3S17I

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s17I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s17I02
4A3LI 1RO4A 3LUSA 4A3II 3GTKI 5IP9I 1I6HI 2PK7A 1I50I 4NBDA 1USPB 2AKLA 4NOZA 3GTOI 2DE6A 1VLAA 2JA7I 2JA5I 5C4JI 3HOWI 1DL6A 4BY1I 1RLYA 5IP7I 2JR6A 3GTGI 2KPIA 3PO3I 3GTMI 1TWGI 2E2II 1ML8A 1ZB9A 3EERA 3VMIA 3VB9A 5C4XI 4A3BI 3S2HI 3HOVI 3Q87A 2R7ZI 3PO3S 1N2FA 5C3EI 3I4MI 1Y1WI 3S1RI 5C44I 3H3VJ 3RZDI 1SFOI 3HOZI 1I3QI 3GTMS 1L1OC 1LQLA 4NBCA 1R9TI 4BY7I 1PFTA 3GCFA 1TWCI 4A3EI 4X6AI 3U50C 2R93I 3S1QI 3GTJI 3PO2I 4A3CI 3GKQA 2E2HI 1YUAA 3HOXI 3VMHA 3HOUI 3VMGA 3CQZI 2JA8I 4NBHA 3I07A 4NBGA 4Y7NI 4Y52I 4NB8A 3S1NI 1USPA 2K5RA 4MH4A 4NBEA 1WW9A 2F4MA 1Y1VI 4A3KI 3S16I 5FLMI 2BJOA 2YU9I 4BBSI 2P3YA 2JA6I 1WCMI 3GTPI 3S17I 2NVQI 2VUMI 2HF1A 4A3FI 2B63I 4A93I 3HOYI 3M3YI 1Y1VS 3S14I 2E2JI 3I4NI 3GTQI 1X3WA 4NBBA 3S2DI 2NVTI 3GTLI 3D6WA 2R92I 2NVXI 2RBLA 2J6AA 4QTTA 1QYPA 3FKII 3K7AI 1ZB8A 4NBAA 4XX2A 4A3GI 3H0GI 1TWFI 1TFIA 1TWHI 3M4OI 1TWAI 2JNYA 5CM2M 4NB9A 3ESWA 3RZOI 3S15I 2DE5A 2JS4A 1X3ZA 2NVYI 4A3MI 4NBFA 3S1MI 1K83I 2DE7A 4A3JI 4A3DI 4BXXI 1NUIA 2F4OA 4BBRI 4QTUA
chains in the Genus database with same CATH superfamily
4A3LI 3LUSA 4A3II 5IP9I 1I50I 2IZ4A 2JA7I 3HOWI 1KQSZ 1Q7Y2 1RLYA 1KQSY 5IP7I 1VQKZ 2IV2X 2V8KA 3J81b 4E2ZA 1TWGI 3CC71 1WJ2A 2RT9A 2E2II 1FDOA 3VTNA 3VB9A 3MZKB 4HH4A 5C3EI 3CC7Z 5D1OA 1I3QI 3G4S1 1K8A1 1VQ8Z 4BY7I 1Z01A 4X6AI 2RPRA 3IFUA 3U50C 2R93I 1NP6A 1X0TA 2QR1B 4AYBA 3P5JB 3CCEZ 3J7A4 5AN9F 1YUAA 3G4SZ 3CCJ1 1K9M2 5T64A 4NBGA 4NB8A 2HU9A 1FDIA 1QVFY 1SIWA 3CCJZ 3S16I 2BJOA 4MD9A 4RVHA 3J81f 2QEX1 3CC21 3JAMf 1WCMI 2VF1A 4E2XA 4A93I 3M3YI 2VPZA 3I4NI 1X3WA 2JIOA 3S2DI 1YJW1 3GTLI 3D9XA 2QEXZ 1VQMZ 3D6WA 3CC2Z 2J6AA 4A3GI 3I551 1VQN1 1TFIA 1TWHI 1YJWZ 2E7ZA 1AA6A 1KD12 2PM9A 3G711 5T6BA 3CCQ1 3RZOI 2OTJ1 4E31A 3S15I 1K732 2H85A 1K83I 1VQPZ 3G71Z 3CCQZ 1Q16A 3CCM1 4A3DI 4BXXI 2OTJZ 3GTMS 1Z03A 2O53A 1I6HI 4NBDA 4NOZA 4HGZA 2DE6A 4NFRA 4DQYB 1M902 2JA5I 5C4JI 3CCMZ 1WZNA 4CL1A 1N8R2 3NH8A 3NH5A 1Q7Y1 1QVGZ 4BY1I 1VQL1 2JR6A 3CC41 1QVGY 3BG0B 2KPIA 3PO3I 1KC82 1YHQ1 1ZB9A 3VMIA 5C4XI 4A3BI 1Q812 1W2BZ 3HOVI 