1K8A1

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k8a100
3CPWZ 1K8A2 3CPWY 1VQM1 1VQO1 3CCQ1 1VQ91 1VQP1 1K731 1VQ7Z 1Q862 1VQN1 1Q822 1YIJZ 3CC71 1YI2Z 3I55Z 3I561 2QEX1 1Q812 1YJW1 1N8R2 3CC41 3CCL1 3CME1 2OTJ1 1K9M1 3G6EZ 3OW2Z 2OTLZ 3CC21 1YITZ 1KD12 3CCR1 3G4SZ 1M901 3CCUZ 3OW2Y 1QVGZ 3CD6Z 1S72Z 1M1K1 1YJ91 1VQL1 3CCS1 1YJNZ 3CCM1 1QVGY 3CMAZ 1VQ41 3CCEZ 1W2BZ 1VQ61 1Q7Y2 1W2BY 1VQK1 3CXCZ 3CCQZ 1VQ81 1VQPZ 1QVFZ 1VQ5Z 3CCJZ 3CXCY 1NJI1 3G71Z 1QVFY 2QA41 3CC4Z 1VQ71 1K732 2OTJZ 1YIJ1 1YHQ1 3CCRZ 1KC81 3G6E1 1K9M2 2OTL1 3CCV1 1VQLZ 1NJI2 1YIT1 3CCSZ 3CCMZ 3CD61 1K8A1 1M902 1S721 1VQ6Z 1VQMZ 1VQOZ 1M1K2 1YJN1 3CMA1 1VQ9Z 1Q821 1VQNZ 1Q811 1N8R1 3CC7Z 1KQSY 3I56Z 2QEXZ 1YJWZ 1VQ8Z 3CMEZ 3CCLZ 1JJ2Y 1YI21 1KD11 3CC2Z 3I551 2QA4Z 1VQ51 3CCJ1 3G711 1YJ9Z 1YHQZ 3G4S1 3CCU1 1VQ4Z 3CCVZ 1Q7Y1 1Q861 1KQSZ 1KC82 3CCE1 1VQKZ 1JJ2Z
chains in the Genus database with same CATH superfamily
3CPWZ 3I07A 5C4JI 5T67A 1Y1WI 3CQZI 3NH5A 4XX2A 1VQ91 1VQP1 1Q862 1NUIA 3VMHA 2OOXB 4QTUA 3I561 4A93I 3CCL1 2KPIA 2QREB 2G2KA 2OTJ1 3S2HI 1ZB8A 1YITZ 4NBEA 3G4SZ 1AA6A 4RVFA 3VMIA 1S72Z 1RO0A 5FLXf 2VUMI 4E33A 4E2XA 3CCS1 5D1OA 3J80b 1W2BZ 1KRLA 3M3YI 2GU2A 3D9XA 2R6MA 2RBLA 1R9TI 3NH8A 1N2FA 1TWHI 2JR6A 2V8IA 4BY7I 1VQPZ 3G71Z 3RZDI 1QVFY 2M6NA 1VQ71 1K732 2OTJZ 1QXFA 1KC81 1FDIA 1NP6A 2K5RA 3G6E1 5C44I 2OTL1 3GTPI 3PO2I 3CCSZ 1RQFA 2JA5I 4NBGA 1K8A1 3GCFA 5IT9f 1RNIA 1VQOZ 1M1K2 1JWHC 3CMA1 4E31A 1Q821 2R7ZI 1VQNZ 1N8R1 2QEXZ 1X0TA 2YADA 2OZKA 4NBAA 4NB9A 4RVGA 4NBHA 2JA8I 1Z02A 5IT9b 1FDOA 2PMZA 2V8JA 3GTJI 4EWCA 2JNYA 4BY1I 4E2ZA 2M48A 2QRDB 4MRIA 1TWAI 2HU9A 2QRCB 2RPRA 2B63I 4RVDA 4Y7NI 2DE5A 2QLVB 4A3CI 5T6BA 1VQM1 3CCQ1 3M4OI 3J81f 1YIJZ 5FLMI 2EGTA 1K9M1 2P28A 3J7A4 4NBCA 4MH4A 3CC21 2GTHA 1KD12 3GKQA 4E2YA 1M901 4HH4A 3CD6Z 1WIIA 1YJ91 3HOZI 1QVGY 1YJNZ 3CCM1 2F4MA 3S1NI 3J81b 2NVQI 1VQ41 3H3VJ 3D2LA 2IZ3A 1I50I 5T64A 3HKZA 5LL6f 3Q87A 2JIPA 3HOYI 1TWGI 3CCQZ 1VQ81 1LQLA 2Q51A 1QVFZ 1VQ5Z 3CXCY 1RO4A 4HGZA 2VUGA 2QA41 2AKLA 3KIFA 1QYPA 5D1PA 2PK7A 3CCV1 2JIOA 3CCMZ 2Y0SA 2E7ZA 1RO2A 