  1K8A 1;  3NDI A;  5FLX f;  1JWH C;  2F4O A;  1Z02 A;  2JIO A;  2NAP A;  3QWU A;  1VQ5 1;  3MZK B;  1VQO 1;  4NOZ A;  1Y1W I;  1L1O C;  3BG0 B;  4HGZ A;  4Y52 I;  5FLX b;  2QEX 1;  4A3I I;  1Q81 2;  1WJ2 A;  2AKL A;  3HOV I;  1Y8C A;  4E2W A;  1S7M A;  3S1N I;  1K8A 2;  1VQ8 1;  3HOZ I;  4E2X A;  3HOW I;  1N2F A;  2JA7 I;  2Y0S A;  4DQY B;  1NUI A;  4A3G I;  2QKD A;  2V8I A;  3J80 f;  3GTL I;  1YJW 1;  1KQS Y;  3GTP I;  2I3C A;  4TNU A;  3CCU Z;  2NVY I;  4NB9 A;  4A3L I;  3HOY I;  3CC4 Z;  3KIH A;  2OOX B;  1YIT Z;  2KPI A;  3CCS 1;  1VQK Z;  1SFO I;  2W04 A;  3IF8 A;  1YUK A;  3EER A;  2VPW A;  2R93 I;  3J80 b;  5A2Q f;  5IP7 I;  1Q16 A;  4NBF A;  4A3C I;  2JIQ A;  1AA6 A;  4BY7 I;  3CMA 1;  3HOU I;  2QRD B;  1R9T I;  3GTJ I;  1Q86 1;  2RHB A;  2IZ3 A;  1USP A;  2ZAE B;  4DK1 A;  1SIW A;  3D2L A;  2EGT A;  2IV2 X;  1YJ9 Z;  2LFU A;  3S15 I;  1VQM Z;  2OZK A;  4A3K I;  4NBG A;  4E2Z A;  3F3F C;  3FKI I;  2RT9 A;  2JNY A;  3CCJ 1;  2RIQ A;  2WAQ A;  1PFT A;  3K7A I;  2HU9 A;  2OTJ 1;  1Q86 2;  5D1P A;  1VQ4 Z;  3EED A;  1Q7Y 1;  1X3Z A;  1VQ5 Z;  4MON A;  5AN9 F;  2E9H A;  2GU2 A;  1QF8 A;  1VQO Z;  2OTL 1;  1WZN A;  3CC2 1;  4A3M I;  1YJN 1;  2HF1 A;  4BBR I;  4A3F I;  2O4H A;  3GTK I;  4QTT A;  3I4M I;  3PO3 I;  1ML8 A;  2DE6 A;  2IZ4 A;  3H0G I;  4CL1 A;  2QEX Z;  3I55 1;  2LEX A;  3S1M I;  2R6M A;  3VMG A;  3FQQ A;  4A3J I;  2GTI A;  3CD6 1;  1KRL A;  5D1O B;  1YI2 1;  1VQ8 Z;  2LIY A;  3I56 1;  1VQN 1;  2QA4 Z;  3GTG I;  3NH8 A;  1FDO A;  5T67 A;  4E32 A;  1YJW Z;  3S1Q I;  1YUA A;  1Y1V I;  4A3B I;  3CCR 1;  2VPX A;  3NH4 A;  3PO2 I;  1TWA I;  1KD1 1;  2Q51 A;  4RV9 A;  5IT9 b;  3PO3 S;  2VF1 A;  3CC7 1;  2H85 A;  3G4S 1;  1DL6 A;  3M3Y I;  3VTN A;  3CMA Z;  2BJO A;  5T6B A;  1VQL Z;  3GTM I;  3CME 1;  3I07 A;  2E2I I;  2E7Z A;  1VLA A;  1NJI 2;  4RVG A;  4Y7N I;  1YIJ 1;  1RO4 A;  2JMO A;  4X6A I;  1Y1V S;  2PM9 A;  4MH4 A;  2RBL A;  1KD1 2;  5LL6 f;  2JR6 A;  1TWH I;  1YHQ Z;  2JA6 I;  1W2B Z;  3GKQ A;  2O53 A;  1RLY A;  4QTU A;  3KIF A;  3U50 C;  1ZB8 A;  3BG1 B;  2P28 A;  1VQP 1;  4RS4 A;  1QVF Z;  3GTM S;  1M1K 1;  2JS4 A;  5IP9 I;  2OTJ Z;  2KI7 B;  1TWG I; 
