3S17I

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s17I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s17I02
3S2DI 3LUSA 1X3ZA 3S1NI 3HOVI 4A3BI 4NBDA 4A3FI 2JA6I 3GTLI 1SFOI 1X3WA 4BXXI 3GTQI 1I6HI 3H3VJ 1TWGI 1VLAA 1WW9A 5IP9I 1RO4A 3PO2I 3GTGI 1TWCI 2E2HI 3U50C 2E2II 5C4XI 3VMGA 2JR6A 1N2FA 1Y1VI 3I4MI 2NVYI 4A3II 2JA8I 4NBBA 4NB9A 3CQZI 3I4NI 4A93I 3S1QI 2HF1A 3GTOI 2J6AA 3I07A 4XX2A 1USPB 2DE6A 1Y1WI 4NBGA 5IP7I 3HOYI 2JS4A 3GTMI 2JNYA 3ESWA 2JA5I 3M3YI 4NBEA 5C44I 3HOXI 3K7AI 2R92I 2F4OA 3FKII 5CM2M 4BY7I 2DE5A 3EERA 2BJOA 1RLYA 4NB8A 4QTUA 3RZDI 1R9TI 2YU9I 1TWFI 1QYPA 4A3DI 1PFTA 2E2JI 2DE7A 3VMIA 3HOUI 4NOZA 3GTPI 3S2HI 3GTMS 1TWAI 1TWHI 3GTKI 3HOWI 4A3MI 4X6AI 2P3YA 3S14I 3GTJI 2NVTI 3PO3I 2R93I 4A3EI 3HOZI 2F4MA 4BBSI 1I3QI 3S16I 3VB9A 3S17I 4MH4A 3RZOI 1Y1VS 1WCMI 1USPA 3M4OI 4A3CI 2K5RA 3S1RI 1DL6A 1YUAA 4A3KI 2NVQI 2JA7I 3H0GI 1TFIA 2VUMI 4NBHA 3GCFA 3GKQA 4NBFA 1NUIA 3VMHA 4NBCA 2AKLA 3Q87A 1I50I 1ZB8A 3PO3S 1LQLA 2R7ZI 1K83I 4A3GI 3D6WA 4NBAA 1ML8A 2B63I 4Y52I 1L1OC 2PK7A 5C4JI 4A3LI 3S15I 2KPIA 4BBRI 3S1MI 5C3EI 2RBLA 4Y7NI 5FLMI 4QTTA 4BY1I 4A3JI 2NVXI 1ZB9A
chains in the Genus database with same CATH superfamily
3CCJ1 5FLXf 3NH4A 1RO0A 4A3FI 5AN9F 1SFOI 1X3WA 1I6HI 3H3VJ 5FLXb 1KC82 1WW9A 4AYBA 1QF8A 2LIYA 1WIIA 2WB1A 1YI21 3QWUA 3U50C 1N8R2 4E2YA 2E2II 5C4XI 1N2FA 3JAMf 2JA8I 2JIQA 2V45A 4MONA 4E30A 3G71Z 1VQM1 3I4NI 4A93I 2J6AA 2JUBA 1KD11 1VQ41 3J81b 1YIJ1 1K9M1 3HOYI 3CCUZ 3CC4Z 2NAPA 1Q812 3CCM1 2GTHA 1RLYA 5D1OA 1PFTA 1S7MA 3OW2Y 3CCU1 1K732 2K3RA 2E2JI 1QVFY 1FDIA 1NJI1 4NOZA 3CCEZ 2O53A 3GTMS 4X6AI 2QREB 3PO3I 2Q4ZA 1VQOZ 4A3EI 1M1K2 4BBSI 2PM9A 3S17I 4HGYA 1WCMI 1DL6A 2QA41 1YHQ1 4E2XA 1VQ8Z 1Q822 2VUMI 4NBHA 3CMEZ 4NBFA 4NH1C 1JJ2Z 1VQ9Z 3F3PC 1WJ2A 1LQLA 4A3GI 1K83I 3D6WA 2H85A 4MD9A 2PK7A 5T6BA 1VQL1 1S721 2YADA 2RBLA 4E2WA 5FLMI 1VQ71 3LUSA 2I3CA 3S1NI 3IR7A 4RS4A 1YIT1 4BXXI 3TDHB 1SIWA 1YITZ 1TWGI 4RV9A 3NFZA 1YJ9Z 4MXUA 1Z03A 4MD7A 2E2HI 1AA6A 2M48A 4S1TA 1Y8CA 1VQ91 1YUKA 4TNUA 3VMGA 3G6EZ 1YI2Z 2HF1A 3GTOI 3I07A 1KQSY 3CCQ1 2QKDA 3CPWZ 2LEXA 3GTMI 2JNYA 3ESWA 2JA5I 1RNIA 3F3FC 3BG1B 3NDJA 2WAQA 1VQ61 