3I551

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i55100
3CXCZ 2QEXZ 3CME1 3CCJZ 3CCSZ 3G71Z 1KC81 1JJ2Y 1Q811 1QVFZ 1K8A1 3I55Z 3CC7Z 3CCR1 3CCMZ 1QVFY 1VQMZ 1K9M2 3G6EZ 3CC41 1VQ91 1VQKZ 1NJI1 2OTJZ 1YJN1 1Q861 3G4S1 3CC21 1VQ41 3CPWY 1VQ6Z 1VQO1 1VQLZ 3OW2Y 1YHQZ 1VQP1 1Q7Y2 1YIT1 3CMAZ 1YI2Z 1YJWZ 1KD12 1S721 1KC82 1VQ9Z 3CXCY 3CCUZ 2OTL1 3G4SZ 1YJ91 1VQ4Z 3CCQZ 3CD6Z 1K731 3CCEZ 3CCL1 3CCV1 1YITZ 3I561 2QA41 3CMEZ 1KQSZ 1VQN1 1K9M1 1M1K1 1W2BZ 1QVGZ 1N8R2 1YIJ1 1VQ51 3CCRZ 1VQ71 3CCJ1 3I56Z 2QA4Z 3CC4Z 3CCS1 1Q812 1YJNZ 3CC2Z 1K8A2 1VQOZ 1VQPZ 3I551 3CC71 1VQK1 1Q821 3CCM1 1NJI2 1M901 1VQ81 1Q862 1JJ2Z 2OTJ1 1VQ7Z 1S72Z 1VQ61 1VQL1 1KD11 1KQSY 2OTLZ 1YHQ1 1YJ9Z 1W2BY 1QVGY 3CMA1 2QEX1 3CCLZ 3CCVZ 1YI21 1YJW1 3CPWZ 3OW2Z 3G711 1VQ8Z 1VQNZ 3CCU1 1K732 3CCQ1 3CD61 1Q7Y1 3CCE1 1Q822 1YIJZ 1VQM1 1M902 1VQ5Z 3G6E1 1N8R1 1M1K2
chains in the Genus database with same CATH superfamily
4E2YA 4A3CI 1FDIA 3J80f 3NH4A 1TWAI 2VPXA 3S1MI 1ZB9A 3S15I 3MONA 2JIOA 3CC41 1FDOA 3D6WA 2QRDB 3G4S1 2IZ4A 3CC21 3GTGI 3GTKI 2JIQA 1JWHC 2P28A 1USPB 4NBCA 1Q16A 2DE5A 5D1PA 1WCMI 2OTL1 4DK1A 1TWCI 1YJ91 2VUMI 2V45A 4X6AI 5D1OA 4E2XA 4MH4A 4A3FI 4BY7I 1VQN1 3GCFA 1RO4A 1QVGZ 4MXUA 2RPRA 3MZLB 1N8R2 2WB1A 4MONA 1WIIA 1YIJ1 2H85A 3KIFA 2JR6A 2W03A 2QRCB 3I4MI 1R9TI 2I3CA 2JA6I 1RNIA 1USPA 2M6NA 5FLXf 1Q821 4QTUA 2IZ3A 1VQ7Z 3GTMS 3FQQA 1KD11 4E33A 5FLMI 3J81b 3PO3I 3TDHB 2QEX1 3CCLZ 1RO2A 3BG0B 1Z03A 1QF8A 3OW2Z 1VQ8Z 4RVGA 3HOVI 3U50C 3PO2I 2QLVB 2E7ZA 4QTTA 4A3EI 1VQ5Z 3J81f 2JNYA 3G6E1 4Y52I 3CXCZ 3CCJZ 3PO3S 4RVFA 1PFTA 4BBSI 3I55Z 2QKDA 2F4MA 2IV2X 1VQMZ 3F3FC 4MRIA 1QYPA 1VQ91 4HH4A 1VQ41 1VQ6Z 1Y1VS 2E2II 3P5JB 2LIYA 1Q7Y2 2JIMA 1S7MA 3CMAZ 3NFZA 2GTIA 1YI2Z 1AA6A 1KRLA 2PK7A 1KD12 5LL6f 2JIRA 3CCQZ 4NBHA 2VPWA 3IF8A 3CCL1 4NB8A 1YITZ 2V8JA 1KQSZ 1M1K1 2NVYI 2RT9A 2HF1A 2JA5I 2JIPA 3IFUA 1I6HI 3S14I 3LUSA 1VQ51 1ML8A 3CCRZ 2RIQA 1I50I 3CCJ1 3I56Z 2QA4Z 3D9XA 4A3KI 1YJNZ 1VQOZ 3GTOI 3S1RI 1X3ZA 1VQPZ 3I551 3FKII 2R92I 2RBLA 1Y8CA 2DE7A 1JJ2Z 5AN9F 1Z02A 5T64A 4E31A 1S72Z 2E2HI 1VQ61 4BY1I 