1K8A1

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2001-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k8a100
1VQ7Z 1Q811 1N8R2 1YJ91 1W2BZ 3OW2Y 1K9M1 1VQNZ 1Q861 1VQ4Z 1K731 3CC2Z 1K8A2 3CCL1 3OW2Z 1VQN1 1S72Z 1YJN1 3I561 3G6E1 1KC82 1S721 1Q822 3CCSZ 1JJ2Y 3CC71 1YIJZ 1JJ2Z 3CCS1 1VQ6Z 1M902 1K8A1 1YIJ1 2OTJZ 1VQ9Z 1VQ71 1KC81 3CCVZ 1VQ41 3CMEZ 1NJI1 1VQMZ 3CC21 1M1K2 1YITZ 3CCV1 3CC4Z 3CME1 3CXCY 1KQSY 1VQM1 1VQ8Z 2QA4Z 1YIT1 3G71Z 3CCEZ 3CC41 1Q7Y1 1VQPZ 1N8R1 2QA41 3CCE1 3G711 3CMAZ 3I55Z 3CCUZ 1VQ61 1Q812 3CMA1 3CPWY 1VQKZ 2OTJ1 1YJWZ 1Q862 3CCU1 2OTLZ 1K732 3CCJZ 3G4SZ 1Q821 1QVGY 1VQK1 1YJW1 1YHQZ 1VQ91 2OTL1 3CCJ1 2QEXZ 3G4S1 3CD6Z 1M901 1YJ9Z 1VQOZ 2QEX1 1W2BY 3CXCZ 1KQSZ 1KD12 3CD61 1VQ81 3CCLZ 1VQLZ 1VQ5Z 1VQO1 1VQP1 3CCMZ 1YJNZ 3I56Z 1VQ51 1VQL1 3G6EZ 1QVFY 3I551 1K9M2 1M1K1 3CCRZ 3CCM1 3CPWZ 3CCQZ 1QVFZ 3CC7Z 1YI2Z 3CCR1 1NJI2 1KD11 3CCQ1 1QVGZ 1YI21 1YHQ1 1Q7Y2
chains in the Genus database with same CATH superfamily
3HOVI 1Q811 2KI7B 4A3KI 3PO3S 1VQNZ 1VQ4Z 1Y1VS 2K5RA 4BBSI 2Q51A 3OW2Z 3RZOI 3CQZI 2GU2A 2E2JI 1YJN1 3FQQA 2PMZA 1Z03A 4HH4A 1Q822 3HOZI 2AYDA 3NDIA 1JJ2Y 2P3YA 5IP9I 3CC71 3D6WA 4NOZA 2WB1A 2Y0SA 1K8A1 2OTJZ 3S1RI 2JIQA 4HGZA 2VUMI 2O53A 3JAMf 4S1TA 1X3WA 1NJI1 1VQ41 4A3MI 3JAMb 2J6AA 2P28A 3CME1 3CXCY 2V3VA 3S17I 2V8KA 2F4MA 2RIQA 2NAPA 2JNYA 3G71Z 1Q7Y1 3GKQA 1RLYA 1WJ2A 3I55Z 4TNUA 3CCUZ 3BG1B 4A3LI 1ZH1A 1Q812 3CMA1 3MZKB 1L1OC 1VQKZ 2OTJ1 2RT9A 3VMIA 3G4SZ 3EEDA 2PK7A 1YJW1 4EWCA 2QKDA 2G2KA 2I3CA 3IFUA 5CM2M 2JIRA 3FKII 4BY1I 3S1QI 1N2FA 5IT9f 1VQOZ 1TWCI 3CXCZ 3GTLI 1VLAA 3T4NB 4MD9A 5IT9b 2JMOA 3D9XA 1VQLZ 2OOYB 1WCMI 5LL6f 2K3RA 1Z01A 2V8IA 4NB9A 2QLVB 2O4HA 2RBLA 3I551 3CCRZ 1TWFI 4A3BI 4RV9A 1NJI2 4A3EI 1KD11 3CCQ1 3GTJI 4A3II 2W04A 2VPXA 1I3QI 1Q7Y2 3M4OI 4NBBA 4AYBA 1VQ7Z 3OW2Y 4MH4A 1K9M1 3CC2Z 4DK1A 2R93I 2VPZA 3S14I 1YUKA 4QTUA 1KC82 1S721 2VUGA 5T64A 1RO2A 2E2II 3F3FC 3GTQI 3CCS1 4HGYA 3H3VJ 2VPWA 3I07A 5C44I 3RZDI 2V8JA 1NP6A 3J81f 4XX2A 5C4JI 1VQ71 3J81b 2KPIA 3CMEZ 3CC21 4A3GI 2VF1A 2YADA 1DL6A 2BJOA 5AN9F 1KQSY 3GTKI 1WZNA 