3CCQZ 3G6E1 3FKII 3CC41 3NDIA 1Q7Y1 2DE5A 3CD6Z 3D9XA 2BJOA 4NB8A 4QTUA 1TWFI 4A3DI 2DE7A 3VMIA 1YJ91 1JJ2Y 3MONA 2VPWA 3GTPI 1Q7Y2 1TWHI 2GU2A 4MRIA 2M6NA 3J80b 2EGTA 2F4MA 2VPXA 3P5JB 1YJNZ 3KIHA 3S16I 2W03A 1JWHC 3D2LA 1USPA 4A3CI 2QR1B 2RIQA 1YUAA 4A3KI 3CPWY 2PMZA 1TFIA 1FDOA 1M1K1 2V3VA 4EWCA 3NH5A 1KQSZ 2E7ZA 1Z02A 3VMHA 2OOYB 1NJI2 2QEX1 3CCR1 3J81f 3G711 3EEDA 2R7ZI 5A2Qb 2VPZA 1VQ81 2B63I 3CC2Z 3FQQA 1VQ6Z 4A3LI 2KPIA 3CCVZ 2OOXB 2OTLZ 4BY1I 2QLVB 1ZB9A 2V8KA 1Q811 1X3ZA 3HOVI 4A3BI 2IZ4A 4NBDA 4HH4A 3I55Z 1VQKZ 1VQP1 3J80f 1K9M2 1VLAA 5IP9I 3PO2I 3GTGI 2JIMA 3BG0B 1X0TA 1VQNZ 2V8JA 3J7A4 3CD61 3CCE1 2G2KA 4DQYB 1NP6A 2JR6A 2VUGA 3I4MI 2NVYI 4NBBA 1Q821 3CQZI 2QRCB 1YJN1 4XX2A 2RPRA 1USPB 1Y1WI 3TE5B 3CCSZ 3HOXI 3K7AI 1VQN1 1KRLA 2R92I 2F4OA 4E33A 3IFUA 2QRDB 3RZDI 1K731 4RVFA 1RQFA 4RVGA 2IZ3A 3I561 3G4S1 3HOUI 1QVFZ 1M902 3OW2Z 3S2HI 1TWAI 4A3MI 3IF8A 3GTJI 2R93I 1VQ7Z 3CC21 3HOZI 2OTJ1 5T67A 3JAMb 3VB9A 1S72Z 4MH4A 1Y1VS 5D1OB 5LL6f 1KD12 3CCJZ 2NVQI 3H0GI 1YJWZ 2R6MA 1Q862 4DK1A 3GCFA 1NUIA 4NBCA 1N8R1 3CXCY 2HU9A 3VTNA 4E31A 3Q87A 1ZB8A 3IX0A 3PO3S 3CME1 1QVGZ 3HKZA 3CCV1 2QA4Z 1YHQZ 4NBAA 1W2BZ 1KC81 3G4SZ 3CC7Z 1QXFA 5C4JI 4BBRI 3S1MI 2KI7B 3KIFA 5D1PA 1VQO1 2AYDA 4MD8A 1VQ51 3S2DI 1ZH1A 2JIPA 4RVHA 2JA6I 3GTLI 4E32A 3GTQI 4CL1A 2VF1A 2ZAEB 3CCS1 1RO4A 2VPYA 2IV2X 1TWCI 4DGLA 3T4NB 1K8A2 3CMAZ 3CC71 1Y1VI 2E9HA 4A3II 4HGZA 3I56Z 4NB9A 2OZKA 3S1QI 2DE6A 1VQLZ 4NBGA 5IP7I 2JS4A 1VQPZ 1YJW1 3M3YI 1RO2A 4NBEA 2V8IA 5C44I 2OTJZ 3I551 1VQK1 1W2BY 5CM2M 2O4HA 4BY7I 1QVGY 2OTL1 3EERA 1Q16A 2JIRA 2Q51A 1R9TI 2YU9I 1QYPA 4E2ZA 3CXCZ 3CCMZ 3CMA1 3CCRZ 5IT9f 3GTKI 3HOWI 2QEXZ 2P3YA 3S14I 2JIOA 2NVTI 3CCLZ 1Q861 5IT9b 1I3QI 1WZNA 1VQ4Z 3MZLB 3RZOI 3FQMA 3M4OI 2RT9A 2K5RA 3CCL1 3S1RI 2W04A 1VQ5Z 2JA7I 1P9NA 2LFUA 3GKQA 4RVDA 3MZKB 4NFRA 2GTIA 2RHBA 2AKLA 1K8A1 1M901 5A2Qf 1I50I 1Z01A 3NH8A 1ML8A 4Y52I 1YIJZ 1L1OC 3S15I 5C3EI 2P28A 4Y7NI 2JMOA 1VQMZ 4QTTA 2Y0SA 4A3JI 2NVXI 5T64A
chains in the Genus database with same CATH topology
