3I551

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i55100
1S721 1VQ5Z 3G711 2QA4Z 1K9M2 1Q811 1YJW1 1VQKZ 3I55Z 1VQ6Z 3CCRZ 3I561 3CC71 1VQMZ 1NJI2 1K8A2 3CCLZ 3G6EZ 1YITZ 3OW2Z 1KC81 3CCMZ 3CC21 1VQ71 1JJ2Y 1VQP1 1S72Z 1M1K1 3OW2Y 3CC41 2QEXZ 1QVGY 1YHQ1 1VQ91 1Q822 3CCU1 1VQNZ 3CMAZ 3CCQZ 1K9M1 3I56Z 3CCS1 3CC7Z 1Q861 1M902 1YIJ1 2OTL1 3CXCZ 1JJ2Z 1W2BZ 1K732 1VQO1 1NJI1 1K8A1 3CC2Z 1QVFY 1VQLZ 1QVGZ 3CCV1 1VQPZ 3CME1 1YJN1 3CXCY 3CC4Z 1YHQZ 1W2BY 1YJ91 3CD61 3G71Z 1KD12 1VQ51 1KQSY 2QA41 1YJWZ 3CCSZ 1VQ81 1VQK1 3CPWY 1Q7Y2 1Q821 1YIJZ 3I551 2OTLZ 1QVFZ 1VQ41 3CCJ1 1VQOZ 1VQM1 1N8R2 1M901 3CCVZ 3CMEZ 1YJNZ 1K731 1VQ7Z 3G4S1 1YI21 1KQSZ 3CCE1 3CPWZ 2QEX1 1Q812 2OTJ1 1VQ9Z 1VQ8Z 3CCUZ 1Q862 1KD11 1VQN1 3CMA1 3CCQ1 1VQ4Z 3CCJZ 1Q7Y1 1VQ61 3CCR1 1KC82 3CCL1 3G4SZ 3G6E1 1YI2Z 1N8R1 1YIT1 1VQL1 3CCM1 3CCEZ 1M1K2 1YJ9Z 3CD6Z 2OTJZ
chains in the Genus database with same CATH superfamily
5IT9f 2QA4Z 4MD9A 1Q811 2RIQA 1NP6A 4BY1I 1QF8A 2JMOA 3JAMf 3I55Z 3H3VJ 1I3QI 3S15I 2AYDA 5IT9b 1K8A2 3CQZI 3I4NI 1YITZ 2JIPA 3JAMb 3CC21 4BY7I 5D1OA 1VQP1 3NDIA 2M48A 1Q822 5D1PA 3TE5B 2R92I 3RZOI 4Y7NI 1Q861 2E2HI 3D2LA 2K3RA 2NAPA 1VQO1 1K8A1 3F3PC 3Q87A 1Y1VS 2IV2X 3PO3S 4QTUA 3CC4Z 1W2BY 4NBCA 4DQYB 1I6HI 3G71Z 3MZLB 4NBEA 2ZAEB 3NH8A 2JUBA 3S17I 3HOVI 3VMIA 2QLVB 3J80f 3KIFA 4HGZA 1JWHC 1RO4A 1YIJZ 1Q821 2OTLZ 1QYPA 1VQ41 1YUAA 4CL1A 4A3FI 1VQM1 1TFIA 1WCMI 3H0GI 3GTGI 4A3DI 2JA5I 2DE5A 1YJNZ 1SFOI 1R9TI 4BBRI 4S1TA 5C44I 4MD8A 4NBDA 1VQ9Z 4TNUA 4E2WA 4RS4A 2GU2A 4E2YA 1N2FA 3GTKI 2I3CA 2DE7A 4A3EI 3CCJZ 5AN9F 2R7ZI 1DL6A 2GTIA 2RT9A 1Z02A 4NB8A 1Z01A 2LIYA 3J81b 2R6MA 2YU9I 1M1K2 1Q16A 1YJ9Z 2AKLA 1S721 3FQMA 3IR7A 4MH4A 2V8JA 2JIRA 1ZH1A 1YJW1 1VQKZ 2HF1A 2DE6A 1QXFA 1NJI2 1P9NA 3CCLZ 3G6EZ 3I4MI 2RHBA 3OW2Z 3D6WA 3CCMZ 3HOYI 2E2JI 4A3JI 1JJ2Y 2JA8I 1M1K1 2QEXZ 1YHQ1 1RO2A 1Y1VI 3PO3I 3FQQA 3CCU1 2OZKA 1ML8A 2BJOA 2EGTA 1M902 5FLXf 1VLAA 1JJ2Z 1NJI1 3CC2Z 1QVFY 1VQPZ 1KRLA 4DGLA 4HH4A 3CME1 3CD61 2QA41 4NBFA 1VQ81 2QR1B 1ZB8A 3I551 1QVFZ 4A93I 3GKQA 3MONA 4RVHA 1VQOZ 4MONA 3TDHB 1M901 