3S17I

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s17I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s17I02
3S1QI 4BXXI 1TWGI 1L1OC 5CM2M 2KPIA 1WCMI 1X3WA 3S15I 3I07A 3VMGA 4QTUA 4NBDA 2VUMI 3CQZI 3S1MI 3S2HI 4QTTA 3GTOI 2NVXI 4A3KI 3GTMI 2E2JI 3HOZI 5IP9I 3I4MI 2DE7A 3HOVI 3PO2I 4A3CI 4NBFA 3K7AI 2DE5A 4A3MI 2P3YA 3VMHA 3U50C 2R7ZI 3HOYI 3HOWI 4A3II 1R9TI 3GKQA 3PO3I 3GTKI 3GTGI 4A3FI 2NVYI 3GTPI 1TWHI 5C4XI 3ESWA 3GCFA 4NBAA 4XX2A 2RBLA 1X3ZA 3EERA 2JA6I 4A3EI 5IP7I 2JA7I 1ML8A 4BY1I 1QYPA 1Y1VS 1USPA 3FKII 1DL6A 3GTQI 2E2II 3S17I 4A3LI 3RZOI 5FLMI 3GTJI 1NUIA 1RO4A 1TWAI 3H0GI 2YU9I 1PFTA 2F4MA 3M3YI 4NB8A 2PK7A 3D6WA 5C44I 2NVTI 4A93I 2B63I 4A3GI 2DE6A 2AKLA 1I50I 1K83I 1LQLA 4NBGA 3S16I 4BBSI 4Y52I 4NB9A 1RLYA 3GTLI 4Y7NI 3I4NI 3VMIA 3S1NI 2JNYA 4BY7I 4NOZA 2HF1A 2R93I 2K5RA 4A3BI 4A3DI 3VB9A 3RZDI 1TFIA 1I3QI 1YUAA 2JA5I 4NBCA 3M4OI 3HOUI 4BBRI 1WW9A 2JS4A 3Q87A 2R92I 4NBBA 3S2DI 1N2FA 2F4OA 3LUSA 1Y1VI 3GTMS 5C3EI 3S14I 3HOXI 2JA8I 1VLAA 1ZB9A 4MH4A 1I6HI 3H3VJ 5C4JI 2NVQI 1TWFI 1SFOI 3PO3S 4X6AI 1USPB 4NBEA 1ZB8A 2J6AA 2E2HI 1TWCI 4A3JI 1Y1WI 4NBHA 2BJOA 3S1RI 2JR6A
chains in the Genus database with same CATH superfamily
3S1QI 3F3PC 2Y0SA 1TWGI 1L1OC 3OW2Z 2QRDB 2YADA 2V8KA 3S15I 3CQZI 3S2HI 1YJW1 4QTTA 2P28A 1RQFA 1Q861 3NH8A 4MRIA 3HOZI 5IP9I 2ZAEB 1YJWZ 1W2BZ 3IF8A 3VMHA 2R7ZI 3NDIA 4E2WA 3HOWI 5IT9f 4A3II 3PO3I 2NVYI 2O53A 4E2ZA 5C4XI 2VPYA 2NAPA 3GCFA 4NBAA 3VTNA 1VQO1 2JA7I 3MZLB 4DGLA 1VQM1 1ML8A 1YIJZ 4BY1I 4E30A 5FLXf 1Y1VS 2OTJ1 1VQOZ 3CMA1 2PM9A 2JUBA 1Q821 3D2LA 1N8R1 1RO4A 3H0GI 5T6BA 4E33A 3TE5B 3CMAZ 1Q862 2NVTI 2QKDA 3S16I 4BBSI 4Y7NI 2PMZA 4NOZA 4HH4A 3CXCY 3G6EZ 1YJN1 1KD12 4A3BI 2GTHA 3CCV1 2M48A 3VB9A 1TFIA 1I3QI 2JA5I 1VQ6Z 2E7ZA 3HOUI 3G4S1 3JAMf 4BBRI 1Q811 1KQSZ 1YJ9Z 2R92I 2JMOA 3CCVZ 1FDOA 2OOYB 1YITZ 3G4SZ 2HU9A 3GTMS 4MD8A 2JA8I 4CL1A 1M1K1 1VLAA 2E9HA 1Q822 2VF1A 1I6HI 1K8A2 1TWFI 2V3VA 2O4HA 3CCU1 4NH1C 1VQPZ 2JIQA 2OTL1 3G71Z 4A3JI 1ZH1A 2OZKA 3IR7A 3CCUZ 2HF1A 2IZ4A 5A2Qf 1X3WA 3I07A 1VQN1 2WAQA 4NBDA 2VUMI 3MONA 4MXUA 2VPWA 3S1MI 3BG1B 1S72Z 1RO0A 3GTOI 3P5JB 4A3KI 3J81f 1VQNZ 2RIQA 4AYBA 3K7AI 