3CCJ1 5FLXf 3NH4A 1RO0A 4A3FI 5AN9F 1SFOI 1X3WA 1I6HI 3H3VJ 5FLXb 1KC82 1WW9A 4AYBA 1QF8A 2LIYA 1WIIA 2WB1A 1YI21 3QWUA 3U50C 1N8R2 4E2YA 2E2II 5C4XI 1N2FA 3JAMf 2JA8I 4MONA 4E30A 1VQM1 3G71Z 3I4NI 4A93I 2J6AA 2JUBA 1KD11 1VQ41 3J81b 1YIJ1 1K9M1 3HOYI 3CCUZ 3CC4Z 1Q812 3CCM1 2GTHA 1RLYA 5D1OA 1PFTA 1S7MA 3OW2Y 3CCU1 1K732 2K3RA 2E2JI 1QVFY 1NJI1 4NOZA 3CCEZ 2O53A 3GTMS 4X6AI 2QREB 3PO3I 2Q4ZA 1VQOZ 4A3EI 1M1K2 4BBSI 2PM9A 3S17I 4HGYA 1WCMI 1DL6A 2QA41 1YHQ1 4E2XA 1VQ8Z 1Q822 2VUMI 4NBHA 3CMEZ 4NBFA 4NH1C 1JJ2Z 1VQ9Z 3F3PC 1LQLA 4A3GI 1K83I 3D6WA 2H85A 4MD9A 2PK7A 5T6BA 1VQL1 1S721 2YADA 2RBLA 4E2WA 5FLMI 1VQ71 3LUSA 2I3CA 3S1NI 4RS4A 1YIT1 4BXXI 3TDHB 1YITZ 1TWGI 4RV9A 3NFZA 1YJ9Z 4MXUA 1Z03A 4MD7A 2E2HI 2M48A 4S1TA 1VQ91 1YUKA 4TNUA 3VMGA 3G6EZ 1YI2Z 2HF1A 3GTOI 3I07A 1KQSY 3CCQ1 2QKDA 3CPWZ 3GTMI 2JNYA 3ESWA 2JA5I 1RNIA 3F3FC 3BG1B 3NDJA 2WAQA 1VQ61 3CCQZ 3G6E1 3FKII 3CC41 3NDIA 1Q7Y1 2DE5A 3CD6Z 3D9XA 2BJOA 4NB8A 4QTUA 1TWFI 4A3DI 2DE7A 3VMIA 1YJ91 1JJ2Y 3MONA 3GTPI 1Q7Y2 1TWHI 2GU2A 4MRIA 2M6NA 3J80b 2EGTA 2F4MA 3P5JB 1YJNZ 3KIHA 3S16I 2W03A 1JWHC 1USPA 4A3CI 2QR1B 2RIQA 1YUAA 4A3KI 3CPWY 2PMZA 1TFIA 1M1K1 4EWCA 3NH5A 1KQSZ 1Z02A 3VMHA 2OOYB 1NJI2 2QEX1 3CCR1 3J81f 3G711 3EEDA 2R7ZI 5A2Qb 1VQ81 2B63I 3CC2Z 3FQQA 1VQ6Z 4A3LI 2KPIA 3CCVZ 2OOXB 2OTLZ 4BY1I 2QLVB 1ZB9A 2V8KA 1Q811 1X3ZA 3HOVI 4A3BI 2IZ4A 4NBDA 4HH4A 3I55Z 1VQKZ 1VQP1 3J80f 1K9M2 1VLAA 5IP9I 3PO2I 3GTGI 3BG0B 1X0TA 1VQNZ 2V8JA 3J7A4 3CD61 3CCE1 2G2KA 4DQYB 1NP6A 2JR6A 2VUGA 3I4MI 2NVYI 4NBBA 1Q821 3CQZI 2QRCB 1YJN1 4XX2A 2RPRA 1USPB 1Y1WI 3TE5B 3CCSZ 3HOXI 3K7AI 1VQN1 1KRLA 2R92I 2F4OA 4E33A 3IFUA 2QRDB 3RZDI 1K731 4RVFA 1RQFA 4RVGA 2IZ3A 3I561 3G4S1 3HOUI 1QVFZ 1M902 3OW2Z 3S2HI 1TWAI 4A3MI 3IF8A 3GTJI 2R93I 1VQ7Z 3CC21 3HOZI 2OTJ1 5T67A 3JAMb 3VB9A 1S72Z 4MH4A 1Y1VS 5D1OB 5LL6f 1KD12 3CCJZ 2NVQI 3H0GI 1YJWZ 2R6MA 1Q862 4DK1A 3GCFA 1NUIA 4NBCA 1N8R1 3CXCY 2HU9A 3VTNA 4E31A 3Q87A 1ZB8A 3IX0A 3PO3S 3CME1 1QVGZ 3HKZA 3CCV1 2QA4Z 1YHQZ 4NBAA 1W2BZ 1KC81 3G4SZ 3CC7Z 5C4JI 4BBRI 3S1MI 2KI7B 3KIFA 5D1PA 1VQO1 4MD8A 1VQ51 3S2DI 1ZH1A 4RVHA 2JA6I 3GTLI 4E32A 3GTQI 4CL1A 2VF1A 2ZAEB 3CCS1 1RO4A 1TWCI 4DGLA 3T4NB 1K8A2 3CMAZ 3CC71 1Y1VI 2E9HA 4A3II 4HGZA 3I56Z 4NB9A 2OZKA 3S1QI 2DE6A 1VQLZ 4NBGA 5IP7I 2JS4A 