4RS4A

Crystal structure and mutational analysis of the endoribonuclease from human coronavirus 229e
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
347
structure length
341
Chain Sequence
SGLENIAFNVVNKGSFVSADGELPVAISGDKVFVRDGNTDNLVFVNKTSLPTNIAFELFAKRKVGLTPPLSILKNLGVVATYKFVLWDYEAERPLTSFTKSVCGYTDFAEDVCTCYDNSIQGSYERFTLSTNAVLFSATAVKAGGKSLPAIKLNFGMLNGNAIATVIKNINWFVYVRKDGKPVDHYDGFYTQGRNLQDFLPRSTMEEDFLNMDMGVFIQKYGLEDFNFEHVVYGDVSKTTLGGLHLSISQVRLSKMGILKAEEFVAASDITLKCCTVTYLNDPSSKTVCTYMDLLLDDFVSVLKSLDLTVVSKVHEVIIDNKPWRWMLWCKDNAVATFYPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Uridylate-specific endoribonuclease
publication title Crystal structure and mutational analysis of the endoribonuclease from human coronavirus 229E
rcsb
source organism Human coronavirus 229e
total genus 76
structure length 341
sequence length 347
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4rs4A01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rs4A02
2GTHA 2GTIA 2OZKA 2RHBA 4RS4A 4S1TA 2H85A
chains in the Genus database with same CATH superfamily
4P5PA 2DT5A 3QLJA 3TZQA 4JBWA 3STHA 1V96A 2P9JA 1PTJA 2X3FA 3SFZA 4QDTA 3GA7A 2WIFA 4IGEA 2PX0A 4BN5A 3JV7A 5CA0A 2XB9A 4YRCA 4L50A 1WR8A 1NW5A 1RWMA 2EFGA 5KX5F 1X7XA 1FMFA 2EGTA 2HDWA 3MFYA 2W6PA 4FLEA 2PT7A 1GAQA 3H11B 4RF4A 3RAEC 3TAUA 2J7PD 2ISSD 3GVHA 3PTZA 2JLVA 4RSGA 4NJMA 2JPDA 2PL5A 5BR4A 5ALNA 4COOA 2OOKA 3WMEA 3FIJA 3ROMA 3RBAA 2G08A 2BFDB 3FYHA 1BHJA 1A9QA 1MJFA 2ATEA 3Q15C 2QRJA 4H17A 4NNOA 4UBIA 1SIBE 1FVXA 5ALIA 4ALNA 4EVQA 1NBMD 5A3VA 3U62A 5CK5A 4BE7B 4R0VA 2AMVA 4JBLA 3T7JA 3VH2A 1EESA 1P9NA 3KE9A 2QRUA 1K0FA 1XAGA 3SXUB 3ZGNA 2FFRA 2BR4A 2GFIA 5AOBA 1IEVA 2FETA 2PMFA 5J4YA 3GOHA 1RTTA 5CDTA 2PBFA 2WMNB 5ALSA 3MBOA 1M8GA 4B6PA 4O2AF 4MICA 5AJXA 3O8BA 3S7ZA 2JEYA 4PN3A 4AWAA 4FZ3A 1O8BA 2QSZA 4WY8A 1D0SA 5C4XI 1ZZGA 2YL2A 1QHIA 5K0ZA 3GG9A 2CJWA 3WLOA 4CT4B 1SA0A 4IJWA 2H06A 4IY1A 4CM5A 1PS0A 3DEHA 2C9YA 2GI4A 3EIWA 1N7HA 4MVYA 3TZCA 1KK1A 3W77A 4QT4A 1WJGA 2X77A 4LZLA 4DABA 4H1WA 1KMQA 3NU1A 4AMGA 1CS0A 1B6RA 3DKKA 3IQDB 1U8ZA 1U6JA 5H59A 3DDNA 3JQFC 4O1HA 3ZY5A 1UC5B 2BKAA 3B60A 3FOBA 5AKEA 3VPHA 2OQIA 2UV8A 4RKEA 4U02A 3ROEA 2I62A 3ZCVA 4Z54A 1K1EA 3GGJA 4A0RA 3QKSA 1ZJ6A 4CLOB 1TUBB 2OAEA 4KU4A 1H69A 1Z74A 2HJ9A 3EFHA 2I2DA 2ACVA 2IZ0A 4XCXA 4QJIA 1H6BA 2PRZA 4JT4A 2FSIA 1JNYA 2O5EA 3VTNA 4PANA 2X8JA 4BDSA 1RP1A 1Z2NX 4DNPA 5FORA 3GZTB 3T0IA 1RMQA 3TVTA 