3ESWA 3GTPI 3S1NI 2JIQA 2Y0SA 2WB1A 4RVGA 1L1OC 1VQ7Z 3G4S1 1YI21 2JIOA 5FLMI 1ZB9A 3S2DI 3NH5A 2JA6I 2OOYB 3HKZA 4E2XA 2VUGA 1NUIA 1TWAI 1USPB 3S1RI 1VQ4Z 3FKII 5IP9I 5A2Qf 4AYBA 1VQ61 1Z03A 3CCR1 1KC82 4BXXI 3EERA 1RNIA 3J80b 1SIWA 2QREB 3M3YI 3GTMS 2KI7B 1Y8CA 1VQ5Z 3G711 3S14I 2PMZA 1FDIA 1USPA 2QKDA 1Y1WI 2GTHA 5T67A 3I561 2M6NA 3CC71 3F3FC 5C4XI 3VMHA 5IP7I 1KC81 1S72Z 3OW2Y 2YADA 2JS4A 2B63I 2QRDB 4E32A 1VQ91 1VQNZ 3CMAZ 3CCQZ 4QTTA 3CCS1 2K5RA 4E2ZA 1RLYA 1I50I 3CXCZ 3HOXI 3S16I 1YUKA 1VQLZ 3CCV1 3BG0B 1TWGI 1LQLA 1YHQZ 1YJ91 2Q51A 2P28A 3K7AI 2Q4ZA 3GTJI 2JA7I 1RQFA 1KQSY 5T64A 3GTQI 1VQK1 3CPWY 4NBBA 3M4OI 3NDJA 1FDOA 2O53A 3VMGA 4NBAA 5C4JI 1N8R2 4A3LI 3BG1B 2H85A 3CMEZ 4DK1A 4E30A 2V8IA 2R93I 2RBLA 4HGYA 1KQSZ 4NOZA 2E9HA 3PO2I 3CCE1 3QWUA 5FLXb 3CPWZ 2O4HA 2QEX1 4A3CI 3VTNA 2OTJ1 1VQ8Z 4NH1C 3GTLI 3HOWI 1Q862 4RVFA 3EEDA 4A3MI 3GTMI 2IZ3A 2NVXI 2F4OA 1RO0A 2W04A 3LUSA 4A3BI 2HU9A 3IF8A 3G4SZ 1YI2Z 4E33A 1WZNA 1N8R1 1YIT1 3IFUA 4BBSI 3RZDI 2KPIA 2V8KA 4MXUA 1K9M2 4NBGA 2NVQI 1VQ6Z 3CCRZ 3GTOI 1VQMZ 3S1QI 2JR6A 3T4NB 1WW9A 4MD7A 3NFZA 4E31A 3VB9A 1TWHI 2VPWA 1VQ71 2LFUA 3GCFA 5A2Qb 3MZKB 1AA6A 5CM2M 4MRIA 3CC41 3P5JB 1QVGY 3S2HI 4XX2A 1X0TA 4A3II 3HOUI 2JIMA 3S1MI 2RPRA 2V3VA 2V45A 1K9M1 2VPZA 3I56Z 3CC7Z 2PM9A 1YIJ1 2OTL1 2QRCB 3I07A 1W2BZ 1K732 2NVYI 3NH4A 1QVGZ 2IZ4A 1PFTA 1TWFI 1S7MA 1YJN1 3CXCY 2W03A 4A3KI 1TWCI 4A3GI 4RV9A 5C3EI 2PK7A 1KD12 1VQ51 2WAQA 2G2KA 4EWCA 2P3YA 2VPXA 5T6BA 2VPYA 1YJWZ 3CCSZ 3J81f 2LEXA 1Q7Y2 2VUMI 3HOZI 3CCJ1 2OOXB 3CCVZ 2E2II 3KIHA 4NB9A 2F4MA 4X6AI 2J6AA 1K731 1WIIA 4NFRA 3U50C 4Y52I 1Q812 4RVDA 2E7ZA 5LL6f 3CCUZ 3J7A4 1KD11 1VQN1 3CMA1 3CCQ1 2JNYA 1Q7Y1 2VF1A 4NBHA 1X3WA 3CCL1 3G6E1 1X3ZA 3IX0A 1VQL1 3CCM1 3CCEZ 1K83I 5D1OB 2NVTI 3CD6Z 3D9XA 2OTJZ 1WJ2A
chains in the Genus database with same CATH topology
