3S17I

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s17I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s17I02
2P3YA 3GTMI 4Y52I 3GTKI 3S1NI 3K7AI 1Y1VI 3FKII 4XX2A 5C4JI 2R93I 1WCMI 1X3WA 3S14I 4A3FI 1TWAI 3S1RI 3HOUI 5C44I 3VMHA 3M4OI 1PFTA 3HOZI 2NVXI 1VLAA 4NBFA 4NBDA 2JA7I 2JA5I 5CM2M 2E2II 4A3BI 1DL6A 4NB8A 2BJOA 4BXXI 1NUIA 2JR6A 1USPA 1I6HI 4BY7I 5FLMI 4NBEA 4A3LI 2KPIA 3S16I 3I4NI 3EERA 5IP7I 2HF1A 5C3EI 3M3YI 2RBLA 3RZDI 1ZB8A 2F4OA 4BY1I 3CQZI 3GTPI 2DE7A 3PO2I 2JA6I 3LUSA 1LQLA 4A3KI 4A3CI 4NB9A 3GKQA 3S17I 1ML8A 3GCFA 4MH4A 2NVTI 5C4XI 4NOZA 1RO4A 2AKLA 3I4MI 3H0GI 4NBBA 2K5RA 2JA8I 3HOXI 4A3MI 4X6AI 3VMIA 1X3ZA 3PO3S 1K83I 4A3II 2F4MA 3GTLI 4NBHA 4QTUA 2R7ZI 2VUMI 3GTJI 2JS4A 3S2HI 1I50I 1TWFI 3Q87A 3GTGI 2PK7A 2E2HI 4BBRI 1L1OC 1TWCI 4QTTA 3GTMS 3VMGA 4A3DI 3S1MI 3VB9A 3S15I 3HOVI 2NVQI 4BBSI 1Y1VS 1TWHI 3ESWA 1RLYA 1WW9A 1ZB9A 4NBCA 1TWGI 2B63I 2E2JI 4A3JI 3H3VJ 3U50C 1N2FA 1SFOI 2DE5A 1USPB 4A3EI 4NBAA 1I3QI 3GTQI 3S2DI 2JNYA 4NBGA 2YU9I 3S1QI 3D6WA 2R92I 2J6AA 3HOWI 3HOYI 4A3GI 2NVYI 3GTOI 3PO3I 3RZOI 1QYPA 4A93I 1Y1WI 2DE6A 1TFIA 3I07A 5IP9I 1R9TI 4Y7NI 1YUAA
chains in the Genus database with same CATH superfamily
3IF8A 3CCQ1 1WJ2A 4Y52I 3S1NI 3I55Z 1Y1VI 4XX2A 2K3RA 3CCU1 3NH4A 3HOUI 4RVGA 3VMHA 1PFTA 5D1PA 4HGZA 4NBFA 1YI21 1QF8A 2JA7I 1VQ91 2JA5I 4A3BI 1M902 4E30A 4BXXI 1YIJ1 1I6HI 3CC2Z 5FLXf 4NBEA 3IR7A 3S16I 1WIIA 5IP7I 1M1K2 2O53A 2RBLA 3CME1 4E2ZA 2E9HA 1VQ5Z 2V8JA 2I3CA 2DE7A 3CMA1 2JA6I 1YJ9Z 4A3KI 3CD61 3CCL1 3TE5B 1ML8A 3MZKB 3I561 4MD8A 2QA41 2NVTI 3NDJA 1RO4A 4DGLA 3G711 1NJI1 2JA8I 3HOXI 1JJ2Z 2V45A 4A3MI 3PO3S 1VQM1 2VPWA 4NBHA 3G4S1 1ZH1A 2OOXB 1TWFI 1Z02A 3FQQA 1TWCI 4QTTA 4DK1A 1YUKA 3NFZA 3VMGA 3GTMS 4A3DI 3VB9A 2VPYA 2NVQI 4BBSI 2VPXA 2M48A 4MD9A 3G6E1 1WW9A 1TWGI 1Y8CA 3H3VJ 3CC7Z 2LIYA 3CCS1 1SFOI 2DE5A 5IT9f 3CCVZ 1I3QI 2WAQA 3S2DI 2OOYB 4NBGA 2QEX1 3BG1B 4E33A 1K8A2 1W2BY 1VQPZ 3NH8A 1QYPA 1VQO1 3CPWZ 2QRDB 4MRIA 2GTIA 1Y1WI 4Y7NI 1YUAA 1JJ2Y 3CC4Z 1S721 3GTKI 1FDOA 3FKII 2JMOA 1X3WA 1K9M1 3S14I 4AYBA 3S1RI 2EGTA 5C44I 2WB1A 2M6NA 2V8KA 3M4OI 5A2Qb 1YITZ 2JIMA 2GU2A 2G2KA 4NBDA 4E2WA 5CM2M 1Z03A 