1A71A 3W2FA 221PA 5JWRA 3GLIE 3G5TA 1NM5C 1ZI6A 2PV7A 1QXFA 4GM4A 1WQ4A 2QN7A 3H2YA 5AI8A 1N6NA 3RRNA 1I7DA 1L6RA 2GA9A 3WGJA 3BKWA 2HGZA 3UENA 4CF3A 2IK8A 1ECCA 3UY4A 3ZR4B 4AS2A 4NCJA 3KYIB 1MX5A 3TGPA 1E94E 1UIMA 3MGCA 4P4SB 4DXAA 4FPXA 1Z12A 1TAGA 3EQ7A 2JVIA 1QHSA 3R6DA 2PZKA 2Q21A 4IIGA 1IBRA 3K8ZA 4IIEA 1Y9EA 1KETA 3CC71 3IALA 4R40A 2CLEB 4DGSA 4ZEXA 4F46A 1QLWA 1HTWA 3H9UA 2HHHB 1ZCFA 2LKCA 5CG2A 2IHTA 2GKOA 3AF0A 2A9JA 2GYYA 1E2NA 2BZGA 1G21E 1QTNA 1WSDA 3DUFA 3U13A 2B34A 1U8CB 3HCEA 4BNZA 4F4DA 3BIXA 4H1HA 4XYEA 1DBSA 5TR9A 3U6KA 4CKZA 3FCCA 3GFGA 1ZK2A 4FTWA 4TMYA 2VDUE 1VCNA 5JALA 1TEZA 1MOQA 1LRJA 3MSXA 1UDBA 1FMCA 4RNCA 4YJDA 3UCEA 1L6IA 1CZRA 1QCYA 1AMNA 1G0NA 3EWNA 4MR7A 2GXUA 3HABA 3LVQE 1TDJA 5HCUA 1DZ3A 1QYVA 1T6BY 2VC2B 2AA3A 1PQWA 2XWJI 3O94A 3TKAA 3ZGOA 3QRWA 2ISCA 2O2CA 1SBNE 3DAFA 1Z82A 1RNIA 1VP9A 2OR3A 3HLKA 4ENVA 4DQUA 3WOVA 1XHLA 3Q72A 4K5QA 3P26A 3VHRA 2PPVA 4A2CA 1GKUB 3L40A 5C32A 1RWVA 1OZGA 4GGOA 2R60A 1SQSA 2N42A 2B4TO 1LEHA 3HDGA 4WNIA 5GY7A 2OXIA 3WGIA 1QF8A 1BE1A 4G84A 3ZHBA 4PFQA 3C8UA 3CCQZ 1FBTA 3RSOA 5CW2A 4LHVA 1HT0A 4OUKX 3FWYA 4EEZA 4ECEA 4Q1BA 2H18A 3V00A 5H9WA 2ZVDA 5EQFA 5F51A 1KO7A 1C4WA 3ABOB 1JFVA 4EF5A 4UHEA 1KWKA 1L1FA 1LQUA 4HAWA 3CV3A 4W6QA 5TRTA 4E2YA 2GBIA 3GJTA 3FOZA 3QPDA 1MQ8B 3B82A 5I7HA 1R10A 3WLTA 5JXGA 4TXNA 2N75A 2X0NA 3AUAA 3AIKA 5LQAA 1V2HE 1GTJ1 5A1TA 3OPYB 1U4SA 1JBEA 1NOKA 4JUDX 4OCZA 2ZYIA 4UVIA 4UAGA 5KVQA 3DHEA 3RFUA 2HRBA 1MJ5A 1MOZA 2V6FA 2DCMA 1AS0A 2X1VA 4OHRA 3ZDZB 3DMPA 4B5LA 4LRTB 1KFJB 2YQ4A 1J23A 1O9BA 4PVDA 1R5OA 4URFA 2M9MA 5L4SA 1AA9A 3RV4A 3QH4A 5JXJA 2MOKA 1QVFZ 2C5EA 1L4HA 2Z6AA 1XQVA 2BIFA 2IYUA 1U2TA 3NHAA 2Q1UA 4OIFA 3F1LA 3ZCXA 5BNWA 1SOVA 2HMTA 2IYLD 3OP4A 2QTLA 3U80A 5LP6A 1R64A 4B4VA 4DLXA 4FYKA 3CRVA 4HTAA 4AU1A 4CM6A 4EB3A 2UXBB 3MAJA 1AN9A 3I8SA 2ZIXB 4H0NA 2R9VA 1B93A 1G2QA 2X41A 2ZJOA 3LK6A 3TSCA 3I01A 3WAJA 2EX4A 3NGLA 5KPJA 3TZKA 2QRGA 3A4NA 1JR3D 1O6GA 2WJPA 3QLVA 2X0KA 3KHSA 4IHAA 4KN9S 3OZWA 3V8VA 1P5HA 2GSWA 2PNFA 1CVRA 1RR6A 3BWDD 3T5DA 1MB4A 1Q0UA 1PU2A 1YACA 2BEWB 5BWNA 5JO0A 3D9QX 1UJ6A 1TYBE 4IJQA 4UPDA 1PK9A 3DP9A 4PPGA 2M6KA 4AF6A 2BHRA 1XU7A 3ETEA 4ZTZB 2E5FA 1EFLA 3K8QA 4HLUA 1O95C 1GTSA 3BGOS 5K8JB 1NXPA 1ZUD1 3FJ1A 4HNTA 3TUZC 2BSQA 3HOUI 2Y1CA 4AJPA 1X7YB 4KI0A 5BW6B 1H5UA 4EI7A 2IOHA 2REQA 3TD6A 5IKEA 2J4DA 3IBYA 4KFRA 3GFVA 4JHXA 3S2UA 5IC4A 4KYIB 1Z5VA 2ZR0A 4MV9A 1Q7Y2 2AQIA 5BVGB 4MR8B 5DCWA 3OE7D 