1VQLZ 3Q87A 3CCL1 3CC4Z 2VUGA 2JUBA 2VPWA 3PO3S 1W2BY 1Q862 2WB1A 2OOYB 3S1RI 3F3FC 1VQ41 3I4MI 5C44I 3H3VJ 3RZDI 2M48A 1SFOI 1YHQZ 4E33A 1L1OC 2LFUA 3CCLZ 1PFTA 4A3EI 1VQ4Z 1VQ71 2LIYA 3CCS1 3S1QI 3GTJI 3G6E1 2GTIA 1Z02A 2M6NA 3PO2I 4A3CI 3JAMb 4E32A 1K9M1 2QREB 2JA8I 3I07A 4Y7NI 4RV9A 1NJI2 3CCSZ 1JWHC 2K5RA 3G6EZ 1WW9A 1JJ2Z 5D1PA 4EWCA 5A2Qf 4A3KI 1JJ2Y 1YIJ1 2P3YA 3CXCZ 1VQ91 3CXCY 2JIPA 2HF1A 4A3FI 2GU2A 3HOYI 1S7MA 1YIJZ 2RHBA 4QTTA 3D2LA 4RVFA 3CD61 1TWFI 4MRIA 1KD11 2JNYA 1YJ91 2OOXB 2OTL1 2DE5A 1Q822 2JS4A 1M1K2 3CD6Z 1K731 3S1MI 4S1TA 1YJ9Z 4MD8A 2K3RA 1YJN1 4BBRI 2OTLZ 2QRDB 2Q4ZA 3FQMA 2RIQA 1USPB 2AKLA 3EEDA 2JIQA 3NFZA 4DGLA 1M901 3FQQA 1N8R1 3KIHA 4MXUA 5IT9b 1DL6A 2AYDA 3GTGI 3NH4A 3CPWZ 3GTMI 2GTHA 3I55Z 3TE5B 1VQNZ 1KC81 2EGTA 4E2WA 1RO2A 1ML8A 2OZKA 3CCV1 3QWUA 1Q811 2R6MA 2R7ZI 1N2FA 1WIIA 1Q861 1ZH1A 5FLXf 3HOZI 3CCVZ 4RVDA 3IR7A 1LQLA 1R9TI 2G2KA 3GCFA 3CME1 1TWCI 1VQ61 5A2Qb 3GKQA 3TDHB 2E2HI 3HOXI 3VMHA 3NDJA 4NBHA 3CMEZ 2NAPA 1VQ6Z 2VPYA 4Y52I 2VPXA 3S1NI 2QA41 1NJI1 4NBEA 5IT9f 3J80f 2PMZA 2WAQA 2Q51A 1YI21 4BBSI 2JA6I 3CCU1 3CMA1 3GTPI 3MONA 2VUMI 4MONA 2B63I 3MZLB 4NH1C 1S721 4E30A 2I3CA 1VQ51 4HGYA 1YI2Z 2JIRA 5LL6f 2R92I 3CCUZ 3CMAZ 3FKII 3K7AI 1RQFA 1VQ7Z 1VQK1 4NBAA 4XX2A 1S72Z 2V45A 2V3VA 1VQ5Z 2V8IA 5D1OB 2QLVB 1P9NA 2LEXA 4NB9A 3ESWA 4E2YA 3CCR1 3T4NB 1X3ZA 4A3MI 1Q821 1M1K1 1YUKA 5T67A 2DE7A 4DK1A 1VQ81 1NUIA 2F4OA 1VQ9Z 3CCRZ 1RO4A 3GTKI 2PK7A 3GTOI 1VLAA 2V8JA 3CCE1 1VQO1 2W03A 5FLXb 2W04A 1VQOZ 3EERA 3S2HI 1QVFZ 2O4HA 2YADA 1Y1WI 2QKDA 2ZAEB 4TNUA 1QF8A 2Y0SA 1K8A2 1VQM1 4NBCA 1YJNZ 3J80b 2P28A 2IZ3A 3CPWY 3HOUI 3VMGA 3CQZI 2KI7B 3KIFA 3NDIA 1USPA 4MH4A 3IX0A 1RO0A 1RNIA 2F4MA 1Y1VI 4RVGA 5FLMI 1VQP1 2YU9I 2JMOA 3HKZA 4MD7A 1YIT1 2NVQI 3S17I 3S14I 1Y1VS 2JIMA 2E2JI 3GTQI 4NBBA 2NVTI 4RS4A 1QXFA 2NVXI 2RBLA 1KRLA 1QYPA 3IF8A 3F3PC 1YITZ 2QRCB 1ZB8A 2E9HA 3H0GI 3BG1B 3I561 3OW2Z 3M4OI 1TWAI 5CM2M 3OW2Y 2QA4Z 2NVYI 1Y8CA 4NBFA 3I56Z 4A3JI 4QTUA
chains in the Genus database with same CATH topology