3CCSZ 1YHQZ 1R9TI 3GKQA 3GTGI 4A3FI 3GTPI 4XX2A 1X3ZA 2JA6I 3D9XA 1VQKZ 4TNUA 2RHBA 2JIMA 1DL6A 1VQ5Z 3FQMA 1WJ2A 2QR1B 2QEXZ 1YUKA 2E2II 3S17I 1W2BY 3HKZA 1TWAI 1VQ8Z 1KD11 3J80b 3NFZA 3D6WA 2EGTA 1YIJ1 1I50I 1LQLA 4EWCA 1KC82 3GTLI 1FDIA 1JWHC 2AYDA 3S1NI 2VPZA 3VMIA 4BY7I 2QLVB 5D1PA 3NDJA 2R93I 2QA4Z 1Q16A 1VQLZ 3RZDI 1YUAA 3M4OI 4S1TA 1K8A1 1N2FA 1Y1VI 2W03A 1SIWA 3HOXI 3G6E1 1NJI2 4HGZA 4HGYA 3CPWY 3J7A4 3H3VJ 5C4JI 1VQ61 1Z01A 1YJ91 1YIT1 1YI21 1KQSY 3CC4Z 1K732 3S1RI 1QVGY 3CC7Z 3CCQZ 4BXXI 1YI2Z 5CM2M 1VQ41 1JJ2Y 1M902 4DK1A 1VQP1 1VQ4Z 3G711 2JIOA 3GTMI 4MD7A 4DQYB 2DE7A 2IV2X 3PO2I 1QXFA 2JIPA 2GTIA 4NFRA 2P3YA 3IX0A 3HOYI 1QVFY 3CD61 5AN9F 3GTKI 2KI7B 1X0TA 1S721 4RV9A 4E2XA 3EERA 3CD6Z 3CCJ1 4A3EI 2GU2A 2K3RA 4RVGA 5T67A 3CCRZ 3F3FC 2VPXA 3CCS1 3CCJZ 4E31A 1KC81 1YHQ1 3GTQI 4A3LI 2RPRA 3I551 3CMEZ 1NUIA 1S7MA 3KIHA 3MZKB 4MD9A 3CCLZ 2YU9I 3M3YI 3I56Z 3OW2Y 2PK7A 5C44I 4A93I 3I55Z 2DE6A 1VQK1 5IT9b 2V45A 4NBGA 1RLYA 3EEDA 3QWUA 2LEXA 1VQ71 1VQ51 3FQQA 2QEX1 4A3DI 1Q7Y2 1KRLA 2WB1A 1VQ7Z 1VQ81 5FLXb 1NJI1 4RS4A 3Q87A 5D1OA 3CCMZ 3CC21 3LUSA 3T4NB 1WIIA 2V8IA 4RVHA 3NH5A 2QA41 1VQL1 1ZB9A 4MH4A 1K731 3CC2Z 2NVQI 1SFOI 1Z02A 1VQ91 3PO3S 2LIYA 1M901 4NBEA 2J6AA 2E2HI 1TWCI 2V8JA 2LFUA 3BG0B 1VQ9Z 1WZNA 3JAMb 1K9M2 2RT9A 1ZB8A 2VUGA 2Q51A 2KPIA 1WCMI 2Q4ZA 3VMGA 4QTUA 3CC41 3IFUA 2NVXI 2E2JI 3I4MI 3CC71 1RNIA 3HOVI 3CCQ1 1P9NA 2IZ3A 1VQMZ 4A3CI 4NBFA 2DE5A 4A3MI 5D1OB 3J80f 2OTJZ 3U50C 2H85A 4MONA 4E2YA 5LL6f 1TWHI 3CPWZ 2OOXB 3ESWA 2RBLA 5A2Qb 5IP7I 2G2KA 3CXCZ 1QYPA 2W04A 1AA6A 3CCE1 1USPA 3FKII 2I3CA 1Y8CA 2JIRA 3J81b 1YJNZ 3RZOI 5FLMI 3KIFA 3GTJI 1QVGZ 3CCEZ 1PFTA 2F4MA 1Q7Y1 4E32A 4NB8A 1QF8A 3NH4A 1JJ2Z 2B63I 4A3GI 2AKLA 1K83I 4Y52I 4NB9A 3CCR1 1N8R2 3I4NI 2JNYA 3TDHB 2K5RA 1NP6A 3CME1 4NBCA 3CCL1 3I561 2M6NA 1WW9A 1Z03A 2JS4A 4NBBA 3S2DI 2OTLZ 2F4OA 1QVFZ 5C3EI 3S14I 2QRCB 1Q812 1K9M1 1RO2A 2R6MA 5T64A 4RVDA 4X6AI 1USPB 4RVFA 3CCM1 1M1K2 1Y1WI 4NBHA 2QREB 2BJOA 2JR6A
chains in the Genus database with same CATH topology