1FFBA 3I1JA 4K9KA 4WKCA 3LS2A 4HBZA 3QP9A 1UZLA 3L41A 4ND7A 3KYCB 4P3KA 3ZD7A 3HWX1 4DIFA 3FFBA 4GNRA 2ZSJA 3SS8A 5HK8A 1RRMA 2W2TA 3USZA 4B82A 4JI7B 2IF2A 1NT4A 5EE5B 1Z4LA 4FVTA 3S2ZA 2I7VA 3V7FA 1F8GA 2FLVA 3RROA 4G67A 3ZI7A 3ZWNA 1J99A 1W36D 2G9ZA 4MA5A 4LE0A 4JLJA 3E9QA 4ND8B 1K68A 2WB1A 2D5CA 5J47A 1JWHC 4Y67A 2C42A 3STYA 5KCZA 1C0KA 1H9AA 2JLWA 2QTRA 3C7KA 2JI9A 3AVUA 5EKTA 2W8BA 1TU3A 3JTEA 3INGA 3R4VA 1I4EB 1HQDA 1KAQA 4Z8XA 5FD8A 3CX4A 1KP9A 4IOLA 3F7OA 4CIAA 5J58A 1XE3A 2ZIVB 4FKMA 3L04A 2A33A 2ZJ6A 1NDUA 2VCHA 4NU6A 4KYUA 1RWQA 5ESXA 3L3BA 4FGJA 4XVRA 1H4TA 3S2SA 1MJNA 3F7NA 5T4BA 1RPJA 1XVVA 2RKBA 3WGKA 4ABTA 2WICA 3QEJA 1ZRMA 1WZEA 4N0MA 2GXSA 5DF1A 4LDRA 3H2ZA 4G0YA 3S17I 3ANSA 2FPSA 5DOZA 1P5FA 2WYVA 3JQGB 1R5NA 1Z17A 4MGIR 4I9UA 3KCQA 5JQWA 3N0XA 1ZOSA 1AGYA 3M2TA 5CT5A 2AMFA 2JIZD 4MHSA 3GEMA 3GRCA 3UBMA 3WLSA 5IDQA 2X4LA 3THWB 2HMSA 2WJ4A 4NMHA 5AVOA 4L8YA 3DTVD 4EIWA 1XXLA 4RGYA 4ZV9A 5DLEA 1G0OA 1OI3A 4BKRA 3L6RA 1SQ5A 4YRGA 2QZPA 1RWNA 5JWHA 2I7TA 5DX8A 4E09A 2FPGB 1A7UA 1HDOA 3E2MA 4AO8A 1MB3A 1UXKA 1W93A 4Z4FA 4DB2A 3HNRA 2E4UA 1JB1A 1WU7A 3CF2A 2GCOB 1P9RA 1S96A 1KVUA 1QV7A 1V6CA 1G8KA 5EKUA 4N0EA 2FDXA 1X1QA 3I4CA 4Q82A 2RI0A 4BTVA 5KX5A 4D9EA 3I58A 4YRBA 1EEHA 1JHXA 1O6BA 5DSZA 2OXCA 4AKEA 3AKYA 4QUJA 1MO5A 2A8YA 2DUWA 4QUDA 4M49A 2GAFA 3IT2A 1W1WA 2JLCA 3EIUA 4UATA 4ZC1A 2C3PA 5CCEA 2ZZMA 1CFZA 1J8QA 2GS9A 3D4BA 4UMVA 5DNDA 4RIGA 5DNYB 4CCYA 4O6VA 1IATA 2PSSA 1OB2A 3CJTA 4N3BA 4PLYA 1SWVA 2DGDA 4POOA 4ZRNA 4TTVA 5LKRA 5IF9A 1AMUA 1Q7CA 1HYHA 1ZCJA 3WGHA 4JEMA 3UC9A 1K88A 5JYEA 2J9RA 4DCTA 3AEKA 3KNZA 1EP1B 1ZNZA 3HJBA 1GG8A 1S8OA 1XZCA 2VK2A 4G5XA 2GJKA 1S0UA 3KHTA 1W85B 1DJQA 3OCUA 5IP5A 5K1ZA 3T0FA 1LQTA 3A3OA 2W6NA 3BQ9A 1YMQA 1Q0QA 3C1AA 2ZSKA 2QHXA 3LA8A 4ZEVA 1LJLA 4K28A 1C0LA 2OLKA 4O2AA 4ZQBA 4Q05A 2C9OA 2WHYA 2Z04A 4KRXA 4GMHA 4AULA 4OXRA 3D4NA 4KDCA 2O1WA 1CX9B 1X9IA 2QYOA 4PM4A 4UUMA 2MMCA 4L9WA 2ZWOA 3V8PA 2YYYA 5TJHA 4AXBA 3KQHA 3H3XA 1N5DA 2HU5A 2QR1B 3SHTA 3H7AA 3DE0X 2VSOA 4O4HB 3U31A 2ZBVA 3O9ZA 1JXMA 3MC1A 3BJZA 5AK5A 5JYBA 1GPNA 2PD6A 3GYGA 5DASA 1MO6A 1KDOA 2BF4A 2JA2A 3NVDA 4J4HA 3AFIA 4KQ2A 3SZ3A 3TQSA 4BS9A 1CEEA 2Z98A 4JLBA 3JQ8B 1EEXB 1K7EB 2PA0A 1QF7A 5EIXA 3PGJA 1Z22A 1Y9ZA 2J0UB 3JYOA 2HHJA 3IDOA 1PJCA 1EK2A 1E0AA 3DLIA 4HWTA 4H0FA 3TPFA 3R9XB 3PKIA 4GX1A 3BGIA 1H6AA 2V7TA 3CN9A 5SICE 4DEYA 1P5JA 1F2UA 1XRRA 2ZJ3A 4DWOA 5L9AA 3WIBA 6GPBA 1ZGHA 2JLUA 1GL6A 