4A3LI 3LUSA 4A3II 5IP9I 1I50I 2IZ4A 2JA7I 3HOWI 1KQSZ 1Q7Y2 1RLYA 1KQSY 5IP7I 1VQKZ 2V8KA 3J81b 4E2ZA 1TWGI 3CC71 2RT9A 2E2II 3VTNA 3VB9A 3MZKB 4HH4A 5C3EI 3CC7Z 5D1OA 1I3QI 3G4S1 1K8A1 1VQ8Z 4BY7I 1Z01A 4X6AI 2RPRA 3IFUA 3U50C 2R93I 1NP6A 1X0TA 2QR1B 4AYBA 3P5JB 3CCEZ 3J7A4 5AN9F 1YUAA 3G4SZ 3CCJ1 1K9M2 5T64A 4NBGA 4NB8A 2HU9A 1QVFY 3CCJZ 3S16I 2BJOA 4MD9A 4RVHA 3J81f 2QEX1 3CC21 3JAMf 1WCMI 2VF1A 4E2XA 4A93I 3M3YI 3I4NI 1X3WA 3S2DI 1YJW1 3GTLI 3D9XA 2QEXZ 1VQMZ 3D6WA 3CC2Z 2J6AA 4A3GI 3I551 1VQN1 1TFIA 1TWHI 1YJWZ 1KD12 2PM9A 3G711 5T6BA 3CCQ1 3RZOI 2OTJ1 4E31A 3S15I 1K732 2H85A 1K83I 1VQPZ 3G71Z 3CCQZ 3CCM1 4A3DI 4BXXI 2OTJZ 3GTMS 1Z03A 2O53A 1I6HI 4NBDA 4NOZA 4HGZA 2DE6A 4NFRA 4DQYB 1M902 2JA5I 5C4JI 3CCMZ 1N8R2 4CL1A 3NH8A 3NH5A 1Q7Y1 1QVGZ 4BY1I 1VQL1 2JR6A 3CC41 1QVGY 3BG0B 2KPIA 3PO3I 1KC82 1YHQ1 1ZB9A 3VMIA 5C4XI 4A3BI 1Q812 1W2BZ 3HOVI 1VQLZ 3Q87A 3CCL1 3CC4Z 2VUGA 2JUBA 3PO3S 1W2BY 1Q862 2WB1A 2OOYB 3S1RI 3F3FC 1VQ41 3I4MI 5C44I 3H3VJ 3RZDI 2M48A 1SFOI 1YHQZ 4E33A 1L1OC 2LFUA 3CCLZ 1PFTA 4A3EI 1VQ4Z 1VQ71 2LIYA 3CCS1 3S1QI 3GTJI 3G6E1 2GTIA 1Z02A 2M6NA 3PO2I 4A3CI 3JAMb 4E32A 1K9M1 2QREB 2JA8I 3I07A 4Y7NI 4RV9A 1NJI2 3CCSZ 1JWHC 2K5RA 3G6EZ 1WW9A 1JJ2Z 5D1PA 4EWCA 5A2Qf 4A3KI 1JJ2Y 1YIJ1 2P3YA 3CXCZ 1VQ91 3CXCY 2HF1A 4A3FI 2GU2A 3HOYI 1S7MA 1YIJZ 2RHBA 4QTTA 4RVFA 3CD61 1TWFI 4MRIA 1KD11 2JNYA 1YJ91 2OOXB 2OTL1 2DE5A 1Q822 2JS4A 1M1K2 3CD6Z 1K731 3S1MI 4S1TA 1YJ9Z 4MD8A 2K3RA 1YJN1 4BBRI 2OTLZ 2QRDB 2Q4ZA 3FQMA 2RIQA 1USPB 2AKLA 3EEDA 3NFZA 4DGLA 1M901 3FQQA 1N8R1 3KIHA 4MXUA 5IT9b 1DL6A 3GTGI 3NH4A 3CPWZ 3GTMI 2GTHA 3I55Z 3TE5B 1VQNZ 1KC81 2EGTA 4E2WA 1RO2A 1ML8A 2OZKA 3CCV1 3QWUA 1Q811 2R6MA 2R7ZI 1N2FA 1WIIA 1Q861 1ZH1A 5FLXf 3HOZI 3CCVZ 4RVDA 1LQLA 1R9TI 2G2KA 3GCFA 3CME1 1TWCI 1VQ61 5A2Qb 3GKQA 3TDHB 2E2HI 3HOXI 3VMHA 3NDJA 4NBHA 3CMEZ 1VQ6Z 4Y52I 3S1NI 2QA41 1NJI1 4NBEA 5IT9f 3J80f 2PMZA 2WAQA 2Q51A 1YI21 4BBSI 2JA6I 3CCU1 3CMA1 3GTPI 3MONA 2VUMI 4MONA 2B63I 3MZLB 4NH1C 1S721 4E30A 2I3CA 1VQ51 4HGYA 1YI2Z 5LL6f 2R92I 3CCUZ 3CMAZ 3FKII 3K7AI 1RQFA 1VQ7Z 1VQK1 4NBAA 4XX2A 1S72Z 1VQ5Z 2V8IA 5D1OB 2QLVB 1P9NA 4NB9A 3ESWA 4E2YA 3CCR1 3T4NB 1X3ZA 4A3MI 1Q821 1M1K1 1YUKA 5T67A 2DE7A 4DK1A 1VQ81 1NUIA 2F4OA 1VQ9Z 3CCRZ 1RO4A 3GTKI 2PK7A 3GTOI 1VLAA 2V8JA 