4NBEA 1N8R1 2QA41 4NFRA 3CCE1 2H85A 1I6HI 5D1PA 1RO0A 1QF8A 3CMAZ 1S7MA 3F3PC 4RVFA 1RNIA 3CPWY 3I4MI 1YJWZ 2JA6I 3MONA 2R6MA 1NUIA 4A3DI 3D2LA 3NH4A 3CCJ1 1LQLA 3NDJA 5T6BA 1Q16A 4MONA 1M901 1YJ9Z 4MRIA 1TFIA 1KQSZ 2RHBA 3J80f 1TWAI 1P9NA 3CCLZ 2LIYA 5FLXf 3GTMS 2JUBA 3I56Z 1VQ51 3G6EZ 5FLXb 2EGTA 3PO3I 3S2HI 2QR1B 2ZAEB 2AKLA 3CPWZ 3CCQZ 4A3JI 1QVFZ 3TDHB 1SIWA 4NB8A 2DE7A 1YI21 3S15I 2NVYI 4NBAA 4A3FI 2LEXA 3IR7A 3ESWA 5A2Qf 4MD7A 2HF1A 1N8R2 1YJ91 3S16I 5A2Qb 1YUAA 5C4XI 1K8A2 3CCL1 2QREB 2GTHA 1S72Z 3M3YI 3I561 3G6E1 1X0TA 3P5JB 2JA5I 5D1OA 4RS4A 3CCSZ 3IX0A 1Z02A 4NBDA 4NBFA 1VQ6Z 1M902 3FQMA 1YIJ1 1RO4A 4Y52I 4E2WA 2W03A 2LFUA 1ML8A 4E32A 1VQ9Z 2E9HA 2PM9A 3CCV1 3LUSA 5T67A 1VQM1 3KIFA 2QA4Z 4E2ZA 1YIT1 3CCEZ 3CC41 1VQPZ 1PFTA 1FDIA 3GTPI 2JIOA 5D1OB 1VQ61 3HKZA 2E2HI 3CCJZ 2NVQI 2F4OA 1VQ91 2QRDB 2OTL1 1Y1WI 2M48A 1ZB8A 1RQFA 2QEX1 1W2BY 1USPA 1KD12 2YU9I 3CD61 5C3EI 2DE5A 1VQ5Z 1VQP1 2JIMA 4MXUA 2JIPA 1QVFY 1M1K1 1K9M2 3CCM1 4QTTA 3GTGI 1YI2Z 2E7ZA 4NBCA 3TE5B 4E31A 3EERA 3HOXI 3J7A4 2Q4ZA 3Q87A 2IZ4A 1TWGI 1W2BZ 3HOUI 1Q861 3J80b 1K731 4X6AI 2OOXB 4A93I 2IV2X 4BY7I 1VQN1 1USPB 1WIIA 4E2YA 2QRCB 1Y1VI 3NFZA 3VMHA 3PO2I 2NVTI 3VTNA 4DGLA 4E33A 3IF8A 4MD8A 1YIJZ 2OZKA 3BG0B 3VMGA 1JJ2Z 1K83I 2DE6A 2VPYA 4NH1C 3VB9A 3GTOI 1QXFA 4RVGA 1KC81 3CCVZ 1WW9A 3NH5A 1KRLA 1VQMZ 3HOWI 1M1K2 1YITZ 1ZB9A 3CC4Z 3KIHA 1VQ8Z 3MZLB 1SFOI 4Y7NI 3HOYI 4RVHA 2M6NA 2V45A 3G711 1I50I 4BXXI 1FDOA 2WAQA 4DQYB 5IP7I 3S1MI 2R92I 4CL1A 2JA8I 3I4NI 3QWUA 1Q862 3GTMI 3CCU1 2OTLZ 1K732 1JWHC 2JA7I 3NH8A 1Q821 1X3ZA 4E30A 1QVGY 1VQK1 3S2DI 2NVXI 1YHQZ 3H0GI 2QEXZ 3G4S1 4A3CI 3GCFA 5FLMI 2JS4A 3CD6Z 1TWHI 2RPRA 2HU9A 4BBRI 2B63I 3S1NI 1VQ81 4NBGA 1AA6A 1VQO1 2JR6A 3U50C 3CCMZ 1YJNZ 2GTIA 1VQL1 1QYPA 3K7AI 3CC7Z 4NBHA 3CCR1 1R9TI 4E2XA 2R7ZI 1QVGZ 1Y8CA 4RVDA 1YHQ1 2IZ3A
chains in the Genus database with same CATH topology