1Y1VS 4A3KI 1SFOI 1VQ9Z 4HGYA 2NAPA 3P5JB 5FLXb 5AN9F 2W04A 1Z03A 3I56Z 2R93I 3CCLZ 1VQ8Z 2NVXI 3BG0B 5IP7I 3MZKB 1YI21 3I4MI 3I551 1K83I 2QA4Z 3CCJ1 1TWFI 2GTIA 4DGLA 3CCU1 2VPWA 2NVTI 3CCVZ 2QR1B 4RVHA 1KQSZ 1WW9A 3S1RI 2E2II 1JJ2Z 3VTNA 2JMOA 2LEXA 2WAQA 2QKDA 2KI7B 3NDIA 3U50C 1K731 2K3RA 2J6AA 1VQ7Z 2RT9A 2DE6A 2IV2X 3CC71 1YI2Z 3I4NI 2F4OA 3I55Z 1Q812 4A3DI 3HOVI 1YJW1 1Q16A 3CC41 3GTMS 3CME1 2JA6I 2NVYI 3G6EZ 2OTLZ 3CCR1 3CCUZ 3OW2Y 1YUAA 1QVGZ 1S7MA 3FKII 3NFZA 4MONA 4NBBA 4A3LI 1VLAA 2V3VA 1M1K1 1VQL1 1USPA 3CMAZ 3S16I 2RIQA 2DE7A 2R92I 1VQ61 3S15I 1Y1VI 2ZAEB 1Q7Y2 3JAMf 2E9HA 2BJOA 1VQK1 2I3CA 3CXCZ 1Y8CA 3ESWA 1NJI1 3GTLI 3PO3S 3MZLB 3CC4Z 2P3YA 2RHBA 1YHQ1 3CCRZ 3HOUI 3QWUA 3IFUA 4NB8A 1I3QI 5A2Qf 1USPB 2Q4ZA 3JAMb 1VQLZ 1YIT1 4MD7A 2VPXA 4A3II 4CL1A 3S17I 3S1QI 4S1TA 1S721 4MXUA 1VQ6Z 1VQMZ 2V45A 4X6AI 3NH4A 3T4NB 2O4HA 3NDJA 3IF8A 5A2Qb 3IX0A 3VB9A 1KD11 3TDHB 3CC2Z 4A3EI 3GTMI 2E2JI 1I6HI 2WB1A 4BBSI 3J80f 3G711 1YJ9Z 3D6WA 1YHQZ 4A3GI 1VQ4Z 3FQMA 3GTGI 1Q861 5C4XI 4DQYB 1KC82 4TNUA 3CCE1 1TFIA 4A3JI 1DL6A 4NH1C 1ZB9A 3K7AI 1K8A2 4NBDA 3CPWY 1VQO1 1L1OC 1PFTA 4RV9A 3GTQI 3F3PC 3RZOI 1VQN1 1Q822 3HOWI 3PO3I 1N8R2 4QTTA 2QEX1 2LIYA 2JS4A 2JIMA 2VPYA 3OW2Z 3LUSA 1X3WA 3KIHA 1X3ZA 3IR7A 2O53A 1SIWA 4E30A 4A3MI 5D1OB 1TWCI 3CCEZ 5C3EI 3H0GI 1YUKA 3MONA 2AYDA 3GTKI 1W2BY 4A3FI 1ML8A 4MD8A 4NOZA 2JA7I 3CCJZ 2E2HI 3F3FC 4BXXI 1WJ2A 1YIJ1 2VPZA 1RLYA 3TE5B 5IP9I 3S2DI 1K9M2 4AYBA 1NJI2 2LFUA 4E2WA 2JIRA 2YU9I 3CD61 1M902 1P9NA 4BBRI 3FQQA 4Y52I 1WCMI 4MD9A 4RS4A 1YJN1 1QF8A 1Z01A 2W03A 1Q811 3CC7Z 1KQSY 2IZ4A 1YJWZ 2HF1A 3VMGA 3CMEZ 3BG1B 4NBFA 1WZNA 2VF1A 1JJ2Y 3EERA 4A3BI 3GTOI 2JIQA 2OOYB 1VQ51 3S1MI 1ZH1A 3EEDA 3G4S1 2PM9A 3S14I 2V8KA 2H85A 2JUBA 4DK1A 1Q7Y1 4E32A 4NFRA 3HOXI 1VQKZ 5CM2M
chains in the Genus database with same CATH topology