2AYDA 1L1OC 1NP6A 2PMZA 2YADA 1QVGY 3CMA1 4E2ZA 3CCVZ 2R6MA 3BG1B 3RZDI 1YI21 4Y7NI 2NVXI 3CPWZ 1ZB8A 3QWUA 4MD8A 2Q51A 4CL1A 2V8KA 1TWHI 3CCQ1 2B63I 4XX2A 3TE5B 4BXXI 1YUKA 1Q7Y1 1M902 1M1K2 4A3JI 2WAQA 4E32A 2JS4A 3CCSZ 1VLAA 3G71Z 2R7ZI 1K8A1 1N2FA 3CC7Z 3IX0A 3CCR1 2P3YA 4DGLA 2VPYA 3CCMZ 2JA8I 1WJ2A 2O4HA 1VQKZ 2OTJZ 1YJN1 4A3DI 2QR1B 4NBFA 3HOXI 1VQO1 3OW2Y 3S1NI 1VQP1 2JA7I 2Q4ZA 3H0GI 3M3YI 1WZNA 1YJWZ 5CM2M 3H3VJ 1S721 1KC82 3CXCY 3CCUZ 3G4SZ 3GTJI 3CD6Z 3T4NB 4NB9A 4A3GI 3CCEZ 3VMIA 2E9HA 3CCV1 2YU9I 2E2JI 5A2Qb 3M4OI 3CMEZ 4NFRA 1K9M1 1W2BZ 1SIWA 2NVQI 3JAMb 3VTNA 1I3QI 5T6BA 3NDIA 2NAPA 1VQ71 2RHBA 4NOZA 5T67A 3CCS1 4MD7A 5A2Qf 1K8A2 4A3BI 2JMOA 4NBDA 2ZAEB 1RO0A 2OOYB 3Q87A 3CC71 3J7A4 2J6AA 3JAMf 3I4NI 3CCM1 1NUIA 1M901 1VQ81 3NH5A 4DQYB 2R93I 4NBEA 2OTJ1 3HOYI 4E2WA 5C44I 2VPZA 4S1TA 4NH1C 1KQSY 2LEXA 1TFIA 3FQMA 2K5RA 3VB9A 4NBAA 3GKQA 3I07A 3CQZI 3EEDA 2F4OA 3GTQI 1YJW1 1Z01A 2OZKA 2O53A 3CCU1 3KIHA 3HOUI 2V8IA 3CD61 5IT9b 4MD9A 4NBGA 3GTLI 3CCE1 3NDJA 1VQM1 2KPIA 1K9M2 2QEXZ 3CME1 3HOWI 1Y1WI 5C3EI 1KC81 1JJ2Y 5IP7I 1YUAA 1Q811 1QVFZ 2EGTA 4A3II 2NVTI 1SFOI 5IT9f 1QVFY 2AKLA 2HU9A 3G6EZ 1NJI1 1Q861 1X0TA 4RVDA 3CPWY 3D2LA 1VQLZ 1YHQZ 3GTMI 2KI7B 5FLXb 1YIT1 4HGYA 3S17I 1P9NA 1VQ9Z 4A93I 2GTHA 2K3RA 1VQ4Z 1K731 4TNUA 3I561 2QA41 3VMHA 2VF1A 4RS4A 1QXFA 3MZKB 1TWGI 2PM9A 4A3LI 2VUGA 4A3MI 4HGZA 3S2HI 1X3WA 5IP9I 3HOZI 3CC4Z 1Q812 1LQLA 1ZH1A 3CC2Z 4E30A 3F3PC 3S16I 3S1QI 1K83I 2V3VA 3GTPI 1Y1VI 2JUBA 4EWCA 1WW9A 1NJI2 2Y0SA 1Q862 4NBBA 4BBRI 1DL6A 3RZOI 3EERA 2BJOA 1RLYA 1VQL1 2OTLZ 1YHQ1 1YJ9Z 1W2BY 4AYBA 4RV9A 3ESWA 2G2KA 1RQFA 3J80b 3S2DI 2DE6A 2GU2A 2M48A 3K7AI 3IR7A 3G711 1VQNZ 1TWFI 4RVHA 1K732 5C4JI 3NH8A 2QREB 1Q822 1YIJZ 2W04A 2LFUA 3VMGA 2OOXB 5C4XI 1VQK1 1N8R1 5D1OB 3HKZA
chains in the Genus database with same CATH topology
