3S17I

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s17I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s17I02
2KPIA 1VLAA 1RO4A 2JR6A 4NBBA 4Y52I 2AKLA 2NVYI 5C44I 1Y1VI 3GKQA 4BBSI 1I3QI 3S15I 3I4MI 1RLYA 2RBLA 3S16I 1I6HI 3M4OI 4A3GI 3HOZI 2JNYA 3GTKI 3GTJI 3VMIA 4NBHA 1USPA 2J6AA 1PFTA 1NUIA 2DE7A 3RZOI 1X3ZA 2YU9I 3M3YI 3U50C 1TFIA 2JA5I 4A3MI 3H3VJ 3GTOI 3PO2I 4BY7I 3I07A 2B63I 2R93I 3GTGI 2HF1A 5IP9I 1TWCI 1Y1WI 1I50I 2JA6I 2R92I 5C4JI 5C3EI 1QYPA 4A3JI 3S1RI 4QTUA 4A3FI 2JS4A 3D6WA 1Y1VS 3H0GI 3LUSA 4BY1I 4NBGA 4Y7NI 3HOYI 4NB8A 3PO3I 3GTMS 3S1NI 2VUMI 5IP7I 4NBDA 3S2DI 4NBAA 1WW9A 3FKII 2NVQI 3HOWI 3HOXI 2E2II 1YUAA 4X6AI 2P3YA 4NBEA 4A3II 4BXXI 1TWGI 2E2HI 1X3WA 3S17I 3PO3S 4MH4A 1WCMI 3CQZI 3VB9A 3GTQI 3ESWA 1SFOI 4A3CI 5CM2M 1L1OC 3RZDI 4NB9A 1ML8A 3EERA 2NVXI 1LQLA 3GTMI 4NOZA 1TWAI 4XX2A 2BJOA 1R9TI 1TWFI 3I4NI 3GTLI 4A3LI 4A3DI 2F4MA 1USPB 3Q87A 3S1QI 2PK7A 2DE6A 2JA8I 1DL6A 4A93I 4A3KI 3GCFA 1K83I 3K7AI 2DE5A 3HOUI 5FLMI 5C4XI 4A3EI 1ZB8A 3S14I 4A3BI 2F4OA 3S2HI 4BBRI 4NBCA 3VMGA 3VMHA 3S1MI 2R7ZI 3HOVI 1TWHI 2JA7I 2E2JI 3GTPI 2K5RA 1ZB9A 4NBFA 1N2FA 2NVTI 4QTTA
chains in the Genus database with same CATH superfamily
2V3VA 2VPYA 5D1PA 3HKZA 1RO4A 1X0TA 2OTLZ 4Y52I 2AKLA 3CC21 5IT9b 3I561 4MD7A 3F3FC 4EWCA 1WJ2A 3J81b 3S16I 1I6HI 3GTKI 1KD11 4NBHA 2DE7A 2P28A 3VTNA 4E2ZA 3U50C 3CXCZ 3NDJA 1TFIA 3PO2I 3GTOI 3I07A 3GTGI 1Y1WI 3S1RI 1Z02A 4QTUA 4BY1I 2JS4A 3H0GI 3LUSA 1W2BZ 1VQNZ 1VQP1 3G71Z 3HOYI 2QEX1 3GTMS 1RO0A 3S1NI 4NH1C 2G2KA 4CL1A 2O53A 3QWUA 4NBEA 1VQMZ 1X3WA 1VQKZ 2E9HA 2RIQA 2JMOA 1KD12 3ESWA 1NJI1 5IT9f 3KIHA 1LQLA 4NOZA 2LEXA 2BJOA 3CCE1 1W2BY 2F4MA 2I3CA 4HGZA 3CMEZ 1Q812 2PK7A 2LIYA 1YIJZ 3IF8A 2JA8I 2VPWA 4A3KI 1K83I 1VQ71 1VQLZ 5A2Qf 1VQ8Z 3IFUA 3NH4A 3CCQ1 3G6EZ 2QA41 1WIIA 2K3RA 1YJNZ 1K9M1 1FDIA 3MZLB 2IV2X 3G6E1 1S7MA 3IX0A 2VPZA 3NDIA 1Z03A 2R6MA 1TWHI 3EEDA 3CCMZ 1VQ41 3GTPI 1ZB9A 4NBFA 4QTTA 2V8JA 5LL6f 1YIJ1 1QVGZ 2JR6A 4NBBA 5FLXf 4RVDA 3MZKB 5C44I 1Y1VI 3GKQA 4MRIA 3S15I 3CCUZ 1YHQ1 4DK1A 2RBLA 1YUKA 4RV9A 1VQ91 3JAMf 2QRDB 1FDOA 3VMIA 2J6AA 1K732 2OZKA 1NUIA 2W03A 1M902 2YU9I 3OW2Z 2JA5I 4DGLA 2HF1A 