3CPWZ 3I07A 5C4JI 5T67A 1Y1WI 3CQZI 3NH5A 4XX2A 1VQ91 1VQP1 1Q862 1NUIA 3VMHA 2OOXB 4QTUA 3I561 4A93I 3CCL1 2KPIA 2QREB 2G2KA 2OTJ1 3S2HI 1ZB8A 1YITZ 4NBEA 3G4SZ 4RVFA 3VMIA 1S72Z 1RO0A 5FLXf 2VUMI 4E33A 4E2XA 3CCS1 5D1OA 3J80b 1W2BZ 1KRLA 3M3YI 2GU2A 3D9XA 2R6MA 2RBLA 1R9TI 3NH8A 1N2FA 1TWHI 2JR6A 2V8IA 4BY7I 1VQPZ 3G71Z 3RZDI 1QVFY 2M6NA 1VQ71 1K732 2OTJZ 1KC81 1NP6A 2K5RA 3G6E1 5C44I 2OTL1 3GTPI 3PO2I 3CCSZ 1RQFA 2JA5I 4NBGA 1K8A1 3GCFA 5IT9f 1RNIA 1VQOZ 1M1K2 1JWHC 3CMA1 4E31A 1Q821 2R7ZI 1VQNZ 1N8R1 2QEXZ 1X0TA 2YADA 2OZKA 4NBAA 4NB9A 4RVGA 4NBHA 2JA8I 1Z02A 5IT9b 2PMZA 2V8JA 3GTJI 4EWCA 2JNYA 4BY1I 4E2ZA 2M48A 2QRDB 4MRIA 1TWAI 2HU9A 2QRCB 2RPRA 2B63I 4RVDA 4Y7NI 2DE5A 2QLVB 4A3CI 5T6BA 1VQM1 3CCQ1 3M4OI 3J81f 1YIJZ 5FLMI 2EGTA 1K9M1 2P28A 3J7A4 4NBCA 4MH4A 3CC21 2GTHA 1KD12 3GKQA 4E2YA 1M901 4HH4A 3CD6Z 1WIIA 1YJ91 3HOZI 1QVGY 1YJNZ 3CCM1 2F4MA 3S1NI 3J81b 2NVQI 1VQ41 3H3VJ 2IZ3A 1I50I 5T64A 3HKZA 5LL6f 3Q87A 3HOYI 1TWGI 3CCQZ 1VQ81 1LQLA 2Q51A 1QVFZ 1VQ5Z 3CXCY 1RO4A 4HGZA 2VUGA 2QA41 2AKLA 3KIFA 1QYPA 5D1PA 2PK7A 3CCV1 3CCMZ 2Y0SA 1RO2A 1Y1VS 4A3KI 1SFOI 1VQ9Z 4HGYA 3P5JB 5FLXb 5AN9F 2W04A 1Z03A 3I56Z 2R93I 3CCLZ 1VQ8Z 2NVXI 3BG0B 5IP7I 3MZKB 1YI21 3I4MI 3I551 1K83I 2QA4Z 3CCJ1 1TWFI 2GTIA 4DGLA 3CCU1 2NVTI 3CCVZ 2QR1B 4RVHA 1KQSZ 1WW9A 3S1RI 2E2II 1JJ2Z 3VTNA 2JMOA 2WAQA 2QKDA 2KI7B 3NDIA 3U50C 1K731 2K3RA 2J6AA 1VQ7Z 2RT9A 2DE6A 3CC71 1YI2Z 3I4NI 2F4OA 3I55Z 1Q812 4A3DI 3HOVI 1YJW1 3CC41 3GTMS 3CME1 2JA6I 2NVYI 3G6EZ 2OTLZ 3CCR1 3OW2Y 3CCUZ 1YUAA 1QVGZ 1S7MA 3FKII 3NFZA 4MONA 4NBBA 4A3LI 1VLAA 1M1K1 1VQL1 1USPA 3CMAZ 3S16I 2RIQA 2DE7A 2R92I 1VQ61 3S15I 1Y1VI 2ZAEB 1Q7Y2 3JAMf 2E9HA 2BJOA 1VQK1 2I3CA 3CXCZ 3ESWA 1NJI1 3GTLI 3PO3S 3MZLB 3CC4Z 2P3YA 2RHBA 1YHQ1 3CCRZ 3HOUI 3QWUA 3IFUA 4NB8A 1I3QI 5A2Qf 1USPB 2Q4ZA 3JAMb 1VQLZ 1YIT1 4MD7A 3S17I 4A3II 4CL1A 3S1QI 4S1TA 1S721 4MXUA 1VQ6Z 1VQMZ 4X6AI 3NH4A 3T4NB 2O4HA 3NDJA 3IF8A 5A2Qb 3IX0A 3VB9A 1KD11 3TDHB 3CC2Z 4A3EI 3GTMI 2E2JI 1I6HI 2WB1A 4BBSI 3J80f 3G711 1YJ9Z 3D6WA 1YHQZ 4A3GI 1VQ4Z 3FQMA 3GTGI 1Q861 5C4XI 4DQYB 1KC82 4TNUA 3CCE1 1TFIA 4A3JI 1DL6A 4NH1C 1ZB9A 3K7AI 1K8A2 4NBDA 3CPWY 1VQO1 1L1OC 1PFTA 4RV9A 3GTQI 3F3PC 3RZOI 1VQN1 1Q822 3HOWI 3PO3I 1N8R2 4QTTA 2QEX1 2LIYA 2JS4A 3OW2Z 3LUSA 1X3WA 3KIHA 1X3ZA 2O53A 4E30A 4A3MI 5D1OB 1TWCI 3CCEZ 5C3EI 