3S1QI 3F3PC 2Y0SA 1TWGI 1L1OC 3OW2Z 2QRDB 2YADA 2V8KA 3S15I 3CQZI 3S2HI 1YJW1 4QTTA 2P28A 1RQFA 1Q861 3NH8A 4MRIA 3HOZI 5IP9I 2ZAEB 1YJWZ 1W2BZ 3IF8A 3VMHA 2R7ZI 3NDIA 4E2WA 3HOWI 5IT9f 4A3II 3PO3I 2NVYI 2O53A 4E2ZA 5C4XI 3GCFA 4NBAA 3VTNA 1VQO1 2JA7I 3MZLB 4DGLA 1VQM1 1ML8A 1YIJZ 4BY1I 4E30A 5FLXf 1Y1VS 2OTJ1 1VQOZ 3CMA1 2PM9A 2JUBA 1Q821 1N8R1 1RO4A 3H0GI 5T6BA 4E33A 3TE5B 3CMAZ 1Q862 2NVTI 2QKDA 3S16I 4BBSI 4Y7NI 2PMZA 4NOZA 4HH4A 3CXCY 3G6EZ 1YJN1 1KD12 4A3BI 2GTHA 3CCV1 2M48A 3VB9A 1TFIA 1I3QI 2JA5I 1VQ6Z 3HOUI 3G4S1 3JAMf 4BBRI 1Q811 1KQSZ 1YJ9Z 2R92I 2JMOA 3CCVZ 2OOYB 1YITZ 3G4SZ 2HU9A 3GTMS 4MD8A 2JA8I 4CL1A 1M1K1 1VLAA 2E9HA 1Q822 2VF1A 1I6HI 1K8A2 1TWFI 2O4HA 3CCU1 4NH1C 1VQPZ 2OTL1 3G71Z 4A3JI 1ZH1A 2OZKA 3CCUZ 2HF1A 2IZ4A 5A2Qf 1X3WA 3I07A 1VQN1 2WAQA 4NBDA 2VUMI 3MONA 4MXUA 3S1MI 3BG1B 1S72Z 1RO0A 3GTOI 3P5JB 4A3KI 3J81f 1VQNZ 2RIQA 4AYBA 3K7AI 3CCSZ 1YHQZ 1R9TI 3GKQA 3GTGI 4A3FI 3GTPI 4XX2A 1X3ZA 2JA6I 3D9XA 1VQKZ 4TNUA 2RHBA 1DL6A 1VQ5Z 3FQMA 2QR1B 2QEXZ 1YUKA 2E2II 3S17I 1W2BY 3HKZA 1TWAI 1VQ8Z 1KD11 3J80b 3NFZA 3D6WA 2EGTA 1YIJ1 1I50I 1LQLA 4EWCA 1KC82 3GTLI 1JWHC 3S1NI 3VMIA 4BY7I 2QLVB 5D1PA 3NDJA 2R93I 2QA4Z 1VQLZ 3RZDI 1YUAA 3M4OI 4S1TA 1K8A1 1N2FA 1Y1VI 2W03A 3HOXI 3G6E1 1NJI2 4HGZA 4HGYA 3CPWY 3J7A4 3H3VJ 5C4JI 1VQ61 1Z01A 1YJ91 1YIT1 1YI21 1KQSY 3CC4Z 1K732 3S1RI 1QVGY 3CC7Z 3CCQZ 4BXXI 1YI2Z 5CM2M 1VQ41 1JJ2Y 1M902 4DK1A 1VQP1 1VQ4Z 3G711 3GTMI 4MD7A 4DQYB 2DE7A 3PO2I 2GTIA 4NFRA 2P3YA 3IX0A 3HOYI 1QVFY 3CD61 5AN9F 3GTKI 2KI7B 1X0TA 1S721 4RV9A 4E2XA 3EERA 3CD6Z 3CCJ1 4A3EI 2GU2A 2K3RA 4RVGA 5T67A 3CCRZ 3F3FC 3CCS1 3CCJZ 4E31A 1KC81 1YHQ1 3GTQI 4A3LI 2RPRA 3I551 3CMEZ 1NUIA 1S7MA 3KIHA 3MZKB 4MD9A 3CCLZ 2YU9I 3M3YI 3I56Z 3OW2Y 2PK7A 5C44I 4A93I 3I55Z 2DE6A 1VQK1 5IT9b 4NBGA 1RLYA 3EEDA 3QWUA 1VQ71 1VQ51 3FQQA 2QEX1 4A3DI 1Q7Y2 1KRLA 2WB1A 1VQ7Z 1VQ81 5FLXb 1NJI1 4RS4A 3Q87A 5D1OA 3CCMZ 3CC21 3LUSA 3T4NB 1WIIA 2V8IA 4RVHA 3NH5A 2QA41 1VQL1 1ZB9A 4MH4A 1K731 3CC2Z 2NVQI 1SFOI 1Z02A 1VQ91 3PO3S 2LIYA 1M901 4NBEA 2J6AA 2E2HI 1TWCI 2V8JA 2LFUA 3BG0B 1VQ9Z 3JAMb 1K9M2 2RT9A 1ZB8A 2VUGA 2Q51A 2KPIA 1WCMI 2Q4ZA 3VMGA 4QTUA 3CC41 3IFUA 2NVXI 2E2JI 3I4MI 3CC71 1RNIA 3HOVI 3CCQ1 1P9NA 2IZ3A 1VQMZ 4A3CI 4NBFA 2DE5A 4A3MI 5D1OB 3J80f 2OTJZ 3U50C 2H85A 