4E2YA 4A3CI 3J80f 3NH4A 1TWAI 3S1MI 1ZB9A 3S15I 3MONA 3CC41 3D6WA 2QRDB 3G4S1 2IZ4A 3CC21 3GTGI 3GTKI 1JWHC 2P28A 1USPB 4NBCA 2DE5A 5D1PA 1WCMI 2OTL1 4DK1A 1TWCI 1YJ91 2VUMI 4X6AI 5D1OA 4E2XA 4MH4A 4A3FI 4BY7I 1VQN1 3GCFA 1RO4A 1QVGZ 4MXUA 2RPRA 3MZLB 1N8R2 2WB1A 4MONA 1WIIA 1YIJ1 2H85A 3KIFA 2JR6A 2W03A 2QRCB 3I4MI 1R9TI 2I3CA 2JA6I 1RNIA 1USPA 2M6NA 5FLXf 1Q821 4QTUA 2IZ3A 1VQ7Z 3GTMS 3FQQA 1KD11 4E33A 5FLMI 3J81b 3PO3I 3TDHB 2QEX1 3CCLZ 1RO2A 3BG0B 1VQ8Z 1Z03A 1QF8A 3OW2Z 4RVGA 3HOVI 3U50C 3PO2I 2QLVB 4QTTA 4A3EI 1VQ5Z 3J81f 2JNYA 3G6E1 4Y52I 3CXCZ 3CCJZ 3PO3S 4RVFA 1PFTA 4BBSI 3I55Z 2QKDA 2F4MA 1VQMZ 3F3FC 4MRIA 1QYPA 1VQ91 4HH4A 1VQ41 1VQ6Z 1Y1VS 2E2II 3P5JB 2LIYA 1Q7Y2 1S7MA 3CMAZ 3NFZA 2GTIA 1YI2Z 1KRLA 2PK7A 1KD12 5LL6f 3CCQZ 4NBHA 3IF8A 3CCL1 4NB8A 1YITZ 2V8JA 1KQSZ 1M1K1 2NVYI 2RT9A 2HF1A 2JA5I 3IFUA 1I6HI 3S14I 3LUSA 1VQ51 1ML8A 3CCRZ 2RIQA 1I50I 3CCJ1 3I56Z 2QA4Z 3D9XA 4A3KI 1YJNZ 1VQOZ 3GTOI 3S1RI 1X3ZA 1VQPZ 3I551 3FKII 2R92I 2RBLA 2DE7A 1JJ2Z 5AN9F 1Z02A 5T64A 4E31A 1S72Z 2E2HI 1VQ61 4BY1I 1L1OC 1NP6A 2PMZA 2YADA 1QVGY 3CMA1 4E2ZA 3RZDI 2R6MA 3BG1B 3CCVZ 1YI21 4Y7NI 2NVXI 3CPWZ 1ZB8A 3QWUA 4MD8A 2Q51A 4CL1A 2V8KA 1TWHI 3CCQ1 2B63I 4XX2A 3TE5B 4BXXI 1YUKA 1Q7Y1 1M902 1M1K2 4A3JI 2WAQA 4E32A 2JS4A 3CCSZ 1VLAA 3G71Z 2R7ZI 1K8A1 1N2FA 3CC7Z 3IX0A 3CCR1 2P3YA 4DGLA 3CCMZ 2JA8I 2O4HA 1VQKZ 2OTJZ 1YJN1 4A3DI 2QR1B 4NBFA 3HOXI 1VQO1 3OW2Y 3S1NI 1VQP1 2JA7I 2Q4ZA 3H0GI 3M3YI 1YJWZ 5CM2M 3H3VJ 1S721 1KC82 3CXCY 3CCUZ 3G4SZ 3GTJI 3CD6Z 3T4NB 4NB9A 4A3GI 3CCEZ 3VMIA 2E9HA 3CCV1 2YU9I 2E2JI 5A2Qb 3M4OI 3CMEZ 4NFRA 1K9M1 1W2BZ 2NVQI 3JAMb 3VTNA 1I3QI 5T6BA 3NDIA 1VQ71 2RHBA 4NOZA 5T67A 3CCS1 4MD7A 5A2Qf 1K8A2 4A3BI 2JMOA 4NBDA 2ZAEB 1RO0A 2OOYB 3Q87A 3CC71 3J7A4 2J6AA 3JAMf 3I4NI 3CCM1 1NUIA 1M901 1VQ81 3NH5A 4DQYB 2R93I 4NBEA 2OTJ1 3HOYI 4E2WA 5C44I 4S1TA 4NH1C 1KQSY 1TFIA 3FQMA 2K5RA 3VB9A 4NBAA 3GKQA 3I07A 3CQZI 3EEDA 2F4OA 3GTQI 1YJW1 1Z01A 2OZKA 2O53A 3CCU1 3KIHA 3HOUI 2V8IA 3CD61 5IT9b 4MD9A 4NBGA 3GTLI 3CCE1 3NDJA 1VQM1 2KPIA 1K9M2 2QEXZ 3CME1 3HOWI 1Y1WI 5C3EI 1KC81 1JJ2Y 5IP7I 1YUAA 1Q811 1QVFZ 2EGTA 4A3II 2NVTI 1SFOI 5IT9f 1QVFY 2AKLA 2HU9A 3G6EZ 1NJI1 1Q861 1X0TA 4RVDA 3CPWY 1VQLZ 1YHQZ 3GTMI 2KI7B 5FLXb 1YIT1 4HGYA 3S17I 1P9NA 1VQ9Z 4A93I 2GTHA 2K3RA 1VQ4Z 1K731 4TNUA 3I561 2QA41 3VMHA 2VF1A 4RS4A 