3H0GI 1YUKA 3MONA 3GTKI 1W2BY 4A3FI 1ML8A 4MD8A 4NOZA 2JA7I 3CCJZ 2E2HI 3F3FC 4BXXI 1YIJ1 1RLYA 3TE5B 5IP9I 3S2DI 1K9M2 4AYBA 1NJI2 2LFUA 4E2WA 2YU9I 3CD61 1M902 1P9NA 4BBRI 3FQQA 4Y52I 1WCMI 4MD9A 4RS4A 1YJN1 1QF8A 1Z01A 2W03A 1Q811 3CC7Z 1KQSY 2IZ4A 1YJWZ 2HF1A 3VMGA 3CMEZ 3BG1B 4NBFA 2VF1A 1JJ2Y 3EERA 4A3BI 3GTOI 2OOYB 1VQ51 3S1MI 1ZH1A 3EEDA 3G4S1 2PM9A 3S14I 2V8KA 2H85A 2JUBA 4DK1A 1Q7Y1 4E32A 4NFRA 3HOXI 1VQKZ 5CM2M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW Z;  1K8A 2;  3CPW Y;  1VQM 1;  1VQO 1;  3CCQ 1;  1VQ9 1;  1VQP 1;  1K73 1;  1VQ7 Z;  1Q86 2;  1VQN 1;  1Q82 2;  1YIJ Z;  3CC7 1;  1YI2 Z;  3I55 Z;  3I56 1;  2QEX 1;  1Q81 2;  1YJW 1;  1N8R 2;  3CC4 1;  3CCL 1;  3CME 1;  2OTJ 1;  1K9M 1;  3G6E Z;  3OW2 Z;  2OTL Z;  3CC2 1;  1YIT Z;  1KD1 2;  3CCR 1;  3G4S Z;  1M90 1;  3CCU Z;  3OW2 Y;  1QVG Z;  3CD6 Z;  1S72 Z;  1M1K 1;  1YJ9 1;  1VQL 1;  3CCS 1;  1YJN Z;  3CCM 1;  1QVG Y;  3CMA Z;  1VQ4 1;  3CCE Z;  1W2B Z;  1VQ6 1;  1Q7Y 2;  1W2B Y;  1VQK 1;  3CXC Z;  3CCQ Z;  1VQ8 1;  1VQP Z;  1QVF Z;  1VQ5 Z;  3CCJ Z;  3CXC Y;  1NJI 1;  3G71 Z;  1QVF Y;  2QA4 1;  3CC4 Z;  1VQ7 1;  1K73 2;  2OTJ Z;  1YIJ 1;  1YHQ 1;  3CCR Z;  1KC8 1;  3G6E 1;  1K9M 2;  2OTL 1;  3CCV 1;  1VQL Z;  1NJI 2;  1YIT 1;  3CCS Z;  3CCM Z;  3CD6 1;  1K8A 1;  1M90 2;  1S72 1;  1VQ6 Z;  1VQM Z;  1VQO Z;  1M1K 2;  1YJN 1;  3CMA 1;  1VQ9 Z;  1Q82 1;  1VQN Z;  1Q81 1;  1N8R 1;  3CC7 Z;  1KQS Y;  3I56 Z;  2QEX Z;  1YJW Z;  1VQ8 Z;  3CME Z;  3CCL Z;  1JJ2 Y;  1YI2 1;  1KD1 1;  3CC2 Z;  3I55 1;  2QA4 Z;  1VQ5 1;  3CCJ 1;  3G71 1;  1YJ9 Z;  1YHQ Z;  3G4S 1;  3CCU 1;  1VQ4 Z;  3CCV Z;  1Q7Y 1;  1Q86 1;  1KQS Z;  1KC8 2;  3CCE 1;  1VQK Z;  1JJ2 Z; 
#chains in the Genus database with same CATH topology
 3CPW Z;  3I07 A;  5C4J I;  5T67 A;  1Y1W I;  3CQZ I;  3NH5 A;  4XX2 A;  1VQ9 1;  1VQP 1;  1Q86 2;  1NUI A;  3VMH A;  2OOX B;  4QTU A;  3I56 1;  4A93 I;  3CCL 1;  2KPI A;  2QRE B;  2G2K A;  2OTJ 1;  3S2H I;  1ZB8 A;  1YIT Z;  4NBE A;  3G4S Z;  1AA6 A;  4RVF A;  3VMI A;  1S72 Z;  1RO0 A;  5FLX f;  2VUM I;  4E33 A;  