4MONA 4E2YA 5LL6f 1TWHI 3CPWZ 2OOXB 3ESWA 2RBLA 5A2Qb 5IP7I 2G2KA 3CXCZ 1QYPA 2W04A 3CCE1 1USPA 3FKII 2I3CA 3J81b 1YJNZ 3RZOI 5FLMI 3KIFA 3GTJI 1QVGZ 3CCEZ 1PFTA 2F4MA 1Q7Y1 4E32A 4NB8A 1QF8A 3NH4A 1JJ2Z 2B63I 4A3GI 2AKLA 1K83I 4Y52I 4NB9A 3CCR1 1N8R2 3I4NI 2JNYA 3TDHB 2K5RA 1NP6A 3CME1 4NBCA 3CCL1 3I561 2M6NA 1WW9A 1Z03A 2JS4A 4NBBA 3S2DI 2OTLZ 2F4OA 1QVFZ 5C3EI 3S14I 2QRCB 1Q812 1K9M1 1RO2A 2R6MA 5T64A 4RVDA 4X6AI 1USPB 4RVFA 3CCM1 1M1K2 1Y1WI 4NBHA 2QREB 2BJOA 2JR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1Q I;  4BXX I;  1TWG I;  1L1O C;  5CM2 M;  2KPI A;  1WCM I;  1X3W A;  3S15 I;  3I07 A;  3VMG A;  4QTU A;  4NBD A;  2VUM I;  3CQZ I;  3S1M I;  3S2H I;  4QTT A;  3GTO I;  2NVX I;  4A3K I;  3GTM I;  2E2J I;  3HOZ I;  5IP9 I;  3I4M I;  2DE7 A;  3HOV I;  3PO2 I;  4A3C I;  4NBF A;  3K7A I;  2DE5 A;  4A3M I;  2P3Y A;  3VMH A;  3U50 C;  2R7Z I;  3HOY I;  3HOW I;  4A3I I;  1R9T I;  3GKQ A;  3PO3 I;  3GTK I;  3GTG I;  4A3F I;  2NVY I;  3GTP I;  1TWH I;  5C4X I;  3ESW A;  3GCF A;  4NBA A;  4XX2 A;  2RBL A;  1X3Z A;  3EER A;  2JA6 I;  4A3E I;  5IP7 I;  2JA7 I;  1ML8 A;  4BY1 I;  1QYP A;  1Y1V S;  1USP A;  3FKI I;  1DL6 A;  3GTQ I;  2E2I I;  3S17 I;  4A3L I;  3RZO I;  5FLM I;  3GTJ I;  1NUI A;  1RO4 A;  1TWA I;  3H0G I;  2YU9 I;  1PFT A;  2F4M A;  3M3Y I;  4NB8 A;  2PK7 A;  3D6W A;  5C44 I;  2NVT I;  4A93 I;  2B63 I;  4A3G I;  2DE6 A;  2AKL A;  1I50 I;  1K83 I;  1LQL A;  4NBG A;  3S16 I;  4BBS I;  4Y52 I;  4NB9 A;  1RLY A;  3GTL I;  4Y7N I;  3I4N I;  3VMI A;  3S1N I;  2JNY A;  4BY7 I;  4NOZ A;  2HF1 A;  2R93 I;  2K5R A;  4A3B I;  4A3D I;  3VB9 A;  3RZD I;  1TFI A;  1I3Q I;  1YUA A;  2JA5 I;  4NBC A;  3M4O I;  3HOU I;  4BBR I;  1WW9 A;  2JS4 A;  3Q87 A;  2R92 I;  4NBB A;  3S2D I;  1N2F A;  2F4O A;  3LUS A;  1Y1V I;  3GTM S;  5C3E I;  3S14 I;  3HOX I;  2JA8 I;  1VLA A;  1ZB9 A;  4MH4 A;  1I6H I;  3H3V J;  5C4J I;  2NVQ I;  1TWF I;  1SFO I;  3PO3 S;  4X6A I;  1USP B;  4NBE A;  1ZB8 A;  2J6A A;  2E2H I;  1TWC I;  4A3J I;  1Y1W I;  4NBH A;  2BJO A;  3S1R I;  2JR6 A; 
#chains in the Genus database with same CATH topology