3CCE1 1VQO1 2W03A 5FLXb 2W04A 1VQOZ 3EERA 3S2HI 1QVFZ 2O4HA 2YADA 1Y1WI 2QKDA 2ZAEB 4TNUA 1QF8A 2Y0SA 1K8A2 1VQM1 4NBCA 1YJNZ 3J80b 2P28A 2IZ3A 3CPWY 3HOUI 3VMGA 3CQZI 2KI7B 3KIFA 3NDIA 1USPA 4MH4A 3IX0A 1RO0A 1RNIA 2F4MA 1Y1VI 4RVGA 5FLMI 1VQP1 2YU9I 2JMOA 3HKZA 4MD7A 1YIT1 2NVQI 3S17I 3S14I 1Y1VS 2E2JI 3GTQI 4NBBA 2NVTI 4RS4A 2NVXI 2RBLA 1KRLA 1QYPA 3IF8A 3F3PC 1YITZ 2QRCB 1ZB8A 2E9HA 3H0GI 3BG1B 3I561 3OW2Z 3M4OI 1TWAI 5CM2M 3OW2Y 2QA4Z 2NVYI 4NBFA 3I56Z 4A3JI 4QTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3L I;  1RO4 A;  3LUS A;  4A3I I;  3GTK I;  5IP9 I;  1I6H I;  2PK7 A;  1I50 I;  4NBD A;  1USP B;  2AKL A;  4NOZ A;  3GTO I;  2DE6 A;  1VLA A;  2JA7 I;  2JA5 I;  5C4J I;  3HOW I;  1DL6 A;  4BY1 I;  1RLY A;  5IP7 I;  2JR6 A;  3GTG I;  2KPI A;  3PO3 I;  3GTM I;  1TWG I;  2E2I I;  1ML8 A;  1ZB9 A;  3EER A;  3VMI A;  3VB9 A;  5C4X I;  4A3B I;  3S2H I;  3HOV I;  3Q87 A;  2R7Z I;  3PO3 S;  1N2F A;  5C3E I;  3I4M I;  1Y1W I;  3S1R I;  5C44 I;  3H3V J;  3RZD I;  1SFO I;  3HOZ I;  1I3Q I;  3GTM S;  1L1O C;  1LQL A;  4NBC A;  1R9T I;  4BY7 I;  1PFT A;  3GCF A;  1TWC I;  4A3E I;  4X6A I;  3U50 C;  2R93 I;  3S1Q I;  3GTJ I;  3PO2 I;  4A3C I;  3GKQ A;  2E2H I;  1YUA A;  3HOX I;  3VMH A;  3HOU I;  3VMG A;  3CQZ I;  2JA8 I;  4NBH A;  3I07 A;  4NBG A;  4Y7N I;  4Y52 I;  4NB8 A;  3S1N I;  1USP A;  2K5R A;  4MH4 A;  4NBE A;  1WW9 A;  2F4M A;  1Y1V I;  4A3K I;  3S16 I;  5FLM I;  2BJO A;  2YU9 I;  4BBS I;  2P3Y A;  2JA6 I;  1WCM I;  3GTP I;  3S17 I;  2NVQ I;  2VUM I;  2HF1 A;  4A3F I;  2B63 I;  4A93 I;  3HOY I;  3M3Y I;  1Y1V S;  3S14 I;  2E2J I;  3I4N I;  3GTQ I;  1X3W A;  4NBB A;  3S2D I;  2NVT I;  3GTL I;  3D6W A;  2R92 I;  2NVX I;  2RBL A;  2J6A A;  4QTT A;  1QYP A;  3FKI I;  3K7A I;  1ZB8 A;  4NBA A;  4XX2 A;  4A3G I;  3H0G I;  1TWF I;  1TFI A;  1TWH I;  3M4O I;  1TWA I;  2JNY A;  5CM2 M;  4NB9 A;  3ESW A;  3RZO I;  3S15 I;  2DE5 A;  2JS4 A;  1X3Z A;  2NVY I;  4A3M I;  4NBF A;  3S1M I;  1K83 I;  2DE7 A;  4A3J I;  4A3D I;  4BXX I;  1NUI A;  2F4O A;  4BBR I;  4QTU A; 
#chains in the Genus database with same CATH topology