3MZKB 1TWGI 2PM9A 4A3LI 2VUGA 4A3MI 4HGZA 3S2HI 1X3WA 5IP9I 3HOZI 3CC4Z 1Q812 1LQLA 1ZH1A 3CC2Z 4E30A 3F3PC 3S16I 3S1QI 1K83I 3GTPI 1Y1VI 2JUBA 4EWCA 1WW9A 1NJI2 2Y0SA 1Q862 4NBBA 4BBRI 1DL6A 3RZOI 3EERA 2BJOA 1RLYA 1VQL1 2OTLZ 1YHQ1 1YJ9Z 1W2BY 4AYBA 4RV9A 3ESWA 2G2KA 1RQFA 3J80b 3S2DI 2DE6A 2GU2A 2M48A 3K7AI 3G711 1VQNZ 1TWFI 4RVHA 1K732 5C4JI 3NH8A 2QREB 1Q822 1YIJZ 2W04A 2LFUA 3VMGA 2OOXB 5C4XI 1VQK1 1N8R1 5D1OB 3HKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC Z;  2QEX Z;  3CME 1;  3CCJ Z;  3CCS Z;  3G71 Z;  1KC8 1;  1JJ2 Y;  1Q81 1;  1QVF Z;  1K8A 1;  3I55 Z;  3CC7 Z;  3CCR 1;  3CCM Z;  1QVF Y;  1VQM Z;  1K9M 2;  3G6E Z;  3CC4 1;  1VQ9 1;  1VQK Z;  1NJI 1;  2OTJ Z;  1YJN 1;  1Q86 1;  3G4S 1;  3CC2 1;  1VQ4 1;  3CPW Y;  1VQ6 Z;  1VQO 1;  1VQL Z;  3OW2 Y;  1YHQ Z;  1VQP 1;  1Q7Y 2;  1YIT 1;  3CMA Z;  1YI2 Z;  1YJW Z;  1KD1 2;  1S72 1;  1KC8 2;  1VQ9 Z;  3CXC Y;  3CCU Z;  2OTL 1;  3G4S Z;  1YJ9 1;  1VQ4 Z;  3CCQ Z;  3CD6 Z;  1K73 1;  3CCE Z;  3CCL 1;  3CCV 1;  1YIT Z;  3I56 1;  2QA4 1;  3CME Z;  1KQS Z;  1VQN 1;  1K9M 1;  1M1K 1;  1W2B Z;  1QVG Z;  1N8R 2;  1YIJ 1;  1VQ5 1;  3CCR Z;  1VQ7 1;  3CCJ 1;  3I56 Z;  2QA4 Z;  3CC4 Z;  3CCS 1;  1Q81 2;  1YJN Z;  3CC2 Z;  1K8A 2;  1VQO Z;  1VQP Z;  3I55 1;  3CC7 1;  1VQK 1;  1Q82 1;  3CCM 1;  1NJI 2;  1M90 1;  1VQ8 1;  1Q86 2;  1JJ2 Z;  2OTJ 1;  1VQ7 Z;  1S72 Z;  1VQ6 1;  1VQL 1;  1KD1 1;  1KQS Y;  2OTL Z;  1YHQ 1;  1YJ9 Z;  1W2B Y;  1QVG Y;  3CMA 1;  2QEX 1;  3CCL Z;  3CCV Z;  1YI2 1;  1YJW 1;  3CPW Z;  3OW2 Z;  3G71 1;  1VQ8 Z;  1VQN Z;  3CCU 1;  1K73 2;  3CCQ 1;  3CD6 1;  1Q7Y 1;  3CCE 1;  1Q82 2;  1YIJ Z;  1VQM 1;  1M90 2;  1VQ5 Z;  3G6E 1;  1N8R 1;  1M1K 2; 
#chains in the Genus database with same CATH topology
 4E2Y A;  4A3C I;  1FDI A;  3J80 f;  3NH4 A;  1TWA I;  2VPX A;  3S1M I;  1ZB9 A;  3S15 I;  3MON A;  2JIO A;  3CC4 1;  1FDO A;  3D6W A;  2QRD B;  3G4S 1;  2IZ4 A;  3CC2 1;  3GTG I;  3GTK I;  2JIQ A;  1JWH C;  2P28 A;  1USP B;  4NBC A;  1Q16 A;  2DE5 A;  5D1P A;  1WCM I;  2OTL 1;  4DK1 A;  1TWC I;  1YJ9 1;  2VUM I;  