3HOVI 1Q811 2KI7B 4A3KI 3PO3S 1VQNZ 1VQ4Z 1Y1VS 2K5RA 4BBSI 2Q51A 3OW2Z 3RZOI 3CQZI 2GU2A 2E2JI 1YJN1 3FQQA 2PMZA 1Z03A 4HH4A 1Q822 3HOZI 3NDIA 1JJ2Y 2P3YA 5IP9I 3CC71 3D6WA 4NOZA 2WB1A 2Y0SA 1K8A1 2OTJZ 3S1RI 4HGZA 2VUMI 2O53A 3JAMf 4S1TA 1X3WA 1NJI1 1VQ41 4A3MI 3JAMb 2J6AA 2P28A 3CME1 3CXCY 3S17I 2V8KA 2F4MA 2RIQA 3G71Z 2JNYA 1Q7Y1 3GKQA 1RLYA 3I55Z 4TNUA 3CCUZ 3BG1B 4A3LI 1ZH1A 1Q812 3CMA1 3MZKB 1L1OC 1VQKZ 2OTJ1 2RT9A 3VMIA 3G4SZ 3EEDA 2PK7A 1YJW1 4EWCA 2QKDA 2G2KA 2I3CA 3IFUA 5CM2M 3FKII 4BY1I 3S1QI 1N2FA 5IT9f 1VQOZ 1TWCI 3CXCZ 3GTLI 1VLAA 3T4NB 4MD9A 5IT9b 2JMOA 3D9XA 1VQLZ 2OOYB 1WCMI 5LL6f 2K3RA 1Z01A 2V8IA 4NB9A 2QLVB 2O4HA 2RBLA 3I551 3CCRZ 1TWFI 4A3BI 4RV9A 1NJI2 4A3EI 1KD11 3CCQ1 3GTJI 4A3II 2W04A 1I3QI 1Q7Y2 3M4OI 4NBBA 4AYBA 1VQ7Z 3OW2Y 4MH4A 1K9M1 3CC2Z 4DK1A 2R93I 3S14I 1YUKA 4QTUA 1KC82 1S721 2VUGA 5T64A 1RO2A 2E2II 3F3FC 3GTQI 3CCS1 4HGYA 3H3VJ 5C44I 3I07A 3RZDI 2V8JA 1NP6A 3J81f 4XX2A 5C4JI 1VQ71 3J81b 2KPIA 3CMEZ 3CC21 4A3GI 2VF1A 2YADA 1DL6A 2BJOA 5AN9F 1KQSY 3GTKI 4NBEA 1N8R1 2QA41 4NFRA 3CCE1 2H85A 1I6HI 5D1PA 1RO0A 1QF8A 3CMAZ 1S7MA 3F3PC 4RVFA 1RNIA 3CPWY 3I4MI 1YJWZ 2JA6I 3MONA 2R6MA 1NUIA 4A3DI 3NH4A 3CCJ1 1LQLA 3NDJA 5T6BA 4MONA 1M901 1YJ9Z 4MRIA 1TFIA 1KQSZ 2RHBA 3J80f 1TWAI 1P9NA 2LIYA 3CCLZ 5FLXf 3GTMS 2JUBA 3I56Z 1VQ51 3G6EZ 5FLXb 2EGTA 3PO3I 3S2HI 2QR1B 2ZAEB 2AKLA 3CPWZ 3CCQZ 4A3JI 1QVFZ 3TDHB 4NB8A 2DE7A 1YI21 3S15I 2NVYI 4NBAA 4A3FI 3ESWA 5A2Qf 4MD7A 2HF1A 1N8R2 1YJ91 3S16I 5A2Qb 1YUAA 5C4XI 1K8A2 3CCL1 2QREB 2GTHA 1S72Z 3M3YI 3I561 3G6E1 1X0TA 3P5JB 2JA5I 5D1OA 4RS4A 3CCSZ 3IX0A 1Z02A 4NBDA 4NBFA 1VQ6Z 1M902 3FQMA 1YIJ1 1RO4A 4Y52I 4E2WA 2W03A 2LFUA 1ML8A 4E32A 1VQ9Z 2E9HA 2PM9A 3CCV1 3LUSA 5T67A 1VQM1 3KIFA 2QA4Z 4E2ZA 1YIT1 3CCEZ 3CC41 1VQPZ 1PFTA 3GTPI 5D1OB 1VQ61 3HKZA 2E2HI 3CCJZ 2NVQI 2F4OA 1VQ91 2QRDB 2OTL1 1Y1WI 2M48A 1ZB8A 1RQFA 2QEX1 1W2BY 1USPA 1KD12 2YU9I 3CD61 5C3EI 2DE5A 1VQ5Z 1VQP1 4MXUA 1QVFY 1M1K1 1K9M2 3CCM1 4QTTA 3GTGI 1YI2Z 4NBCA 3TE5B 4E31A 3EERA 3HOXI 3J7A4 2Q4ZA 3Q87A 2IZ4A 1TWGI 1W2BZ 3HOUI 1Q861 3J80b 1K731 4X6AI 2OOXB 4A93I 4BY7I 1VQN1 1USPB 1WIIA 4E2YA 2QRCB 1Y1VI 3NFZA 3VMHA 3PO2I 2NVTI 3VTNA 4DGLA 4E33A 3IF8A 4MD8A 1YIJZ 2OZKA 3BG0B 3VMGA 1JJ2Z 1K83I 2DE6A 4NH1C 3VB9A 3GTOI 4RVGA 1KC81 3CCVZ 1WW9A 3NH5A 1KRLA 