4E2X A;  3CCS 1;  5D1O A;  3J80 b;  1W2B Z;  1KRL A;  3M3Y I;  2GU2 A;  3D9X A;  2R6M A;  2RBL A;  1R9T I;  3NH8 A;  1N2F A;  1TWH I;  2JR6 A;  2V8I A;  4BY7 I;  1VQP Z;  3G71 Z;  3RZD I;  1QVF Y;  2M6N A;  1VQ7 1;  1K73 2;  2OTJ Z;  1QXF A;  1KC8 1;  1FDI A;  1NP6 A;  2K5R A;  3G6E 1;  5C44 I;  2OTL 1;  3GTP I;  3PO2 I;  3CCS Z;  1RQF A;  2JA5 I;  4NBG A;  1K8A 1;  3GCF A;  5IT9 f;  1RNI A;  1VQO Z;  1M1K 2;  1JWH C;  3CMA 1;  4E31 A;  1Q82 1;  2R7Z I;  1VQN Z;  1N8R 1;  2QEX Z;  1X0T A;  2YAD A;  2OZK A;  4NBA A;  4NB9 A;  4RVG A;  4NBH A;  2JA8 I;  1Z02 A;  5IT9 b;  1FDO A;  2PMZ A;  2V8J A;  3GTJ I;  4EWC A;  2JNY A;  4BY1 I;  4E2Z A;  2M48 A;  2QRD B;  4MRI A;  1TWA I;  2HU9 A;  2QRC B;  2RPR A;  2B63 I;  4RVD A;  4Y7N I;  2DE5 A;  2QLV B;  4A3C I;  5T6B A;  1VQM 1;  3CCQ 1;  3M4O I;  3J81 f;  1YIJ Z;  5FLM I;  2EGT A;  1K9M 1;  2P28 A;  3J7A 4;  4NBC A;  4MH4 A;  3CC2 1;  2GTH A;  1KD1 2;  3GKQ A;  4E2Y A;  1M90 1;  4HH4 A;  3CD6 Z;  1WII A;  1YJ9 1;  3HOZ I;  1QVG Y;  1YJN Z;  3CCM 1;  2F4M A;  3S1N I;  3J81 b;  2NVQ I;  1VQ4 1;  3H3V J;  3D2L A;  2IZ3 A;  1I50 I;  5T64 A;  3HKZ A;  5LL6 f;  3Q87 A;  2JIP A;  3HOY I;  1TWG I;  3CCQ Z;  1VQ8 1;  1LQL A;  2Q51 A;  1QVF Z;  1VQ5 Z;  3CXC Y;  1RO4 A;  4HGZ A;  2VUG A;  2QA4 1;  2AKL A;  3KIF A;  1QYP A;  5D1P A;  2PK7 A;  3CCV 1;  2JIO A;  3CCM Z;  2Y0S A;  2E7Z A;  1RO2 A;  1Y1V S;  4A3K I;  1SFO I;  1VQ9 Z;  4HGY A;  2NAP A;  3P5J B;  5FLX b;  5AN9 F;  2W04 A;  1Z03 A;  3I56 Z;  2R93 I;  3CCL Z;  1VQ8 Z;  2NVX I;  3BG0 B;  5IP7 I;  3MZK B;  1YI2 1;  3I4M I;  3I55 1;  1K83 I;  2QA4 Z;  3CCJ 1;  1TWF I;  2GTI A;  4DGL A;  3CCU 1;  2VPW A;  2NVT I;  3CCV Z;  2QR1 B;  4RVH A;  1KQS Z;  1WW9 A;  3S1R I;  2E2I I;  1JJ2 Z;  3VTN A;  2JMO A;  2LEX A;  2WAQ A;  2QKD A;  2KI7 B;  3NDI A;  3U50 C;  1K73 1;  2K3R A;  2J6A A;  1VQ7 Z;  2RT9 A;  2DE6 A;  2IV2 X;  3CC7 1;  1YI2 Z;  3I4N I;  2F4O A;  3I55 Z;  1Q81 2;  4A3D I;  3HOV I;  1YJW 1;  1Q16 A;  3CC4 1;  3GTM S;  3CME 1;  2JA6 I;  2NVY I;  3G6E Z;  2OTL Z;  3CCR 1;  3CCU Z;  3OW2 Y;  