2JR6A 4HGYA 1USPA 2PM9A 1AA6A 2QRCB 2IV2X 5FLMI 4BY7I 4A3LI 1YJN1 3EERA 3MZLB 3J7A4 3J81b 4BY1I 1S7MA 2Y0SA 1YHQZ 1M901 3GTPI 3CCR1 1K732 3PO2I 3P5JB 3GKQA 3S17I 2PMZA 3GCFA 1M1K1 5T67A 2OTL1 1VQN1 1RO2A 3CPWY 1K83I 4A3II 2F4MA 1RO0A 3CCUZ 2VUMI 3KIHA 2JS4A 1QVGY 3GTGI 5D1OA 4BBRI 1L1OC 3NH5A 1YI2Z 2OTJ1 1VQ9Z 4E31A 1Y1VS 1YIJZ 3CXCZ 1RLYA 2QLVB 1VQ61 4NBCA 1YJWZ 1VQK1 2E2JI 3CMEZ 4A3JI 1USPB 3D9XA 3CCM1 4NBAA 3CMAZ 2VPZA 1Q822 1Q811 3GTQI 2JNYA 4DQYB 2YU9I 4RVFA 4CL1A 5LL6f 4E2YA 1VQ81 3CCLZ 3CD6Z 1NP6A 2QREB 2R92I 2QA4Z 3HOWI 4NFRA 4A3GI 1VQ41 2NVYI 3GTOI 3NDIA 3G71Z 1Q812 1K8A1 1TFIA 1VQMZ 2V8IA 3G4SZ 1N8R1 1Q862 3VTNA 3OW2Z 1VQL1 3K7AI 5C4JI 3CCV1 1WCMI 2OZKA 4A3FI 1TWAI 2IZ3A 3FQMA 2RPRA 5A2Qf 1N8R2 2W03A 2IZ4A 2LFUA 1DL6A 5D1OB 4NB8A 2RT9A 1KD12 3KIFA 3CCSZ 3HKZA 5C3EI 2HF1A 4RV9A 4NH1C 3M3YI 2QEXZ 3T4NB 2YADA 5AN9F 2F4OA 3J81f 3JAMb 3BG0B 3CCE1 2Q4ZA 3LUSA 4A3CI 2RHBA 4NB9A 2V3VA 2HU9A 4RVDA 4MH4A 1VQOZ 5C4XI 2AKLA 3IFUA 3H0GI 4NBBA 3EEDA 1K731 4MONA 4X6AI 2VF1A 1S72Z 2NAPA 3VMIA 3QWUA 4QTUA 3S2HI 3I551 1YHQ1 2PK7A 3CCJZ 2E2HI 3S1MI 3S15I 1RNIA 1KQSZ 1TWHI 1KRLA 2H85A 4MD7A 1ZB9A 1VQ7Z 2KI7B 4MXUA 4EWCA 3CC21 3CCQZ 4RVHA 3D2LA 3CCRZ 1KC82 2JIRA 1FDIA 1VQ51 2OTLZ 2J6AA 3MONA 1YJ91 1VQNZ 1QVFZ 1RQFA 3PO3I 3RZOI 1Q821 4A93I 4HH4A 3J80b 5IP9I 2QR1B 1R9TI 1YJW1 2P3YA 3GTMI 1W2BZ 2R93I 1Q16A 1JWHC 2OTJZ 1P9NA 3I56Z 5T64A 2LEXA 3HOZI 2NVXI 1VQ6Z 1VLAA 1Q861 2JIPA 2E2II 2BJOA 1KQSY 1NUIA 1VQKZ 5FLXb 2KPIA 2QKDA 3I4NI 3CCMZ 2JIOA 2R6MA 3RZDI 1ZB8A 3CC71 1VQ8Z 1NJI2 3CQZI 3JAMf 1KD11 1VQ4Z 3IX0A 2RIQA 1LQLA 1WZNA 4NOZA 3G6EZ 3TDHB 1VQP1 3I4MI 1QXFA 1QVFY 2K5RA 5T6BA 3CXCY 4E32A 2P28A 1VQLZ 1X3ZA 3GTLI 1Z01A 2R7ZI 3GTJI 3CC41 2GTHA 1I50I 3F3FC 3Q87A 1SIWA 2JUBA 1Q7Y1 3HOVI 2JIQA 1YIT1 3ESWA 4RS4A 2VUGA 4E2XA 2B63I 1Q7Y2 3U50C 1N2FA 5IT9b 1QVGZ 4A3EI 3CCEZ 3S1QI 2Q51A 3F3PC 3D6WA 3OW2Y 1X0TA 2ZAEB 3HOYI 3CCJ1 4TNUA 4S1TA 2O4HA 1KC81 1K9M2 2AYDA 1YJNZ 2DE6A 3I07A 3J80f 2W04A 2E7ZA 1VQ71
chains in the Genus database with same CATH topology