#chains in the Genus database with same CATH homology
 2DE7 A;  4E31 A;  2JUB A;  5C3E I;  2OTL Z;  1I6H I;  1YJN Z;  3MZL B;  1JJ2 Z;  1WCM I;  4NBH A;  3CCQ 1;  3JAM f;  3I55 Z;  1RNI A;  1NP6 A;  3TE5 B;  5A2Q b;  1KC8 2;  1TWF I;  1QYP A;  4NBC A;  2YU9 I;  1YI2 Z;  5C44 I;  3VMI A;  1USP B;  1M1K 2;  3I56 Z;  4NBE A;  1VQN Z;  1Z03 A;  3OW2 Z;  4E2Y A;  3CCM 1;  3JAM b;  3CCL Z;  5CM2 M;  4NB8 A;  1K9M 2;  3CQZ I;  3HKZ A;  2JA8 I;  3S2H I;  2K5R A;  3CC7 Z;  4DGL A;  3LUS A;  1RO2 A;  3G4S Z;  2DE5 A;  3G71 1;  3CME Z;  4BBS I;  3TDH B;  1Z01 A;  1YIJ Z;  3D6W A;  1VQ7 1;  4A3E I;  2V8K A;  1VQ9 1;  1X0T A;  3HOX I;  1NJI 1;  4MXU A;  3H3V J;  4MD8 A;  3VMH A;  1VQ6 1;  2OOY B;  1VQP Z;  1K73 1;  3CXC Z;  3CCS Z;  4NH1 C;  3NFZ A;  1ZH1 A;  1WII A;  3M4O I;  1QVG Z;  3CPW Z;  3NH5 A;  5T64 A;  2E2J I;  1RQF A;  1Q82 2;  1N8R 2;  4RVF A;  3CCQ Z;  3S2D I;  4E30 A;  3CCE 1;  4EWC A;  3G6E 1;  1TFI A;  1W2B Y;  2QRE B;  2M48 A;  4BXX I;  1K73 2;  2P3Y A;  1VQ4 1;  4HH4 A;  2QRC B;  3CCM Z;  1QVF Y;  1I3Q I;  1S72 1;  1LQL A;  2J6A A;  1KC8 1;  3GTQ I;  3FQM A;  3CCJ Z;  2PMZ A;  3GTO I;  2B63 I;  5C4J I;  1K83 I;  1JJ2 Y;  4A93 I;  1P9N A;  3S17 I;  3MON A;  2PK7 A;  2QA4 1;  3G71 Z;  1K9M 1;  2V8J A;  3CC2 Z;  2F4M A;  2M6N A;  3CCV 1;  2Q4Z A;  1RO0 A;  1X3W A;  3OW2 Y;  4A3D I;  4XX2 A;  1VQ7 Z;  3CD6 Z;  1VQ9 Z;  1KQS Z;  1ZB9 A;  2YAD A;  1M90 1;  1WW9 A;  4E33 A;  3S1R I;  4NBB A;  2W03 A;  3IFU A;  1VQL 1;  1VQ6 Z;  4NFR A;  3F3P C;  4MD7 A;  3CCR Z;  4BY1 I;  2QLV B;  2NVX I;  2K3R A;  4MD9 A;  4RVH A;  3GCF A;  3P5J B;  3VB9 A;  3J81 f;  3S14 I;  2WB1 A;  2VUM I;  1YHQ 1;  1M90 2;  3CCU 1;  2GTH A;  2NVQ I;  3CCE Z;  3Q87 A;  3CC4 1;  3G6E Z;  3J81 b;  1YIT 1;  1VQK 1;  4MRI A;  1TWC I;  4S1T A;  3ESW A;  4NBA A;  5FLM I;  4AYB A;  2R7Z I;  1Q82 1;  4NBD A;  2G2K A;  1N8R 1;  2QR1 B;  3CXC Y;  3RZD I;  2JA5 I;  3S16 I;  1S72 Z;  3RZO I;  3IX0 A;  1QVG Y;  3CPW Y;  3NDJ A;  2R92 I;  4RVD A;  5D1O A;  5C4X I;  4HGY A;  2NVT I;  3D9X A;  1I50 I;  1YJ9 1;  1VQM 1;  5IT9 f;  1Q7Y 2;  2RPR A;  3T4N B;  