1VQPZ 1YJW1 3M3YI 1RO2A 4NBEA 2V8IA 5C44I 2OTJZ 3I551 1VQK1 1W2BY 5CM2M 2O4HA 4BY7I 1QVGY 2OTL1 3EERA 2Q51A 1R9TI 2YU9I 1QYPA 4E2ZA 3CXCZ 3CCMZ 3CMA1 3CCRZ 5IT9f 3GTKI 3HOWI 2QEXZ 2P3YA 3S14I 2NVTI 3CCLZ 1Q861 5IT9b 1I3QI 1VQ4Z 3MZLB 3RZOI 3FQMA 3M4OI 2RT9A 2K5RA 3CCL1 3S1RI 2W04A 1VQ5Z 2JA7I 1P9NA 2LFUA 3GKQA 4RVDA 3MZKB 4NFRA 2GTIA 2RHBA 2AKLA 1K8A1 1M901 5A2Qf 1I50I 1Z01A 3NH8A 1ML8A 4Y52I 1YIJZ 1L1OC 3S15I 5C3EI 2P28A 4Y7NI 2JMOA 1VQMZ 4QTTA 2Y0SA 4A3JI 2NVXI 5T64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2D I;  3LUS A;  1X3Z A;  3S1N I;  3HOV I;  4A3B I;  4NBD A;  4A3F I;  2JA6 I;  3GTL I;  1SFO I;  1X3W A;  4BXX I;  3GTQ I;  1I6H I;  3H3V J;  1TWG I;  1VLA A;  1WW9 A;  5IP9 I;  1RO4 A;  3PO2 I;  3GTG I;  1TWC I;  2E2H I;  3U50 C;  2E2I I;  5C4X I;  3VMG A;  2JR6 A;  1N2F A;  1Y1V I;  3I4M I;  2NVY I;  4A3I I;  2JA8 I;  4NBB A;  4NB9 A;  3CQZ I;  3I4N I;  4A93 I;  3S1Q I;  2HF1 A;  3GTO I;  2J6A A;  3I07 A;  4XX2 A;  1USP B;  2DE6 A;  1Y1W I;  4NBG A;  5IP7 I;  3HOY I;  2JS4 A;  3GTM I;  2JNY A;  3ESW A;  2JA5 I;  3M3Y I;  4NBE A;  5C44 I;  3HOX I;  3K7A I;  2R92 I;  2F4O A;  3FKI I;  5CM2 M;  4BY7 I;  2DE5 A;  3EER A;  2BJO A;  1RLY A;  4NB8 A;  4QTU A;  3RZD I;  1R9T I;  2YU9 I;  1TWF I;  1QYP A;  4A3D I;  1PFT A;  2E2J I;  2DE7 A;  3VMI A;  3HOU I;  4NOZ A;  3GTP I;  3S2H I;  3GTM S;  1TWA I;  1TWH I;  3GTK I;  3HOW I;  4A3M I;  4X6A I;  2P3Y A;  3S14 I;  3GTJ I;  2NVT I;  3PO3 I;  2R93 I;  4A3E I;  3HOZ I;  2F4M A;  4BBS I;  1I3Q I;  3S16 I;  3VB9 A;  3S17 I;  4MH4 A;  3RZO I;  1Y1V S;  1WCM I;  1USP A;  3M4O I;  4A3C I;  2K5R A;  3S1R I;  1DL6 A;  1YUA A;  4A3K I;  2NVQ I;  2JA7 I;  3H0G I;  1TFI A;  2VUM I;  4NBH A;  3GCF A;  3GKQ A;  4NBF A;  1NUI A;  3VMH A;  4NBC A;  2AKL A;  3Q87 A;  1I50 I;  1ZB8 A;  3PO3 S;  1LQL A;  2R7Z I;  1K83 I;  4A3G I;  3D6W A;  4NBA A;  1ML8 A;  2B63 I;  4Y52 I;  1L1O C;  2PK7 A;  5C4J I;  4A3L I;  3S15 I;  2KPI A;  4BBR I;  3S1M I;  5C3E I;  2RBL A;  4Y7N I;  5FLM I;  4QTT A;  4BY1 I;  4A3J I;  2NVX I;  1ZB9 A; 
#chains in the Genus database with same CATH topology
