3S17I

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s17I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s17I02
2J6AA 2RBLA 1ZB8A 2NVYI 2YU9I 3H3VJ 1TFIA 2F4OA 2JR6A 4NBAA 4A3II 1QYPA 5CM2M 4A3JI 1Y1VI 3HOWI 2BJOA 4BY1I 3RZDI 1TWHI 5C4JI 2JA8I 1TWAI 4A93I 4NBGA 3GTMI 2JNYA 3PO3S 2NVTI 1ML8A 3PO3I 1VLAA 3HOXI 5FLMI 3M4OI 2F4MA 4NB9A 3I07A 1X3WA 4Y7NI 1X3ZA 2VUMI 4A3FI 2K5RA 4NBBA 4QTUA 4NBHA 1ZB9A 4A3MI 3S17I 3GTOI 3PO2I 1TWCI 2B63I 4X6AI 4NB8A 5C4XI 1RLYA 4A3LI 4XX2A 1PFTA 2NVXI 3VMIA 1NUIA 1DL6A 1USPB 3GKQA 3GTLI 2JA5I 3S2HI 1I6HI 2PK7A 3HOZI 3VMHA 2JS4A 2JA6I 3I4NI 3U50C 4NBFA 3GCFA 1I3QI 2NVQI 5IP7I 3GTJI 3VMGA 2E2II 3S14I 1R9TI 1WW9A 3FKII 3S1RI 3GTPI 3K7AI 4BBSI 1I50I 1WCMI 3S15I 3CQZI 3GTKI 4A3CI 3S1QI 4NBCA 4NOZA 1LQLA 3Q87A 3S1MI 2DE6A 3H0GI 3S1NI 2DE7A 4NBDA 3D6WA 4A3GI 1Y1VS 4Y52I 2JA7I 1TWGI 4A3KI 4A3BI 2AKLA 5C44I 3S2DI 1YUAA 4A3EI 2E2JI 1RO4A 3HOVI 3LUSA 2E2HI 2R93I 5IP9I 3HOUI 3GTQI 2P3YA 3ESWA 1N2FA 2HF1A 3S16I 2R7ZI 4MH4A 3RZOI 1K83I 2R92I 1SFOI 3M3YI 3GTGI 4NBEA 1USPA 1TWFI 2DE5A 1Y1WI 4A3DI 4BXXI 3I4MI 3HOYI 4BY7I 2KPIA 4QTTA 3EERA 3VB9A 5C3EI 4BBRI 3GTMS 1L1OC
chains in the Genus database with same CATH superfamily
2AYDA 2R6MA 1QXFA 2M6NA 4HGZA 3NDJA 2YU9I 3H3VJ 1TFIA 2F4OA 3MZLB 1YJNZ 4NBAA 2LIYA 4RVHA 4A3JI 1Y1VI 3HOWI 2PM9A 3HKZA 3KIFA 2O53A 2BJOA 4BY1I 4E30A 3CPWY 1TWAI 1Z03A 3GTMI 3CCSZ 1K9M1 1WZNA 3CC71 3G6E1 1YI2Z 5FLMI 3FQQA 3F3PC 1KD12 4MONA 1X3WA 5D1OA 4Y7NI 2VUMI 2LFUA 4QTUA 1M901 3CMAZ 3TDHB 1ZH1A 3CCMZ 3JAMb 1VQ91 3IF8A 1VQK1 3IR7A 1PFTA 2NVXI 3J81b 3GKQA 2W03A 4MD8A 1S721 2VF1A 2JA5I 4AYBA 1FDOA 3HOZI 2JA6I 5A2Qb 3G4SZ 3NH4A 3CCR1 3VTNA 5IP7I 3CMA1 2W04A 3GTPI 3G711 3K7AI 4BBSI 2JMOA 2OOYB 1YITZ 3S15I 2V8JA 3NDIA 3I56Z 3G6EZ 1YI21 2OZKA 3CC7Z 3Q87A 2V45A 1AA6A 1RO2A 2QRCB 3D6WA 2JA7I 1K8A2 2RHBA 2AKLA 4A3BI 3CCE1 1VQPZ 4A3EI 1RO4A 4S1TA 2E2HI 2R93I 5IP9I 4DQYB 3CC21 1M1K2 1N2FA 2RT9A 2R7ZI 3CMEZ 1P9NA 1Z01A 3I561 4TNUA 2VPYA 1VQLZ 2QR1B 4RS4A 1SFOI 1VQL1 3M3YI 3GTGI 4NBEA 2LEXA 3CC4Z 5FLXb 2WB1A 3CD6Z 3CPWZ 4BBRI 1W2BY 1VQP1 1KC82 5IT9b 2J6AA 4E32A 2V8IA 3CCL1 3CCJZ 3CCJ1 3NH8A 2JR6A 1QYPA 1K9M2 1K731 1Q16A 