4ZVQA 2J5RA 3G2NA 2VH2A 3JQAA 3TIFA 1Z36A 3B1JA 3AFOA 4GDFA 4KH1A 1GKYA 3B53X 3FUCA 1Q83A 3H99A 4C5CA 3GT7A 3F9RA 4Q3AA 3B1XA 3KFXA 1LPNA 5CXSA 1SOWA 3MINA 4N54A 1NW7A 5LDGA 3HXOA 3UMRA 3N8NA 1DOZA 1T3LA 3PHCA 4J4BA 1SKMA 4RTSA 1QF6A 1E6LA 1P18A 1P73A 1SURA 4TMWA 5FWAA 4MAFA 1KAOA 4AF7A 4BB5A 5JS7A 2JAOA 4OQZA 1E1LA 1NM5A 1F7UA 1GQ2A 1PT5A 4HY3A 5AP9A 4EW2A 2B98A 5JAPA 3ZLJA 2VP6A 1KJYA 4OJQA 2DUUA 2NWQA 3VKUA 5A9SB 4OMUA 1JG3A 3QYFA 3EIXA 5EWLB 2WU0A 4QNRA 2WFLB 5EIHA 2Q5JA 2ZRLA 2G6TA 3GCXA 3HYTA 1BA2A 1UBHS 3IURA 3LIIA 4OP3A 4W1RA 5B7PA 2IPLA 1IXRC 4ZU1X 4R9SA 1W0JA 1FRNA 1E9DA 1HLPA 2DKFA 1RIFA 5K3AA 1M67A 4G2TA 2ANCA 4KZKA 3QU7A 4JVSB 4QXOA 1IJKA 3FPCA 4O25A 4AWXA 3OFND 3ESAA 1PHRA 3FGNA 3QM1A 3D1VA 3HXQA 2BELA 3DJYA 1A9ZA 3FWNA 2NXCA 4X8OA 2PMZA 4CHGA 2P6PA 4ZT6A 4R68A 1N3LA 1K7FB 3I23A 1S8FA 2PLFA 2QG4A 2I2XB 2OWDA 2WG1A 4HXEB 5CM9C 3BTOA 4A6EA 4DG8A 1T3TA 1YNOA 2C84A 3KLNA 4X1KA 2O23A 2IHJA 1KEVA 2JCXA 4JENA 2EFDB 2FEWB 2C07A 2LIPA 4TMTA 2OPHA 5A06A 4BLRA 1LC0A 1DKQA 3GPBA 3TMYA 4CIDA 5IJ0B 4OX9B 3ZCQA 1AKTA 2HV9A 3V4ZA 2XGGA 3UWMA 4ER0A 3F5FA 1AF7A 5AN9F 1YI21 1W96A 1Z34A 2BHTA 1DVRA 4BKOA 3E7XA 2FPXA 4IDOA 1KI9A 2YJZA 3CX3A 4LY3A 4R8MA 3PHHA 1TNDA 4YDRA 4ZEMA 2AVDA 1LLUA 3ZD8A 3B3FA 5K2MA 1G7CA 4S2EA 4C7VA 3S2IA 3F2IA 3UWPA 3WLJA 2DM6A 4BWVA 2XUJA 4BRZA 1OLOA 4ZYUA 3DD1A 1KHHA 1L1QA 3L0BA 1Z4IA 4J0EA 4MUIA 3B6KA 1P6QA 3JQBC 4BO2A 4BJ1A 3H9GA 1T9GR 3A9WA 3A9RA 4OH7A 3OCWA 5C7OO 1TTQB 2RCYA 2C0CA 5EN4A 1O94C 1JQ5A 1XVIA 2ZUUA 2QS9A 3MCVA 3OQBA 4K9PA 3URKA 1XXHB 2CZGA 1S2MA 2YDXA 6REQA 3IDQA 1JDPA 3NEAA 4U7GA 2IELA 5E4FA 2ZTLA 3EZ9A 2IV2X 4G5GA 3DDOA 5B1SA 4RPJA 4UXJA 1P44A 1VDZA 5C34B 2ZRGA 3PNLA 1I2DA 2FFJA 2JA5I 4ETNA 4IWNA 3CU5A 4MYDA 2WDZA 4UJ5A 4WNCA 4EGSA 3IQWA 1TUIA 3JQDA 3LPNA 4FT2A 4PO3X 4EX6A 4ZK6A 1Y48E 2Z57A 5E1BA 4EP1A 4L4YA 2E4AA 3NUQA 1EE9A 1UXJA 1WKVA 2IBTA 1D2HA 2HUNA 4LX8A 3O84A 1T8YA 4J2OA 1HNWB 3TRFA 2R84A 1AV6A 2VTEA 2P35A 4UQPA 3U4QA 2GASA 2HPZA 3E58A 4G8JA 4PG6A 1K5DA 3H2IA 4PC1A 3D8TA 1B6SA 1EX1A 2FW1A 1MXHA 1CQIA 1TKAA 1V1RA 1W5FA 2Q3JA 3B9QA 3ETJA 3MWYW 3OJCA 2PGLA 3PF8A 4U63A 3UM9A 4A1FA 3R5KA 3R6GA 4GH5A 1J0BA 1G5FA 1GNPA 2VJOA 3AP1A 3TBFA 3DFFA 1ZBDA 4NHEA 4BNXA 1J5XA 2AJDA 3MTBA 2OGZA 1JH8A 1I2MA 1LVGA 1GZVA 4XIJA 1QWSA 5GGXA 4BCBA 2VBIA 5D5PA 1CQPA 3PI7A 3BXOA 4AN4A 3KKEA 2MSNA 2ZJ7A 4LYEA 4DRYA 1K731 1RI1A 2DKOA 2PGIA 3BIFA 3DV0B 5COAA 5M5BA 3CKYA 1ECGA 5B1HA 3LIPA 2DBQA 