 3S1Q I;  3F3P C;  2Y0S A;  1TWG I;  1L1O C;  3OW2 Z;  2QRD B;  2YAD A;  2V8K A;  3S15 I;  3CQZ I;  3S2H I;  1YJW 1;  4QTT A;  2P28 A;  1RQF A;  1Q86 1;  3NH8 A;  4MRI A;  3HOZ I;  5IP9 I;  2ZAE B;  1YJW Z;  1W2B Z;  3IF8 A;  3VMH A;  2R7Z I;  3NDI A;  4E2W A;  3HOW I;  5IT9 f;  4A3I I;  3PO3 I;  2NVY I;  2O53 A;  4E2Z A;  5C4X I;  2VPY A;  2NAP A;  3GCF A;  4NBA A;  3VTN A;  1VQO 1;  2JA7 I;  3MZL B;  4DGL A;  1VQM 1;  1ML8 A;  1YIJ Z;  4BY1 I;  4E30 A;  5FLX f;  1Y1V S;  2OTJ 1;  1VQO Z;  3CMA 1;  2PM9 A;  2JUB A;  1Q82 1;  3D2L A;  1N8R 1;  1RO4 A;  3H0G I;  5T6B A;  4E33 A;  3TE5 B;  3CMA Z;  1Q86 2;  2NVT I;  2QKD A;  3S16 I;  4BBS I;  4Y7N I;  2PMZ A;  4NOZ A;  4HH4 A;  3CXC Y;  3G6E Z;  1YJN 1;  1KD1 2;  4A3B I;  2GTH A;  3CCV 1;  2M48 A;  3VB9 A;  1TFI A;  1I3Q I;  2JA5 I;  1VQ6 Z;  2E7Z A;  3HOU I;  3G4S 1;  3JAM f;  4BBR I;  1Q81 1;  1KQS Z;  1YJ9 Z;  2R92 I;  2JMO A;  3CCV Z;  1FDO A;  2OOY B;  1YIT Z;  3G4S Z;  2HU9 A;  3GTM S;  4MD8 A;  2JA8 I;  4CL1 A;  1M1K 1;  1VLA A;  2E9H A;  1Q82 2;  2VF1 A;  1I6H I;  1K8A 2;  1TWF I;  2V3V A;  2O4H A;  3CCU 1;  4NH1 C;  1VQP Z;  2JIQ A;  2OTL 1;  3G71 Z;  4A3J I;  1ZH1 A;  2OZK A;  3IR7 A;  3CCU Z;  2HF1 A;  2IZ4 A;  5A2Q f;  1X3W A;  3I07 A;  1VQN 1;  2WAQ A;  4NBD A;  2VUM I;  3MON A;  4MXU A;  2VPW A;  3S1M I;  3BG1 B;  1S72 Z;  1RO0 A;  3GTO I;  3P5J B;  4A3K I;  3J81 f;  1VQN Z;  2RIQ A;  4AYB A;  3K7A I;  3CCS Z;  1YHQ Z;  1R9T I;  3GKQ A;  3GTG I;  4A3F I;  3GTP I;  4XX2 A;  1X3Z A;  2JA6 I;  3D9X A;  1VQK Z;  4TNU A;  2RHB A;  2JIM A;  1DL6 A;  1VQ5 Z;  3FQM A;  1WJ2 A;  2QR1 B;  2QEX Z;  1YUK A;  2E2I I;  3S17 I;  1W2B Y;  3HKZ A;  1TWA I;  1VQ8 Z;  1KD1 1;  3J80 b;  3NFZ A;  3D6W A;  2EGT A;  1YIJ 1;  1I50 I;  1LQL A;  4EWC A;  1KC8 2;  3GTL I;  1FDI A;  1JWH C;  2AYD A;  3S1N I;  2VPZ A;  3VMI A;  4BY7 I;  2QLV B;  5D1P A;  3NDJ A;  2R93 I;  2QA4 Z;  1Q16 A;  1VQL Z;  3RZD I;  1YUA A;  3M4O I;  4S1T A;  1K8A 1;  1N2F A;  1Y1V I;  2W03 A;  1SIW A;  3HOX I;  3G6E 1;  1NJI 2;  4HGZ A;  4HGY A;  3CPW Y;  3J7A 4;  3H3V J;  5C4J I;  1VQ6 1;  1Z01 A;  1YJ9 1;  1YIT 1;  1YI2 1;  1KQS Y;  3CC4 Z;  1K73 2;  3S1R I;  1QVG Y;  3CC7 