 3CCJ 1;  5FLX f;  3NH4 A;  1RO0 A;  4A3F I;  5AN9 F;  1SFO I;  1X3W A;  1I6H I;  3H3V J;  5FLX b;  1KC8 2;  1WW9 A;  4AYB A;  1QF8 A;  2LIY A;  1WII A;  2WB1 A;  1YI2 1;  3QWU A;  3U50 C;  1N8R 2;  4E2Y A;  2E2I I;  5C4X I;  1N2F A;  3JAM f;  2JA8 I;  2JIQ A;  2V45 A;  4MON A;  4E30 A;  3G71 Z;  1VQM 1;  3I4N I;  4A93 I;  2J6A A;  2JUB A;  1KD1 1;  1VQ4 1;  3J81 b;  1YIJ 1;  1K9M 1;  3HOY I;  3CCU Z;  3CC4 Z;  2NAP A;  1Q81 2;  3CCM 1;  2GTH A;  1RLY A;  5D1O A;  1PFT A;  1S7M A;  3OW2 Y;  3CCU 1;  1K73 2;  2K3R A;  2E2J I;  1QVF Y;  1FDI A;  1NJI 1;  4NOZ A;  3CCE Z;  2O53 A;  3GTM S;  4X6A I;  2QRE B;  3PO3 I;  2Q4Z A;  1VQO Z;  4A3E I;  1M1K 2;  4BBS I;  2PM9 A;  3S17 I;  4HGY A;  1WCM I;  1DL6 A;  2QA4 1;  1YHQ 1;  4E2X A;  1VQ8 Z;  1Q82 2;  2VUM I;  4NBH A;  3CME Z;  4NBF A;  4NH1 C;  1JJ2 Z;  1VQ9 Z;  3F3P C;  1WJ2 A;  1LQL A;  4A3G I;  1K83 I;  3D6W A;  2H85 A;  4MD9 A;  2PK7 A;  5T6B A;  1VQL 1;  1S72 1;  2YAD A;  2RBL A;  4E2W A;  5FLM I;  1VQ7 1;  3LUS A;  2I3C A;  3S1N I;  3IR7 A;  4RS4 A;  1YIT 1;  4BXX I;  3TDH B;  1SIW A;  1YIT Z;  1TWG I;  4RV9 A;  3NFZ A;  1YJ9 Z;  4MXU A;  1Z03 A;  4MD7 A;  2E2H I;  1AA6 A;  2M48 A;  4S1T A;  1Y8C A;  1VQ9 1;  1YUK A;  4TNU A;  3VMG A;  3G6E Z;  1YI2 Z;  2HF1 A;  3GTO I;  3I07 A;  1KQS Y;  3CCQ 1;  2QKD A;  3CPW Z;  2LEX A;  3GTM I;  2JNY A;  3ESW A;  2JA5 I;  1RNI A;  3F3F C;  3BG1 B;  3NDJ A;  2WAQ A;  1VQ6 1;  3CCQ Z;  3G6E 1;  3FKI I;  3CC4 1;  3NDI A;  1Q7Y 1;  2DE5 A;  3CD6 Z;  3D9X A;  2BJO A;  4NB8 A;  4QTU A;  1TWF I;  4A3D I;  2DE7 A;  3VMI A;  1YJ9 1;  1JJ2 Y;  3MON A;  2VPW A;  3GTP I;  1Q7Y 2;  1TWH I;  2GU2 A;  4MRI A;  2M6N A;  3J80 b;  2EGT A;  2F4M A;  2VPX A;  3P5J B;  1YJN Z;  3KIH A;  3S16 I;  2W03 A;  1JWH C;  3D2L A;  1USP A;  4A3C I;  2QR1 B;  2RIQ A;  1YUA A;  4A3K I;  3CPW Y;  2PMZ A;  1TFI A;  1FDO A;  1M1K 1;  2V3V A;  4EWC A;  3NH5 A;  1KQS Z;  2E7Z A;  1Z02 A;  3VMH A;  2OOY B;  1NJI 2;  2QEX 1;  3CCR 1;  3J81 f;  3G71 1;  3EED A;  2R7Z I;  5A2Q b;  2VPZ A;  1VQ8 1;  2B63 I;  3CC2 Z;  3FQQ A;  1VQ6 Z;  4A3L I;  2KPI A;  3CCV Z;  2OOX B;  2OTL Z;  4BY1 I;  2QLV B;  1ZB9 A;  2V8K A;  1Q81 1;  1X3Z A;  3HOV