3IF8A 3CCQ1 4Y52I 3S1NI 3I55Z 1Y1VI 4XX2A 2K3RA 3CCU1 3NH4A 3HOUI 4RVGA 3VMHA 1PFTA 5D1PA 4HGZA 4NBFA 1YI21 1QF8A 2JA7I 1VQ91 2JA5I 4A3BI 1M902 4E30A 4BXXI 1YIJ1 1I6HI 3CC2Z 5FLXf 4NBEA 3S16I 1WIIA 5IP7I 1M1K2 2O53A 2RBLA 3CME1 4E2ZA 2E9HA 1VQ5Z 2V8JA 2I3CA 2DE7A 3CMA1 2JA6I 1YJ9Z 4A3KI 3CD61 3CCL1 3TE5B 1ML8A 3MZKB 3I561 4MD8A 2QA41 2NVTI 3NDJA 1RO4A 4DGLA 3G711 1NJI1 2JA8I 3HOXI 1JJ2Z 4A3MI 3PO3S 1VQM1 4NBHA 3G4S1 1ZH1A 2OOXB 1TWFI 1Z02A 3FQQA 1TWCI 4QTTA 4DK1A 1YUKA 3NFZA 3VMGA 3GTMS 4A3DI 3VB9A 2NVQI 4BBSI 2M48A 4MD9A 3G6E1 1WW9A 1TWGI 3H3VJ 3CC7Z 2LIYA 3CCS1 1SFOI 2DE5A 5IT9f 3CCVZ 1I3QI 2WAQA 3S2DI 2OOYB 4NBGA 2QEX1 3BG1B 4E33A 1K8A2 1W2BY 1VQPZ 3NH8A 1QYPA 1VQO1 3CPWZ 2QRDB 4MRIA 2GTIA 1Y1WI 4Y7NI 1YUAA 1JJ2Y 3CC4Z 1S721 3GTKI 3FKII 2JMOA 1X3WA 1K9M1 3S14I 4AYBA 3S1RI 2EGTA 5C44I 2WB1A 2M6NA 2V8KA 3M4OI 5A2Qb 1YITZ 2GU2A 2G2KA 4NBDA 4E2WA 5CM2M 1Z03A 2JR6A 4HGYA 1USPA 2PM9A 2QRCB 4BY7I 5FLMI 4A3LI 1YJN1 3EERA 3MZLB 3J7A4 3J81b 4BY1I 1S7MA 2Y0SA 1YHQZ 1M901 3GTPI 3CCR1 1K732 3PO2I 3P5JB 3GKQA 3S17I 2PMZA 3GCFA 1M1K1 5T67A 2OTL1 1VQN1 1RO2A 3CPWY 1K83I 4A3II 2F4MA 1RO0A 3CCUZ 2VUMI 3KIHA 2JS4A 1QVGY 3GTGI 5D1OA 4BBRI 1L1OC 3NH5A 1YI2Z 2OTJ1 1VQ9Z 4E31A 1Y1VS 1YIJZ 3CXCZ 1RLYA 2QLVB 1VQ61 4NBCA 1YJWZ 1VQK1 2E2JI 3CMEZ 4A3JI 1USPB 3D9XA 3CCM1 4NBAA 3CMAZ 1Q822 3GTQI 1Q811 2JNYA 4DQYB 2YU9I 4RVFA 4CL1A 5LL6f 4E2YA 1VQ81 3CCLZ 3CD6Z 1NP6A 2QREB 2R92I 2QA4Z 3HOWI 4NFRA 4A3GI 1VQ41 2NVYI 3GTOI 3NDIA 3G71Z 1Q812 1K8A1 1TFIA 1VQMZ 2V8IA 3G4SZ 1N8R1 1Q862 3VTNA 3OW2Z 1VQL1 3K7AI 5C4JI 3CCV1 1WCMI 2OZKA 4A3FI 1TWAI 2IZ3A 3FQMA 2RPRA 5A2Qf 1N8R2 2W03A 2IZ4A 2LFUA 1DL6A 5D1OB 4NB8A 2RT9A 1KD12 3KIFA 3CCSZ 3HKZA 5C3EI 2HF1A 4RV9A 4NH1C 3M3YI 2QEXZ 3T4NB 2YADA 5AN9F 2F4OA 3J81f 3JAMb 3BG0B 3CCE1 2Q4ZA 3LUSA 4A3CI 2RHBA 4NB9A 2HU9A 4RVDA 4MH4A 1VQOZ 5C4XI 2AKLA 3IFUA 3H0GI 4NBBA 3EEDA 1K731 4MONA 4X6AI 2VF1A 1S72Z 3VMIA 3QWUA 4QTUA 3S2HI 3I551 1YHQ1 2PK7A 3CCJZ 2E2HI 3S1MI 3S15I 1RNIA 1KQSZ 1TWHI 1KRLA 2H85A 4MD7A 1ZB9A 1VQ7Z 2KI7B 4MXUA 4EWCA 3CC21 3CCQZ 4RVHA 3CCRZ 1KC82 1VQ51 2OTLZ 2J6AA 3MONA 1YJ91 1VQNZ 1QVFZ 1RQFA 3PO3I 3RZOI 1Q821 4A93I 4HH4A 3J80b 5IP9I 2QR1B 1R9TI 1YJW1 2P3YA 3GTMI 1W2BZ 2R93I 1JWHC 2OTJZ 1P9NA 3I56Z 5T64A 3HOZI 2NVXI 1VQ6Z 1VLAA 1Q861 2E2II 2BJOA 