1VQ9Z 1NJI1 1Q822 2QEX1 3RZDI 1YJWZ 3BG1B 3CC41 4A93I 1VQ41 2QKDA 1JJ2Z 2E9HA 1KD11 1VQMZ 2JNYA 4MXUA 2QREB 2F4MA 2OTJ1 3CC2Z 1X3ZA 4A3FI 2K5RA 2WAQA 2G2KA 5D1PA 3D9XA 3EEDA 3QWUA 3CXCZ 1K8A1 3S17I 2KI7B 4RV9A 4X6AI 4NB8A 3OW2Z 4XX2A 1YJN1 3GTLI 5T67A 2OTL1 2V8KA 1I6HI 3NH5A 2V3VA 3IX0A 4NBFA 2E7ZA 4E2XA 1VQN1 2NVQI 3GTJI 3CCRZ 1WW9A 1YIJ1 3S1RI 2EGTA 4EWCA 4NOZA 3S1MI 1RNIA 3S1NI 1KC81 2DE7A 1Y1VS 1QVGY 1TWGI 3JAMf 3CCUZ 2JUBA 1VQNZ 3J81f 1VQ7Z 4MH4A 1KQSZ 1K83I 1WJ2A 2R92I 1S7MA 3CCVZ 1VQ81 1VQ5Z 4A3DI 4BXXI 3HOYI 4BY7I 2QLVB 4HH4A 1KRLA 3J80b 3CCEZ 2Q51A 1Z02A 1VQ51 2RBLA 1ZB8A 2RIQA 1YHQ1 3CCQ1 2H85A 1Q7Y1 1YIJZ 3I551 1VQ71 1VQ61 2O4HA 2QA41 2M48A 4RVGA 1YJW1 1TWHI 2JA8I 2QRDB 1N8R2 3PO3S 2Y0SA 3OW2Y 1YUKA 3PO3I 1RO0A 3HOXI 3NFZA 3M4OI 3I07A 4NBHA 1ZB9A 3CCM1 3CD61 5T64A 2JIOA 1Q812 1YJ9Z 4RVDA 1NUIA 2VUGA 4E2YA 1VQOZ 2OTLZ 1KQSY 2GTIA 1FDIA 3CCS1 3S2HI 3VMHA 3I4NI 1I3QI 1QVGZ 2E2II 4E33A 1I50I 3GTKI 4A3CI 1K732 4NBCA 4DGLA 3S1QI 1QF8A 1LQLA 2PMZA 2OTJZ 2NAPA 1M1K1 2DE6A 3IFUA 5AN9F 4NBDA 3TE5B 4E2ZA 2IZ4A 1Q821 4CL1A 2RPRA 4A3KI 1QVFY 5C44I 3G4S1 3CCU1 2VPZA 3LUSA 3HOVI 3GTQI 2P3YA 3ESWA 1Q861 2HU9A 1YHQZ 2HF1A 2ZAEB 1W2BZ 3KIHA 3RZOI 2GTHA 1N8R1 5A2Qf 1USPA 1TWFI 2JIMA 3CCLZ 2DE5A 1Y1WI 3MZKB 2VPXA 1NJI2 3VB9A 3EERA 5C3EI 2I3CA 1VQ8Z 2QA4Z 2YADA 5IT9f 1JJ2Y 2NVYI 1SIWA 4A3II 1VQ4Z 3CCQZ 5CM2M 3FQMA 3CME1 3D2LA 1QVFZ 2QEXZ 5C4JI 4MRIA 1X0TA 1RQFA 4NBGA 1S72Z 5T6BA 2NVTI 1ML8A 2JIRA 1VLAA 1VQKZ 4MD9A 1WIIA 4NB9A 5D1OB 4MD7A 1Q811 2VPWA 2OOXB 4HGYA 1VQO1 4NBBA 1Y8CA 1YIT1 2K3RA 4A3MI 3G71Z 3GTOI 3PO2I 4E31A 1TWCI 1M902 2B63I 5C4XI 1RLYA 4A3LI 3VMIA 1DL6A 1USPB 2PK7A 2JS4A 3U50C 3GCFA 3VMGA 3S14I 1R9TI 3FKII 1WCMI 1Q7Y2 3CQZI 3CCV1 4NFRA 3H0GI 1VQ6Z 3J7A4 1YJ91 4A3GI 4Y52I 2JIQA 3S2DI 1Q862 1YUAA 1NP6A 2E2JI 2P28A 4E2WA 3HOUI 2GU2A 2IZ3A 2Q4ZA 3S16I 3F3FC 5FLXf 3BG0B 1JWHC 2JIPA 3MONA 4RVFA 2IV2X 4DK1A 4NH1C 3T4NB 1VQM1 3I4MI 5LL6f 3J80f 3P5JB 2KPIA 4QTTA 3I55Z 3GTMS 3CXCY 1L1OC
chains in the Genus database with same CATH topology