I;  4A3B I;  2IZ4 A;  4NBD A;  4HH4 A;  3I55 Z;  1VQK Z;  1VQP 1;  3J80 f;  1K9M 2;  1VLA A;  5IP9 I;  3PO2 I;  3GTG I;  2JIM A;  3BG0 B;  1X0T A;  1VQN Z;  2V8J A;  3J7A 4;  3CD6 1;  3CCE 1;  2G2K A;  4DQY B;  1NP6 A;  2JR6 A;  2VUG A;  3I4M I;  2NVY I;  4NBB A;  1Q82 1;  3CQZ I;  2QRC B;  1YJN 1;  4XX2 A;  2RPR A;  1USP B;  1Y1W I;  3TE5 B;  3CCS Z;  3HOX I;  3K7A I;  1VQN 1;  1KRL A;  2R92 I;  2F4O A;  4E33 A;  3IFU A;  2QRD B;  3RZD I;  1K73 1;  4RVF A;  1RQF A;  4RVG A;  2IZ3 A;  3I56 1;  3G4S 1;  3HOU I;  1QVF Z;  1M90 2;  3OW2 Z;  3S2H I;  1TWA I;  4A3M I;  3IF8 A;  3GTJ I;  2R93 I;  1VQ7 Z;  3CC2 1;  3HOZ I;  2OTJ 1;  5T67 A;  3JAM b;  3VB9 A;  1S72 Z;  4MH4 A;  1Y1V S;  5D1O B;  5LL6 f;  1KD1 2;  3CCJ Z;  2NVQ I;  3H0G I;  1YJW Z;  2R6M A;  1Q86 2;  4DK1 A;  3GCF A;  1NUI A;  4NBC A;  1N8R 1;  3CXC Y;  2HU9 A;  3VTN A;  4E31 A;  3Q87 A;  1ZB8 A;  3IX0 A;  3PO3 S;  3CME 1;  1QVG Z;  3HKZ A;  3CCV 1;  2QA4 Z;  1YHQ Z;  4NBA A;  1W2B Z;  1KC8 1;  3G4S Z;  3CC7 Z;  1QXF A;  5C4J I;  4BBR I;  3S1M I;  2KI7 B;  3KIF A;  5D1P A;  1VQO 1;  2AYD A;  4MD8 A;  1VQ5 1;  3S2D I;  1ZH1 A;  2JIP A;  4RVH A;  2JA6 I;  3GTL I;  4E32 A;  3GTQ I;  4CL1 A;  2VF1 A;  2ZAE B;  3CCS 1;  1RO4 A;  2VPY A;  2IV2 X;  1TWC I;  4DGL A;  3T4N B;  1K8A 2;  3CMA Z;  3CC7 1;  1Y1V I;  2E9H A;  4A3I I;  4HGZ A;  3I56 Z;  4NB9 A;  2OZK A;  3S1Q I;  2DE6 A;  1VQL Z;  4NBG A;  5IP7 I;  2JS4 A;  1VQP Z;  1YJW 1;  3M3Y I;  1RO2 A;  4NBE A;  2V8I A;  5C44 I;  2OTJ Z;  3I55 1;  1VQK 1;  1W2B Y;  5CM2 M;  2O4H A;  4BY7 I;  1QVG Y;  2OTL 1;  3EER A;  1Q16 A;  2JIR A;  2Q51 A;  1R9T I;  2YU9 I;  1QYP A;  4E2Z A;  3CXC Z;  3CCM Z;  3CMA 1;  3CCR Z;  5IT9 f;  3GTK I;  3HOW I;  2QEX Z;  2P3Y A;  3S14 I;  2JIO A;  2NVT I;  3CCL Z;  1Q86 1;  5IT9 b;  1I3Q I;  1WZN A;  1VQ4 Z;  3MZL B;  3RZO I;  3FQM A;  3M4O I;  2RT9 A;  2K5R A;  3CCL 1;  3S1R I;  2W04 A;  1VQ5 Z;  2JA7 I;  1P9N A;  2LFU A;  3GKQ A;  4RVD A;  3MZK B;  4NFR A;  2GTI A;  2RHB A;  2AKL A;  1K8A 1;  1M90 1;  5A2Q f;  1I50 I;  1Z01 A;  3NH8 A;  1ML8 A;  4Y52 I;  1YIJ Z;  1L1O C;  3S15 I;  5C3E I;  2P28 A;  4Y7N I;  2JMO A;  1VQM Z;  4QTT A;  2Y0S A;  4A3J I;  2NVX I;  5T64 A; 