1TWCI 5IP9I 4E2YA 1I50I 4E32A 2QA4Z 5C4JI 4A3JI 2Q4ZA 3CCQZ 1YITZ 3CCS1 1VQ81 2IZ4A 2JIPA 4NBGA 3CC4Z 3PO3I 1WZNA 5AN9F 5IP7I 4NBDA 1VQN1 3S2DI 3FKII 2NVQI 1YUAA 1QVFZ 3J80b 2VPXA 3CCJ1 2QLVB 1TWGI 3FQQA 3S17I 1SIWA 1N8R2 4MH4A 4A3CI 3RZDI 2JIMA 1ML8A 3EERA 4RVFA 3GTMI 1R9TI 2AYDA 4MD8A 3I55Z 1USPB 2HU9A 3S1QI 3NFZA 3TDHB 3G4S1 2QEXZ 2VF1A 2M48A 3KIFA 1VQPZ 2W04A 4A93I 3GCFA 2PMZA 2DE5A 2M6NA 3D9XA 1ZB8A 5D1OB 1Y8CA 2O4HA 5T6BA 4DQYB 3S14I 4A3BI 1KRLA 1K8A2 4NBCA 2H85A 3VMHA 3S1MI 3HOVI 1YJ9Z 4E30A 2OTJZ 3NH5A 1VQ61 2JA7I 2E2JI 1Q861 2K5RA 4RVHA 2OOXB 3BG1B 3I551 2NVTI 1YIT1 3J81f 2RT9A 2NVYI 2RPRA 1VQOZ 1KC81 3CCRZ 3M4OI 3HOZI 2JIRA 2JNYA 1Q862 1AA6A 2E7ZA 2VUGA 1USPA 1PFTA 3CCJZ 1YHQZ 3CCU1 1Q7Y2 4A3MI 3CCVZ 3H3VJ 4BY7I 2B63I 3MONA 2JA6I 3D2LA 2R92I 1QYPA 2WAQA 3CC41 1Y1VS 1QF8A 4MD9A 3CCM1 3CCSZ 4NB8A 4S1TA 2VUMI 1YJN1 4NBAA 4MXUA 3HOXI 2E2II 4E2XA 1YJW1 1QVGY 3TE5B 4BXXI 1YI21 1RNIA 2E2HI 1Z01A 1VQ9Z 3VB9A 2OOYB 2JIOA 1SFOI 1L1OC 2YADA 3CC71 3CME1 2NVXI 1TWAI 2KI7B 3CCEZ 1TWFI 1S72Z 2GTHA 3CMAZ 5D1OA 4A3DI 4A3LI 1VQ4Z 2DE6A 5T67A 4E33A 3JAMb 1QXFA 4AYBA 3K7AI 1Q821 4MONA 4A3EI 5C4XI 3CCL1 5FLXb 4RS4A 3S2HI 2LFUA 2V45A 4BBRI 1VQL1 1VQ7Z 3VMGA 2R7ZI 1K731 3CCLZ 3CPWY 5T64A 2QREB 3G711 3T4NB 1KQSY 1QVFY 4HH4A 4E31A 1VQ51 1RO2A 1N2FA 1WW9A 2V8KA 2KPIA 1VLAA 2IZ3A 4E2WA 2Q51A 4BBSI 1I3QI 3CPWZ 3I4MI 1RLYA 1S721 1M1K2 2V8IA 4A3GI 2PM9A 3GTJI 1Q822 1VQK1 1VQ5Z 1JJ2Y 2RHBA 1VQM1 3CC7Z 3RZOI 1X3ZA 3M3YI 3OW2Y 3CXCY 3I56Z 3CC2Z 2R93I 3FQMA 5C3EI 3J7A4 4A3FI 3D6WA 3IR7A 2Y0SA 4Y7NI 1Q7Y1 2QR1B 1K8A1 3HOWI 3P5JB 2NAPA 3CMA1 4X6AI 2P3YA 5A2Qb 2WB1A 1M1K1 4A3II 1KC82 1NP6A 1P9NA 1ZH1A 1NJI2 3CCV1 3PO3S 1K9M2 1WCMI 3CQZI 3GTQI 3J80f 5CM2M 4NB9A 2QKDA 3BG0B 2EGTA 2OTL1 1YI2Z 3CCR1 4XX2A 1VQO1 1JWHC 1YJWZ 4NFRA 3I4NI 3GTLI 4TNUA 3Q87A 2QRCB 1Q811 1RQFA 3F3PC 1JJ2Z 2GU2A 1DL6A 2GTIA 1N8R1 1VQ6Z 3CD6Z 3HOUI 1M901 2OTJ1 5FLMI 3NH8A 1YJ91 4HGYA 2F4OA 3CD61 4RVGA 2ZAEB 2JUBA 1KQSZ 1Q16A 3G4SZ 2JIQA
chains in the Genus database with same CATH topology