2R6MA 2M6NA 4HGZA 3NDJA 2YU9I 3H3VJ 1TFIA 2F4OA 3MZLB 1YJNZ 4NBAA 2LIYA 4RVHA 4A3JI 1Y1VI 3HOWI 2PM9A 3HKZA 3KIFA 2O53A 2BJOA 4BY1I 4E30A 3CPWY 1TWAI 1Z03A 3GTMI 3CCSZ 1K9M1 3CC71 3G6E1 1YI2Z 5FLMI 3FQQA 3F3PC 1KD12 4MONA 1X3WA 5D1OA 4Y7NI 2VUMI 2LFUA 4QTUA 1M901 3CMAZ 3TDHB 1ZH1A 3CCMZ 3JAMb 1VQ91 3IF8A 1VQK1 1PFTA 2NVXI 3J81b 3GKQA 2W03A 4MD8A 1S721 2VF1A 2JA5I 4AYBA 3HOZI 2JA6I 5A2Qb 3G4SZ 3NH4A 3CCR1 3VTNA 5IP7I 3CMA1 2W04A 3GTPI 3G711 3K7AI 4BBSI 2JMOA 2OOYB 1YITZ 3S15I 2V8JA 3NDIA 3I56Z 3G6EZ 1YI21 2OZKA 3CC7Z 3Q87A 1RO2A 2QRCB 3D6WA 2JA7I 1K8A2 2RHBA 2AKLA 4A3BI 3CCE1 1VQPZ 4A3EI 1RO4A 4S1TA 2E2HI 2R93I 5IP9I 4DQYB 3CC21 1M1K2 1N2FA 2RT9A 2R7ZI 3CMEZ 1P9NA 1Z01A 3I561 4TNUA 1VQLZ 2QR1B 4RS4A 1SFOI 1VQL1 3M3YI 3GTGI 4NBEA 3CC4Z 5FLXb 2WB1A 3CD6Z 3CPWZ 4BBRI 1W2BY 1VQP1 1KC82 5IT9b 2J6AA 4E32A 2V8IA 3CCL1 3CCJZ 3CCJ1 3NH8A 2JR6A 1QYPA 1K9M2 1K731 1VQ9Z 1NJI1 1Q822 2QEX1 3RZDI 1YJWZ 3BG1B 3CC41 4A93I 1VQ41 2QKDA 1JJ2Z 2E9HA 1KD11 1VQMZ 2JNYA 4MXUA 2QREB 2F4MA 2OTJ1 3CC2Z 1X3ZA 4A3FI 2K5RA 2WAQA 2G2KA 5D1PA 3D9XA 3EEDA 3QWUA 3CXCZ 1K8A1 3S17I 2KI7B 4RV9A 4X6AI 4NB8A 3OW2Z 4XX2A 1YJN1 3GTLI 5T67A 2OTL1 2V8KA 1I6HI 3NH5A 3IX0A 4NBFA 4E2XA 1VQN1 2NVQI 3GTJI 3CCRZ 1WW9A 1YIJ1 3S1RI 2EGTA 4EWCA 4NOZA 3S1MI 1RNIA 3S1NI 1KC81 2DE7A 1Y1VS 1QVGY 1TWGI 3JAMf 3CCUZ 2JUBA 1VQNZ 3J81f 1VQ7Z 4MH4A 1KQSZ 1K83I 2R92I 1S7MA 3CCVZ 1VQ81 1VQ5Z 4A3DI 4BXXI 3HOYI 4BY7I 2QLVB 4HH4A 1KRLA 3J80b 3CCEZ 2Q51A 1Z02A 1VQ51 2RBLA 1ZB8A 2RIQA 1YHQ1 3CCQ1 2H85A 1Q7Y1 1YIJZ 3I551 1VQ71 1VQ61 2O4HA 2QA41 2M48A 4RVGA 1YJW1 1TWHI 2JA8I 2QRDB 1N8R2 3PO3S 2Y0SA 3OW2Y 1YUKA 3PO3I 1RO0A 3HOXI 3NFZA 3M4OI 3I07A 4NBHA 1ZB9A 3CCM1 3CD61 5T64A 1Q812 1YJ9Z 4RVDA 1NUIA 2VUGA 4E2YA 1VQOZ 2OTLZ 1KQSY 2GTIA 3CCS1 3S2HI 3VMHA 3I4NI 1I3QI 1QVGZ 2E2II 4E33A 1I50I 3GTKI 4A3CI 1K732 4NBCA 4DGLA 3S1QI 1QF8A 1LQLA 2PMZA 2OTJZ 1M1K1 2DE6A 3IFUA 5AN9F 4NBDA 3TE5B 4E2ZA 2IZ4A 1Q821 4CL1A 2RPRA 4A3KI 1QVFY 5C44I 3G4S1 3CCU1 3HOVI 3LUSA 3GTQI 2P3YA 3ESWA 1Q861 2HU9A 1YHQZ 2HF1A 2ZAEB 1W2BZ 3KIHA 3RZOI 2GTHA 1N8R1 5A2Qf 1USPA 1TWFI 3CCLZ 2DE5A 1Y1WI 3MZKB 1NJI2 3VB9A 3EERA 5C3EI 2I3CA 1VQ8Z 2QA4Z 2YADA 5IT9f 1JJ2Y 2NVYI 4A3II 1VQ4Z 3CCQZ 5CM2M 3FQMA 3CME1 1QVFZ 2QEXZ 5C4JI 4MRIA 1X0TA 1RQFA 4NBGA 1S72Z 5T6BA 2NVTI 1ML8A 