1VQMZ 3HOWI 1M1K2 1YITZ 1ZB9A 3CC4Z 3KIHA 1VQ8Z 3MZLB 1SFOI 4Y7NI 3HOYI 4RVHA 2M6NA 3G711 1I50I 4BXXI 2WAQA 4DQYB 5IP7I 3S1MI 2R92I 4CL1A 2JA8I 3I4NI 3QWUA 1Q862 3GTMI 3CCU1 2OTLZ 1K732 1JWHC 2JA7I 3NH8A 1Q821 1X3ZA 4E30A 1QVGY 1VQK1 3S2DI 2NVXI 1YHQZ 3H0GI 2QEXZ 3G4S1 4A3CI 3GCFA 5FLMI 2JS4A 3CD6Z 1TWHI 2RPRA 2HU9A 4BBRI 2B63I 3S1NI 1VQ81 4NBGA 1VQO1 2JR6A 3U50C 3CCMZ 1YJNZ 2GTIA 1VQL1 1QYPA 3K7AI 3CC7Z 4NBHA 3CCR1 1R9TI 4E2XA 2R7ZI 1QVGZ 4RVDA 1YHQ1 2IZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 Z;  1Q81 1;  1N8R 2;  1YJ9 1;  1W2B Z;  3OW2 Y;  1K9M 1;  1VQN Z;  1Q86 1;  1VQ4 Z;  1K73 1;  3CC2 Z;  1K8A 2;  3CCL 1;  3OW2 Z;  1VQN 1;  1S72 Z;  1YJN 1;  3I56 1;  3G6E 1;  1KC8 2;  1S72 1;  1Q82 2;  3CCS Z;  1JJ2 Y;  3CC7 1;  1YIJ Z;  1JJ2 Z;  3CCS 1;  1VQ6 Z;  1M90 2;  1K8A 1;  1YIJ 1;  2OTJ Z;  1VQ9 Z;  1VQ7 1;  1KC8 1;  3CCV Z;  1VQ4 1;  3CME Z;  1NJI 1;  1VQM Z;  3CC2 1;  1M1K 2;  1YIT Z;  3CCV 1;  3CC4 Z;  3CME 1;  3CXC Y;  1KQS Y;  1VQM 1;  1VQ8 Z;  2QA4 Z;  1YIT 1;  3G71 Z;  3CCE Z;  3CC4 1;  1Q7Y 1;  1VQP Z;  1N8R 1;  2QA4 1;  3CCE 1;  3G71 1;  3CMA Z;  3I55 Z;  3CCU Z;  1VQ6 1;  1Q81 2;  3CMA 1;  3CPW Y;  1VQK Z;  2OTJ 1;  1YJW Z;  1Q86 2;  3CCU 1;  2OTL Z;  1K73 2;  3CCJ Z;  3G4S Z;  1Q82 1;  1QVG Y;  1VQK 1;  1YJW 1;  1YHQ Z;  1VQ9 1;  2OTL 1;  3CCJ 1;  2QEX Z;  3G4S 1;  3CD6 Z;  1M90 1;  1YJ9 Z;  1VQO Z;  2QEX 1;  1W2B Y;  3CXC Z;  1KQS Z;  1KD1 2;  3CD6 1;  1VQ8 1;  3CCL Z;  1VQL Z;  1VQ5 Z;  1VQO 1;  1VQP 1;  3CCM Z;  1YJN Z;  3I56 Z;  1VQ5 1;  1VQL 1;  3G6E Z;  1QVF Y;  3I55 1;  1K9M 2;  1M1K 1;  3CCR Z;  3CCM 1;  3CPW Z;  3CCQ Z;  1QVF Z;  3CC7 Z;  1YI2 Z;  3CCR 1;  1NJI 2;  1KD1 1;  3CCQ 1;  1QVG Z;  1YI2 1;  1YHQ 1;  1Q7Y 2; 
#chains in the Genus database with same CATH topology