#chains in the Genus database with same CATH homology
 3CCJ 1;  5FLX f;  3NH4 A;  1RO0 A;  4A3F I;  5AN9 F;  1SFO I;  1X3W A;  1I6H I;  3H3V J;  5FLX b;  1KC8 2;  1WW9 A;  4AYB A;  1QF8 A;  2LIY A;  1WII A;  2WB1 A;  1YI2 1;  3QWU A;  3U50 C;  1N8R 2;  4E2Y A;  2E2I I;  5C4X I;  1N2F A;  3JAM f;  2JA8 I;  4MON A;  4E30 A;  1VQM 1;  3G71 Z;  3I4N I;  4A93 I;  2J6A A;  2JUB A;  1KD1 1;  1VQ4 1;  3J81 b;  1YIJ 1;  1K9M 1;  3HOY I;  3CCU Z;  3CC4 Z;  1Q81 2;  3CCM 1;  2GTH A;  1RLY A;  5D1O A;  1PFT A;  1S7M A;  3OW2 Y;  3CCU 1;  1K73 2;  2K3R A;  2E2J I;  1QVF Y;  1NJI 1;  4NOZ A;  3CCE Z;  2O53 A;  3GTM S;  4X6A I;  2QRE B;  3PO3 I;  2Q4Z A;  1VQO Z;  4A3E I;  1M1K 2;  4BBS I;  2PM9 A;  3S17 I;  4HGY A;  1WCM I;  1DL6 A;  2QA4 1;  1YHQ 1;  4E2X A;  1VQ8 Z;  1Q82 2;  2VUM I;  4NBH A;  3CME Z;  4NBF A;  4NH1 C;  1JJ2 Z;  1VQ9 Z;  3F3P C;  1LQL A;  4A3G I;  1K83 I;  3D6W A;  2H85 A;  4MD9 A;  2PK7 A;  5T6B A;  1VQL 1;  1S72 1;  2YAD A;  2RBL A;  4E2W A;  5FLM I;  1VQ7 1;  3LUS A;  2I3C A;  3S1N I;  4RS4 A;  1YIT 1;  4BXX I;  3TDH B;  1YIT Z;  1TWG I;  4RV9 A;  3NFZ A;  1YJ9 Z;  4MXU A;  1Z03 A;  4MD7 A;  2E2H I;  2M48 A;  4S1T A;  1VQ9 1;  1YUK A;  4TNU A;  3VMG A;  3G6E Z;  1YI2 Z;  2HF1 A;  3GTO I;  3I07 A;  1KQS Y;  3CCQ 1;  2QKD A;  3CPW Z;  3GTM I;  2JNY A;  3ESW A;  2JA5 I;  1RNI A;  3F3F C;  3BG1 B;  3NDJ A;  2WAQ A;  1VQ6 1;  3CCQ Z;  3G6E 1;  3FKI I;  3CC4 1;  3NDI A;  1Q7Y 1;  2DE5 A;  3CD6 Z;  3D9X A;  2BJO A;  4NB8 A;  4QTU A;  1TWF I;  4A3D I;  2DE7 A;  3VMI A;  1YJ9 1;  1JJ2 Y;  3MON A;  3GTP I;  1Q7Y 2;  1TWH I;  2GU2 A;  4MRI A;  2M6N A;  3J80 b;  2EGT A;  2F4M A;  3P5J B;  1YJN Z;  3KIH A;  3S16 I;  2W03 A;  1JWH C;  1USP A;  4A3C I;  2QR1 B;  2RIQ A;  1YUA A;  4A3K I;  3CPW Y;  2PMZ A;  1TFI A;  1M1K 1;  4EWC A;  3NH5 A;  1KQS Z;  1Z02 A;  3VMH A;  2OOY B;  1NJI 2;  2QEX 1;  3CCR 1;  3J81 f;  3G71 1;  3EED A;  2R7Z I;  5A2Q b;  1VQ8 1;  2B63 I;  3CC2 Z;  3FQQ A;  1VQ6 Z;  4A3L I;  2KPI A;  3CCV Z;  2OOX B;  2OTL Z;  4BY1 I;  2QLV B;  1ZB9 A;  2V8K A;  1Q81 1;  1X3Z A;  3HOV I;  4A3B I;  