5D1PA 3HKZA 1RO4A 1X0TA 2OTLZ 4Y52I 2AKLA 3CC21 5IT9b 3I561 4MD7A 3F3FC 4EWCA 3J81b 3S16I 1I6HI 3GTKI 1KD11 4NBHA 2DE7A 2P28A 3VTNA 4E2ZA 3U50C 3CXCZ 3NDJA 1TFIA 3PO2I 3GTOI 3I07A 3GTGI 1Y1WI 3S1RI 1Z02A 4QTUA 4BY1I 2JS4A 3H0GI 3LUSA 1W2BZ 1VQNZ 1VQP1 3G71Z 3HOYI 2QEX1 3GTMS 1RO0A 3S1NI 4NH1C 2G2KA 4CL1A 2O53A 3QWUA 4NBEA 1VQMZ 1X3WA 1VQKZ 2E9HA 2RIQA 2JMOA 1KD12 3ESWA 1NJI1 5IT9f 3KIHA 1LQLA 4NOZA 2BJOA 3CCE1 1W2BY 2F4MA 2I3CA 4HGZA 3CMEZ 1Q812 2PK7A 2LIYA 1YIJZ 3IF8A 2JA8I 4A3KI 1K83I 1VQ71 1VQLZ 5A2Qf 1VQ8Z 3IFUA 3NH4A 3CCQ1 3G6EZ 2QA41 1WIIA 2K3RA 1YJNZ 1K9M1 3MZLB 3G6E1 1S7MA 3IX0A 3NDIA 1Z03A 2R6MA 1TWHI 3EEDA 3CCMZ 1VQ41 3GTPI 1ZB9A 4NBFA 4QTTA 2V8JA 5LL6f 1YIJ1 1QVGZ 2JR6A 4NBBA 5FLXf 4RVDA 3MZKB 5C44I 1Y1VI 3GKQA 4MRIA 3S15I 3CCUZ 1YHQ1 4DK1A 2RBLA 1YUKA 4RV9A 1VQ91 3JAMf 2QRDB 3VMIA 2J6AA 1K732 2OZKA 1NUIA 2W03A 1M902 2YU9I 3OW2Z 2JA5I 4DGLA 2HF1A 1TWCI 5IP9I 4E2YA 1I50I 4E32A 2QA4Z 5C4JI 4A3JI 2Q4ZA 3CCQZ 1YITZ 3CCS1 1VQ81 2IZ4A 4NBGA 3CC4Z 3PO3I 5AN9F 5IP7I 4NBDA 1VQN1 3S2DI 3FKII 2NVQI 1YUAA 1QVFZ 3J80b 3CCJ1 2QLVB 1TWGI 3FQQA 3S17I 1N8R2 4MH4A 4A3CI 3RZDI 1ML8A 3EERA 4RVFA 3GTMI 1R9TI 4MD8A 3I55Z 1USPB 2HU9A 3S1QI 3NFZA 3TDHB 3G4S1 2QEXZ 2VF1A 2M48A 3KIFA 1VQPZ 2W04A 4A93I 3GCFA 2PMZA 2DE5A 2M6NA 3D9XA 1ZB8A 5D1OB 2O4HA 5T6BA 4DQYB 3S14I 4A3BI 1KRLA 1K8A2 4NBCA 2H85A 3VMHA 3S1MI 3HOVI 1YJ9Z 4E30A 2OTJZ 3NH5A 1VQ61 2JA7I 2E2JI 1Q861 2K5RA 4RVHA 2OOXB 3BG1B 3I551 2NVTI 1YIT1 3J81f 2RT9A 2NVYI 2RPRA 1VQOZ 1KC81 3CCRZ 3M4OI 3HOZI 2JNYA 1Q862 2VUGA 1USPA 1PFTA 3CCJZ 1YHQZ 3CCU1 1Q7Y2 4A3MI 3CCVZ 3H3VJ 4BY7I 2B63I 3MONA 2JA6I 2R92I 1QYPA 2WAQA 3CC41 1Y1VS 1QF8A 4MD9A 3CCM1 3CCSZ 4NB8A 4S1TA 2VUMI 1YJN1 4NBAA 4MXUA 3HOXI 2E2II 4E2XA 1YJW1 1QVGY 3TE5B 4BXXI 1YI21 1RNIA 2E2HI 1Z01A 1VQ9Z 3VB9A 2OOYB 1SFOI 1L1OC 2YADA 3CC71 3CME1 2NVXI 1TWAI 2KI7B 3CCEZ 1TWFI 1S72Z 2GTHA 3CMAZ 5D1OA 4A3DI 4A3LI 1VQ4Z 2DE6A 5T67A 4E33A 3JAMb 4AYBA 3K7AI 1Q821 4MONA 5C4XI 4A3EI 3CCL1 5FLXb 4RS4A 3S2HI 2LFUA 4BBRI 1VQL1 1VQ7Z 3VMGA 2R7ZI 1K731 3CCLZ 3CPWY 5T64A 2QREB 3G711 3T4NB 1KQSY 1QVFY 4HH4A 4E31A 1VQ51 1RO2A 1N2FA 1WW9A 2V8KA 2KPIA 1VLAA 2IZ3A 4E2WA 2Q51A 4BBSI 1I3QI 3CPWZ 3I4MI 1RLYA 1S721 1M1K2 2V8IA 4A3GI 2PM9A 3GTJI 1Q822 1VQK1 1VQ5Z 1JJ2Y 2RHBA 1VQM1 3CC7Z 3RZOI 1X3ZA 