 3HOV I;  1Q81 1;  2KI7 B;  4A3K I;  3PO3 S;  1VQN Z;  1VQ4 Z;  1Y1V S;  2K5R A;  4BBS I;  2Q51 A;  3OW2 Z;  3RZO I;  3CQZ I;  2GU2 A;  2E2J I;  1YJN 1;  3FQQ A;  2PMZ A;  1Z03 A;  4HH4 A;  1Q82 2;  3HOZ I;  2AYD A;  3NDI A;  1JJ2 Y;  2P3Y A;  5IP9 I;  3CC7 1;  3D6W A;  4NOZ A;  2WB1 A;  2Y0S A;  1K8A 1;  2OTJ Z;  3S1R I;  2JIQ A;  4HGZ A;  2VUM I;  2O53 A;  3JAM f;  4S1T A;  1X3W A;  1NJI 1;  1VQ4 1;  4A3M I;  3JAM b;  2J6A A;  2P28 A;  3CME 1;  3CXC Y;  2V3V A;  3S17 I;  2V8K A;  2F4M A;  2RIQ A;  2NAP A;  2JNY A;  3G71 Z;  1Q7Y 1;  3GKQ A;  1RLY A;  1WJ2 A;  3I55 Z;  4TNU A;  3CCU Z;  3BG1 B;  4A3L I;  1ZH1 A;  1Q81 2;  3CMA 1;  3MZK B;  1L1O C;  1VQK Z;  2OTJ 1;  2RT9 A;  3VMI A;  3G4S Z;  3EED A;  2PK7 A;  1YJW 1;  4EWC A;  2QKD A;  2G2K A;  2I3C A;  3IFU A;  5CM2 M;  2JIR A;  3FKI I;  4BY1 I;  3S1Q I;  1N2F A;  5IT9 f;  1VQO Z;  1TWC I;  3CXC Z;  3GTL I;  1VLA A;  3T4N B;  4MD9 A;  5IT9 b;  2JMO A;  3D9X A;  1VQL Z;  2OOY B;  1WCM I;  5LL6 f;  2K3R A;  1Z01 A;  2V8I A;  4NB9 A;  2QLV B;  2O4H A;  2RBL A;  3I55 1;  3CCR Z;  1TWF I;  4A3B I;  4RV9 A;  1NJI 2;  4A3E I;  1KD1 1;  3CCQ 1;  3GTJ I;  4A3I I;  2W04 A;  2VPX A;  1I3Q I;  1Q7Y 2;  3M4O I;  4NBB A;  4AYB A;  1VQ7 Z;  3OW2 Y;  4MH4 A;  1K9M 1;  3CC2 Z;  4DK1 A;  2R93 I;  2VPZ A;  3S14 I;  1YUK A;  4QTU A;  1KC8 2;  1S72 1;  2VUG A;  5T64 A;  1RO2 A;  2E2I I;  3F3F C;  3GTQ I;  3CCS 1;  4HGY A;  3H3V J;  2VPW A;  3I07 A;  5C44 I;  3RZD I;  2V8J A;  1NP6 A;  3J81 f;  4XX2 A;  5C4J I;  1VQ7 1;  3J81 b;  2KPI A;  3CME Z;  3CC2 1;  4A3G I;  2VF1 A;  2YAD A;  1DL6 A;  2BJO A;  5AN9 F;  1KQS Y;  3GTK I;  1WZN A;  4NBE A;  1N8R 1;  2QA4 1;  4NFR A;  3CCE 1;  2H85 A;  1I6H I;  5D1P A;  1RO0 A;  1QF8 A;  3CMA Z;  1S7M A;  3F3P C;  4RVF A;  1RNI A;  3CPW Y;  3I4M I;  1YJW Z;  2JA6 I;  3MON A;  2R6M A;  1NUI A;  4A3D I;  3D2L A;  3NH4 A;  3CCJ 1;  1LQL A;  3NDJ A;  5T6B A;  1Q16 A;  4MON A;  1M90 1;  1YJ9 Z;  4MRI A;  1TFI A;  1KQS Z;  2RHB A;  3J80 f;  1TWA I;  1P9N A;  3CCL Z;  2LIY A;  5FLX f;  3GTM S;  2JUB A;  3I56 Z;  1VQ5 1;  3G6E Z;  5FLX b;  2EGT A;  3PO3 I;  3S2H I;  2QR1 B;  2ZAE B;  2AKL A;  3CPW Z;  3CCQ Z;  4A3J I;  1QVF Z;  3TDH B;  1SIW A;  4NB8 A;  2DE7 A;  1YI2 1;  3S15 I;  2NVY I;  4NBA A;  4A3F I;  2LEX A;  3IR7 A;  3ESW A;  5A2Q f;  4MD7 A;  2HF1 A;  1N8R 2;  1YJ9 1;  3S16 I;  5A2Q b;  1YUA A;  5C4X