1KQSY 1NUIA 1VQKZ 5FLXb 2KPIA 2QKDA 3I4NI 3CCMZ 2R6MA 3RZDI 1ZB8A 3CC71 1VQ8Z 1NJI2 3CQZI 3JAMf 1KD11 1VQ4Z 3IX0A 2RIQA 1LQLA 4NOZA 3G6EZ 3TDHB 1VQP1 3I4MI 1QVFY 2K5RA 5T6BA 3CXCY 4E32A 2P28A 1VQLZ 1X3ZA 3GTLI 1Z01A 2R7ZI 3GTJI 3CC41 2GTHA 1I50I 3F3FC 3Q87A 2JUBA 1Q7Y1 3HOVI 1YIT1 3ESWA 4RS4A 2VUGA 4E2XA 2B63I 1Q7Y2 3U50C 1N2FA 5IT9b 1QVGZ 4A3EI 3CCEZ 3S1QI 2Q51A 3F3PC 3D6WA 3OW2Y 1X0TA 2ZAEB 3HOYI 3CCJ1 4TNUA 4S1TA 2O4HA 1KC81 1K9M2 1YJNZ 2DE6A 3I07A 3J80f 2W04A 1VQ71
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P3Y A;  3GTM I;  4Y52 I;  3GTK I;  3S1N I;  3K7A I;  1Y1V I;  3FKI I;  4XX2 A;  5C4J I;  2R93 I;  1WCM I;  1X3W A;  3S14 I;  4A3F I;  1TWA I;  3S1R I;  3HOU I;  5C44 I;  3VMH A;  3M4O I;  1PFT A;  3HOZ I;  2NVX I;  1VLA A;  4NBF A;  4NBD A;  2JA7 I;  2JA5 I;  5CM2 M;  2E2I I;  4A3B I;  1DL6 A;  4NB8 A;  2BJO A;  4BXX I;  1NUI A;  2JR6 A;  1USP A;  1I6H I;  4BY7 I;  5FLM I;  4NBE A;  4A3L I;  2KPI A;  3S16 I;  3I4N I;  3EER A;  5IP7 I;  2HF1 A;  5C3E I;  3M3Y I;  2RBL A;  3RZD I;  1ZB8 A;  2F4O A;  4BY1 I;  3CQZ I;  3GTP I;  2DE7 A;  3PO2 I;  2JA6 I;  3LUS A;  1LQL A;  4A3K I;  4A3C I;  4NB9 A;  3GKQ A;  3S17 I;  1ML8 A;  3GCF A;  4MH4 A;  2NVT I;  5C4X I;  4NOZ A;  1RO4 A;  2AKL A;  3I4M I;  3H0G I;  4NBB A;  2K5R A;  2JA8 I;  3HOX I;  4A3M I;  4X6A I;  3VMI A;  1X3Z A;  3PO3 S;  1K83 I;  4A3I I;  2F4M A;  3GTL I;  4NBH A;  4QTU A;  2R7Z I;  2VUM I;  3GTJ I;  2JS4 A;  3S2H I;  1I50 I;  1TWF I;  3Q87 A;  3GTG I;  2PK7 A;  2E2H I;  4BBR I;  1L1O C;  1TWC I;  4QTT A;  3GTM S;  3VMG A;  4A3D I;  3S1M I;  3VB9 A;  3S15 I;  3HOV I;  2NVQ I;  4BBS I;  1Y1V S;  1TWH I;  3ESW A;  1RLY A;  1WW9 A;  1ZB9 A;  4NBC A;  1TWG I;  2B63 I;  2E2J I;  4A3J I;  3H3V J;  3U50 C;  1N2F A;  1SFO I;  2DE5 A;  1USP B;  4A3E I;  4NBA A;  1I3Q I;  3GTQ I;  3S2D I;  2JNY A;  4NBG A;  2YU9 I;  3S1Q I;  3D6W A;  2R92 I;  2J6A A;  3HOW I;  3HOY I;  4A3G I;  2NVY I;  3GTO I;  3PO3 I;  3RZO I;  1QYP A;  4A93 I;  1Y1W I;  2DE6 A;  1TFI A;  3I07 A;  5IP9 I;  1R9T I;  4Y7N I;  1YUA A; 
#chains in the Genus database with same CATH topology