5IT9f 2QA4Z 4MD9A 1Q811 2RIQA 1NP6A 4BY1I 1QF8A 2JMOA 3JAMf 3I55Z 3H3VJ 1I3QI 3S15I 5IT9b 1K8A2 3CQZI 3I4NI 1YITZ 3JAMb 3CC21 4BY7I 5D1OA 1VQP1 3NDIA 2M48A 1Q822 5D1PA 3TE5B 2R92I 3RZOI 4Y7NI 1Q861 2E2HI 2K3RA 1VQO1 1K8A1 3F3PC 3Q87A 1Y1VS 3PO3S 4QTUA 3CC4Z 1W2BY 4NBCA 4DQYB 1I6HI 3G71Z 3MZLB 4NBEA 2ZAEB 3NH8A 2JUBA 3S17I 3HOVI 3VMIA 2QLVB 3J80f 3KIFA 4HGZA 1JWHC 1RO4A 1YIJZ 1Q821 2OTLZ 1QYPA 1VQ41 1YUAA 4CL1A 4A3FI 1VQM1 1TFIA 1WCMI 3H0GI 3GTGI 4A3DI 2JA5I 2DE5A 1YJNZ 1SFOI 1R9TI 4BBRI 4S1TA 5C44I 4MD8A 4NBDA 1VQ9Z 4TNUA 4E2WA 4RS4A 2GU2A 4E2YA 1N2FA 3GTKI 2I3CA 2DE7A 4A3EI 3CCJZ 5AN9F 2R7ZI 1DL6A 2GTIA 2RT9A 1Z02A 4NB8A 1Z01A 2LIYA 3J81b 2R6MA 2YU9I 1M1K2 1YJ9Z 2AKLA 1S721 3FQMA 4MH4A 2V8JA 1ZH1A 1YJW1 1VQKZ 2HF1A 2DE6A 1NJI2 1P9NA 3CCLZ 3G6EZ 3I4MI 2RHBA 3OW2Z 3D6WA 3CCMZ 3HOYI 2E2JI 4A3JI 1JJ2Y 2JA8I 1M1K1 2QEXZ 1YHQ1 1RO2A 1Y1VI 3PO3I 3FQQA 3CCU1 2OZKA 1ML8A 2BJOA 2EGTA 1M902 5FLXf 1VLAA 1JJ2Z 1NJI1 3CC2Z 1QVFY 1VQPZ 1KRLA 4DGLA 4HH4A 3CME1 3CD61 2QA41 4NBFA 1VQ81 2QR1B 1ZB8A 3I551 1QVFZ 4A93I 3GKQA 3MONA 1VQOZ 4RVHA 4MONA 3TDHB 1M901 3ESWA 3GTPI 3S1NI 2Y0SA 2WB1A 4RVGA 1L1OC 1VQ7Z 3G4S1 1YI21 5FLMI 1ZB9A 3S2DI 3NH5A 2JA6I 2OOYB 3HKZA 4E2XA 2VUGA 3S1RI 1NUIA 1TWAI 1USPB 1VQ4Z 3FKII 5IP9I 5A2Qf 4AYBA 1VQ61 1Z03A 3CCR1 1KC82 4BXXI 3EERA 1RNIA 3J80b 2QREB 3M3YI 3GTMS 2KI7B 1VQ5Z 3G711 3S14I 2PMZA 1USPA 2QKDA 1Y1WI 2GTHA 5T67A 3I561 2M6NA 3CC71 3F3FC 5C4XI 3VMHA 5IP7I 1KC81 1S72Z 3OW2Y 2YADA 2JS4A 2B63I 2QRDB 4E32A 1VQ91 1VQNZ 3CMAZ 3CCQZ 4QTTA 3CCS1 2K5RA 4E2ZA 1RLYA 1I50I 3CXCZ 3HOXI 3S16I 1YUKA 1VQLZ 3CCV1 3BG0B 1TWGI 1LQLA 1YHQZ 1YJ91 2Q51A 2P28A 3K7AI 2Q4ZA 3GTJI 2JA7I 1RQFA 1KQSY 5T64A 3GTQI 1VQK1 3CPWY 4NBBA 3M4OI 3NDJA 2O53A 3VMGA 4NBAA 5C4JI 1N8R2 4A3LI 3BG1B 2H85A 3CMEZ 4DK1A 4E30A 2V8IA 2R93I 2RBLA 4HGYA 1KQSZ 4NOZA 2E9HA 3PO2I 3CCE1 3QWUA 5FLXb 3CPWZ 2O4HA 2QEX1 4A3CI 3VTNA 2OTJ1 1VQ8Z 4NH1C 3GTLI 3HOWI 1Q862 4RVFA 3EEDA 4A3MI 3GTMI 2IZ3A 2NVXI 2F4OA 1RO0A 2W04A 3LUSA 4A3BI 2HU9A 3IF8A 3G4SZ 1YI2Z 4E33A 1N8R1 1YIT1 3IFUA 4BBSI 3RZDI 2KPIA 2V8KA 4MXUA 1K9M2 4NBGA 2NVQI 1VQ6Z 3CCRZ 3GTOI 1VQMZ 3S1QI 2JR6A 3T4NB 1WW9A 4MD7A 3NFZA 4E31A 3VB9A 1TWHI 1VQ71 2LFUA 3GCFA 5A2Qb 3MZKB 5CM2M 4MRIA 3CC41 3P5JB 1QVGY 3S2HI 4XX2A 1X0TA 4A3II 3HOUI 3S1MI 2RPRA 1K9M1 3I56Z 3CC7Z 2PM9A 1YIJ1 2OTL1 2QRCB 3I07A 1W2BZ 