3M3YI 3OW2Y 3CXCY 3I56Z 3CC2Z 2R93I 3FQMA 5C3EI 3J7A4 4A3FI 3D6WA 2Y0SA 4Y7NI 1Q7Y1 2QR1B 1K8A1 3HOWI 3P5JB 3CMA1 4X6AI 2P3YA 5A2Qb 2WB1A 1M1K1 4A3II 1KC82 1NP6A 1P9NA 1ZH1A 1NJI2 3CCV1 3PO3S 1K9M2 1WCMI 3CQZI 3GTQI 3J80f 5CM2M 4NB9A 2QKDA 3BG0B 2EGTA 2OTL1 1YI2Z 3CCR1 4XX2A 1VQO1 1JWHC 1YJWZ 4NFRA 3I4NI 3GTLI 4TNUA 3Q87A 2QRCB 1Q811 1RQFA 3F3PC 1JJ2Z 2GU2A 1DL6A 2GTIA 1N8R1 1VQ6Z 3CD6Z 3HOUI 1M901 2OTJ1 5FLMI 3NH8A 1YJ91 4HGYA 2F4OA 3CD61 4RVGA 2ZAEB 2JUBA 1KQSZ 3G4SZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPI A;  1VLA A;  1RO4 A;  2JR6 A;  4NBB A;  4Y52 I;  2AKL A;  2NVY I;  5C44 I;  1Y1V I;  3GKQ A;  4BBS I;  1I3Q I;  3S15 I;  3I4M I;  1RLY A;  2RBL A;  3S16 I;  1I6H I;  3M4O I;  4A3G I;  3HOZ I;  2JNY A;  3GTK I;  3GTJ I;  3VMI A;  4NBH A;  1USP A;  2J6A A;  1PFT A;  1NUI A;  2DE7 A;  3RZO I;  1X3Z A;  2YU9 I;  3M3Y I;  3U50 C;  1TFI A;  2JA5 I;  4A3M I;  3H3V J;  3GTO I;  3PO2 I;  4BY7 I;  3I07 A;  2B63 I;  2R93 I;  3GTG I;  2HF1 A;  5IP9 I;  1TWC I;  1Y1W I;  1I50 I;  2JA6 I;  2R92 I;  5C4J I;  5C3E I;  1QYP A;  4A3J I;  3S1R I;  4QTU A;  4A3F I;  2JS4 A;  3D6W A;  1Y1V S;  3H0G I;  3LUS A;  4BY1 I;  4NBG A;  4Y7N I;  3HOY I;  4NB8 A;  3PO3 I;  3GTM S;  3S1N I;  2VUM I;  5IP7 I;  4NBD A;  3S2D I;  4NBA A;  1WW9 A;  3FKI I;  2NVQ I;  3HOW I;  3HOX I;  2E2I I;  1YUA A;  4X6A I;  2P3Y A;  4NBE A;  4A3I I;  4BXX I;  1TWG I;  2E2H I;  1X3W A;  3S17 I;  3PO3 S;  4MH4 A;  1WCM I;  3CQZ I;  3VB9 A;  3GTQ I;  3ESW A;  1SFO I;  4A3C I;  5CM2 M;  1L1O C;  3RZD I;  4NB9 A;  1ML8 A;  3EER A;  2NVX I;  1LQL A;  3GTM I;  4NOZ A;  1TWA I;  4XX2 A;  2BJO A;  1R9T I;  1TWF I;  3I4N I;  3GTL I;  4A3L I;  4A3D I;  2F4M A;  1USP B;  3Q87 A;  3S1Q I;  2PK7 A;  2DE6 A;  2JA8 I;  1DL6 A;  4A93 I;  4A3K I;  3GCF A;  1K83 I;  3K7A I;  2DE5 A;  3HOU I;  5FLM I;  5C4X I;  4A3E I;  1ZB8 A;  3S14 I;  4A3B I;  2F4O A;  3S2H I;  4BBR I;  4NBC A;  3VMG A;  3VMH A;  3S1M I;  2R7Z I;  3HOV I;  1TWH I;  2JA7 I;  2E2J I;  3GTP I;  2K5R A;  1ZB9 A;  4NBF A;  1N2F A;  2NVT I;  4QTT A; 
#chains in the Genus database with same CATH topology