1YUA A;  1QVG Z;  1S7M A;  3FKI I;  3NFZ A;  4MON A;  4NBB A;  4A3L I;  1VLA A;  2V3V A;  1M1K 1;  1VQL 1;  1USP A;  3CMA Z;  3S16 I;  2RIQ A;  2DE7 A;  2R92 I;  1VQ6 1;  3S15 I;  1Y1V I;  2ZAE B;  1Q7Y 2;  3JAM f;  2E9H A;  2BJO A;  1VQK 1;  2I3C A;  3CXC Z;  1Y8C A;  3ESW A;  1NJI 1;  3GTL I;  3PO3 S;  3MZL B;  3CC4 Z;  2P3Y A;  2RHB A;  1YHQ 1;  3CCR Z;  3HOU I;  3QWU A;  3IFU A;  4NB8 A;  1I3Q I;  5A2Q f;  1USP B;  2Q4Z A;  3JAM b;  1VQL Z;  1YIT 1;  4MD7 A;  2VPX A;  4A3I I;  4CL1 A;  3S17 I;  3S1Q I;  4S1T A;  1S72 1;  4MXU A;  1VQ6 Z;  1VQM Z;  2V45 A;  4X6A I;  3NH4 A;  3T4N B;  2O4H A;  3NDJ A;  3IF8 A;  5A2Q b;  3IX0 A;  3VB9 A;  1KD1 1;  3TDH B;  3CC2 Z;  4A3E I;  3GTM I;  2E2J I;  1I6H I;  2WB1 A;  4BBS I;  3J80 f;  3G71 1;  1YJ9 Z;  3D6W A;  1YHQ Z;  4A3G I;  1VQ4 Z;  3FQM A;  3GTG I;  1Q86 1;  5C4X I;  4DQY B;  1KC8 2;  4TNU A;  3CCE 1;  1TFI A;  4A3J I;  1DL6 A;  4NH1 C;  1ZB9 A;  3K7A I;  1K8A 2;  4NBD A;  3CPW Y;  1VQO 1;  1L1O C;  1PFT A;  4RV9 A;  3GTQ I;  3F3P C;  3RZO I;  1VQN 1;  1Q82 2;  3HOW I;  3PO3 I;  1N8R 2;  4QTT A;  2QEX 1;  2LIY A;  2JS4 A;  2JIM A;  2VPY A;  3OW2 Z;  3LUS A;  1X3W A;  3KIH A;  1X3Z A;  3IR7 A;  2O53 A;  1SIW A;  4E30 A;  4A3M I;  5D1O B;  1TWC I;  3CCE Z;  5C3E I;  3H0G I;  1YUK A;  3MON A;  2AYD A;  3GTK I;  1W2B Y;  4A3F I;  1ML8 A;  4MD8 A;  4NOZ A;  2JA7 I;  3CCJ Z;  2E2H I;  3F3F C;  4BXX I;  1WJ2 A;  1YIJ 1;  2VPZ A;  1RLY A;  3TE5 B;  5IP9 I;  3S2D I;  1K9M 2;  4AYB A;  1NJI 2;  2LFU A;  4E2W A;  2JIR A;  2YU9 I;  3CD6 1;  1M90 2;  1P9N A;  4BBR I;  3FQQ A;  4Y52 I;  1WCM I;  4MD9 A;  4RS4 A;  1YJN 1;  1QF8 A;  1Z01 A;  2W03 A;  1Q81 1;  3CC7 Z;  1KQS Y;  2IZ4 A;  1YJW Z;  2HF1 A;  3VMG A;  3CME Z;  3BG1 B;  4NBF A;  1WZN A;  2VF1 A;  1JJ2 Y;  3EER A;  4A3B I;  3GTO I;  2JIQ A;  2OOY B;  1VQ5 1;  3S1M I;  1ZH1 A;  3EED A;  3G4S 1;  2PM9 A;  3S14 I;  2V8K A;  2H85 A;  2JUB A;  4DK1 A;  1Q7Y 1;  4E32 A;  4NFR A;  3HOX I;  1VQK Z;  5CM2 M; 
#chains in the Genus database with same CATH homology