I;  1K8A 2;  3CCL 1;  2QRE B;  2GTH A;  1S72 Z;  3M3Y I;  3I56 1;  3G6E 1;  1X0T A;  3P5J B;  2JA5 I;  5D1O A;  4RS4 A;  3CCS Z;  3IX0 A;  1Z02 A;  4NBD A;  4NBF A;  1VQ6 Z;  1M90 2;  3FQM A;  1YIJ 1;  1RO4 A;  4Y52 I;  4E2W A;  2W03 A;  2LFU A;  1ML8 A;  4E32 A;  1VQ9 Z;  2E9H A;  2PM9 A;  3CCV 1;  3LUS A;  5T67 A;  1VQM 1;  3KIF A;  2QA4 Z;  4E2Z A;  1YIT 1;  3CCE Z;  3CC4 1;  1VQP Z;  1PFT A;  1FDI A;  3GTP I;  2JIO A;  5D1O B;  1VQ6 1;  3HKZ A;  2E2H I;  3CCJ Z;  2NVQ I;  2F4O A;  1VQ9 1;  2QRD B;  2OTL 1;  1Y1W I;  2M48 A;  1ZB8 A;  1RQF A;  2QEX 1;  1W2B Y;  1USP A;  1KD1 2;  2YU9 I;  3CD6 1;  5C3E I;  2DE5 A;  1VQ5 Z;  1VQP 1;  2JIM A;  4MXU A;  2JIP A;  1QVF Y;  1M1K 1;  1K9M 2;  3CCM 1;  4QTT A;  3GTG I;  1YI2 Z;  2E7Z A;  4NBC A;  3TE5 B;  4E31 A;  3EER A;  3HOX I;  3J7A 4;  2Q4Z A;  3Q87 A;  2IZ4 A;  1TWG I;  1W2B Z;  3HOU I;  1Q86 1;  3J80 b;  1K73 1;  4X6A I;  2OOX B;  4A93 I;  2IV2 X;  4BY7 I;  1VQN 1;  1USP B;  1WII A;  4E2Y A;  2QRC B;  1Y1V I;  3NFZ A;  3VMH A;  3PO2 I;  2NVT I;  3VTN A;  4DGL A;  4E33 A;  3IF8 A;  4MD8 A;  1YIJ Z;  2OZK A;  3BG0 B;  3VMG A;  1JJ2 Z;  1K83 I;  2DE6 A;  2VPY A;  4NH1 C;  3VB9 A;  3GTO I;  1QXF A;  4RVG A;  1KC8 1;  3CCV Z;  1WW9 A;  3NH5 A;  1KRL A;  1VQM Z;  3HOW I;  1M1K 2;  1YIT Z;  1ZB9 A;  3CC4 Z;  3KIH A;  1VQ8 Z;  3MZL B;  1SFO I;  4Y7N I;  3HOY I;  4RVH A;  2M6N A;  2V45 A;  3G71 1;  1I50 I;  4BXX I;  1FDO A;  2WAQ A;  4DQY B;  5IP7 I;  3S1M I;  2R92 I;  4CL1 A;  2JA8 I;  3I4N I;  3QWU A;  1Q86 2;  3GTM I;  3CCU 1;  2OTL Z;  1K73 2;  1JWH C;  2JA7 I;  3NH8 A;  1Q82 1;  1X3Z A;  4E30 A;  1QVG Y;  1VQK 1;  3S2D I;  2NVX I;  1YHQ Z;  3H0G I;  2QEX Z;  3G4S 1;  4A3C I;  3GCF A;  5FLM I;  2JS4 A;  3CD6 Z;  1TWH I;  2RPR A;  2HU9 A;  4BBR I;  2B63 I;  3S1N I;  1VQ8 1;  4NBG A;  1AA6 A;  1VQO 1;  2JR6 A;  3U50 C;  3CCM Z;  1YJN Z;  2GTI A;  1VQL 1;  1QYP A;  3K7A I;  3CC7 Z;  4NBH A;  3CCR 1;  1R9T I;  4E2X A;  2R7Z I;  1QVG Z;  1Y8C A;  4RVD A;  1YHQ 1;  2IZ3 A; 
#chains in the Genus database with same CATH homology