 4A3L I;  3LUS A;  4A3I I;  5IP9 I;  1I50 I;  2IZ4 A;  2JA7 I;  3HOW I;  1KQS Z;  1Q7Y 2;  1RLY A;  1KQS Y;  5IP7 I;  1VQK Z;  2IV2 X;  2V8K A;  3J81 b;  4E2Z A;  1TWG I;  3CC7 1;  1WJ2 A;  2RT9 A;  2E2I I;  1FDO A;  3VTN A;  3VB9 A;  3MZK B;  4HH4 A;  5C3E I;  3CC7 Z;  5D1O A;  1I3Q I;  3G4S 1;  1K8A 1;  1VQ8 Z;  4BY7 I;  1Z01 A;  4X6A I;  2RPR A;  3IFU A;  3U50 C;  2R93 I;  1NP6 A;  1X0T A;  2QR1 B;  4AYB A;  3P5J B;  3CCE Z;  3J7A 4;  5AN9 F;  1YUA A;  3G4S Z;  3CCJ 1;  1K9M 2;  5T64 A;  4NBG A;  4NB8 A;  2HU9 A;  1FDI A;  1QVF Y;  1SIW A;  3CCJ Z;  3S16 I;  2BJO A;  4MD9 A;  4RVH A;  3J81 f;  2QEX 1;  3CC2 1;  3JAM f;  1WCM I;  2VF1 A;  4E2X A;  4A93 I;  3M3Y I;  2VPZ A;  3I4N I;  1X3W A;  2JIO A;  3S2D I;  1YJW 1;  3GTL I;  3D9X A;  2QEX Z;  1VQM Z;  3D6W A;  3CC2 Z;  2J6A A;  4A3G I;  3I55 1;  1VQN 1;  1TFI A;  1TWH I;  1YJW Z;  2E7Z A;  1AA6 A;  1KD1 2;  2PM9 A;  3G71 1;  5T6B A;  3CCQ 1;  3RZO I;  2OTJ 1;  4E31 A;  3S15 I;  1K73 2;  2H85 A;  1K83 I;  1VQP Z;  3G71 Z;  3CCQ Z;  1Q16 A;  3CCM 1;  4A3D I;  4BXX I;  2OTJ Z;  3GTM S;  1Z03 A;  2O53 A;  1I6H I;  4NBD A;  4NOZ A;  4HGZ A;  2DE6 A;  4NFR A;  4DQY B;  1M90 2;  2JA5 I;  5C4J I;  3CCM Z;  1WZN A;  4CL1 A;  1N8R 2;  3NH8 A;  3NH5 A;  1Q7Y 1;  1QVG Z;  4BY1 I;  1VQL 1;  2JR6 A;  3CC4 1;  1QVG Y;  3BG0 B;  2KPI A;  3PO3 I;  1KC8 2;  1YHQ 1;  1ZB9 A;  3VMI A;  5C4X I;  4A3B I;  1Q81 2;  1W2B Z;  3HOV I;  1VQL Z;  3Q87 A;  3CCL 1;  3CC4 Z;  2VUG A;  2JUB A;  2VPW A;  3PO3 S;  1W2B Y;  1Q86 2;  2WB1 A;  2OOY B;  3S1R I;  3F3F C;  1VQ4 1;  3I4M I;  5C44 I;  3H3V J;  3RZD I;  2M48 A;  1SFO I;  1YHQ Z;  4E33 A;  1L1O C;  2LFU A;  3CCL Z;  1PFT A;  4A3E I;  1VQ4 Z;  1VQ7 1;  2LIY A;  3CCS 1;  3S1Q I;  3GTJ I;  3G6E 1;  2GTI A;  1Z02 A;  2M6N A;  3PO2 I;  4A3C I;  3JAM b;  4E32 A;  1K9M 1;  2QRE B;  2JA8 I;  3I07 A;  4Y7N I;  4RV9 A;  1NJI 2;  3CCS Z;  1JWH C;  2K5R A;  3G6E Z;  1WW9 A;  1JJ2 Z;  5D1P A;  4EWC A;  5A2Q f;  4A3K I;  1JJ2 Y;  1YIJ 1;  2P3Y A;  3CXC Z;  1VQ9 1;  3CXC Y;  2JIP A;  2HF1 A;  4A3F I;  2GU2 A;  3HOY I;  1S7M A;  1YIJ Z;  2RHB A;  4QTT A;  3D2L A;  4RVF A;  3CD6 1;  1TWF I;  4MRI A;  1KD1 1;  2JNY A;  1YJ9 