1VLAA 1VQKZ 4MD9A 1WIIA 4NB9A 5D1OB 4MD7A 1Q811 2OOXB 4HGYA 1VQO1 4NBBA 1YIT1 2K3RA 4A3MI 3G71Z 3GTOI 3PO2I 4E31A 1TWCI 1M902 2B63I 5C4XI 1RLYA 4A3LI 3VMIA 1DL6A 1USPB 2PK7A 2JS4A 3U50C 3GCFA 3VMGA 3S14I 1R9TI 3FKII 1WCMI 1Q7Y2 3CQZI 3CCV1 4NFRA 3H0GI 1VQ6Z 3J7A4 1YJ91 4A3GI 4Y52I 3S2DI 1Q862 1YUAA 1NP6A 2E2JI 2P28A 4E2WA 3HOUI 2GU2A 2IZ3A 2Q4ZA 3S16I 3F3FC 5FLXf 3BG0B 1JWHC 3MONA 4RVFA 4DK1A 4NH1C 3T4NB 1VQM1 3I4MI 5LL6f 3J80f 3P5JB 2KPIA 4QTTA 3I55Z 3GTMS 3CXCY 1L1OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J6A A;  2RBL A;  1ZB8 A;  2NVY I;  2YU9 I;  3H3V J;  1TFI A;  2F4O A;  2JR6 A;  4NBA A;  4A3I I;  1QYP A;  5CM2 M;  4A3J I;  1Y1V I;  3HOW I;  2BJO A;  4BY1 I;  3RZD I;  1TWH I;  5C4J I;  2JA8 I;  1TWA I;  4A93 I;  4NBG A;  3GTM I;  2JNY A;  3PO3 S;  2NVT I;  1ML8 A;  3PO3 I;  1VLA A;  3HOX I;  5FLM I;  3M4O I;  2F4M A;  4NB9 A;  3I07 A;  1X3W A;  4Y7N I;  1X3Z A;  2VUM I;  4A3F I;  2K5R A;  4NBB A;  4QTU A;  4NBH A;  1ZB9 A;  4A3M I;  3S17 I;  3GTO I;  3PO2 I;  1TWC I;  2B63 I;  4X6A I;  4NB8 A;  5C4X I;  1RLY A;  4A3L I;  4XX2 A;  1PFT A;  2NVX I;  3VMI A;  1NUI A;  1DL6 A;  1USP B;  3GKQ A;  3GTL I;  2JA5 I;  3S2H I;  1I6H I;  2PK7 A;  3HOZ I;  3VMH A;  2JS4 A;  2JA6 I;  3I4N I;  3U50 C;  4NBF A;  3GCF A;  1I3Q I;  2NVQ I;  5IP7 I;  3GTJ I;  3VMG A;  2E2I I;  3S14 I;  1R9T I;  1WW9 A;  3FKI I;  3S1R I;  3GTP I;  3K7A I;  4BBS I;  1I50 I;  1WCM I;  3S15 I;  3CQZ I;  3GTK I;  4A3C I;  3S1Q I;  4NBC A;  4NOZ A;  1LQL A;  3Q87 A;  3S1M I;  2DE6 A;  3H0G I;  3S1N I;  2DE7 A;  4NBD A;  3D6W A;  4A3G I;  1Y1V S;  4Y52 I;  2JA7 I;  1TWG I;  4A3K I;  4A3B I;  2AKL A;  5C44 I;  3S2D I;  1YUA A;  4A3E I;  2E2J I;  1RO4 A;  3HOV I;  3LUS A;  2E2H I;  2R93 I;  5IP9 I;  3HOU I;  3GTQ I;  2P3Y A;  3ESW A;  1N2F A;  2HF1 A;  3S16 I;  2R7Z I;  4MH4 A;  3RZO I;  1K83 I;  2R92 I;  1SFO I;  3M3Y I;  3GTG I;  4NBE A;  1USP A;  1TWF I;  2DE5 A;  1Y1W I;  4A3D I;  4BXX I;  3I4M I;  3HOY I;  4BY7 I;  2KPI A;  4QTT A;  3EER A;  3VB9 A;  5C3E I;  4BBR I;  3GTM S;  1L1O C; 
#chains in the Genus database with same CATH topology