1K732 2NVYI 3NH4A 1QVGZ 2IZ4A 1PFTA 1TWFI 1S7MA 1YJN1 3CXCY 2W03A 4A3KI 1TWCI 4A3GI 4RV9A 5C3EI 2PK7A 1KD12 1VQ51 2WAQA 2G2KA 4EWCA 2P3YA 5T6BA 1YJWZ 3CCSZ 3J81f 1Q7Y2 2VUMI 3HOZI 3CCJ1 2OOXB 3CCVZ 2E2II 3KIHA 4NB9A 2F4MA 4X6AI 2J6AA 1K731 1WIIA 4NFRA 3U50C 4Y52I 1Q812 4RVDA 5LL6f 3CCUZ 3J7A4 1KD11 1VQN1 3CMA1 3CCQ1 2JNYA 1Q7Y1 2VF1A 4NBHA 1X3WA 3CCL1 3G6E1 1X3ZA 3IX0A 1VQL1 3CCM1 3CCEZ 1K83I 5D1OB 2NVTI 3CD6Z 3D9XA 2OTJZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 1;  1VQ5 Z;  3G71 1;  2QA4 Z;  1K9M 2;  1Q81 1;  1YJW 1;  1VQK Z;  3I55 Z;  1VQ6 Z;  3CCR Z;  3I56 1;  3CC7 1;  1VQM Z;  1NJI 2;  1K8A 2;  3CCL Z;  3G6E Z;  1YIT Z;  3OW2 Z;  1KC8 1;  3CCM Z;  3CC2 1;  1VQ7 1;  1JJ2 Y;  1VQP 1;  1S72 Z;  1M1K 1;  3OW2 Y;  3CC4 1;  2QEX Z;  1QVG Y;  1YHQ 1;  1VQ9 1;  1Q82 2;  3CCU 1;  1VQN Z;  3CMA Z;  3CCQ Z;  1K9M 1;  3I56 Z;  3CCS 1;  3CC7 Z;  1Q86 1;  1M90 2;  1YIJ 1;  2OTL 1;  3CXC Z;  1JJ2 Z;  1W2B Z;  1K73 2;  1VQO 1;  1NJI 1;  1K8A 1;  3CC2 Z;  1QVF Y;  1VQL Z;  1QVG Z;  3CCV 1;  1VQP Z;  3CME 1;  1YJN 1;  3CXC Y;  3CC4 Z;  1YHQ Z;  1W2B Y;  1YJ9 1;  3CD6 1;  3G71 Z;  1KD1 2;  1VQ5 1;  1KQS Y;  2QA4 1;  1YJW Z;  3CCS Z;  1VQ8 1;  1VQK 1;  3CPW Y;  1Q7Y 2;  1Q82 1;  1YIJ Z;  3I55 1;  2OTL Z;  1QVF Z;  1VQ4 1;  3CCJ 1;  1VQO Z;  1VQM 1;  1N8R 2;  1M90 1;  3CCV Z;  3CME Z;  1YJN Z;  1K73 1;  1VQ7 Z;  3G4S 1;  1YI2 1;  1KQS Z;  3CCE 1;  3CPW Z;  2QEX 1;  1Q81 2;  2OTJ 1;  1VQ9 Z;  1VQ8 Z;  3CCU Z;  1Q86 2;  1KD1 1;  1VQN 1;  3CMA 1;  3CCQ 1;  1VQ4 Z;  3CCJ Z;  1Q7Y 1;  1VQ6 1;  3CCR 1;  1KC8 2;  3CCL 1;  3G4S Z;  3G6E 1;  1YI2 Z;  1N8R 1;  1YIT 1;  1VQL 1;  3CCM 1;  3CCE Z;  1M1K 2;  1YJ9 Z;  3CD6 Z;  2OTJ Z; 
#chains in the Genus database with same CATH topology
 5IT9 f;  2QA4 Z;  4MD9 A;  1Q81 1;  2RIQ A;  1NP6 A;  4BY1 I;  1QF8 A;  2JMO A;  3JAM f;  3I55 Z;  3H3V J;  1I3Q I;  3S15 I;  2AYD A;  5IT9 b;  1K8A 2;  3CQZ I;  3I4N I;  1YIT Z;  2JIP A;  3JAM b;  3CC2 1;  4BY7 I;  5D1O A;  1VQP 1;  3NDI A;  2M48 A;  1Q82 2;  5D1P A;  3TE5 B;  2R92 I;  3RZO I;  4Y7N I;  1Q86 1;  