 3HOV I;  1Q81 1;  2KI7 B;  4A3K I;  3PO3 S;  1VQN Z;  1VQ4 Z;  1Y1V S;  2K5R A;  4BBS I;  2Q51 A;  3OW2 Z;  3RZO I;  3CQZ I;  2GU2 A;  2E2J I;  1YJN 1;  3FQQ A;  2PMZ A;  1Z03 A;  4HH4 A;  1Q82 2;  3HOZ I;  3NDI A;  1JJ2 Y;  2P3Y A;  5IP9 I;  3CC7 1;  3D6W A;  4NOZ A;  2WB1 A;  2Y0S A;  1K8A 1;  2OTJ Z;  3S1R I;  4HGZ A;  2VUM I;  2O53 A;  3JAM f;  4S1T A;  1X3W A;  1NJI 1;  1VQ4 1;  4A3M I;  3JAM b;  2J6A A;  2P28 A;  3CME 1;  3CXC Y;  3S17 I;  2V8K A;  2F4M A;  2RIQ A;  3G71 Z;  2JNY A;  1Q7Y 1;  3GKQ A;  1RLY A;  3I55 Z;  4TNU A;  3CCU Z;  3BG1 B;  4A3L I;  1ZH1 A;  1Q81 2;  3CMA 1;  3MZK B;  1L1O C;  1VQK Z;  2OTJ 1;  2RT9 A;  3VMI A;  3G4S Z;  3EED A;  2PK7 A;  1YJW 1;  4EWC A;  2QKD A;  2G2K A;  2I3C A;  3IFU A;  5CM2 M;  3FKI I;  4BY1 I;  3S1Q I;  1N2F A;  5IT9 f;  1VQO Z;  1TWC I;  3CXC Z;  3GTL I;  1VLA A;  3T4N B;  4MD9 A;  5IT9 b;  2JMO A;  3D9X A;  1VQL Z;  2OOY B;  1WCM I;  5LL6 f;  2K3R A;  1Z01 A;  2V8I A;  4NB9 A;  2QLV B;  2O4H A;  2RBL A;  3I55 1;  3CCR Z;  1TWF I;  4A3B I;  4RV9 A;  1NJI 2;  4A3E I;  1KD1 1;  3CCQ 1;  3GTJ I;  4A3I I;  2W04 A;  1I3Q I;  1Q7Y 2;  3M4O I;  4NBB A;  4AYB A;  1VQ7 Z;  3OW2 Y;  4MH4 A;  1K9M 1;  3CC2 Z;  4DK1 A;  2R93 I;  3S14 I;  1YUK A;  4QTU A;  1KC8 2;  1S72 1;  2VUG A;  5T64 A;  1RO2 A;  2E2I I;  3F3F C;  3GTQ I;  3CCS 1;  4HGY A;  3H3V J;  5C44 I;  3I07 A;  3RZD I;  2V8J A;  1NP6 A;  3J81 f;  4XX2 A;  5C4J I;  1VQ7 1;  3J81 b;  2KPI A;  3CME Z;  3CC2 1;  4A3G I;  2VF1 A;  2YAD A;  1DL6 A;  2BJO A;  5AN9 F;  1KQS Y;  3GTK I;  4NBE A;  1N8R 1;  2QA4 1;  4NFR A;  3CCE 1;  2H85 A;  1I6H I;  5D1P A;  1RO0 A;  1QF8 A;  3CMA Z;  1S7M A;  3F3P C;  4RVF A;  1RNI A;  3CPW Y;  3I4M I;  1YJW Z;  2JA6 I;  3MON A;  2R6M A;  1NUI A;  4A3D I;  3NH4 A;  3CCJ 1;  1LQL A;  3NDJ A;  5T6B A;  4MON A;  1M90 1;  1YJ9 Z;  4MRI A;  1TFI A;  1KQS Z;  2RHB A;  3J80 f;  1TWA I;  1P9N A;  2LIY A;  3CCL Z;  5FLX f;  3GTM S;  2JUB A;  3I56 Z;  1VQ5 1;  3G6E Z;  5FLX b;  2EGT A;  3PO3 I;  3S2H I;  2QR1 B;  2ZAE B;  2AKL A;  3CPW Z;  3CCQ Z;  4A3J I;  1QVF Z;  3TDH B;  4NB8 A;  2DE7 A;  