 2AYD A;  2R6M A;  1QXF A;  2M6N A;  4HGZ A;  3NDJ A;  2YU9 I;  3H3V J;  1TFI A;  2F4O A;  3MZL B;  1YJN Z;  4NBA A;  2LIY A;  4RVH A;  4A3J I;  1Y1V I;  3HOW I;  2PM9 A;  3HKZ A;  3KIF A;  2O53 A;  2BJO A;  4BY1 I;  4E30 A;  3CPW Y;  1TWA I;  1Z03 A;  3GTM I;  3CCS Z;  1K9M 1;  1WZN A;  3CC7 1;  3G6E 1;  1YI2 Z;  5FLM I;  3FQQ A;  3F3P C;  1KD1 2;  4MON A;  1X3W A;  5D1O A;  4Y7N I;  2VUM I;  2LFU A;  4QTU A;  1M90 1;  3CMA Z;  3TDH B;  1ZH1 A;  3CCM Z;  3JAM b;  1VQ9 1;  3IF8 A;  1VQK 1;  3IR7 A;  1PFT A;  2NVX I;  3J81 b;  3GKQ A;  2W03 A;  4MD8 A;  1S72 1;  2VF1 A;  2JA5 I;  4AYB A;  1FDO A;  3HOZ I;  2JA6 I;  5A2Q b;  3G4S Z;  3NH4 A;  3CCR 1;  3VTN A;  5IP7 I;  3CMA 1;  2W04 A;  3GTP I;  3G71 1;  3K7A I;  4BBS I;  2JMO A;  2OOY B;  1YIT Z;  3S15 I;  2V8J A;  3NDI A;  3I56 Z;  3G6E Z;  1YI2 1;  2OZK A;  3CC7 Z;  3Q87 A;  2V45 A;  1AA6 A;  1RO2 A;  2QRC B;  3D6W A;  2JA7 I;  1K8A 2;  2RHB A;  2AKL A;  4A3B I;  3CCE 1;  1VQP Z;  4A3E I;  1RO4 A;  4S1T A;  2E2H I;  2R93 I;  5IP9 I;  4DQY B;  3CC2 1;  1M1K 2;  1N2F A;  2RT9 A;  2R7Z I;  3CME Z;  1P9N A;  1Z01 A;  3I56 1;  4TNU A;  2VPY A;  1VQL Z;  2QR1 B;  4RS4 A;  1SFO I;  1VQL 1;  3M3Y I;  3GTG I;  4NBE A;  2LEX A;  3CC4 Z;  5FLX b;  2WB1 A;  3CD6 Z;  3CPW Z;  4BBR I;  1W2B Y;  1VQP 1;  1KC8 2;  5IT9 b;  2J6A A;  4E32 A;  2V8I A;  3CCL 1;  3CCJ Z;  3CCJ 1;  3NH8 A;  2JR6 A;  1QYP A;  1K9M 2;  1K73 1;  1Q16 A;  1VQ9 Z;  1NJI 1;  1Q82 2;  2QEX 1;  3RZD I;  1YJW Z;  3BG1 B;  3CC4 1;  4A93 I;  1VQ4 1;  2QKD A;  1JJ2 Z;  2E9H A;  1KD1 1;  1VQM Z;  2JNY A;  4MXU A;  2QRE B;  2F4M A;  2OTJ 1;  3CC2 Z;  1X3Z A;  4A3F I;  2K5R A;  2WAQ A;  2G2K A;  5D1P A;  3D9X A;  3EED A;  3QWU A;  3CXC Z;  1K8A 1;  3S17 I;  2KI7 B;  4RV9 A;  4X6A I;  4NB8 A;  3OW2 Z;  4XX2 A;  1YJN 1;  3GTL I;  5T67 A;  2OTL 1;  2V8K A;  1I6H I;  3NH5 A;  2V3V A;  3IX0 A;  4NBF A;  2E7Z A;  4E2X A;  1VQN 1;  2NVQ I;  3GTJ I;  3CCR Z;  1WW9 A;  1YIJ 1;  3S1R I;  2EGT A;  4EWC A;  4NOZ A;  3S1M I;  1RNI A;  3S1N I;  1KC8 1;  2DE7 A;  1Y1V S;  1QVG Y;  1TWG I;  3JAM f;  3CCU Z;  2JUB A;  1VQN Z;  3J81 f;  1VQ7 Z;  4MH4 A;  1KQS Z;  1K83 I;  1WJ2 A;  2R92 I;  1S7M A;  3CCV