2V45 A;  4X6A I;  5D1O A;  4E2X A;  4MH4 A;  4A3F I;  4BY7 I;  1VQN 1;  3GCF A;  1RO4 A;  1QVG Z;  4MXU A;  2RPR A;  3MZL B;  1N8R 2;  2WB1 A;  4MON A;  1WII A;  1YIJ 1;  2H85 A;  3KIF A;  2JR6 A;  2W03 A;  2QRC B;  3I4M I;  1R9T I;  2I3C A;  2JA6 I;  1RNI A;  1USP A;  2M6N A;  5FLX f;  1Q82 1;  4QTU A;  2IZ3 A;  1VQ7 Z;  3GTM S;  3FQQ A;  1KD1 1;  4E33 A;  5FLM I;  3J81 b;  3PO3 I;  3TDH B;  2QEX 1;  3CCL Z;  1RO2 A;  3BG0 B;  1Z03 A;  1QF8 A;  3OW2 Z;  1VQ8 Z;  4RVG A;  3HOV I;  3U50 C;  3PO2 I;  2QLV B;  2E7Z A;  4QTT A;  4A3E I;  1VQ5 Z;  3J81 f;  2JNY A;  3G6E 1;  4Y52 I;  3CXC Z;  3CCJ Z;  3PO3 S;  4RVF A;  1PFT A;  4BBS I;  3I55 Z;  2QKD A;  2F4M A;  2IV2 X;  1VQM Z;  3F3F C;  4MRI A;  1QYP A;  1VQ9 1;  4HH4 A;  1VQ4 1;  1VQ6 Z;  1Y1V S;  2E2I I;  3P5J B;  2LIY A;  1Q7Y 2;  2JIM A;  1S7M A;  3CMA Z;  3NFZ A;  2GTI A;  1YI2 Z;  1AA6 A;  1KRL A;  2PK7 A;  1KD1 2;  5LL6 f;  2JIR A;  3CCQ Z;  4NBH A;  2VPW A;  3IF8 A;  3CCL 1;  4NB8 A;  1YIT Z;  2V8J A;  1KQS Z;  1M1K 1;  2NVY I;  2RT9 A;  2HF1 A;  2JA5 I;  2JIP A;  3IFU A;  1I6H I;  3S14 I;  3LUS A;  1VQ5 1;  1ML8 A;  3CCR Z;  2RIQ A;  1I50 I;  3CCJ 1;  3I56 Z;  2QA4 Z;  3D9X A;  4A3K I;  1YJN Z;  1VQO Z;  3GTO I;  3S1R I;  1X3Z A;  1VQP Z;  3I55 1;  3FKI I;  2R92 I;  2RBL A;  1Y8C A;  2DE7 A;  1JJ2 Z;  5AN9 F;  1Z02 A;  5T64 A;  4E31 A;  1S72 Z;  2E2H I;  1VQ6 1;  4BY1 I;  2AYD A;  1L1O C;  1NP6 A;  2PMZ A;  2YAD A;  1QVG Y;  3CMA 1;  4E2Z A;  3CCV Z;  2R6M A;  3BG1 B;  3RZD I;  1YI2 1;  4Y7N I;  2NVX I;  3CPW Z;  1ZB8 A;  3QWU A;  4MD8 A;  2Q51 A;  4CL1 A;  2V8K A;  1TWH I;  3CCQ 1;  2B63 I;  4XX2 A;  3TE5 B;  4BXX I;  1YUK A;  1Q7Y 1;  1M90 2;  1M1K 2;  4A3J I;  2WAQ A;  4E32 A;  2JS4 A;  3CCS Z;  1VLA A;  3G71 Z;  2R7Z I;  1K8A 1;  1N2F A;  3CC7 Z;  3IX0 A;  3CCR 1;  2P3Y A;  4DGL A;  2VPY A;  3CCM Z;  2JA8 I;  1WJ2 A;  2O4H A;  1VQK Z;  2OTJ Z;  1YJN 1;  4A3D I;  2QR1 B;  4NBF A;  3HOX I;  1VQO 1;  3OW2 Y;  3S1N I;  1VQP 1;  2JA7 I;  2Q4Z A;  3H0G I;  3M3Y I;  1WZN A;  1YJW Z;  5CM2 M;  3H3V J;  1S72 1;  1KC8 2;  3CXC Y;  