Z;  3CCQ Z;  4BXX I;  1YI2 Z;  5CM2 M;  1VQ4 1;  1JJ2 Y;  1M90 2;  4DK1 A;  1VQP 1;  1VQ4 Z;  3G71 1;  2JIO A;  3GTM I;  4MD7 A;  4DQY B;  2DE7 A;  2IV2 X;  3PO2 I;  1QXF A;  2JIP A;  2GTI A;  4NFR A;  2P3Y A;  3IX0 A;  3HOY I;  1QVF Y;  3CD6 1;  5AN9 F;  3GTK I;  2KI7 B;  1X0T A;  1S72 1;  4RV9 A;  4E2X A;  3EER A;  3CD6 Z;  3CCJ 1;  4A3E I;  2GU2 A;  2K3R A;  4RVG A;  5T67 A;  3CCR Z;  3F3F C;  2VPX A;  3CCS 1;  3CCJ Z;  4E31 A;  1KC8 1;  1YHQ 1;  3GTQ I;  4A3L I;  2RPR A;  3I55 1;  3CME Z;  1NUI A;  1S7M A;  3KIH A;  3MZK B;  4MD9 A;  3CCL Z;  2YU9 I;  3M3Y I;  3I56 Z;  3OW2 Y;  2PK7 A;  5C44 I;  4A93 I;  3I55 Z;  2DE6 A;  1VQK 1;  5IT9 b;  2V45 A;  4NBG A;  1RLY A;  3EED A;  3QWU A;  2LEX A;  1VQ7 1;  1VQ5 1;  3FQQ A;  2QEX 1;  4A3D I;  1Q7Y 2;  1KRL A;  2WB1 A;  1VQ7 Z;  1VQ8 1;  5FLX b;  1NJI 1;  4RS4 A;  3Q87 A;  5D1O A;  3CCM Z;  3CC2 1;  3LUS A;  3T4N B;  1WII A;  2V8I A;  4RVH A;  3NH5 A;  2QA4 1;  1VQL 1;  1ZB9 A;  4MH4 A;  1K73 1;  3CC2 Z;  2NVQ I;  1SFO I;  1Z02 A;  1VQ9 1;  3PO3 S;  2LIY A;  1M90 1;  4NBE A;  2J6A A;  2E2H I;  1TWC I;  2V8J A;  2LFU A;  3BG0 B;  1VQ9 Z;  1WZN A;  3JAM b;  1K9M 2;  2RT9 A;  1ZB8 A;  2VUG A;  2Q51 A;  2KPI A;  1WCM I;  2Q4Z A;  3VMG A;  4QTU A;  3CC4 1;  3IFU A;  2NVX I;  2E2J I;  3I4M I;  3CC7 1;  1RNI A;  3HOV I;  3CCQ 1;  1P9N A;  2IZ3 A;  1VQM Z;  4A3C I;  4NBF A;  2DE5 A;  4A3M I;  5D1O B;  3J80 f;  2OTJ Z;  3U50 C;  2H85 A;  4MON A;  4E2Y A;  5LL6 f;  1TWH I;  3CPW Z;  2OOX B;  3ESW A;  2RBL A;  5A2Q b;  5IP7 I;  2G2K A;  3CXC Z;  1QYP A;  2W04 A;  1AA6 A;  3CCE 1;  1USP A;  3FKI I;  2I3C A;  1Y8C A;  2JIR A;  3J81 b;  1YJN Z;  3RZO I;  5FLM I;  3KIF A;  3GTJ I;  1QVG Z;  3CCE Z;  1PFT A;  2F4M A;  1Q7Y 1;  4E32 A;  4NB8 A;  1QF8 A;  3NH4 A;  1JJ2 Z;  2B63 I;  4A3G I;  2AKL A;  1K83 I;  4Y52 I;  4NB9 A;  3CCR 1;  1N8R 2;  3I4N I;  2JNY A;  3TDH B;  2K5R A;  1NP6 A;  3CME 1;  4NBC A;  3CCL 1;  3I56 1;  2M6N A;  1WW9 A;  1Z03 A;  2JS4 A;  4NBB A;  3S2D I;  2OTL Z;  2F4O A;  1QVF Z;  5C3E I;  3S14 I;  2QRC B;  1Q81 2;  1K9M 1;  1RO2 A;  2R6M A;  5T64 A;  4RVD A;  4X6A I;  1USP B;  4RVF A;  3CCM 1;  1M1K 2;  1Y1W I;  4NBH A;  2QRE B;  2BJO A;  2JR6 A; 