3WLFA 3AR4A 1C41A 3UJPA 3RARA 1GAXA 3JPYA 1RSZA 3AM5A 2A94A 1SFOI 3ZOZA 1UAAA 1O9HA 5MF6A 3IJRA 2IH2A 1DAKA 1EK5A 3ZBPA 4EUNA 1X38A 3HGTA 3U4CA 3AONB 4GGPA 4DJAA 5A7HA 1T2UA 1X6VA 4F6RA 3VO9A 3A2NA 2NVQI 2BHLA 3KZ1E 1XA4A 5T8KC 2GD2A 4NPAA 3KLPX 1RYYA 5F1KA 1UBCA 3PITA 3GN2A 2PPLA 4IDEA 2PGNA 4QHSA 2O8CA 3VVCA 6Q21A 4UVGA 3VR4A 3JYHA 3OEHA 1EA7A 1VSUA 2Z2YA 4K1LA 2GRJA 4PX3A 4MQBA 4NMLA 1FDRA 3W9YA 1G63A 1YZFA 4C03A 4X7PA 3RREA 4XSVA 4C78A 1NXQA 3OBIA 3KT6A 4DNFA 3A1TA 1Z0UA 5K3DA 4DA8A 2VSYA 4C4YA 5C53B 4DT1B 1FS5A 1CUXA 1A9XB 3X3HA 3G2IA 3SHVA 4TRMA 4RACA 2ZYUX 4H18A 4BE4A 3CT4A 1LLCA 4GG1A 2IF0A 4JJGA 1UK6A 3N74A 2R8OA 3NDPA 2AIRA 2E0IA 1A76A 3UOWA 1N2OA 2AF3C 2VDVE 5ES4B 2BW0A 2IPXA 3C3DA 1P3JA 3L7CA 4HXYA 1KY2A 4PAMA 4DAEA 1E2HA 1DGQA 3PP8A 3NS7A 4LA4A 13PKA 1RBMA 4D6PA 1K63A 1DPGA 1BDJA 4XR9A 3B5IA 3U9TA 4U6NA 2WZQA 3R1IA 1D2NA 2A6PA 2IJGX 1WDLA 3D7NA 1B26A 3LDAA 1PLJA 3DPSA 3N2LA 1Q1BA 1NFRA 3QBDA 5KVCA 1CVIA 3FMGA 4CL0A 1H6DA 2C7BA 4UUNA 4J7UA 3WLEA 4WBNF 4R0MA 1DIGA 3LGXA 1QOZA 3FDIA 4TTPA 3A4TA 3M34A 4FBLA 4B3RB 1MN6A 2I1VB 1U8XX 4K2HA 5L40A 1WABA 1KQ3A 3DDCA 1DIAA 3CNBA 5AI6A 4EKDA 3W5AA 1T1GA 2FE4A 3MMXA 4N7MA 3ZUPA 3D1JA 3VV3A 1KDVA 1LA2A 2FY8A 4EGFA 5KMGA 5E0KB 4UUPA 1RWBA 1OAOC 4B3GA 2D74A 4M1TA 4OGLA 4R54A 4IDAA 2K7ZA 1FDSA 2VP0A 4RQAA 1D8TA 4S12A 1RMTA 2J6CA 4UAJA 1DEKA 2R00C 1YJ5A 1C7JA 4LQDA 3FSRA 4D8YA 1CR1A 4MR9B 1N8TA 1Y7HA 2CNWD 2IDKA 2PHZA 4QXQA 1NR5A 4LRXA 2C8LA 4R1PA 5HEKA 1F14A 1MVOA 3IPXA 1GNVA 4O5OA 3KTAA 4HGOA 2ZYHA 1LK7A 4MKXA 4BFUA 2Q5FA 4XQ0A 3TOSA 1P4HA 1AQNA 1EHIA 2XRFA 1JH9A 1E2BA 2VJMB 3NTQA 3T4XA 3LXRA 2NUPB 2CYCA 3D6HA 2IYOA 1IWBB 1DT3A 3GFPA 1SK9A 1ACMA 4WA7A 2E3JA 3WQQA 4EHFA 3TI9A 3E9YA 3IIIA 1C8VB 3PC6A 3T6KA 3QUSA 1HM5A 5FUXA 4ECAA 2HOQA 2XTZA 2UVQA 2JRLA 3LF1A 3VISA 3NGMA 1RLOA 4MVCA 4WEOA 3D3WB 3VZBA 1YQGA 2P3LA 3EGXB 4BZPA 1NP6A 1Y42X 1V3QE 3FPHA 3LYUA 2HJSA 1XRSB 4NZOA 4RZQA 1PR0A 3NTLA 1ZONA 2C2WA 3ASYA 1DBPA 3A6EA 2Z9DA 4WACA 5EJMA 4MXDA 4ICIA 5FOTA 3I2KA 1OFHA 3Q0IA 5A0TA 4KYVA 1JDTA 1CZKA 1O87A 4HV4A 2P5UA 1G6HA 4QGSA 2LXNA 4U8GA 3AEYA 3MCUA 2WSSD 4Q3NA 4LVOA 3V2IA 4UU8A 5EE0A 1KGDA 1E2QA 3RSFA 4J1SA 3IBTA 3AK4A 4R83A 4ZEOA 2C58A 1AU9A 3KJHA 3SQXA 5SY9A 2ZXUA 2V3CC 2QJWA 1XZIA 1FDUA 2PV0A 3EUWA 3F6RA 3L6UA 1M6HA 4JLDA 1I2CA 3E0XA 3ZI0A 1EVJA 4RK4A 3BFJA 4EHJA 4JL8A 1K6XA 3A14A 1R0ZA 4TTAA 3WZ2A 5C51B 4JJKA 5BWOA 2W2XA 2XWBF 4PPFA 4Y6PA 4M9CA 2XTAA 1H8HD 1N2JA 