2IZ4 A;  4NBD A;  4HH4 A;  3I55 Z;  1VQK Z;  1VQP 1;  3J80 f;  1K9M 2;  1VLA A;  5IP9 I;  3PO2 I;  3GTG I;  3BG0 B;  1X0T A;  1VQN Z;  2V8J A;  3J7A 4;  3CD6 1;  3CCE 1;  2G2K A;  4DQY B;  1NP6 A;  2JR6 A;  2VUG A;  3I4M I;  2NVY I;  4NBB A;  1Q82 1;  3CQZ I;  2QRC B;  1YJN 1;  4XX2 A;  2RPR A;  1USP B;  1Y1W I;  3TE5 B;  3CCS Z;  3HOX I;  3K7A I;  1VQN 1;  1KRL A;  2R92 I;  2F4O A;  4E33 A;  3IFU A;  2QRD B;  3RZD I;  1K73 1;  4RVF A;  1RQF A;  4RVG A;  2IZ3 A;  3I56 1;  3G4S 1;  3HOU I;  1QVF Z;  1M90 2;  3OW2 Z;  3S2H I;  1TWA I;  4A3M I;  3IF8 A;  3GTJ I;  2R93 I;  1VQ7 Z;  3CC2 1;  3HOZ I;  2OTJ 1;  5T67 A;  3JAM b;  3VB9 A;  1S72 Z;  4MH4 A;  1Y1V S;  5D1O B;  5LL6 f;  1KD1 2;  3CCJ Z;  2NVQ I;  3H0G I;  1YJW Z;  2R6M A;  1Q86 2;  4DK1 A;  3GCF A;  1NUI A;  4NBC A;  1N8R 1;  3CXC Y;  2HU9 A;  3VTN A;  4E31 A;  3Q87 A;  1ZB8 A;  3IX0 A;  3PO3 S;  3CME 1;  1QVG Z;  3HKZ A;  3CCV 1;  2QA4 Z;  1YHQ Z;  4NBA A;  1W2B Z;  1KC8 1;  3G4S Z;  3CC7 Z;  5C4J I;  4BBR I;  3S1M I;  2KI7 B;  3KIF A;  5D1P A;  1VQO 1;  4MD8 A;  1VQ5 1;  3S2D I;  1ZH1 A;  4RVH A;  2JA6 I;  3GTL I;  4E32 A;  3GTQ I;  4CL1 A;  2VF1 A;  2ZAE B;  3CCS 1;  1RO4 A;  1TWC I;  4DGL A;  3T4N B;  1K8A 2;  3CMA Z;  3CC7 1;  1Y1V I;  2E9H A;  4A3I I;  4HGZ A;  3I56 Z;  4NB9 A;  2OZK A;  3S1Q I;  2DE6 A;  1VQL Z;  4NBG A;  5IP7 I;  2JS4 A;  1VQP Z;  1YJW 1;  3M3Y I;  1RO2 A;  4NBE A;  2V8I A;  5C44 I;  2OTJ Z;  3I55 1;  1VQK 1;  1W2B Y;  5CM2 M;  2O4H A;  4BY7 I;  1QVG Y;  2OTL 1;  3EER A;  2Q51 A;  1R9T I;  2YU9 I;  1QYP A;  4E2Z A;  3CXC Z;  3CCM Z;  3CMA 1;  3CCR Z;  5IT9 f;  3GTK I;  3HOW I;  2QEX Z;  2P3Y A;  3S14 I;  2NVT I;  3CCL Z;  1Q86 1;  5IT9 b;  1I3Q I;  1VQ4 Z;  3MZL B;  3RZO I;  3FQM A;  3M4O I;  2RT9 A;  2K5R A;  3CCL 1;  3S1R I;  2W04 A;  1VQ5 Z;  2JA7 I;  1P9N A;  2LFU A;  3GKQ A;  4RVD A;  3MZK B;  4NFR A;  2GTI A;  2RHB A;  2AKL A;  1K8A 1;  1M90 1;  5A2Q f;  1I50 I;  1Z01 A;  3NH8 A;  1ML8 A;  4Y52 I;  1YIJ Z;  1L1O C;  3S15 I;  5C3E I;  2P28 A;  4Y7N I;  2JMO A;  1VQM Z;  4QTT A;  2Y0S A;  4A3J I;  2NVX I;  5T64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...