 2V3V A;  2VPY A;  5D1P A;  3HKZ A;  1RO4 A;  1X0T A;  2OTL Z;  4Y52 I;  2AKL A;  3CC2 1;  5IT9 b;  3I56 1;  4MD7 A;  3F3F C;  4EWC A;  1WJ2 A;  3J81 b;  3S16 I;  1I6H I;  3GTK I;  1KD1 1;  4NBH A;  2DE7 A;  2P28 A;  3VTN A;  4E2Z A;  3U50 C;  3CXC Z;  3NDJ A;  1TFI A;  3PO2 I;  3GTO I;  3I07 A;  3GTG I;  1Y1W I;  3S1R I;  1Z02 A;  4QTU A;  4BY1 I;  2JS4 A;  3H0G I;  3LUS A;  1W2B Z;  1VQN Z;  1VQP 1;  3G71 Z;  3HOY I;  2QEX 1;  3GTM S;  1RO0 A;  3S1N I;  4NH1 C;  2G2K A;  4CL1 A;  2O53 A;  3QWU A;  4NBE A;  1VQM Z;  1X3W A;  1VQK Z;  2E9H A;  2RIQ A;  2JMO A;  1KD1 2;  3ESW A;  1NJI 1;  5IT9 f;  3KIH A;  1LQL A;  4NOZ A;  2LEX A;  2BJO A;  3CCE 1;  1W2B Y;  2F4M A;  2I3C A;  4HGZ A;  3CME Z;  1Q81 2;  2PK7 A;  2LIY A;  1YIJ Z;  3IF8 A;  2JA8 I;  2VPW A;  4A3K I;  1K83 I;  1VQ7 1;  1VQL Z;  5A2Q f;  1VQ8 Z;  3IFU A;  3NH4 A;  3CCQ 1;  3G6E Z;  2QA4 1;  1WII A;  2K3R A;  1YJN Z;  1K9M 1;  1FDI A;  3MZL B;  2IV2 X;  3G6E 1;  1S7M A;  3IX0 A;  2VPZ A;  3NDI A;  1Z03 A;  2R6M A;  1TWH I;  3EED A;  3CCM Z;  1VQ4 1;  3GTP I;  1ZB9 A;  4NBF A;  4QTT A;  2V8J A;  5LL6 f;  1YIJ 1;  1QVG Z;  2JR6 A;  4NBB A;  5FLX f;  4RVD A;  3MZK B;  5C44 I;  1Y1V I;  3GKQ A;  4MRI A;  3S15 I;  3CCU Z;  1YHQ 1;  4DK1 A;  2RBL A;  1YUK A;  4RV9 A;  1VQ9 1;  3JAM f;  2QRD B;  1FDO A;  3VMI A;  2J6A A;  1K73 2;  2OZK A;  1NUI A;  2W03 A;  1M90 2;  2YU9 I;  3OW2 Z;  2JA5 I;  4DGL A;  2HF1 A;  1TWC I;  5IP9 I;  4E2Y A;  1I50 I;  4E32 A;  2QA4 Z;  5C4J I;  4A3J I;  2Q4Z A;  3CCQ Z;  1YIT Z;  3CCS 1;  1VQ8 1;  2IZ4 A;  2JIP A;  4NBG A;  3CC4 Z;  3PO3 I;  1WZN A;  5AN9 F;  5IP7 I;  4NBD A;  1VQN 1;  3S2D I;  3FKI I;  2NVQ I;  1YUA A;  1QVF Z;  3J80 b;  2VPX A;  3CCJ 1;  2QLV B;  1TWG I;  3FQQ A;  3S17 I;  1SIW A;  1N8R 2;  4MH4 A;  4A3C I;  3RZD I;  2JIM A;  1ML8 A;  3EER A;  4RVF A;  3GTM I;  1R9T I;  2AYD A;  4MD8 A;  3I55 Z;  1USP B;  2HU9 A;  3S1Q I;  3NFZ A;  3TDH B;  3G4S 1;  2QEX Z;  2VF1 A;  2M48 A;  3KIF A;  1VQP Z;  2W04 A;  4A93 I;  3GCF A;  2PMZ A;  2DE5 A;  2M6N A;  3D9X A;  1ZB8 A;  5D1O B;  1Y8C A;  2O4H A;  5T6B A;  4DQY B;  3S14 I;  4A3B I;  1KRL A;  1K8A 2;  4NBC A;  2H85 A;  3VMH A;  3S1M I;  3HOV