Z;  1VQ8 1;  1VQ5 Z;  4A3D I;  4BXX I;  3HOY I;  4BY7 I;  2QLV B;  4HH4 A;  1KRL A;  3J80 b;  3CCE Z;  2Q51 A;  1Z02 A;  1VQ5 1;  2RBL A;  1ZB8 A;  2RIQ A;  1YHQ 1;  3CCQ 1;  2H85 A;  1Q7Y 1;  1YIJ Z;  3I55 1;  1VQ7 1;  1VQ6 1;  2O4H A;  2QA4 1;  2M48 A;  4RVG A;  1YJW 1;  1TWH I;  2JA8 I;  2QRD B;  1N8R 2;  3PO3 S;  2Y0S A;  3OW2 Y;  1YUK A;  3PO3 I;  1RO0 A;  3HOX I;  3NFZ A;  3M4O I;  3I07 A;  4NBH A;  1ZB9 A;  3CCM 1;  3CD6 1;  5T64 A;  2JIO A;  1Q81 2;  1YJ9 Z;  4RVD A;  1NUI A;  2VUG A;  4E2Y A;  1VQO Z;  2OTL Z;  1KQS Y;  2GTI A;  1FDI A;  3CCS 1;  3S2H I;  3VMH A;  3I4N I;  1I3Q I;  1QVG Z;  2E2I I;  4E33 A;  1I50 I;  3GTK I;  4A3C I;  1K73 2;  4NBC A;  4DGL A;  3S1Q I;  1QF8 A;  1LQL A;  2PMZ A;  2OTJ Z;  2NAP A;  1M1K 1;  2DE6 A;  3IFU A;  5AN9 F;  4NBD A;  3TE5 B;  4E2Z A;  2IZ4 A;  1Q82 1;  4CL1 A;  2RPR A;  4A3K I;  1QVF Y;  5C44 I;  3G4S 1;  3CCU 1;  2VPZ A;  3LUS A;  3HOV I;  3GTQ I;  2P3Y A;  3ESW A;  1Q86 1;  2HU9 A;  1YHQ Z;  2HF1 A;  2ZAE B;  1W2B Z;  3KIH A;  3RZO I;  2GTH A;  1N8R 1;  5A2Q f;  1USP A;  1TWF I;  2JIM A;  3CCL Z;  2DE5 A;  1Y1W I;  3MZK B;  2VPX A;  1NJI 2;  3VB9 A;  3EER A;  5C3E I;  2I3C A;  1VQ8 Z;  2QA4 Z;  2YAD A;  5IT9 f;  1JJ2 Y;  2NVY I;  1SIW A;  4A3I I;  1VQ4 Z;  3CCQ Z;  5CM2 M;  3FQM A;  3CME 1;  3D2L A;  1QVF Z;  2QEX Z;  5C4J I;  4MRI A;  1X0T A;  1RQF A;  4NBG A;  1S72 Z;  5T6B A;  2NVT I;  1ML8 A;  2JIR A;  1VLA A;  1VQK Z;  4MD9 A;  1WII A;  4NB9 A;  5D1O B;  4MD7 A;  1Q81 1;  2VPW A;  2OOX B;  4HGY A;  1VQO 1;  4NBB A;  1Y8C A;  1YIT 1;  2K3R A;  4A3M I;  3G71 Z;  3GTO I;  3PO2 I;  4E31 A;  1TWC I;  1M90 2;  2B63 I;  5C4X I;  1RLY A;  4A3L I;  3VMI A;  1DL6 A;  1USP B;  2PK7 A;  2JS4 A;  3U50 C;  3GCF A;  3VMG A;  3S14 I;  1R9T I;  3FKI I;  1WCM I;  1Q7Y 2;  3CQZ I;  3CCV 1;  4NFR A;  3H0G I;  1VQ6 Z;  3J7A 4;  1YJ9 1;  4A3G I;  4Y52 I;  2JIQ A;  3S2D I;  1Q86 2;  1YUA A;  1NP6 A;  2E2J I;  2P28 A;  4E2W A;  3HOU I;  2GU2 A;  2IZ3 A;  2Q4Z A;  3S16 I;  3F3F C;  5FLX f;  3BG0 B;  1JWH C;  2JIP A;  3MON A;  4RVF A;  2IV2 X;  4DK1 A;  4NH1 C;  3T4N B;  1VQM 1;  3I4M I;  5LL6 f;  3J80 f;  3P5J B;  2KPI A;  4QTT A;  3I55 Z;  3GTM S;  3CXC Y;  1L1O C; 