 3CPW Z;  3I07 A;  5C4J I;  5T67 A;  1Y1W I;  3CQZ I;  3NH5 A;  4XX2 A;  1VQ9 1;  1VQP 1;  1Q86 2;  1NUI A;  3VMH A;  2OOX B;  4QTU A;  3I56 1;  4A93 I;  3CCL 1;  2KPI A;  2QRE B;  2G2K A;  2OTJ 1;  3S2H I;  1ZB8 A;  1YIT Z;  4NBE A;  3G4S Z;  4RVF A;  3VMI A;  1S72 Z;  1RO0 A;  5FLX f;  2VUM I;  4E33 A;  4E2X A;  3CCS 1;  5D1O A;  3J80 b;  1W2B Z;  1KRL A;  3M3Y I;  2GU2 A;  3D9X A;  2R6M A;  2RBL A;  1R9T I;  3NH8 A;  1N2F A;  1TWH I;  2JR6 A;  2V8I A;  4BY7 I;  1VQP Z;  3G71 Z;  3RZD I;  1QVF Y;  2M6N A;  1VQ7 1;  1K73 2;  2OTJ Z;  1KC8 1;  1NP6 A;  2K5R A;  3G6E 1;  5C44 I;  2OTL 1;  3GTP I;  3PO2 I;  3CCS Z;  1RQF A;  2JA5 I;  4NBG A;  1K8A 1;  3GCF A;  5IT9 f;  1RNI A;  1VQO Z;  1M1K 2;  1JWH C;  3CMA 1;  4E31 A;  1Q82 1;  2R7Z I;  1VQN Z;  1N8R 1;  2QEX Z;  1X0T A;  2YAD A;  2OZK A;  4NBA A;  4NB9 A;  4RVG A;  4NBH A;  2JA8 I;  1Z02 A;  5IT9 b;  2PMZ A;  2V8J A;  3GTJ I;  4EWC A;  2JNY A;  4BY1 I;  4E2Z A;  2M48 A;  2QRD B;  4MRI A;  1TWA I;  2HU9 A;  2QRC B;  2RPR A;  2B63 I;  4RVD A;  4Y7N I;  2DE5 A;  2QLV B;  4A3C I;  5T6B A;  1VQM 1;  3CCQ 1;  3M4O I;  3J81 f;  1YIJ Z;  5FLM I;  2EGT A;  1K9M 1;  2P28 A;  3J7A 4;  4NBC A;  4MH4 A;  3CC2 1;  2GTH A;  1KD1 2;  3GKQ A;  4E2Y A;  1M90 1;  4HH4 A;  3CD6 Z;  1WII A;  1YJ9 1;  3HOZ I;  1QVG Y;  1YJN Z;  3CCM 1;  2F4M A;  3S1N I;  3J81 b;  2NVQ I;  1VQ4 1;  3H3V J;  2IZ3 A;  1I50 I;  5T64 A;  3HKZ A;  5LL6 f;  3Q87 A;  3HOY I;  1TWG I;  3CCQ Z;  1VQ8 1;  1LQL A;  2Q51 A;  1QVF Z;  1VQ5 Z;  3CXC Y;  1RO4 A;  4HGZ A;  2VUG A;  2QA4 1;  2AKL A;  3KIF A;  1QYP A;  5D1P A;  2PK7 A;  3CCV 1;  3CCM Z;  2Y0S A;  1RO2 A;  1Y1V S;  4A3K I;  1SFO I;  1VQ9 Z;  4HGY A;  3P5J B;  5FLX b;  5AN9 F;  2W04 A;  1Z03 A;  3I56 Z;  2R93 I;  3CCL Z;  1VQ8 Z;  2NVX I;  3BG0 B;  5IP7 I;  3MZK B;  1YI2 1;  3I4M I;  3I55 1;  1K83 I;  2QA4 Z;  3CCJ 1;  1TWF I;  2GTI A;  4DGL A;  3CCU 1;  2NVT I;  3CCV Z;  2QR1 B;  4RVH A;  1KQS Z;  1WW9 A;  3S1R I;  2E2I I;  1JJ2 Z;  3VTN A;  2JMO A;  2WAQ A;  2QKD A;  2KI7 B;  3NDI A;  3U50 C;  1K73 1;  2K3R A;  2J6A A;  1VQ7 Z;  2RT9 A;  2DE6 A;  3CC7 1;  