 3IF8 A;  3CCQ 1;  1WJ2 A;  4Y52 I;  3S1N I;  3I55 Z;  1Y1V I;  4XX2 A;  2K3R A;  3CCU 1;  3NH4 A;  3HOU I;  4RVG A;  3VMH A;  1PFT A;  5D1P A;  4HGZ A;  4NBF A;  1YI2 1;  1QF8 A;  2JA7 I;  1VQ9 1;  2JA5 I;  4A3B I;  1M90 2;  4E30 A;  4BXX I;  1YIJ 1;  1I6H I;  3CC2 Z;  5FLX f;  4NBE A;  3IR7 A;  3S16 I;  1WII A;  5IP7 I;  1M1K 2;  2O53 A;  2RBL A;  3CME 1;  4E2Z A;  2E9H A;  1VQ5 Z;  2V8J A;  2I3C A;  2DE7 A;  3CMA 1;  2JA6 I;  1YJ9 Z;  4A3K I;  3CD6 1;  3CCL 1;  3TE5 B;  1ML8 A;  3MZK B;  3I56 1;  4MD8 A;  2QA4 1;  2NVT I;  3NDJ A;  1RO4 A;  4DGL A;  3G71 1;  1NJI 1;  2JA8 I;  3HOX I;  1JJ2 Z;  2V45 A;  4A3M I;  3PO3 S;  1VQM 1;  2VPW A;  4NBH A;  3G4S 1;  1ZH1 A;  2OOX B;  1TWF I;  1Z02 A;  3FQQ A;  1TWC I;  4QTT A;  4DK1 A;  1YUK A;  3NFZ A;  3VMG A;  3GTM S;  4A3D I;  3VB9 A;  2VPY A;  2NVQ I;  4BBS I;  2VPX A;  2M48 A;  4MD9 A;  3G6E 1;  1WW9 A;  1TWG I;  1Y8C A;  3H3V J;  3CC7 Z;  2LIY A;  3CCS 1;  1SFO I;  2DE5 A;  5IT9 f;  3CCV Z;  1I3Q I;  2WAQ A;  3S2D I;  2OOY B;  4NBG A;  2QEX 1;  3BG1 B;  4E33 A;  1K8A 2;  1W2B Y;  1VQP Z;  3NH8 A;  1QYP A;  1VQO 1;  3CPW Z;  2QRD B;  4MRI A;  2GTI A;  1Y1W I;  4Y7N I;  1YUA A;  1JJ2 Y;  3CC4 Z;  1S72 1;  3GTK I;  1FDO A;  3FKI I;  2JMO A;  1X3W A;  1K9M 1;  3S14 I;  4AYB A;  3S1R I;  2EGT A;  5C44 I;  2WB1 A;  2M6N A;  2V8K A;  3M4O I;  5A2Q b;  1YIT Z;  2JIM A;  2GU2 A;  2G2K A;  4NBD A;  4E2W A;  5CM2 M;  1Z03 A;  2JR6 A;  4HGY A;  1USP A;  2PM9 A;  1AA6 A;  2QRC B;  2IV2 X;  5FLM I;  4BY7 I;  4A3L I;  1YJN 1;  3EER A;  3MZL B;  3J7A 4;  3J81 b;  4BY1 I;  1S7M A;  2Y0S A;  1YHQ Z;  1M90 1;  3GTP I;  3CCR 1;  1K73 2;  3PO2 I;  3P5J B;  3GKQ A;  3S17 I;  2PMZ A;  3GCF A;  1M1K 1;  5T67 A;  2OTL 1;  1VQN 1;  1RO2 A;  3CPW Y;  1K83 I;  4A3I I;  2F4M A;  1RO0 A;  3CCU Z;  2VUM I;  3KIH A;  2JS4 A;  1QVG Y;  3GTG I;  5D1O A;  4BBR I;  1L1O C;  3NH5 A;  1YI2 Z;  2OTJ 1;  1VQ9 Z;  4E31 A;  1Y1V S;  1YIJ Z;  3CXC Z;  1RLY A;  2QLV B;  1VQ6 1;  4NBC A;  1YJW Z;  1VQK 1;  2E2J I;  3CME Z;  4A3J I;  1USP B;  3D9X A;  3CCM 1;  4NBA A;  3CMA Z;  2VPZ A;  1Q82 2;  1Q81 1;  3GTQ I;  2JNY A;  4DQY B;  2YU9 I;  4RVF A;  4CL1 A;  5LL6 f;  4E2Y A;  1VQ8 