#chains in the Genus database with same CATH homology
 3S1Q I;  3F3P C;  2Y0S A;  1TWG I;  1L1O C;  3OW2 Z;  2QRD B;  2YAD A;  2V8K A;  3S15 I;  3CQZ I;  3S2H I;  1YJW 1;  4QTT A;  2P28 A;  1RQF A;  1Q86 1;  3NH8 A;  4MRI A;  3HOZ I;  5IP9 I;  2ZAE B;  1YJW Z;  1W2B Z;  3IF8 A;  3VMH A;  2R7Z I;  3NDI A;  4E2W A;  3HOW I;  5IT9 f;  4A3I I;  3PO3 I;  2NVY I;  2O53 A;  4E2Z A;  5C4X I;  3GCF A;  4NBA A;  3VTN A;  1VQO 1;  2JA7 I;  3MZL B;  4DGL A;  1VQM 1;  1ML8 A;  1YIJ Z;  4BY1 I;  4E30 A;  5FLX f;  1Y1V S;  2OTJ 1;  1VQO Z;  3CMA 1;  2PM9 A;  2JUB A;  1Q82 1;  1N8R 1;  1RO4 A;  3H0G I;  5T6B A;  4E33 A;  3TE5 B;  3CMA Z;  1Q86 2;  2NVT I;  2QKD A;  3S16 I;  4BBS I;  4Y7N I;  2PMZ A;  4NOZ A;  4HH4 A;  3CXC Y;  3G6E Z;  1YJN 1;  1KD1 2;  4A3B I;  2GTH A;  3CCV 1;  2M48 A;  3VB9 A;  1TFI A;  1I3Q I;  2JA5 I;  1VQ6 Z;  3HOU I;  3G4S 1;  3JAM f;  4BBR I;  1Q81 1;  1KQS Z;  1YJ9 Z;  2R92 I;  2JMO A;  3CCV Z;  2OOY B;  1YIT Z;  3G4S Z;  2HU9 A;  3GTM S;  4MD8 A;  2JA8 I;  4CL1 A;  1M1K 1;  1VLA A;  2E9H A;  1Q82 2;  2VF1 A;  1I6H I;  1K8A 2;  1TWF I;  2O4H A;  3CCU 1;  4NH1 C;  1VQP Z;  2OTL 1;  3G71 Z;  4A3J I;  1ZH1 A;  2OZK A;  3CCU Z;  2HF1 A;  2IZ4 A;  5A2Q f;  1X3W A;  3I07 A;  1VQN 1;  2WAQ A;  4NBD A;  2VUM I;  3MON A;  4MXU A;  3S1M I;  3BG1 B;  1S72 Z;  1RO0 A;  3GTO I;  3P5J B;  4A3K I;  3J81 f;  1VQN Z;  2RIQ A;  4AYB A;  3K7A I;  3CCS Z;  1YHQ Z;  1R9T I;  3GKQ A;  3GTG I;  4A3F I;  3GTP I;  4XX2 A;  1X3Z A;  2JA6 I;  3D9X A;  1VQK Z;  4TNU A;  2RHB A;  1DL6 A;  1VQ5 Z;  3FQM A;  2QR1 B;  2QEX Z;  1YUK A;  2E2I I;  3S17 I;  1W2B Y;  3HKZ A;  1TWA I;  1VQ8 Z;  1KD1 1;  3J80 b;  3NFZ A;  3D6W A;  2EGT A;  1YIJ 1;  1I50 I;  1LQL A;  4EWC A;  1KC8 2;  3GTL I;  1JWH C;  3S1N I;  3VMI A;  4BY7 I;  2QLV B;  5D1P A;  3NDJ A;  2R93 I;  2QA4 Z;  1VQL Z;  3RZD I;  1YUA A;  3M4O I;  4S1T A;  1K8A 1;  1N2F A;  1Y1V I;  2W03 A;  3HOX I;  3G6E 1;  1NJI 2;  4HGZ A;  4HGY A;  3CPW Y;  3J7A 4;  3H3V J;  5C4J I;  1VQ6 1;  1Z01 A;  1YJ9 1;  1YIT 1;  1YI2 1;  1KQS Y;  3CC4 Z;  1K73 2;  3S1R I;  1QVG Y;  3CC7 Z;  