1YI2 Z;  3I4N I;  2F4O A;  3I55 Z;  1Q81 2;  4A3D I;  3HOV I;  1YJW 1;  3CC4 1;  3GTM S;  3CME 1;  2JA6 I;  2NVY I;  3G6E Z;  2OTL Z;  3CCR 1;  3OW2 Y;  3CCU Z;  1YUA A;  1QVG Z;  1S7M A;  3FKI I;  3NFZ A;  4MON A;  4NBB A;  4A3L I;  1VLA A;  1M1K 1;  1VQL 1;  1USP A;  3CMA Z;  3S16 I;  2RIQ A;  2DE7 A;  2R92 I;  1VQ6 1;  3S15 I;  1Y1V I;  2ZAE B;  1Q7Y 2;  3JAM f;  2E9H A;  2BJO A;  1VQK 1;  2I3C A;  3CXC Z;  3ESW A;  1NJI 1;  3GTL I;  3PO3 S;  3MZL B;  3CC4 Z;  2P3Y A;  2RHB A;  1YHQ 1;  3CCR Z;  3HOU I;  3QWU A;  3IFU A;  4NB8 A;  1I3Q I;  5A2Q f;  1USP B;  2Q4Z A;  3JAM b;  1VQL Z;  1YIT 1;  4MD7 A;  3S17 I;  4A3I I;  4CL1 A;  3S1Q I;  4S1T A;  1S72 1;  4MXU A;  1VQ6 Z;  1VQM Z;  4X6A I;  3NH4 A;  3T4N B;  2O4H A;  3NDJ A;  3IF8 A;  5A2Q b;  3IX0 A;  3VB9 A;  1KD1 1;  3TDH B;  3CC2 Z;  4A3E I;  3GTM I;  2E2J I;  1I6H I;  2WB1 A;  4BBS I;  3J80 f;  3G71 1;  1YJ9 Z;  3D6W A;  1YHQ Z;  4A3G I;  1VQ4 Z;  3FQM A;  3GTG I;  1Q86 1;  5C4X I;  4DQY B;  1KC8 2;  4TNU A;  3CCE 1;  1TFI A;  4A3J I;  1DL6 A;  4NH1 C;  1ZB9 A;  3K7A I;  1K8A 2;  4NBD A;  3CPW Y;  1VQO 1;  1L1O C;  1PFT A;  4RV9 A;  3GTQ I;  3F3P C;  3RZO I;  1VQN 1;  1Q82 2;  3HOW I;  3PO3 I;  1N8R 2;  4QTT A;  2QEX 1;  2LIY A;  2JS4 A;  3OW2 Z;  3LUS A;  1X3W A;  3KIH A;  1X3Z A;  2O53 A;  4E30 A;  4A3M I;  5D1O B;  1TWC I;  3CCE Z;  5C3E I;  3H0G I;  1YUK A;  3MON A;  3GTK I;  1W2B Y;  4A3F I;  1ML8 A;  4MD8 A;  4NOZ A;  2JA7 I;  3CCJ Z;  2E2H I;  3F3F C;  4BXX I;  1YIJ 1;  1RLY A;  3TE5 B;  5IP9 I;  3S2D I;  1K9M 2;  4AYB A;  1NJI 2;  2LFU A;  4E2W A;  2YU9 I;  3CD6 1;  1M90 2;  1P9N A;  4BBR I;  3FQQ A;  4Y52 I;  1WCM I;  4MD9 A;  4RS4 A;  1YJN 1;  1QF8 A;  1Z01 A;  2W03 A;  1Q81 1;  3CC7 Z;  1KQS Y;  2IZ4 A;  1YJW Z;  2HF1 A;  3VMG A;  3CME Z;  3BG1 B;  4NBF A;  2VF1 A;  1JJ2 Y;  3EER A;  4A3B I;  3GTO I;  2OOY B;  1VQ5 1;  3S1M I;  1ZH1 A;  3EED A;  3G4S 1;  2PM9 A;  3S14 I;  2V8K A;  2H85 A;  2JUB A;  4DK1 A;  1Q7Y 1;  4E32 A;  4NFR A;  3HOX I;  1VQK Z;  5CM2 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...