1;  3CCL Z;  3CD6 Z;  1NP6 A;  2QRE B;  2R92 I;  2QA4 Z;  3HOW I;  4NFR A;  4A3G I;  1VQ4 1;  2NVY I;  3GTO I;  3NDI A;  3G71 Z;  1Q81 2;  1K8A 1;  1TFI A;  1VQM Z;  2V8I A;  3G4S Z;  1N8R 1;  1Q86 2;  3VTN A;  3OW2 Z;  1VQL 1;  3K7A I;  5C4J I;  3CCV 1;  1WCM I;  2OZK A;  4A3F I;  1TWA I;  2IZ3 A;  3FQM A;  2RPR A;  5A2Q f;  1N8R 2;  2W03 A;  2IZ4 A;  2LFU A;  1DL6 A;  5D1O B;  4NB8 A;  2RT9 A;  1KD1 2;  3KIF A;  3CCS Z;  3HKZ A;  5C3E I;  2HF1 A;  4RV9 A;  4NH1 C;  3M3Y I;  2QEX Z;  3T4N B;  2YAD A;  5AN9 F;  2F4O A;  3J81 f;  3JAM b;  3BG0 B;  3CCE 1;  2Q4Z A;  3LUS A;  4A3C I;  2RHB A;  4NB9 A;  2V3V A;  2HU9 A;  4RVD A;  4MH4 A;  1VQO Z;  5C4X I;  2AKL A;  3IFU A;  3H0G I;  4NBB A;  3EED A;  1K73 1;  4MON A;  4X6A I;  2VF1 A;  1S72 Z;  2NAP A;  3VMI A;  3QWU A;  4QTU A;  3S2H I;  3I55 1;  1YHQ 1;  2PK7 A;  3CCJ Z;  2E2H I;  3S1M I;  3S15 I;  1RNI A;  1KQS Z;  1TWH I;  1KRL A;  2H85 A;  4MD7 A;  1ZB9 A;  1VQ7 Z;  2KI7 B;  4MXU A;  4EWC A;  3CC2 1;  3CCQ Z;  4RVH A;  3D2L A;  3CCR Z;  1KC8 2;  2JIR A;  1FDI A;  1VQ5 1;  2OTL Z;  2J6A A;  3MON A;  1YJ9 1;  1VQN Z;  1QVF Z;  1RQF A;  3PO3 I;  3RZO I;  1Q82 1;  4A93 I;  4HH4 A;  3J80 b;  5IP9 I;  2QR1 B;  1R9T I;  1YJW 1;  2P3Y A;  3GTM I;  1W2B Z;  2R93 I;  1Q16 A;  1JWH C;  2OTJ Z;  1P9N A;  3I56 Z;  5T64 A;  2LEX A;  3HOZ I;  2NVX I;  1VQ6 Z;  1VLA A;  1Q86 1;  2JIP A;  2E2I I;  2BJO A;  1KQS Y;  1NUI A;  1VQK Z;  5FLX b;  2KPI A;  2QKD A;  3I4N I;  3CCM Z;  2JIO A;  2R6M A;  3RZD I;  1ZB8 A;  3CC7 1;  1VQ8 Z;  1NJI 2;  3CQZ I;  3JAM f;  1KD1 1;  1VQ4 Z;  3IX0 A;  2RIQ A;  1LQL A;  1WZN A;  4NOZ A;  3G6E Z;  3TDH B;  1VQP 1;  3I4M I;  1QXF A;  1QVF Y;  2K5R A;  5T6B A;  3CXC Y;  4E32 A;  2P28 A;  1VQL Z;  1X3Z A;  3GTL I;  1Z01 A;  2R7Z I;  3GTJ I;  3CC4 1;  2GTH A;  1I50 I;  3F3F C;  3Q87 A;  1SIW A;  2JUB A;  1Q7Y 1;  3HOV I;  2JIQ A;  1YIT 1;  3ESW A;  4RS4 A;  2VUG A;  4E2X A;  2B63 I;  1Q7Y 2;  3U50 C;  1N2F A;  5IT9 b;  1QVG Z;  4A3E I;  3CCE Z;  3S1Q I;  2Q51 A;  3F3P C;  3D6W A;  3OW2 Y;  1X0T A;  2ZAE B;  3HOY I;  3CCJ 1;  4TNU A;  4S1T A;  2O4H A;  1KC8 1;  1K9M 2;  2AYD A;  1YJN Z;  2DE6 A;  3I07 A;  3J80 f;  2W04 A;  2E7Z A;  1VQ7 1; 