2E2H I;  3D2L A;  2K3R A;  2NAP A;  1VQO 1;  1K8A 1;  3F3P C;  3Q87 A;  1Y1V S;  2IV2 X;  3PO3 S;  4QTU A;  3CC4 Z;  1W2B Y;  4NBC A;  4DQY B;  1I6H I;  3G71 Z;  3MZL B;  4NBE A;  2ZAE B;  3NH8 A;  2JUB A;  3S17 I;  3HOV I;  3VMI A;  2QLV B;  3J80 f;  3KIF A;  4HGZ A;  1JWH C;  1RO4 A;  1YIJ Z;  1Q82 1;  2OTL Z;  1QYP A;  1VQ4 1;  1YUA A;  4CL1 A;  4A3F I;  1VQM 1;  1TFI A;  1WCM I;  3H0G I;  3GTG I;  4A3D I;  2JA5 I;  2DE5 A;  1YJN Z;  1SFO I;  1R9T I;  4BBR I;  4S1T A;  5C44 I;  4MD8 A;  4NBD A;  1VQ9 Z;  4TNU A;  4E2W A;  4RS4 A;  2GU2 A;  4E2Y A;  1N2F A;  3GTK I;  2I3C A;  2DE7 A;  4A3E I;  3CCJ Z;  5AN9 F;  2R7Z I;  1DL6 A;  2GTI A;  2RT9 A;  1Z02 A;  4NB8 A;  1Z01 A;  2LIY A;  3J81 b;  2R6M A;  2YU9 I;  1M1K 2;  1Q16 A;  1YJ9 Z;  2AKL A;  1S72 1;  3FQM A;  3IR7 A;  4MH4 A;  2V8J A;  2JIR A;  1ZH1 A;  1YJW 1;  1VQK Z;  2HF1 A;  2DE6 A;  1QXF A;  1NJI 2;  1P9N A;  3CCL Z;  3G6E Z;  3I4M I;  2RHB A;  3OW2 Z;  3D6W A;  3CCM Z;  3HOY I;  2E2J I;  4A3J I;  1JJ2 Y;  2JA8 I;  1M1K 1;  2QEX Z;  1YHQ 1;  1RO2 A;  1Y1V I;  3PO3 I;  3FQQ A;  3CCU 1;  2OZK A;  1ML8 A;  2BJO A;  2EGT A;  1M90 2;  5FLX f;  1VLA A;  1JJ2 Z;  1NJI 1;  3CC2 Z;  1QVF Y;  1VQP Z;  1KRL A;  4DGL A;  4HH4 A;  3CME 1;  3CD6 1;  2QA4 1;  4NBF A;  1VQ8 1;  2QR1 B;  1ZB8 A;  3I55 1;  1QVF Z;  4A93 I;  3GKQ A;  3MON A;  4RVH A;  1VQO Z;  4MON A;  3TDH B;  1M90 1;  3ESW A;  3GTP I;  3S1N I;  2JIQ A;  2Y0S A;  2WB1 A;  4RVG A;  1L1O C;  1VQ7 Z;  3G4S 1;  1YI2 1;  2JIO A;  5FLM I;  1ZB9 A;  3S2D I;  3NH5 A;  2JA6 I;  2OOY B;  3HKZ A;  4E2X A;  2VUG A;  1NUI A;  1TWA I;  1USP B;  3S1R I;  1VQ4 Z;  3FKI I;  5IP9 I;  5A2Q f;  4AYB A;  1VQ6 1;  1Z03 A;  3CCR 1;  1KC8 2;  4BXX I;  3EER A;  1RNI A;  3J80 b;  1SIW A;  2QRE B;  3M3Y I;  3GTM S;  2KI7 B;  1Y8C A;  1VQ5 Z;  3G71 1;  3S14 I;  2PMZ A;  1FDI A;  1USP A;  2QKD A;  1Y1W I;  2GTH A;  5T67 A;  3I56 1;  2M6N A;  3CC7 1;  3F3F C;  5C4X I;  3VMH A;  5IP7 I;  1KC8 1;  1S72 Z;  3OW2 Y;  2YAD A;  2JS4 A;  2B63 I;  2QRD B;  4E32 A;  1VQ9 1;  1VQN Z;  3CMA Z;  3CCQ Z;  4QTT A;  