3CCU Z;  3G4S Z;  3GTJ I;  3CD6 Z;  3T4N B;  4NB9 A;  4A3G I;  3CCE Z;  3VMI A;  2E9H A;  3CCV 1;  2YU9 I;  2E2J I;  5A2Q b;  3M4O I;  3CME Z;  4NFR A;  1K9M 1;  1W2B Z;  1SIW A;  2NVQ I;  3JAM b;  3VTN A;  1I3Q I;  5T6B A;  3NDI A;  2NAP A;  1VQ7 1;  2RHB A;  4NOZ A;  5T67 A;  3CCS 1;  4MD7 A;  5A2Q f;  1K8A 2;  4A3B I;  2JMO A;  4NBD A;  2ZAE B;  1RO0 A;  2OOY B;  3Q87 A;  3CC7 1;  3J7A 4;  2J6A A;  3JAM f;  3I4N I;  3CCM 1;  1NUI A;  1M90 1;  1VQ8 1;  3NH5 A;  4DQY B;  2R93 I;  4NBE A;  2OTJ 1;  3HOY I;  4E2W A;  5C44 I;  2VPZ A;  4S1T A;  4NH1 C;  1KQS Y;  2LEX A;  1TFI A;  3FQM A;  2K5R A;  3VB9 A;  4NBA A;  3GKQ A;  3I07 A;  3CQZ I;  3EED A;  2F4O A;  3GTQ I;  1YJW 1;  1Z01 A;  2OZK A;  2O53 A;  3CCU 1;  3KIH A;  3HOU I;  2V8I A;  3CD6 1;  5IT9 b;  4MD9 A;  4NBG A;  3GTL I;  3CCE 1;  3NDJ A;  1VQM 1;  2KPI A;  1K9M 2;  2QEX Z;  3CME 1;  3HOW I;  1Y1W I;  5C3E I;  1KC8 1;  1JJ2 Y;  5IP7 I;  1YUA A;  1Q81 1;  1QVF Z;  2EGT A;  4A3I I;  2NVT I;  1SFO I;  5IT9 f;  1QVF Y;  2AKL A;  2HU9 A;  3G6E Z;  1NJI 1;  1Q86 1;  1X0T A;  4RVD A;  3CPW Y;  3D2L A;  1VQL Z;  1YHQ Z;  3GTM I;  2KI7 B;  5FLX b;  1YIT 1;  4HGY A;  3S17 I;  1P9N A;  1VQ9 Z;  4A93 I;  2GTH A;  2K3R A;  1VQ4 Z;  1K73 1;  4TNU A;  3I56 1;  2QA4 1;  3VMH A;  2VF1 A;  4RS4 A;  1QXF A;  3MZK B;  1TWG I;  2PM9 A;  4A3L I;  2VUG A;  4A3M I;  4HGZ A;  3S2H I;  1X3W A;  5IP9 I;  3HOZ I;  3CC4 Z;  1Q81 2;  1LQL A;  1ZH1 A;  3CC2 Z;  4E30 A;  3F3P C;  3S16 I;  3S1Q I;  1K83 I;  2V3V A;  3GTP I;  1Y1V I;  2JUB A;  4EWC A;  1WW9 A;  1NJI 2;  2Y0S A;  1Q86 2;  4NBB A;  4BBR I;  1DL6 A;  3RZO I;  3EER A;  2BJO A;  1RLY A;  1VQL 1;  2OTL Z;  1YHQ 1;  1YJ9 Z;  1W2B Y;  4AYB A;  4RV9 A;  3ESW A;  2G2K A;  1RQF A;  3J80 b;  3S2D I;  2DE6 A;  2GU2 A;  2M48 A;  3K7A I;  3IR7 A;  3G71 1;  1VQN Z;  1TWF I;  4RVH A;  1K73 2;  5C4J I;  3NH8 A;  2QRE B;  1Q82 2;  1YIJ Z;  2W04 A;  2LFU A;  3VMG A;  2OOX B;  5C4X I;  1VQK 1;  1N8R 1;  5D1O B;  3HKZ A; 
#chains in the Genus database with same CATH homology