#chains in the Genus database with same CATH homology
 3IF8 A;  3CCQ 1;  4Y52 I;  3S1N I;  3I55 Z;  1Y1V I;  4XX2 A;  2K3R A;  3CCU 1;  3NH4 A;  3HOU I;  4RVG A;  3VMH A;  1PFT A;  5D1P A;  4HGZ A;  4NBF A;  1YI2 1;  1QF8 A;  2JA7 I;  1VQ9 1;  2JA5 I;  4A3B I;  1M90 2;  4E30 A;  4BXX I;  1YIJ 1;  1I6H I;  3CC2 Z;  5FLX f;  4NBE A;  3S16 I;  1WII A;  5IP7 I;  1M1K 2;  2O53 A;  2RBL A;  3CME 1;  4E2Z A;  2E9H A;  1VQ5 Z;  2V8J A;  2I3C A;  2DE7 A;  3CMA 1;  2JA6 I;  1YJ9 Z;  4A3K I;  3CD6 1;  3CCL 1;  3TE5 B;  1ML8 A;  3MZK B;  3I56 1;  4MD8 A;  2QA4 1;  2NVT I;  3NDJ A;  1RO4 A;  4DGL A;  3G71 1;  1NJI 1;  2JA8 I;  3HOX I;  1JJ2 Z;  4A3M I;  3PO3 S;  1VQM 1;  4NBH A;  3G4S 1;  1ZH1 A;  2OOX B;  1TWF I;  1Z02 A;  3FQQ A;  1TWC I;  4QTT A;  4DK1 A;  1YUK A;  3NFZ A;  3VMG A;  3GTM S;  4A3D I;  3VB9 A;  2NVQ I;  4BBS I;  2M48 A;  4MD9 A;  3G6E 1;  1WW9 A;  1TWG I;  3H3V J;  3CC7 Z;  2LIY A;  3CCS 1;  1SFO I;  2DE5 A;  5IT9 f;  3CCV Z;  1I3Q I;  2WAQ A;  3S2D I;  2OOY B;  4NBG A;  2QEX 1;  3BG1 B;  4E33 A;  1K8A 2;  1W2B Y;  1VQP Z;  3NH8 A;  1QYP A;  1VQO 1;  3CPW Z;  2QRD B;  4MRI A;  2GTI A;  1Y1W I;  4Y7N I;  1YUA A;  1JJ2 Y;  3CC4 Z;  1S72 1;  3GTK I;  3FKI I;  2JMO A;  1X3W A;  1K9M 1;  3S14 I;  4AYB A;  3S1R I;  2EGT A;  5C44 I;  2WB1 A;  2M6N A;  2V8K A;  3M4O I;  5A2Q b;  1YIT Z;  2GU2 A;  2G2K A;  4NBD A;  4E2W A;  5CM2 M;  1Z03 A;  2JR6 A;  4HGY A;  1USP A;  2PM9 A;  2QRC B;  4BY7 I;  5FLM I;  4A3L I;  1YJN 1;  3EER A;  3MZL B;  3J7A 4;  3J81 b;  4BY1 I;  1S7M A;  2Y0S A;  1YHQ Z;  1M90 1;  3GTP I;  3CCR 1;  1K73 2;  3PO2 I;  3P5J B;  3GKQ A;  3S17 I;  2PMZ A;  3GCF A;  1M1K 1;  5T67 A;  2OTL 1;  1VQN 1;  1RO2 A;  3CPW Y;  1K83 I;  4A3I I;  2F4M A;  1RO0 A;  3CCU Z;  2VUM I;  3KIH A;  2JS4 A;  1QVG Y;  3GTG I;  5D1O A;  4BBR I;  1L1O C;  3NH5 A;  1YI2 Z;  2OTJ 1;  1VQ9 Z;  4E31 A;  1Y1V S;  1YIJ Z;  3CXC Z;  1RLY A;  2QLV B;  1VQ6 1;  4NBC A;  1YJW Z;  1VQK 1;  2E2J I;  3CME Z;  4A3J I;  1USP B;  3D9X A;  3CCM 1;  4NBA A;  3CMA Z;  1Q82 2;  3GTQ I;  1Q81 1;  2JNY A;  4DQY B;  2YU9 I;  4RVF A;  