3CCQ Z;  4BXX I;  1YI2 Z;  5CM2 M;  1VQ4 1;  1JJ2 Y;  1M90 2;  4DK1 A;  1VQP 1;  1VQ4 Z;  3G71 1;  3GTM I;  4MD7 A;  4DQY B;  2DE7 A;  3PO2 I;  2GTI A;  4NFR A;  2P3Y A;  3IX0 A;  3HOY I;  1QVF Y;  3CD6 1;  5AN9 F;  3GTK I;  2KI7 B;  1X0T A;  1S72 1;  4RV9 A;  4E2X A;  3EER A;  3CD6 Z;  3CCJ 1;  4A3E I;  2GU2 A;  2K3R A;  4RVG A;  5T67 A;  3CCR Z;  3F3F C;  3CCS 1;  3CCJ Z;  4E31 A;  1KC8 1;  1YHQ 1;  3GTQ I;  4A3L I;  2RPR A;  3I55 1;  3CME Z;  1NUI A;  1S7M A;  3KIH A;  3MZK B;  4MD9 A;  3CCL Z;  2YU9 I;  3M3Y I;  3I56 Z;  3OW2 Y;  2PK7 A;  5C44 I;  4A93 I;  3I55 Z;  2DE6 A;  1VQK 1;  5IT9 b;  4NBG A;  1RLY A;  3EED A;  3QWU A;  1VQ7 1;  1VQ5 1;  3FQQ A;  2QEX 1;  4A3D I;  1Q7Y 2;  1KRL A;  2WB1 A;  1VQ7 Z;  1VQ8 1;  5FLX b;  1NJI 1;  4RS4 A;  3Q87 A;  5D1O A;  3CCM Z;  3CC2 1;  3LUS A;  3T4N B;  1WII A;  2V8I A;  4RVH A;  3NH5 A;  2QA4 1;  1VQL 1;  1ZB9 A;  4MH4 A;  1K73 1;  3CC2 Z;  2NVQ I;  1SFO I;  1Z02 A;  1VQ9 1;  3PO3 S;  2LIY A;  1M90 1;  4NBE A;  2J6A A;  2E2H I;  1TWC I;  2V8J A;  2LFU A;  3BG0 B;  1VQ9 Z;  3JAM b;  1K9M 2;  2RT9 A;  1ZB8 A;  2VUG A;  2Q51 A;  2KPI A;  1WCM I;  2Q4Z A;  3VMG A;  4QTU A;  3CC4 1;  3IFU A;  2NVX I;  2E2J I;  3I4M I;  3CC7 1;  1RNI A;  3HOV I;  3CCQ 1;  1P9N A;  2IZ3 A;  1VQM Z;  4A3C I;  4NBF A;  2DE5 A;  4A3M I;  5D1O B;  3J80 f;  2OTJ Z;  3U50 C;  2H85 A;  4MON A;  4E2Y A;  5LL6 f;  1TWH I;  3CPW Z;  2OOX B;  3ESW A;  2RBL A;  5A2Q b;  5IP7 I;  2G2K A;  3CXC Z;  1QYP A;  2W04 A;  3CCE 1;  1USP A;  3FKI I;  2I3C A;  3J81 b;  1YJN Z;  3RZO I;  5FLM I;  3KIF A;  3GTJ I;  1QVG Z;  3CCE Z;  1PFT A;  2F4M A;  1Q7Y 1;  4E32 A;  4NB8 A;  1QF8 A;  3NH4 A;  1JJ2 Z;  2B63 I;  4A3G I;  2AKL A;  1K83 I;  4Y52 I;  4NB9 A;  3CCR 1;  1N8R 2;  3I4N I;  2JNY A;  3TDH B;  2K5R A;  1NP6 A;  3CME 1;  4NBC A;  3CCL 1;  3I56 1;  2M6N A;  1WW9 A;  1Z03 A;  2JS4 A;  4NBB A;  3S2D I;  2OTL Z;  2F4O A;  1QVF Z;  5C3E I;  3S14 I;  2QRC B;  1Q81 2;  1K9M 1;  1RO2 A;  2R6M A;  5T64 A;  4RVD A;  4X6A I;  1USP B;  4RVF A;  3CCM 1;  1M1K 2;  1Y1W I;  4NBH A;  2QRE B;  2BJO A;  2JR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...