1;  2OOX B;  2OTL 1;  2DE5 A;  1Q82 2;  2JS4 A;  1M1K 2;  3CD6 Z;  1K73 1;  3S1M I;  4S1T A;  1YJ9 Z;  4MD8 A;  2K3R A;  1YJN 1;  4BBR I;  2OTL Z;  2QRD B;  2Q4Z A;  3FQM A;  2RIQ A;  1USP B;  2AKL A;  3EED A;  2JIQ A;  3NFZ A;  4DGL A;  1M90 1;  3FQQ A;  1N8R 1;  3KIH A;  4MXU A;  5IT9 b;  1DL6 A;  2AYD A;  3GTG I;  3NH4 A;  3CPW Z;  3GTM I;  2GTH A;  3I55 Z;  3TE5 B;  1VQN Z;  1KC8 1;  2EGT A;  4E2W A;  1RO2 A;  1ML8 A;  2OZK A;  3CCV 1;  3QWU A;  1Q81 1;  2R6M A;  2R7Z I;  1N2F A;  1WII A;  1Q86 1;  1ZH1 A;  5FLX f;  3HOZ I;  3CCV Z;  4RVD A;  3IR7 A;  1LQL A;  1R9T I;  2G2K A;  3GCF A;  3CME 1;  1TWC I;  1VQ6 1;  5A2Q b;  3GKQ A;  3TDH B;  2E2H I;  3HOX I;  3VMH A;  3NDJ A;  4NBH A;  3CME Z;  2NAP A;  1VQ6 Z;  2VPY A;  4Y52 I;  2VPX A;  3S1N I;  2QA4 1;  1NJI 1;  4NBE A;  5IT9 f;  3J80 f;  2PMZ A;  2WAQ A;  2Q51 A;  1YI2 1;  4BBS I;  2JA6 I;  3CCU 1;  3CMA 1;  3GTP I;  3MON A;  2VUM I;  4MON A;  2B63 I;  3MZL B;  4NH1 C;  1S72 1;  4E30 A;  2I3C A;  1VQ5 1;  4HGY A;  1YI2 Z;  2JIR A;  5LL6 f;  2R92 I;  3CCU Z;  3CMA Z;  3FKI I;  3K7A I;  1RQF A;  1VQ7 Z;  1VQK 1;  4NBA A;  4XX2 A;  1S72 Z;  2V45 A;  2V3V A;  1VQ5 Z;  2V8I A;  5D1O B;  2QLV B;  1P9N A;  2LEX A;  4NB9 A;  3ESW A;  4E2Y A;  3CCR 1;  3T4N B;  1X3Z A;  4A3M I;  1Q82 1;  1M1K 1;  1YUK A;  5T67 A;  2DE7 A;  4DK1 A;  1VQ8 1;  1NUI A;  2F4O A;  1VQ9 Z;  3CCR Z;  1RO4 A;  3GTK I;  2PK7 A;  3GTO I;  1VLA A;  2V8J A;  3CCE 1;  1VQO 1;  2W03 A;  5FLX b;  2W04 A;  1VQO Z;  3EER A;  3S2H I;  1QVF Z;  2O4H A;  2YAD A;  1Y1W I;  2QKD A;  2ZAE B;  4TNU A;  1QF8 A;  2Y0S A;  1K8A 2;  1VQM 1;  4NBC A;  1YJN Z;  3J80 b;  2P28 A;  2IZ3 A;  3CPW Y;  3HOU I;  3VMG A;  3CQZ I;  2KI7 B;  3KIF A;  3NDI A;  1USP A;  4MH4 A;  3IX0 A;  1RO0 A;  1RNI A;  2F4M A;  1Y1V I;  4RVG A;  5FLM I;  1VQP 1;  2YU9 I;  2JMO A;  3HKZ A;  4MD7 A;  1YIT 1;  2NVQ I;  3S17 I;  3S14 I;  1Y1V S;  2JIM A;  2E2J I;  3GTQ I;  4NBB A;  2NVT I;  4RS4 A;  1QXF A;  2NVX I;  2RBL A;  1KRL A;  1QYP A;  3IF8 A;  3F3P C;  1YIT Z;  2QRC B;  1ZB8 A;  2E9H A;  3H0G I;  3BG1 B;  3I56 1;  3OW2 Z;  3M4O I;  1TWA I;  5CM2 M;  3OW2 Y;  2QA4 Z;  2NVY I;  1Y8C A;  4NBF A;  3I56 Z;  4A3J I;  4QTU A; 