 4E2Y A;  4A3C I;  3J80 f;  3NH4 A;  1TWA I;  3S1M I;  1ZB9 A;  3S15 I;  3MON A;  3CC4 1;  3D6W A;  2QRD B;  3G4S 1;  2IZ4 A;  3CC2 1;  3GTG I;  3GTK I;  1JWH C;  2P28 A;  1USP B;  4NBC A;  2DE5 A;  5D1P A;  1WCM I;  2OTL 1;  4DK1 A;  1TWC I;  1YJ9 1;  2VUM I;  4X6A I;  5D1O A;  4E2X A;  4MH4 A;  4A3F I;  4BY7 I;  1VQN 1;  3GCF A;  1RO4 A;  1QVG Z;  4MXU A;  2RPR A;  3MZL B;  1N8R 2;  2WB1 A;  4MON A;  1WII A;  1YIJ 1;  2H85 A;  3KIF A;  2JR6 A;  2W03 A;  2QRC B;  3I4M I;  1R9T I;  2I3C A;  2JA6 I;  1RNI A;  1USP A;  2M6N A;  5FLX f;  1Q82 1;  4QTU A;  2IZ3 A;  1VQ7 Z;  3GTM S;  3FQQ A;  1KD1 1;  4E33 A;  5FLM I;  3J81 b;  3PO3 I;  3TDH B;  2QEX 1;  3CCL Z;  1RO2 A;  3BG0 B;  1VQ8 Z;  1Z03 A;  1QF8 A;  3OW2 Z;  4RVG A;  3HOV I;  3U50 C;  3PO2 I;  2QLV B;  4QTT A;  4A3E I;  1VQ5 Z;  3J81 f;  2JNY A;  3G6E 1;  4Y52 I;  3CXC Z;  3CCJ Z;  3PO3 S;  4RVF A;  1PFT A;  4BBS I;  3I55 Z;  2QKD A;  2F4M A;  1VQM Z;  3F3F C;  4MRI A;  1QYP A;  1VQ9 1;  4HH4 A;  1VQ4 1;  1VQ6 Z;  1Y1V S;  2E2I I;  3P5J B;  2LIY A;  1Q7Y 2;  1S7M A;  3CMA Z;  3NFZ A;  2GTI A;  1YI2 Z;  1KRL A;  2PK7 A;  1KD1 2;  5LL6 f;  3CCQ Z;  4NBH A;  3IF8 A;  3CCL 1;  4NB8 A;  1YIT Z;  2V8J A;  1KQS Z;  1M1K 1;  2NVY I;  2RT9 A;  2HF1 A;  2JA5 I;  3IFU A;  1I6H I;  3S14 I;  3LUS A;  1VQ5 1;  1ML8 A;  3CCR Z;  2RIQ A;  1I50 I;  3CCJ 1;  3I56 Z;  2QA4 Z;  3D9X A;  4A3K I;  1YJN Z;  1VQO Z;  3GTO I;  3S1R I;  1X3Z A;  1VQP Z;  3I55 1;  3FKI I;  2R92 I;  2RBL A;  2DE7 A;  1JJ2 Z;  5AN9 F;  1Z02 A;  5T64 A;  4E31 A;  1S72 Z;  2E2H I;  1VQ6 1;  4BY1 I;  1L1O C;  1NP6 A;  2PMZ A;  2YAD A;  1QVG Y;  3CMA 1;  4E2Z A;  3RZD I;  2R6M A;  3BG1 B;  3CCV Z;  1YI2 1;  4Y7N I;  2NVX I;  3CPW Z;  1ZB8 A;  3QWU A;  4MD8 A;  2Q51 A;  4CL1 A;  2V8K A;  1TWH I;  3CCQ 1;  2B63 I;  4XX2 A;  3TE5 B;  4BXX I;  1YUK A;  1Q7Y 1;  1M90 2;  1M1K 2;  4A3J I;  2WAQ A;  4E32 A;  2JS4 A;  3CCS Z;  1VLA A;  3G71 Z;  2R7Z I;  1K8A 1;  1N2F A;  3CC7 Z;  3IX0 A;  3CCR 1;  2P3Y A;  4DGL A;  3CCM Z;  2JA8 I;  2O4H A;  1VQK Z;  2OTJ Z;  1YJN 1;  4A3D I;  2QR1 B;  4NBF A;  3HOX I;  1VQO 1;  3OW2 