3CCS 1;  2K5R A;  4E2Z A;  1RLY A;  1I50 I;  3CXC Z;  3HOX I;  3S16 I;  1YUK A;  1VQL Z;  3CCV 1;  3BG0 B;  1TWG I;  1LQL A;  1YHQ Z;  1YJ9 1;  2Q51 A;  2P28 A;  3K7A I;  2Q4Z A;  3GTJ I;  2JA7 I;  1RQF A;  1KQS Y;  5T64 A;  3GTQ I;  1VQK 1;  3CPW Y;  4NBB A;  3M4O I;  3NDJ A;  1FDO A;  2O53 A;  3VMG A;  4NBA A;  5C4J I;  1N8R 2;  4A3L I;  3BG1 B;  2H85 A;  3CME Z;  4DK1 A;  4E30 A;  2V8I A;  2R93 I;  2RBL A;  4HGY A;  1KQS Z;  4NOZ A;  2E9H A;  3PO2 I;  3CCE 1;  3QWU A;  5FLX b;  3CPW Z;  2O4H A;  2QEX 1;  4A3C I;  3VTN A;  2OTJ 1;  1VQ8 Z;  4NH1 C;  3GTL I;  3HOW I;  1Q86 2;  4RVF A;  3EED A;  4A3M I;  3GTM I;  2IZ3 A;  2NVX I;  2F4O A;  1RO0 A;  2W04 A;  3LUS A;  4A3B I;  2HU9 A;  3IF8 A;  3G4S Z;  1YI2 Z;  4E33 A;  1WZN A;  1N8R 1;  1YIT 1;  3IFU A;  4BBS I;  3RZD I;  2KPI A;  2V8K A;  4MXU A;  1K9M 2;  4NBG A;  2NVQ I;  1VQ6 Z;  3CCR Z;  3GTO I;  1VQM Z;  3S1Q I;  2JR6 A;  3T4N B;  1WW9 A;  4MD7 A;  3NFZ A;  4E31 A;  3VB9 A;  1TWH I;  2VPW A;  1VQ7 1;  2LFU A;  3GCF A;  5A2Q b;  3MZK B;  1AA6 A;  5CM2 M;  4MRI A;  3CC4 1;  3P5J B;  1QVG Y;  3S2H I;  4XX2 A;  1X0T A;  4A3I I;  3HOU I;  2JIM A;  3S1M I;  2RPR A;  2V3V A;  2V45 A;  1K9M 1;  2VPZ A;  3I56 Z;  3CC7 Z;  2PM9 A;  1YIJ 1;  2OTL 1;  2QRC B;  3I07 A;  1W2B Z;  1K73 2;  2NVY I;  3NH4 A;  1QVG Z;  2IZ4 A;  1PFT A;  1TWF I;  1S7M A;  1YJN 1;  3CXC Y;  2W03 A;  4A3K I;  1TWC I;  4A3G I;  4RV9 A;  5C3E I;  2PK7 A;  1KD1 2;  1VQ5 1;  2WAQ A;  2G2K A;  4EWC A;  2P3Y A;  2VPX A;  5T6B A;  2VPY A;  1YJW Z;  3CCS Z;  3J81 f;  2LEX A;  1Q7Y 2;  2VUM I;  3HOZ I;  3CCJ 1;  2OOX B;  3CCV Z;  2E2I I;  3KIH A;  4NB9 A;  2F4M A;  4X6A I;  2J6A A;  1K73 1;  1WII A;  4NFR A;  3U50 C;  4Y52 I;  1Q81 2;  4RVD A;  2E7Z A;  5LL6 f;  3CCU Z;  3J7A 4;  1KD1 1;  1VQN 1;  3CMA 1;  3CCQ 1;  2JNY A;  1Q7Y 1;  2VF1 A;  4NBH A;  1X3W A;  3CCL 1;  3G6E 1;  1X3Z A;  3IX0 A;  1VQL 1;  3CCM 1;  3CCE Z;  1K83 I;  5D1O B;  2NVT I;  3CD6 Z;  3D9X A;  2OTJ Z;  1WJ2 A; 
#chains in the Genus database with same CATH homology