2QM7A 2QR2A 3RNOA 4JI0B 5LFAA 4AZVA 2KWIA 2XSZD 1YFZA 2FN3A 2BBSA 2FFBA 2H2FA 4PLGA 3CT6A 2WPDA 1YU9A 2E4YA 3QSGA 1MU0A 4BZZA 1YIT1 3KB6A 3TBKA 4DM7A 2RHGB 4EJ6A 2PUDA 4OHOA 3ANXA 1Z9BA 3OQMA 4Y6SA 1YR2A 3GQBB 4OBBA 4CKCB 2HFKA 3GUVA 5CLLA 2F3QA 1OFIA 5L3RA 3RM3A 1UKZA 3H18A 2W2KB 3VNAA 1GCOA 3PYMA 1NZJA 3GGSA 2L19A 4X6XA 1C1DA 1GNRA 2JAXA 1PZMA 2QYTA 3FDZB 4OSEA 5HKKA 3CCBA 2NU9A 4XB2A 1TT5A 4F12A 5KWJA 2WINI 2BWJA 3T95A 1UMBA 2DTDA 4W4TA 1YD7A 4DR7B 4YHHB 2RSLA 3QA3E 3B12A 3TB6A 2HLDD 2IKSA 4L2IB 3GF4A 4X7MA 3E4DA 4LJRA 4XJTA 1WV0A 4JVLA 3RHFA 3FWHA 4BO3A 2G63A 3NPAA 2FQQA 2IRWA 4RFLA 3VNRA 3C8ZA 1QZZA 2W6JA 4MEJA 4DRXA 2GEJA 1ISHA 1OXTA 4QTZA 3VV2A 1U3WA 2RJOA 4JJEA 5HCIA 4DBVO 4UU7A 1II9A 2SKEA 3ABQB 3GGPA 3TLXA 1LVUA 4BU0A 3RAJA 1EPUA 1AQYA 5LB4A 2D0OB 4QQNA 4ZAVA 1MDBA 3I3OA 3QNMA 5LUBA 3VGPA 4CNQA 2CDBA 2GJ8A 4TVOA 4YRPA 4US2R 4F7WA 1QZTA 2AG5A 1U7XA 2QMHA 1V4BA 4C88A 2VZ8A 1F6BA 2G8NA 2FSFA 4HH1A 4JBNA 3BBPA 1THTA 4LDZA 4NOLA 3TTSA 4QO7A 4ZJYA 2QUZA 4DV2B 2ZGVA 4I6EA 2YZMA 4MP8A 5BV2P 2YFHA 5CT4A 3OZXA 2WJIA 2WWGA 1Y80A 4J0HA 2A0UA 3M5WA 5DIFA 3UV3A 5DGDA 3A6LA 2Q4RA 4JC5A 3VKVA 2ECOA 3EDYA 4M4SA 1T2AA 4NE9A 5CK4A 4F86A 2O6LA 2VCEA 1LB1B 4PY2A 1SG6A 3OUUA 4LXUA 4WN9A 4RJTA 1BDHA 2C0QA 3QXXA 4P84A 4X20A 2W2VA 2NXWA 4AP5A 1NBWB 4NCXA 5LOVF 2NW6A 1GUFA 1I3CA 1PR9A 3KAJA 3LCRA 5DW3A 2OQRA 4JJFA 5CB4B 5I8PA 4Z4EA 4XA8A 4DIEA 3A6KA 3OQIA 2HD4A 2CDCA 5LWHA 1EFRA 4UCFA 4DLYA 2NVUA 3THXA 1J42A 4HVAA 1NN5A 4I3HA 4EMBA 1A82A 2O8BB 4YUZA 4CU5A 1X7WB 4B71A 4DCJA 1APBA 1IIBA 1ZMXA 1WY5A 1PG0A 1R0XA 1F7VA 5IH3A 3K9QO 4Y1FA 1JDUA 5GZ6A 1OY1A 4UM9B 4A2PA 4GLOA 3HFSA 1QG2A 1NU6A 2R6HA 1WZCA 3NR2A 4KVGA 3ILXA 2EHDA 4G5FA 1NRWA 1E9RA 1VQ41 2OKGA 2QD5A 2ZT7A 3RYTC 3Q8KA 3PHIA 1ZYUA 3CME1 1U4NA 2XNSA 2TMDA 4MQLA 1XMIA 4MCAA 4WXRA 3ZKAA 4C6TA 4GX0A 1Z47A 4Y2XA 1MCZA 4X94A 3MLAA 1K98A 1SZPA 2KMLA 3LQKA 1J0CA 3DBVO 2XIQA 2JCVA 3OZVA 4P1ZA 3AFGA 1F5SA 1ZN2A 2C29D 4NTZA 1JHVA 1U2PA 3BAZA 1PR4A 2VP9A 4FHGA 4PLPA 2M6LA 4TV8F 4V0MA 4EY7A 4N1AA 3LCUA 4WRRA 1WU8A 3PDJA 1GSHA 2QTCA 1ZGJA 3WLAA 4IVNA 3ZU4A 5KKAA 3F7MA 2O52A 1EZ1A 3ZHRA 4YCSA 1YSCA 3DCIA 1PGPA 4P53A 3QU5A 3KQKA 4OXIA 4UU1A 4HPWA 4LJ9A 1WAMA 5T8KA 5C4IA 1UXGA 4TVKA 5B3AA 3SIWA 3ZQKA 2PGJA 2QN8A 5FWYB 3ZW7A 2HRRA 3GFBA 3KJQA 2I4NA 5IC6A 2B0JA 4BNTA 1NN1A 3M6FA 3M4YA 4NBGA 2WJAA 4LMPA 4MV1A 4RS3A 4BHTA 5B7NA 1C14A 3L0SA 3TR6A 3HKDB 4NYMQ 2C97A 4Z86A 4DUZB 2BY4A 2GNOA 1MR3F 