#chains in the Genus database with same CATH homology
 4A3L I;  3LUS A;  4A3I I;  5IP9 I;  1I50 I;  2IZ4 A;  2JA7 I;  3HOW I;  1KQS Z;  1Q7Y 2;  1RLY A;  1KQS Y;  5IP7 I;  1VQK Z;  2V8K A;  3J81 b;  4E2Z A;  1TWG I;  3CC7 1;  2RT9 A;  2E2I I;  3VTN A;  3VB9 A;  3MZK B;  4HH4 A;  5C3E I;  3CC7 Z;  5D1O A;  1I3Q I;  3G4S 1;  1K8A 1;  1VQ8 Z;  4BY7 I;  1Z01 A;  4X6A I;  2RPR A;  3IFU A;  3U50 C;  2R93 I;  1NP6 A;  1X0T A;  2QR1 B;  4AYB A;  3P5J B;  3CCE Z;  3J7A 4;  5AN9 F;  1YUA A;  3G4S Z;  3CCJ 1;  1K9M 2;  5T64 A;  4NBG A;  4NB8 A;  2HU9 A;  1QVF Y;  3CCJ Z;  3S16 I;  2BJO A;  4MD9 A;  4RVH A;  3J81 f;  2QEX 1;  3CC2 1;  3JAM f;  1WCM I;  2VF1 A;  4E2X A;  4A93 I;  3M3Y I;  3I4N I;  1X3W A;  3S2D I;  1YJW 1;  3GTL I;  3D9X A;  2QEX Z;  1VQM Z;  3D6W A;  3CC2 Z;  2J6A A;  4A3G I;  3I55 1;  1VQN 1;  1TFI A;  1TWH I;  1YJW Z;  1KD1 2;  2PM9 A;  3G71 1;  5T6B A;  3CCQ 1;  3RZO I;  2OTJ 1;  4E31 A;  3S15 I;  1K73 2;  2H85 A;  1K83 I;  1VQP Z;  3G71 Z;  3CCQ Z;  3CCM 1;  4A3D I;  4BXX I;  2OTJ Z;  3GTM S;  1Z03 A;  2O53 A;  1I6H I;  4NBD A;  4NOZ A;  4HGZ A;  2DE6 A;  4NFR A;  4DQY B;  1M90 2;  2JA5 I;  5C4J I;  3CCM Z;  1N8R 2;  4CL1 A;  3NH8 A;  3NH5 A;  1Q7Y 1;  1QVG Z;  4BY1 I;  1VQL 1;  2JR6 A;  3CC4 1;  1QVG Y;  3BG0 B;  2KPI A;  3PO3 I;  1KC8 2;  1YHQ 1;  1ZB9 A;  3VMI A;  5C4X I;  4A3B I;  1Q81 2;  1W2B Z;  3HOV I;  1VQL Z;  3Q87 A;  3CCL 1;  3CC4 Z;  2VUG A;  2JUB A;  3PO3 S;  1W2B Y;  1Q86 2;  2WB1 A;  2OOY B;  3S1R I;  3F3F C;  1VQ4 1;  3I4M I;  5C44 I;  3H3V J;  3RZD I;  2M48 A;  1SFO I;  1YHQ Z;  4E33 A;  1L1O C;  2LFU A;  3CCL Z;  1PFT A;  4A3E I;  1VQ4 Z;  1VQ7 1;  2LIY A;  3CCS 1;  3S1Q I;  3GTJ I;  3G6E 1;  2GTI A;  1Z02 A;  2M6N A;  3PO2 I;  4A3C I;  3JAM b;  4E32 A;  1K9M 1;  2QRE B;  2JA8 I;  3I07 A;  4Y7N I;  4RV9 A;  1NJI 2;  3CCS Z;  1JWH C;  2K5R A;  3G6E Z;  1WW9 A;  1JJ2 Z;  5D1P A;  4EWC A;  5A2Q f;  4A3K I;  1JJ2 Y;  1YIJ 1;  2P3Y A;  3CXC Z;  1VQ9 1;  3CXC Y;  2HF1 A;  4A3F I;  2GU2 A;  3HOY I;  1S7M A;  1YIJ Z;  2RHB A;  4QTT A;  4RVF A;  3CD6 1;  1TWF I;  4MRI A;  1KD1 1;  