I;  1YJ9 Z;  4E30 A;  2OTJ Z;  3NH5 A;  1VQ6 1;  2JA7 I;  2E2J I;  1Q86 1;  2K5R A;  4RVH A;  2OOX B;  3BG1 B;  3I55 1;  2NVT I;  1YIT 1;  3J81 f;  2RT9 A;  2NVY I;  2RPR A;  1VQO Z;  1KC8 1;  3CCR Z;  3M4O I;  3HOZ I;  2JIR A;  2JNY A;  1Q86 2;  1AA6 A;  2E7Z A;  2VUG A;  1USP A;  1PFT A;  3CCJ Z;  1YHQ Z;  3CCU 1;  1Q7Y 2;  4A3M I;  3CCV Z;  3H3V J;  4BY7 I;  2B63 I;  3MON A;  2JA6 I;  3D2L A;  2R92 I;  1QYP A;  2WAQ A;  3CC4 1;  1Y1V S;  1QF8 A;  4MD9 A;  3CCM 1;  3CCS Z;  4NB8 A;  4S1T A;  2VUM I;  1YJN 1;  4NBA A;  4MXU A;  3HOX I;  2E2I I;  4E2X A;  1YJW 1;  1QVG Y;  3TE5 B;  4BXX I;  1YI2 1;  1RNI A;  2E2H I;  1Z01 A;  1VQ9 Z;  3VB9 A;  2OOY B;  2JIO A;  1SFO I;  1L1O C;  2YAD A;  3CC7 1;  3CME 1;  2NVX I;  1TWA I;  2KI7 B;  3CCE Z;  1TWF I;  1S72 Z;  2GTH A;  3CMA Z;  5D1O A;  4A3D I;  4A3L I;  1VQ4 Z;  2DE6 A;  5T67 A;  4E33 A;  3JAM b;  1QXF A;  4AYB A;  3K7A I;  1Q82 1;  4MON A;  4A3E I;  5C4X I;  3CCL 1;  5FLX b;  4RS4 A;  3S2H I;  2LFU A;  2V45 A;  4BBR I;  1VQL 1;  1VQ7 Z;  3VMG A;  2R7Z I;  1K73 1;  3CCL Z;  3CPW Y;  5T64 A;  2QRE B;  3G71 1;  3T4N B;  1KQS Y;  1QVF Y;  4HH4 A;  4E31 A;  1VQ5 1;  1RO2 A;  1N2F A;  1WW9 A;  2V8K A;  2KPI A;  1VLA A;  2IZ3 A;  4E2W A;  2Q51 A;  4BBS I;  1I3Q I;  3CPW Z;  3I4M I;  1RLY A;  1S72 1;  1M1K 2;  2V8I A;  4A3G I;  2PM9 A;  3GTJ I;  1Q82 2;  1VQK 1;  1VQ5 Z;  1JJ2 Y;  2RHB A;  1VQM 1;  3CC7 Z;  3RZO I;  1X3Z A;  3M3Y I;  3OW2 Y;  3CXC Y;  3I56 Z;  3CC2 Z;  2R93 I;  3FQM A;  5C3E I;  3J7A 4;  4A3F I;  3D6W A;  3IR7 A;  2Y0S A;  4Y7N I;  1Q7Y 1;  2QR1 B;  1K8A 1;  3HOW I;  3P5J B;  2NAP A;  3CMA 1;  4X6A I;  2P3Y A;  5A2Q b;  2WB1 A;  1M1K 1;  4A3I I;  1KC8 2;  1NP6 A;  1P9N A;  1ZH1 A;  1NJI 2;  3CCV 1;  3PO3 S;  1K9M 2;  1WCM I;  3CQZ I;  3GTQ I;  3J80 f;  5CM2 M;  4NB9 A;  2QKD A;  3BG0 B;  2EGT A;  2OTL 1;  1YI2 Z;  3CCR 1;  4XX2 A;  1VQO 1;  1JWH C;  1YJW Z;  4NFR A;  3I4N I;  3GTL I;  4TNU A;  3Q87 A;  2QRC B;  1Q81 1;  1RQF A;  3F3P C;  1JJ2 Z;  2GU2 A;  1DL6 A;  2GTI A;  1N8R 1;  1VQ6 Z;  3CD6 Z;  3HOU I;  1M90 1;  2OTJ 1;  5FLM I;  3NH8 A;  1YJ9 1;  4HGY A;  2F4O A;  3CD6 1;  4RVG A;  2ZAE B;  2JUB A;  1KQS Z;  1Q16 A;  3G4S Z;  2JIQ A; 