 5IT9 f;  2QA4 Z;  4MD9 A;  1Q81 1;  2RIQ A;  1NP6 A;  4BY1 I;  1QF8 A;  2JMO A;  3JAM f;  3I55 Z;  3H3V J;  1I3Q I;  3S15 I;  5IT9 b;  1K8A 2;  3CQZ I;  3I4N I;  1YIT Z;  3JAM b;  3CC2 1;  4BY7 I;  5D1O A;  1VQP 1;  3NDI A;  2M48 A;  1Q82 2;  5D1P A;  3TE5 B;  2R92 I;  3RZO I;  4Y7N I;  1Q86 1;  2E2H I;  2K3R A;  1VQO 1;  1K8A 1;  3F3P C;  3Q87 A;  1Y1V S;  3PO3 S;  4QTU A;  3CC4 Z;  1W2B Y;  4NBC A;  4DQY B;  1I6H I;  3G71 Z;  3MZL B;  4NBE A;  2ZAE B;  3NH8 A;  2JUB A;  3S17 I;  3HOV I;  3VMI A;  2QLV B;  3J80 f;  3KIF A;  4HGZ A;  1JWH C;  1RO4 A;  1YIJ Z;  1Q82 1;  2OTL Z;  1QYP A;  1VQ4 1;  1YUA A;  4CL1 A;  4A3F I;  1VQM 1;  1TFI A;  1WCM I;  3H0G I;  3GTG I;  4A3D I;  2JA5 I;  2DE5 A;  1YJN Z;  1SFO I;  1R9T I;  4BBR I;  4S1T A;  5C44 I;  4MD8 A;  4NBD A;  1VQ9 Z;  4TNU A;  4E2W A;  4RS4 A;  2GU2 A;  4E2Y A;  1N2F A;  3GTK I;  2I3C A;  2DE7 A;  4A3E I;  3CCJ Z;  5AN9 F;  2R7Z I;  1DL6 A;  2GTI A;  2RT9 A;  1Z02 A;  4NB8 A;  1Z01 A;  2LIY A;  3J81 b;  2R6M A;  2YU9 I;  1M1K 2;  1YJ9 Z;  2AKL A;  1S72 1;  3FQM A;  4MH4 A;  2V8J A;  1ZH1 A;  1YJW 1;  1VQK Z;  2HF1 A;  2DE6 A;  1NJI 2;  1P9N A;  3CCL Z;  3G6E Z;  3I4M I;  2RHB A;  3OW2 Z;  3D6W A;  3CCM Z;  3HOY I;  2E2J I;  4A3J I;  1JJ2 Y;  2JA8 I;  1M1K 1;  2QEX Z;  1YHQ 1;  1RO2 A;  1Y1V I;  3PO3 I;  3FQQ A;  3CCU 1;  2OZK A;  1ML8 A;  2BJO A;  2EGT A;  1M90 2;  5FLX f;  1VLA A;  1JJ2 Z;  1NJI 1;  3CC2 Z;  1QVF Y;  1VQP Z;  1KRL A;  4DGL A;  4HH4 A;  3CME 1;  3CD6 1;  2QA4 1;  4NBF A;  1VQ8 1;  2QR1 B;  1ZB8 A;  3I55 1;  1QVF Z;  4A93 I;  3GKQ A;  3MON A;  1VQO Z;  4RVH A;  4MON A;  3TDH B;  1M90 1;  3ESW A;  3GTP I;  3S1N I;  2Y0S A;  2WB1 A;  4RVG A;  1L1O C;  1VQ7 Z;  3G4S 1;  1YI2 1;  5FLM I;  1ZB9 A;  3S2D I;  3NH5 A;  2JA6 I;  2OOY B;  3HKZ A;  4E2X A;  2VUG A;  3S1R I;  1NUI A;  1TWA I;  1USP B;  1VQ4 Z;  3FKI I;  5IP9 I;  5A2Q f;  4AYB A;  1VQ6 1;  1Z03 A;  3CCR 1;  1KC8 2;  4BXX I;  3EER A;  1RNI A;  3J80 b;  2QRE B;  3M3Y I;  3GTM S;  2KI7 B;  1VQ5 Z;  3G71 1;  3S14 I;  2PMZ A;  1USP A;  2QKD A;  1Y1W I;  2GTH A;  5T67 A;  3I56 1;  2M6N A;  3CC7 