3REFA 1YOVA 4PQYA 3E8MA 5FT9A 5B1IA 1ZM3A 3O9VA 3SX2A 2N3ZA 1Z7BA 4IYRA 4X00A 4R98A 2B4KA 3OWHA 3UMVA 4X97A 3UT6A 4HH0A 2PL9A 4LJAA 1M72A 4C3ZA 5CEJA 2ZRCA 1YQXA 1U0FA 1UOOA 1V8OA 1PCXA 5FEMA 1USIA 4JC8A 4WW0A 1CUIA 4NICA 1KO1A 4MIOA 1CWUA 4ER5A 3VYTB 3OWXA 5EGNA 1JLLB 4Y2JA 4B32A 2VSNA 4EZEA 2E21A 4S1WA 2XCSB 4ATNA 3AESB 2P2SA 4IS3A 2JGFA 3GEIA 5BQFA 2RGRA 3AMVA 4NS1A 3I04M 3ZGXA 4C0SA 4WBNA 4YV1A 2AD1A 2IXEA 4F92B 121PA 3FOAA 4KPYA 1QR6A 2C54A 1RQLA 2EZTA 4JLVA 3MWJA 1JRLA 1BGWA 1DKPA 5KWEA 2D5LA 1DUIA 1T5HX 3I05A 4K6FA 1RXYA 2RKWA 2XUFA 3E70C 3S8EA 2GAOA 3AF5A 4UULA 3RRXA 3ES9A 3KOWA 3JARA 4X41A 1RQGA 2YBDA 4DPMA 3G2HA 1RQ7A 5EMLA 5B53A 2NYRA 5JZBA 3JYLA 4RH1A 2AWNA 5ITSA 1QPZA 1RI5A 4QTTB 4XM1A 4MPDA 4BEJA 5KNCA 3FWKA 2R1VA 4ML3A 3TLJA 1Y63A 3Q6IA 1G2PA 3N3BC 4WOKA 1ZH8A 4XDZA 5DT9A 3LBYA 4FK8A 4FN5A 2QN6A 4L72A 1GKIA 1E2IA 1I36A 2V7XA 3A05A 1VLAA 1EFDN 2CEAA 2ZAOA 3EYWA 3GUYA 3M4JA 1E2GA 4KGDA 3JSAA 5AI5A 1L7MA 4CCWA 3AIMA 1DRKA 3C3XA 3N5KA 4L8WB 4UD6A 5CFZA 1QIJA 1R3DA 3DL0A 3ZC3A 1T1RA 2QE6A 1Y8CA 3U19A 1TQDA 3GLIB 3SM3A 1IBKB 4GOJA 4WK6A 4EARA 2R00A 4GO1A 1QF9A 2H48A 1M66A 3B6ZA 3ILVA 1JGTA 4F4IA 5B5SA 1A7JA 4JAVC 1X3ZA 2QM3A 5CLGA 4QREA 1ABFA 1G5PA 1NBEA 1US8A 2JCBA 4MK4A 4IVRA 4KW7A 1T0JB 2XUZA 3N7AA 4U39A 3R9KA 3ZCPA 5LKAA 2QRDB 1T4CA 1IM2A 1OJLA 3VH1A 4NDZA 5B6JA 2FB9A 4D3ZA 3PFNA 4O4IB 4HGZA 1T1EA 2EW8A 4KLRA 4Z9XA 4PW0A 2JW5A 4TZKA 3WFZA 5TIIA 3SWWA 4LWQA 3GH1A 2HBYA 2HSGA 5JC1A 1RLTA 4N5NA 5ECYA 3PX3A 2YVLA 4M1QA 1SHKA 2COUA 1D2AA 1A77A 3C3EA 4R2XA 4CLDA 3OCJA 3DNMA 2R6R1 3WY9A 5IX8A 4IFIA 3U4HA 4BO0A 4URUR 2GEUA 3OCZA 3UK1A 4G9GA 3AJEA 3IR5A 1SCQA 4OAQA 4MQ5A 3ZE2B 1Q862 5EKDA 2ZQZA 4YBRA 1DBVO 3B1FA 2O5RA 2IUSA 1CRQA 1GZ3A 2FF5A 1T6ZA 4DR5B 3TFQA 4V24A 1R0SA 3QXJA 4Y52I 4BBAA 2AN3A 3FUTA 4BMOB 4C87A 5TMPA 3PKZA 5BVHA 3JAWB 1GQOA 2P28A 3JQ7A 4XZ3A 1VKRA 4CR6A 3CQZI 2JNWA 4K9DA 2PD3A 4NPHA 2WUVA 2DH5A 1GEGA 2XB8A 3VNVA 5DXAA 2XT0A 5M04A 4G09A 1BXZA 3HMQA 2AR7A 4L8FA 4XB6B 4V0RA 3T35A 2C4WA 2OAGA 4G26A 1KEUA 4H4CA 3WBBA 5FV7A 4RA6A 2Q4ZA 1J90A 2EBHX 1EJBA 5J5CA 4BNHA 3N2KB 5ICEA 3EVTA 4FYIA 2O2JA 2BZ1A 2HMWA 3EDQA 3AHGA 1FUIA 5JFOA 5HF8A 2CCGA 2XGOA 4I5DA 4OD0A 3L2OB 3V7YA 4BE9A 1OKKA 4IKEA 1GLNA 4DXHA 1N2FA 4I4TB 5D01A 1KD11 3CVYA 4G0UA 4DSNA 2PUTA 5JH7A 1WLSA 6PFKA 1LDGA 1UP4A 3PC7A 3DBLA 4YAUA 2VPTA 1P1HA 2NSHA 2WAXA 2AI2A 3H04A 4KKXB 4Q7KA 5CRIA 3RU7A 2HJRA 4HXGA 3UGTA 5BW4A 3RS7A 3K35A 3PXGA 