#chains in the Genus database with same CATH homology
 5D1P A;  3HKZ A;  1RO4 A;  1X0T A;  2OTL Z;  4Y52 I;  2AKL A;  3CC2 1;  5IT9 b;  3I56 1;  4MD7 A;  3F3F C;  4EWC A;  3J81 b;  3S16 I;  1I6H I;  3GTK I;  1KD1 1;  4NBH A;  2DE7 A;  2P28 A;  3VTN A;  4E2Z A;  3U50 C;  3CXC Z;  3NDJ A;  1TFI A;  3PO2 I;  3GTO I;  3I07 A;  3GTG I;  1Y1W I;  3S1R I;  1Z02 A;  4QTU A;  4BY1 I;  2JS4 A;  3H0G I;  3LUS A;  1W2B Z;  1VQN Z;  1VQP 1;  3G71 Z;  3HOY I;  2QEX 1;  3GTM S;  1RO0 A;  3S1N I;  4NH1 C;  2G2K A;  4CL1 A;  2O53 A;  3QWU A;  4NBE A;  1VQM Z;  1X3W A;  1VQK Z;  2E9H A;  2RIQ A;  2JMO A;  1KD1 2;  3ESW A;  1NJI 1;  5IT9 f;  3KIH A;  1LQL A;  4NOZ A;  2BJO A;  3CCE 1;  1W2B Y;  2F4M A;  2I3C A;  4HGZ A;  3CME Z;  1Q81 2;  2PK7 A;  2LIY A;  1YIJ Z;  3IF8 A;  2JA8 I;  4A3K I;  1K83 I;  1VQ7 1;  1VQL Z;  5A2Q f;  1VQ8 Z;  3IFU A;  3NH4 A;  3CCQ 1;  3G6E Z;  2QA4 1;  1WII A;  2K3R A;  1YJN Z;  1K9M 1;  3MZL B;  3G6E 1;  1S7M A;  3IX0 A;  3NDI A;  1Z03 A;  2R6M A;  1TWH I;  3EED A;  3CCM Z;  1VQ4 1;  3GTP I;  1ZB9 A;  4NBF A;  4QTT A;  2V8J A;  5LL6 f;  1YIJ 1;  1QVG Z;  2JR6 A;  4NBB A;  5FLX f;  4RVD A;  3MZK B;  5C44 I;  1Y1V I;  3GKQ A;  4MRI A;  3S15 I;  3CCU Z;  1YHQ 1;  4DK1 A;  2RBL A;  1YUK A;  4RV9 A;  1VQ9 1;  3JAM f;  2QRD B;  3VMI A;  2J6A A;  1K73 2;  2OZK A;  1NUI A;  2W03 A;  1M90 2;  2YU9 I;  3OW2 Z;  2JA5 I;  4DGL A;  2HF1 A;  1TWC I;  5IP9 I;  4E2Y A;  1I50 I;  4E32 A;  2QA4 Z;  5C4J I;  4A3J I;  2Q4Z A;  3CCQ Z;  1YIT Z;  3CCS 1;  1VQ8 1;  2IZ4 A;  4NBG A;  3CC4 Z;  3PO3 I;  5AN9 F;  5IP7 I;  4NBD A;  1VQN 1;  3S2D I;  3FKI I;  2NVQ I;  1YUA A;  1QVF Z;  3J80 b;  3CCJ 1;  2QLV B;  1TWG I;  3FQQ A;  3S17 I;  1N8R 2;  4MH4 A;  4A3C I;  3RZD I;  1ML8 A;  3EER A;  4RVF A;  3GTM I;  1R9T I;  4MD8 A;  3I55 Z;  1USP B;  2HU9 A;  3S1Q I;  3NFZ A;  3TDH B;  3G4S 1;  2QEX Z;  2VF1 A;  2M48 A;  3KIF A;  1VQP Z;  2W04 A;  4A93 I;  3GCF A;  2PMZ A;  2DE5 A;  2M6N A;  3D9X A;  1ZB8 A;  5D1O B;  2O4H A;  5T6B A;  4DQY B;  3S14 I;  4A3B I;  1KRL A;  1K8A 2;  4NBC A;  2H85 A;  3VMH A;  3S1M I;  3HOV I;  