1;  3F3F C;  5C4X I;  3VMH A;  5IP7 I;  1KC8 1;  1S72 Z;  3OW2 Y;  2YAD A;  2JS4 A;  2B63 I;  2QRD B;  4E32 A;  1VQ9 1;  1VQN Z;  3CMA Z;  3CCQ Z;  4QTT A;  3CCS 1;  2K5R A;  4E2Z A;  1RLY A;  1I50 I;  3CXC Z;  3HOX I;  3S16 I;  1YUK A;  1VQL Z;  3CCV 1;  3BG0 B;  1TWG I;  1LQL A;  1YHQ Z;  1YJ9 1;  2Q51 A;  2P28 A;  3K7A I;  2Q4Z A;  3GTJ I;  2JA7 I;  1RQF A;  1KQS Y;  5T64 A;  3GTQ I;  1VQK 1;  3CPW Y;  4NBB A;  3M4O I;  3NDJ A;  2O53 A;  3VMG A;  4NBA A;  5C4J I;  1N8R 2;  4A3L I;  3BG1 B;  2H85 A;  3CME Z;  4DK1 A;  4E30 A;  2V8I A;  2R93 I;  2RBL A;  4HGY A;  1KQS Z;  4NOZ A;  2E9H A;  3PO2 I;  3CCE 1;  3QWU A;  5FLX b;  3CPW Z;  2O4H A;  2QEX 1;  4A3C I;  3VTN A;  2OTJ 1;  1VQ8 Z;  4NH1 C;  3GTL I;  3HOW I;  1Q86 2;  4RVF A;  3EED A;  4A3M I;  3GTM I;  2IZ3 A;  2NVX I;  2F4O A;  1RO0 A;  2W04 A;  3LUS A;  4A3B I;  2HU9 A;  3IF8 A;  3G4S Z;  1YI2 Z;  4E33 A;  1N8R 1;  1YIT 1;  3IFU A;  4BBS I;  3RZD I;  2KPI A;  2V8K A;  4MXU A;  1K9M 2;  4NBG A;  2NVQ I;  1VQ6 Z;  3CCR Z;  3GTO I;  1VQM Z;  3S1Q I;  2JR6 A;  3T4N B;  1WW9 A;  4MD7 A;  3NFZ A;  4E31 A;  3VB9 A;  1TWH I;  1VQ7 1;  2LFU A;  3GCF A;  5A2Q b;  3MZK B;  5CM2 M;  4MRI A;  3CC4 1;  3P5J B;  1QVG Y;  3S2H I;  4XX2 A;  1X0T A;  4A3I I;  3HOU I;  3S1M I;  2RPR A;  1K9M 1;  3I56 Z;  3CC7 Z;  2PM9 A;  1YIJ 1;  2OTL 1;  2QRC B;  3I07 A;  1W2B Z;  1K73 2;  2NVY I;  3NH4 A;  1QVG Z;  2IZ4 A;  1PFT A;  1TWF I;  1S7M A;  1YJN 1;  3CXC Y;  2W03 A;  4A3K I;  1TWC I;  4A3G I;  4RV9 A;  5C3E I;  2PK7 A;  1KD1 2;  1VQ5 1;  2WAQ A;  2G2K A;  4EWC A;  2P3Y A;  5T6B A;  1YJW Z;  3CCS Z;  3J81 f;  1Q7Y 2;  2VUM I;  3HOZ I;  3CCJ 1;  2OOX B;  3CCV Z;  2E2I I;  3KIH A;  4NB9 A;  2F4M A;  4X6A I;  2J6A A;  1K73 1;  1WII A;  4NFR A;  3U50 C;  4Y52 I;  1Q81 2;  4RVD A;  5LL6 f;  3CCU Z;  3J7A 4;  1KD1 1;  1VQN 1;  3CMA 1;  3CCQ 1;  2JNY A;  1Q7Y 1;  2VF1 A;  4NBH A;  1X3W A;  3CCL 1;  3G6E 1;  1X3Z A;  3IX0 A;  1VQL 1;  3CCM 1;  3CCE Z;  1K83 I;  5D1O B;  2NVT I;  3CD6 Z;  3D9X A;  2OTJ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...