3CCL 1;  3CCV Z;  1Q81 1;  2E2H I;  2VUG A;  3J7A 4;  3I4N I;  1K8A 1;  3NDI A;  5FLX f;  1JWH C;  2F4O A;  1Z02 A;  3QWU A;  1VQ5 1;  3MZK B;  1VQO 1;  4NOZ A;  1Y1W I;  1L1O C;  3BG0 B;  4HGZ A;  4Y52 I;  5FLX b;  2QEX 1;  4A3I I;  1Q81 2;  2AKL A;  3HOV I;  4E2W A;  1S7M A;  3S1N I;  1K8A 2;  1VQ8 1;  3HOZ I;  4E2X A;  3HOW I;  1N2F A;  2JA7 I;  2Y0S A;  4DQY B;  1NUI A;  4A3G I;  2QKD A;  2V8I A;  3J80 f;  3GTL I;  1YJW 1;  1KQS Y;  3GTP I;  2I3C A;  4TNU A;  3CCU Z;  2NVY I;  4NB9 A;  4A3L I;  3HOY I;  3CC4 Z;  3KIH A;  2OOX B;  1YIT Z;  2KPI A;  3CCS 1;  1VQK Z;  1SFO I;  2W04 A;  3IF8 A;  1YUK A;  3EER A;  2R93 I;  3J80 b;  5A2Q f;  5IP7 I;  4NBF A;  4A3C I;  4BY7 I;  3CMA 1;  3HOU I;  2QRD B;  1R9T I;  3GTJ I;  1Q86 1;  2RHB A;  2IZ3 A;  1USP A;  2ZAE B;  4DK1 A;  2EGT A;  1YJ9 Z;  2LFU A;  3S15 I;  1VQM Z;  2OZK A;  4A3K I;  4NBG A;  4E2Z A;  3F3F C;  3FKI I;  2RT9 A;  2JNY A;  3CCJ 1;  2RIQ A;  2WAQ A;  1PFT A;  3K7A I;  2HU9 A;  2OTJ 1;  1Q86 2;  5D1P A;  1VQ4 Z;  3EED A;  1Q7Y 1;  1X3Z A;  1VQ5 Z;  4MON A;  5AN9 F;  2E9H A;  2GU2 A;  1QF8 A;  1VQO Z;  2OTL 1;  3CC2 1;  4A3M I;  1YJN 1;  2HF1 A;  4BBR I;  4A3F I;  2O4H A;  3GTK I;  4QTT A;  3I4M I;  3PO3 I;  1ML8 A;  2DE6 A;  2IZ4 A;  3H0G I;  4CL1 A;  2QEX Z;  3I55 1;  3S1M I;  2R6M A;  3VMG A;  3FQQ A;  4A3J I;  2GTI A;  3CD6 1;  1KRL A;  5D1O B;  1YI2 1;  1VQ8 Z;  2LIY A;  3I56 1;  1VQN 1;  2QA4 Z;  3GTG I;  3NH8 A;  5T67 A;  4E32 A;  1YJW Z;  3S1Q I;  1YUA A;  1Y1V I;  4A3B I;  3CCR 1;  3NH4 A;  3PO2 I;  1TWA I;  1KD1 1;  2Q51 A;  4RV9 A;  5IT9 b;  3PO3 S;  2VF1 A;  3CC7 1;  2H85 A;  3G4S 1;  1DL6 A;  3M3Y I;  3VTN A;  3CMA Z;  2BJO A;  5T6B A;  1VQL Z;  3GTM I;  3CME 1;  3I07 A;  2E2I I;  1NJI 2;  1VLA A;  4RVG A;  4Y7N I;  1YIJ 1;  1RO4 A;  2JMO A;  4X6A I;  1Y1V S;  2PM9 A;  4MH4 A;  2RBL A;  1KD1 2;  5LL6 f;  2JR6 A;  1TWH I;  1YHQ Z;  2JA6 I;  1W2B Z;  3GKQ A;  2O53 A;  1RLY A;  4QTU A;  3KIF A;  3U50 C;  1ZB8 A;  3BG1 B;  2P28 A;  1VQP 1;  4RS4 A;  1QVF Z;  3GTM S;  1M1K 1;  2JS4 A;  5IP9 I;  2OTJ Z;  2KI7 B;  1TWG I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...