#chains in the Genus database with same CATH homology
 2R6M A;  2M6N A;  4HGZ A;  3NDJ A;  2YU9 I;  3H3V J;  1TFI A;  2F4O A;  3MZL B;  1YJN Z;  4NBA A;  2LIY A;  4RVH A;  4A3J I;  1Y1V I;  3HOW I;  2PM9 A;  3HKZ A;  3KIF A;  2O53 A;  2BJO A;  4BY1 I;  4E30 A;  3CPW Y;  1TWA I;  1Z03 A;  3GTM I;  3CCS Z;  1K9M 1;  3CC7 1;  3G6E 1;  1YI2 Z;  5FLM I;  3FQQ A;  3F3P C;  1KD1 2;  4MON A;  1X3W A;  5D1O A;  4Y7N I;  2VUM I;  2LFU A;  4QTU A;  1M90 1;  3CMA Z;  3TDH B;  1ZH1 A;  3CCM Z;  3JAM b;  1VQ9 1;  3IF8 A;  1VQK 1;  1PFT A;  2NVX I;  3J81 b;  3GKQ A;  2W03 A;  4MD8 A;  1S72 1;  2VF1 A;  2JA5 I;  4AYB A;  3HOZ I;  2JA6 I;  5A2Q b;  3G4S Z;  3NH4 A;  3CCR 1;  3VTN A;  5IP7 I;  3CMA 1;  2W04 A;  3GTP I;  3G71 1;  3K7A I;  4BBS I;  2JMO A;  2OOY B;  1YIT Z;  3S15 I;  2V8J A;  3NDI A;  3I56 Z;  3G6E Z;  1YI2 1;  2OZK A;  3CC7 Z;  3Q87 A;  1RO2 A;  2QRC B;  3D6W A;  2JA7 I;  1K8A 2;  2RHB A;  2AKL A;  4A3B I;  3CCE 1;  1VQP Z;  4A3E I;  1RO4 A;  4S1T A;  2E2H I;  2R93 I;  5IP9 I;  4DQY B;  3CC2 1;  1M1K 2;  1N2F A;  2RT9 A;  2R7Z I;  3CME Z;  1P9N A;  1Z01 A;  3I56 1;  4TNU A;  1VQL Z;  2QR1 B;  4RS4 A;  1SFO I;  1VQL 1;  3M3Y I;  3GTG I;  4NBE A;  3CC4 Z;  5FLX b;  2WB1 A;  3CD6 Z;  3CPW Z;  4BBR I;  1W2B Y;  1VQP 1;  1KC8 2;  5IT9 b;  2J6A A;  4E32 A;  2V8I A;  3CCL 1;  3CCJ Z;  3CCJ 1;  3NH8 A;  2JR6 A;  1QYP A;  1K9M 2;  1K73 1;  1VQ9 Z;  1NJI 1;  1Q82 2;  2QEX 1;  3RZD I;  1YJW Z;  3BG1 B;  3CC4 1;  4A93 I;  1VQ4 1;  2QKD A;  1JJ2 Z;  2E9H A;  1KD1 1;  1VQM Z;  2JNY A;  4MXU A;  2QRE B;  2F4M A;  2OTJ 1;  3CC2 Z;  1X3Z A;  4A3F I;  2K5R A;  2WAQ A;  2G2K A;  5D1P A;  3D9X A;  3EED A;  3QWU A;  3CXC Z;  1K8A 1;  3S17 I;  2KI7 B;  4RV9 A;  4X6A I;  4NB8 A;  3OW2 Z;  4XX2 A;  1YJN 1;  3GTL I;  5T67 A;  2OTL 1;  2V8K A;  1I6H I;  3NH5 A;  3IX0 A;  4NBF A;  4E2X A;  1VQN 1;  2NVQ I;  3GTJ I;  3CCR Z;  1WW9 A;  1YIJ 1;  3S1R I;  2EGT A;  4EWC A;  4NOZ A;  3S1M I;  1RNI A;  3S1N I;  1KC8 1;  2DE7 A;  1Y1V S;  1QVG Y;  1TWG I;  3JAM f;  3CCU Z;  2JUB A;  1VQN Z;  3J81 f;  1VQ7 Z;  4MH4 A;  1KQS Z;  1K83 I;  