4CL1 A;  5LL6 f;  4E2Y A;  1VQ8 1;  3CCL Z;  3CD6 Z;  1NP6 A;  2QRE B;  2R92 I;  2QA4 Z;  3HOW I;  4NFR A;  4A3G I;  1VQ4 1;  2NVY I;  3GTO I;  3NDI A;  3G71 Z;  1Q81 2;  1K8A 1;  1TFI A;  1VQM Z;  2V8I A;  3G4S Z;  1N8R 1;  1Q86 2;  3VTN A;  3OW2 Z;  1VQL 1;  3K7A I;  5C4J I;  3CCV 1;  1WCM I;  2OZK A;  4A3F I;  1TWA I;  2IZ3 A;  3FQM A;  2RPR A;  5A2Q f;  1N8R 2;  2W03 A;  2IZ4 A;  2LFU A;  1DL6 A;  5D1O B;  4NB8 A;  2RT9 A;  1KD1 2;  3KIF A;  3CCS Z;  3HKZ A;  5C3E I;  2HF1 A;  4RV9 A;  4NH1 C;  3M3Y I;  2QEX Z;  3T4N B;  2YAD A;  5AN9 F;  2F4O A;  3J81 f;  3JAM b;  3BG0 B;  3CCE 1;  2Q4Z A;  3LUS A;  4A3C I;  2RHB A;  4NB9 A;  2HU9 A;  4RVD A;  4MH4 A;  1VQO Z;  5C4X I;  2AKL A;  3IFU A;  3H0G I;  4NBB A;  3EED A;  1K73 1;  4MON A;  4X6A I;  2VF1 A;  1S72 Z;  3VMI A;  3QWU A;  4QTU A;  3S2H I;  3I55 1;  1YHQ 1;  2PK7 A;  3CCJ Z;  2E2H I;  3S1M I;  3S15 I;  1RNI A;  1KQS Z;  1TWH I;  1KRL A;  2H85 A;  4MD7 A;  1ZB9 A;  1VQ7 Z;  2KI7 B;  4MXU A;  4EWC A;  3CC2 1;  3CCQ Z;  4RVH A;  3CCR Z;  1KC8 2;  1VQ5 1;  2OTL Z;  2J6A A;  3MON A;  1YJ9 1;  1VQN Z;  1QVF Z;  1RQF A;  3PO3 I;  3RZO I;  1Q82 1;  4A93 I;  4HH4 A;  3J80 b;  5IP9 I;  2QR1 B;  1R9T I;  1YJW 1;  2P3Y A;  3GTM I;  1W2B Z;  2R93 I;  1JWH C;  2OTJ Z;  1P9N A;  3I56 Z;  5T64 A;  3HOZ I;  2NVX I;  1VQ6 Z;  1VLA A;  1Q86 1;  2E2I I;  2BJO A;  1KQS Y;  1NUI A;  1VQK Z;  5FLX b;  2KPI A;  2QKD A;  3I4N I;  3CCM Z;  2R6M A;  3RZD I;  1ZB8 A;  3CC7 1;  1VQ8 Z;  1NJI 2;  3CQZ I;  3JAM f;  1KD1 1;  1VQ4 Z;  3IX0 A;  2RIQ A;  1LQL A;  4NOZ A;  3G6E Z;  3TDH B;  1VQP 1;  3I4M I;  1QVF Y;  2K5R A;  5T6B A;  3CXC Y;  4E32 A;  2P28 A;  1VQL Z;  1X3Z A;  3GTL I;  1Z01 A;  2R7Z I;  3GTJ I;  3CC4 1;  2GTH A;  1I50 I;  3F3F C;  3Q87 A;  2JUB A;  1Q7Y 1;  3HOV I;  1YIT 1;  3ESW A;  4RS4 A;  2VUG A;  4E2X A;  2B63 I;  1Q7Y 2;  3U50 C;  1N2F A;  5IT9 b;  1QVG Z;  4A3E I;  3CCE Z;  3S1Q I;  2Q51 A;  3F3P C;  3D6W A;  3OW2 Y;  1X0T A;  2ZAE B;  3HOY I;  3CCJ 1;  4TNU A;  4S1T A;  2O4H A;  1KC8 1;  1K9M 2;  1YJN Z;  2DE6 A;  3I07 A;  3J80 f;  2W04 A;  1VQ7 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...