Y;  3S1N I;  1VQP 1;  2JA7 I;  2Q4Z A;  3H0G I;  3M3Y I;  1YJW Z;  5CM2 M;  3H3V J;  1S72 1;  1KC8 2;  3CXC Y;  3CCU Z;  3G4S Z;  3GTJ I;  3CD6 Z;  3T4N B;  4NB9 A;  4A3G I;  3CCE Z;  3VMI A;  2E9H A;  3CCV 1;  2YU9 I;  2E2J I;  5A2Q b;  3M4O I;  3CME Z;  4NFR A;  1K9M 1;  1W2B Z;  2NVQ I;  3JAM b;  3VTN A;  1I3Q I;  5T6B A;  3NDI A;  1VQ7 1;  2RHB A;  4NOZ A;  5T67 A;  3CCS 1;  4MD7 A;  5A2Q f;  1K8A 2;  4A3B I;  2JMO A;  4NBD A;  2ZAE B;  1RO0 A;  2OOY B;  3Q87 A;  3CC7 1;  3J7A 4;  2J6A A;  3JAM f;  3I4N I;  3CCM 1;  1NUI A;  1M90 1;  1VQ8 1;  3NH5 A;  4DQY B;  2R93 I;  4NBE A;  2OTJ 1;  3HOY I;  4E2W A;  5C44 I;  4S1T A;  4NH1 C;  1KQS Y;  1TFI A;  3FQM A;  2K5R A;  3VB9 A;  4NBA A;  3GKQ A;  3I07 A;  3CQZ I;  3EED A;  2F4O A;  3GTQ I;  1YJW 1;  1Z01 A;  2OZK A;  2O53 A;  3CCU 1;  3KIH A;  3HOU I;  2V8I A;  3CD6 1;  5IT9 b;  4MD9 A;  4NBG A;  3GTL I;  3CCE 1;  3NDJ A;  1VQM 1;  2KPI A;  1K9M 2;  2QEX Z;  3CME 1;  3HOW I;  1Y1W I;  5C3E I;  1KC8 1;  1JJ2 Y;  5IP7 I;  1YUA A;  1Q81 1;  1QVF Z;  2EGT A;  4A3I I;  2NVT I;  1SFO I;  5IT9 f;  1QVF Y;  2AKL A;  2HU9 A;  3G6E Z;  1NJI 1;  1Q86 1;  1X0T A;  4RVD A;  3CPW Y;  1VQL Z;  1YHQ Z;  3GTM I;  2KI7 B;  5FLX b;  1YIT 1;  4HGY A;  3S17 I;  1P9N A;  1VQ9 Z;  4A93 I;  2GTH A;  2K3R A;  1VQ4 Z;  1K73 1;  4TNU A;  3I56 1;  2QA4 1;  3VMH A;  2VF1 A;  4RS4 A;  3MZK B;  1TWG I;  2PM9 A;  4A3L I;  2VUG A;  4A3M I;  4HGZ A;  3S2H I;  1X3W A;  5IP9 I;  3HOZ I;  3CC4 Z;  1Q81 2;  1LQL A;  1ZH1 A;  3CC2 Z;  4E30 A;  3F3P C;  3S16 I;  3S1Q I;  1K83 I;  3GTP I;  1Y1V I;  2JUB A;  4EWC A;  1WW9 A;  1NJI 2;  2Y0S A;  1Q86 2;  4NBB A;  4BBR I;  1DL6 A;  3RZO I;  3EER A;  2BJO A;  1RLY A;  1VQL 1;  2OTL Z;  1YHQ 1;  1YJ9 Z;  1W2B Y;  4AYB A;  4RV9 A;  3ESW A;  2G2K A;  1RQF A;  3J80 b;  3S2D I;  2DE6 A;  2GU2 A;  2M48 A;  3K7A I;  3G71 1;  1VQN Z;  1TWF I;  4RVH A;  1K73 2;  5C4J I;  3NH8 A;  2QRE B;  1Q82 2;  1YIJ Z;  2W04 A;  2LFU A;  3VMG A;  2OOX B;  5C4X I;  1VQK 1;  1N8R 1;  5D1O B;  3HKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...