1YI2 1;  3S15 I;  2NVY I;  4NBA A;  4A3F I;  3ESW A;  5A2Q f;  4MD7 A;  2HF1 A;  1N8R 2;  1YJ9 1;  3S16 I;  5A2Q b;  1YUA A;  5C4X I;  1K8A 2;  3CCL 1;  2QRE B;  2GTH A;  1S72 Z;  3M3Y I;  3I56 1;  3G6E 1;  1X0T A;  3P5J B;  2JA5 I;  5D1O A;  4RS4 A;  3CCS Z;  3IX0 A;  1Z02 A;  4NBD A;  4NBF A;  1VQ6 Z;  1M90 2;  3FQM A;  1YIJ 1;  1RO4 A;  4Y52 I;  4E2W A;  2W03 A;  2LFU A;  1ML8 A;  4E32 A;  1VQ9 Z;  2E9H A;  2PM9 A;  3CCV 1;  3LUS A;  5T67 A;  1VQM 1;  3KIF A;  2QA4 Z;  4E2Z A;  1YIT 1;  3CCE Z;  3CC4 1;  1VQP Z;  1PFT A;  3GTP I;  5D1O B;  1VQ6 1;  3HKZ A;  2E2H I;  3CCJ Z;  2NVQ I;  2F4O A;  1VQ9 1;  2QRD B;  2OTL 1;  1Y1W I;  2M48 A;  1ZB8 A;  1RQF A;  2QEX 1;  1W2B Y;  1USP A;  1KD1 2;  2YU9 I;  3CD6 1;  5C3E I;  2DE5 A;  1VQ5 Z;  1VQP 1;  4MXU A;  1QVF Y;  1M1K 1;  1K9M 2;  3CCM 1;  4QTT A;  3GTG I;  1YI2 Z;  4NBC A;  3TE5 B;  4E31 A;  3EER A;  3HOX I;  3J7A 4;  2Q4Z A;  3Q87 A;  2IZ4 A;  1TWG I;  1W2B Z;  3HOU I;  1Q86 1;  3J80 b;  1K73 1;  4X6A I;  2OOX B;  4A93 I;  4BY7 I;  1VQN 1;  1USP B;  1WII A;  4E2Y A;  2QRC B;  1Y1V I;  3NFZ A;  3VMH A;  3PO2 I;  2NVT I;  3VTN A;  4DGL A;  4E33 A;  3IF8 A;  4MD8 A;  1YIJ Z;  2OZK A;  3BG0 B;  3VMG A;  1JJ2 Z;  1K83 I;  2DE6 A;  4NH1 C;  3VB9 A;  3GTO I;  4RVG A;  1KC8 1;  3CCV Z;  1WW9 A;  3NH5 A;  1KRL A;  1VQM Z;  3HOW I;  1M1K 2;  1YIT Z;  1ZB9 A;  3CC4 Z;  3KIH A;  1VQ8 Z;  3MZL B;  1SFO I;  4Y7N I;  3HOY I;  4RVH A;  2M6N A;  3G71 1;  1I50 I;  4BXX I;  2WAQ A;  4DQY B;  5IP7 I;  3S1M I;  2R92 I;  4CL1 A;  2JA8 I;  3I4N I;  3QWU A;  1Q86 2;  3GTM I;  3CCU 1;  2OTL Z;  1K73 2;  1JWH C;  2JA7 I;  3NH8 A;  1Q82 1;  1X3Z A;  4E30 A;  1QVG Y;  1VQK 1;  3S2D I;  2NVX I;  1YHQ Z;  3H0G I;  2QEX Z;  3G4S 1;  4A3C I;  3GCF A;  5FLM I;  2JS4 A;  3CD6 Z;  1TWH I;  2RPR A;  2HU9 A;  4BBR I;  2B63 I;  3S1N I;  1VQ8 1;  4NBG A;  1VQO 1;  2JR6 A;  3U50 C;  3CCM Z;  1YJN Z;  2GTI A;  1VQL 1;  1QYP A;  3K7A I;  3CC7 Z;  4NBH A;  3CCR 1;  1R9T I;  4E2X A;  2R7Z I;  1QVG Z;  4RVD A;  1YHQ 1;  2IZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...