2R92 I;  1S7M A;  3CCV Z;  1VQ8 1;  1VQ5 Z;  4A3D I;  4BXX I;  3HOY I;  4BY7 I;  2QLV B;  4HH4 A;  1KRL A;  3J80 b;  3CCE Z;  2Q51 A;  1Z02 A;  1VQ5 1;  2RBL A;  1ZB8 A;  2RIQ A;  1YHQ 1;  3CCQ 1;  2H85 A;  1Q7Y 1;  1YIJ Z;  3I55 1;  1VQ7 1;  1VQ6 1;  2O4H A;  2QA4 1;  2M48 A;  4RVG A;  1YJW 1;  1TWH I;  2JA8 I;  2QRD B;  1N8R 2;  3PO3 S;  2Y0S A;  3OW2 Y;  1YUK A;  3PO3 I;  1RO0 A;  3HOX I;  3NFZ A;  3M4O I;  3I07 A;  4NBH A;  1ZB9 A;  3CCM 1;  3CD6 1;  5T64 A;  1Q81 2;  1YJ9 Z;  4RVD A;  1NUI A;  2VUG A;  4E2Y A;  1VQO Z;  2OTL Z;  1KQS Y;  2GTI A;  3CCS 1;  3S2H I;  3VMH A;  3I4N I;  1I3Q I;  1QVG Z;  2E2I I;  4E33 A;  1I50 I;  3GTK I;  4A3C I;  1K73 2;  4NBC A;  4DGL A;  3S1Q I;  1QF8 A;  1LQL A;  2PMZ A;  2OTJ Z;  1M1K 1;  2DE6 A;  3IFU A;  5AN9 F;  4NBD A;  3TE5 B;  4E2Z A;  2IZ4 A;  1Q82 1;  4CL1 A;  2RPR A;  4A3K I;  1QVF Y;  5C44 I;  3G4S 1;  3CCU 1;  3HOV I;  3LUS A;  3GTQ I;  2P3Y A;  3ESW A;  1Q86 1;  2HU9 A;  1YHQ Z;  2HF1 A;  2ZAE B;  1W2B Z;  3KIH A;  3RZO I;  2GTH A;  1N8R 1;  5A2Q f;  1USP A;  1TWF I;  3CCL Z;  2DE5 A;  1Y1W I;  3MZK B;  1NJI 2;  3VB9 A;  3EER A;  5C3E I;  2I3C A;  1VQ8 Z;  2QA4 Z;  2YAD A;  5IT9 f;  1JJ2 Y;  2NVY I;  4A3I I;  1VQ4 Z;  3CCQ Z;  5CM2 M;  3FQM A;  3CME 1;  1QVF Z;  2QEX Z;  5C4J I;  4MRI A;  1X0T A;  1RQF A;  4NBG A;  1S72 Z;  5T6B A;  2NVT I;  1ML8 A;  1VLA A;  1VQK Z;  4MD9 A;  1WII A;  4NB9 A;  5D1O B;  4MD7 A;  1Q81 1;  2OOX B;  4HGY A;  1VQO 1;  4NBB A;  1YIT 1;  2K3R A;  4A3M I;  3G71 Z;  3GTO I;  3PO2 I;  4E31 A;  1TWC I;  1M90 2;  2B63 I;  5C4X I;  1RLY A;  4A3L I;  3VMI A;  1DL6 A;  1USP B;  2PK7 A;  2JS4 A;  3U50 C;  3GCF A;  3VMG A;  3S14 I;  1R9T I;  3FKI I;  1WCM I;  1Q7Y 2;  3CQZ I;  3CCV 1;  4NFR A;  3H0G I;  1VQ6 Z;  3J7A 4;  1YJ9 1;  4A3G I;  4Y52 I;  3S2D I;  1Q86 2;  1YUA A;  1NP6 A;  2E2J I;  2P28 A;  4E2W A;  3HOU I;  2GU2 A;  2IZ3 A;  2Q4Z A;  3S16 I;  3F3F C;  5FLX f;  3BG0 B;  1JWH C;  3MON A;  4RVF A;  4DK1 A;  4NH1 C;  3T4N B;  1VQM 1;  3I4M I;  5LL6 f;  3J80 f;  3P5J B;  2KPI A;  4QTT A;  3I55 Z;  3GTM S;  3CXC Y;  1L1O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...