1YJ9 Z;  4E30 A;  2OTJ Z;  3NH5 A;  1VQ6 1;  2JA7 I;  2E2J I;  1Q86 1;  2K5R A;  4RVH A;  2OOX B;  3BG1 B;  3I55 1;  2NVT I;  1YIT 1;  3J81 f;  2RT9 A;  2NVY I;  2RPR A;  1VQO Z;  1KC8 1;  3CCR Z;  3M4O I;  3HOZ I;  2JNY A;  1Q86 2;  2VUG A;  1USP A;  1PFT A;  3CCJ Z;  1YHQ Z;  3CCU 1;  1Q7Y 2;  4A3M I;  3CCV Z;  3H3V J;  4BY7 I;  2B63 I;  3MON A;  2JA6 I;  2R92 I;  1QYP A;  2WAQ A;  3CC4 1;  1Y1V S;  1QF8 A;  4MD9 A;  3CCM 1;  3CCS Z;  4NB8 A;  4S1T A;  2VUM I;  1YJN 1;  4NBA A;  4MXU A;  3HOX I;  2E2I I;  4E2X A;  1YJW 1;  1QVG Y;  3TE5 B;  4BXX I;  1YI2 1;  1RNI A;  2E2H I;  1Z01 A;  1VQ9 Z;  3VB9 A;  2OOY B;  1SFO I;  1L1O C;  2YAD A;  3CC7 1;  3CME 1;  2NVX I;  1TWA I;  2KI7 B;  3CCE Z;  1TWF I;  1S72 Z;  2GTH A;  3CMA Z;  5D1O A;  4A3D I;  4A3L I;  1VQ4 Z;  2DE6 A;  5T67 A;  4E33 A;  3JAM b;  4AYB A;  3K7A I;  1Q82 1;  4MON A;  5C4X I;  4A3E I;  3CCL 1;  5FLX b;  4RS4 A;  3S2H I;  2LFU A;  4BBR I;  1VQL 1;  1VQ7 Z;  3VMG A;  2R7Z I;  1K73 1;  3CCL Z;  3CPW Y;  5T64 A;  2QRE B;  3G71 1;  3T4N B;  1KQS Y;  1QVF Y;  4HH4 A;  4E31 A;  1VQ5 1;  1RO2 A;  1N2F A;  1WW9 A;  2V8K A;  2KPI A;  1VLA A;  2IZ3 A;  4E2W A;  2Q51 A;  4BBS I;  1I3Q I;  3CPW Z;  3I4M I;  1RLY A;  1S72 1;  1M1K 2;  2V8I A;  4A3G I;  2PM9 A;  3GTJ I;  1Q82 2;  1VQK 1;  1VQ5 Z;  1JJ2 Y;  2RHB A;  1VQM 1;  3CC7 Z;  3RZO I;  1X3Z A;  3M3Y I;  3OW2 Y;  3CXC Y;  3I56 Z;  3CC2 Z;  2R93 I;  3FQM A;  5C3E I;  3J7A 4;  4A3F I;  3D6W A;  2Y0S A;  4Y7N I;  1Q7Y 1;  2QR1 B;  1K8A 1;  3HOW I;  3P5J B;  3CMA 1;  4X6A I;  2P3Y A;  5A2Q b;  2WB1 A;  1M1K 1;  4A3I I;  1KC8 2;  1NP6 A;  1P9N A;  1ZH1 A;  1NJI 2;  3CCV 1;  3PO3 S;  1K9M 2;  1WCM I;  3CQZ I;  3GTQ I;  3J80 f;  5CM2 M;  4NB9 A;  2QKD A;  3BG0 B;  2EGT A;  2OTL 1;  1YI2 Z;  3CCR 1;  4XX2 A;  1VQO 1;  1JWH C;  1YJW Z;  4NFR A;  3I4N I;  3GTL I;  4TNU A;  3Q87 A;  2QRC B;  1Q81 1;  1RQF A;  3F3P C;  1JJ2 Z;  2GU2 A;  1DL6 A;  2GTI A;  1N8R 1;  1VQ6 Z;  3CD6 Z;  3HOU I;  1M90 1;  2OTJ 1;  5FLM I;  3NH8 A;  1YJ9 1;  4HGY A;  2F4O A;  3CD6 1;  4RVG A;  2ZAE B;  2JUB A;  1KQS Z;  3G4S Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...