2JNY A;  1YJ9 1;  2OOX B;  2OTL 1;  2DE5 A;  1Q82 2;  2JS4 A;  1M1K 2;  3CD6 Z;  1K73 1;  3S1M I;  4S1T A;  1YJ9 Z;  4MD8 A;  2K3R A;  1YJN 1;  4BBR I;  2OTL Z;  2QRD B;  2Q4Z A;  3FQM A;  2RIQ A;  1USP B;  2AKL A;  3EED A;  3NFZ A;  4DGL A;  1M90 1;  3FQQ A;  1N8R 1;  3KIH A;  4MXU A;  5IT9 b;  1DL6 A;  3GTG I;  3NH4 A;  3CPW Z;  3GTM I;  2GTH A;  3I55 Z;  3TE5 B;  1VQN Z;  1KC8 1;  2EGT A;  4E2W A;  1RO2 A;  1ML8 A;  2OZK A;  3CCV 1;  3QWU A;  1Q81 1;  2R6M A;  2R7Z I;  1N2F A;  1WII A;  1Q86 1;  1ZH1 A;  5FLX f;  3HOZ I;  3CCV Z;  4RVD A;  1LQL A;  1R9T I;  2G2K A;  3GCF A;  3CME 1;  1TWC I;  1VQ6 1;  5A2Q b;  3GKQ A;  3TDH B;  2E2H I;  3HOX I;  3VMH A;  3NDJ A;  4NBH A;  3CME Z;  1VQ6 Z;  4Y52 I;  3S1N I;  2QA4 1;  1NJI 1;  4NBE A;  5IT9 f;  3J80 f;  2PMZ A;  2WAQ A;  2Q51 A;  1YI2 1;  4BBS I;  2JA6 I;  3CCU 1;  3CMA 1;  3GTP I;  3MON A;  2VUM I;  4MON A;  2B63 I;  3MZL B;  4NH1 C;  1S72 1;  4E30 A;  2I3C A;  1VQ5 1;  4HGY A;  1YI2 Z;  5LL6 f;  2R92 I;  3CCU Z;  3CMA Z;  3FKI I;  3K7A I;  1RQF A;  1VQ7 Z;  1VQK 1;  4NBA A;  4XX2 A;  1S72 Z;  1VQ5 Z;  2V8I A;  5D1O B;  2QLV B;  1P9N A;  4NB9 A;  3ESW A;  4E2Y A;  3CCR 1;  3T4N B;  1X3Z A;  4A3M I;  1Q82 1;  1M1K 1;  1YUK A;  5T67 A;  2DE7 A;  4DK1 A;  1VQ8 1;  1NUI A;  2F4O A;  1VQ9 Z;  3CCR Z;  1RO4 A;  3GTK I;  2PK7 A;  3GTO I;  1VLA A;  2V8J A;  3CCE 1;  1VQO 1;  2W03 A;  5FLX b;  2W04 A;  1VQO Z;  3EER A;  3S2H I;  1QVF Z;  2O4H A;  2YAD A;  1Y1W I;  2QKD A;  2ZAE B;  4TNU A;  1QF8 A;  2Y0S A;  1K8A 2;  1VQM 1;  4NBC A;  1YJN Z;  3J80 b;  2P28 A;  2IZ3 A;  3CPW Y;  3HOU I;  3VMG A;  3CQZ I;  2KI7 B;  3KIF A;  3NDI A;  1USP A;  4MH4 A;  3IX0 A;  1RO0 A;  1RNI A;  2F4M A;  1Y1V I;  4RVG A;  5FLM I;  1VQP 1;  2YU9 I;  2JMO A;  3HKZ A;  4MD7 A;  1YIT 1;  2NVQ I;  3S17 I;  3S14 I;  1Y1V S;  2E2J I;  3GTQ I;  4NBB A;  2NVT I;  4RS4 A;  2NVX I;  2RBL A;  1KRL A;  1QYP A;  3IF8 A;  3F3P C;  1YIT Z;  2QRC B;  1ZB8 A;  2E9H A;  3H0G I;  3BG1 B;  3I56 1;  3OW2 Z;  3M4O I;  1TWA I;  5CM2 M;  3OW2 Y;  2QA4 Z;  2NVY I;  4NBF A;  3I56 Z;  4A3J I;  4QTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...