1KY3A 3OJFA 1R2QA 4OGGA 2ZIZA 2V7EA 1XHEA 3K0FA 3ZD9A 3MB5A 4A73A 4KIGA 4MUEA 4BZQA 4WJLA 2FCAA 2CKMA 3T5GA 5EWJA 1XROA 1ADYA 3AR9A 3OC6A 4M76B 1V2GA 1VLLA 3FZNA 3PS9A 3T54A 2MIIA 1C4KA 5I3CA 4X95A 3Q7SA 2QG9A 2BBTA 3NC1C 4URXR 1KPIA 4D4GA 1PWXA 3LHDA 2YV3A 3H3VJ 3KEMA 3WWPA 1Y6JA 4MI1A 4O0LA 3AJAA 1KKMA 1C2YA 1B8UA 2X0JA 1RXVA 2JGJA 2E6UX 1KQSY 1EUCA 3KRTA 2Z6QA 4OYHA 5ELMA 2GERA 2C7PA 4MQFA 2WJHA 1TK3A 1YS4A 2M48A 4GNKA 2BISA 4PYIA 4C0LA 1YKSA 5JNVA 3A6JA 2DBYA 1VQ6Z 2C5FA 3Q0EA 4LFCB 4EO4A 3CRZA 3WISA 5KVSA 1KBZA 4PHHA 1ECPA 3NBMA 2Y66A 2IUYA 3MB8A 1J8VA 3NTUA 4AQDA 1M1NB 2IQ5A 1WZ2A 2CMDA 2GZSA 1XEFA 1ZVJA 2HBRA 4KR2A 3QENA 2BGMA 4F96A 4KXWA 4YT8A 3ELUA 5LUAA 3UKDA 4DR2B 1EFCA 1W88A 2BSAA 1A27A 2R66A 2Z3WA 3E48A 3FKSD 4P08A 3PYXA 3W3AA 4WE3A 1KYIA 4YAGA 5F5LA 1ZGCA 2C82A 3DBHB 1FDOA 4GPIB 3BDIA 5REQA 4ESOA 3PUXA 721PA 4X1YA 4K3UA 3GR6A 4FW9A 1PUXA 1BYUA 2VHEA 1OX4A 4PBTA 1JHYA 4OAPA 1RJFA 5BT9A 4I5FA 4B81A 1UQUA 4HZUA 4DR3B 3CFYA 1Y5LA 1JAZA 5A1JA 2VNIA 3A04A 4ZO4A 5LOVA 2QGFA 3JRXA 1XF1A 3EBPA 1OZ0A 3GZNB 1PLLA 2D3TA 3PQ6A 4HMOA 5EQTA 1TZBA 3UJNA 1CJUC 1VB5A 4D9GA 4G4GA 1LTQA 2WJWA 3QJGA 4HADA 4KOEC 1RJEA 1HC7A 4PX9A 1UM9B 2CHQA 3BE8A 2R7AA 1JE1A 5B1YA 2QPLA 4BY9E 2QKYA 3GZ4A 4PZDA 2VF4X 2QRLA 4FS3A 4NV1A 5E2BA 3WO1A 2QI9C 1L4MA 2CNNA 3C8MA 4IG4A 1YHQ1 1T29A 4IGKA 3KV1A 4JOCA 1LXCA 3JCZA 1KVRA 4G1EB 4XDYA 4YS6A 3UMFA 2YV1A 2J5BA 4EO9A 4CQLA 5JYDA 4AMBA 1K5PA 4PRZA 1HNNA 4F2GA 4E07A 2OBMA 4EVIA 1OLXA 2OA0A 3T06B 3PT5A 3AERA 3IEIA 1QNFA 4XJSA 1H3NA 1FTNA 1JEDA 3BJMA 1HR0B 3BB3A 5AM5A 5IU6A 3DKPA 1AA6A 5K4AA 5A6SA 4KQWA 2O2ZA 5FR1A 1DELA 2QX6A 3L1JA 4D9HA 2G9QA 3RIYA 4CIVA 2FZWA 4B6QA 4PNEA 4I1PA 4JUIA 4MRVA 4UUBA 1VQ9Z 1QUEA 3NCHA 4ZKEA 1O4WA 4CL2A 3F6SA 2JGRA 2AG1A 2X5XA 2J0EA 4QUBA 1KS2A 5ALXA 2GVZC 1AGNA 3T7RA 2PUGA 3QPWA 5KTRA 1LCIA 2IZ6A 3VJLA 1W2WB 2HAEA 3HVIA 2XOKA 5IH7A 1V5IA 3R0ZA 4FC7A 1DXYA 2LBPA 4QIHA 3CLKA 4XIGS 4X61A 4RY2A 1Z0DA 3TJRA 3B9PA 3IHLA 4JV5B 3HWRA 2G5TA 4TV8A 5IWCA 2P6UA 4BGUA 2QORA 4XWKA 3INRA 1FSGA 4DBLC 1HF3A 2UDPA 4KOAA 5IF3A 3HDYA 4PZUA 1CE8B 3L8GA 4WKBA 3WYEA 3NZEA 2WTEA 3FPFA 2AN9A 4MWBA 4IXTA 2X2PA 4LXIA 1KARA 4WK0B 4A1OA 1RACA 5U4XA 4AMYA 1YI8A 1BMQA 1OBVA 3NHRA 4Y6QA 3NDRA 5B6PA 4EY3A 2C5SA 2LIVA 1XF9A 3DFUA 4Q1AA 2VI5A 5DYIA 3L8CA 2D7JA 1PR5A 1Y6RA 4OLHA 1T36B 3AOEC 3OJXA 4G81A 4AJIA 4C4XA 1ENOA 2VDLB 4Q7QA 5G02A 1YR1A 2Y2UA 3GNQA 2PCJA 3WRYC 3OOEA 1HKUA 3I28A 2Q8NA 3C6QA 1WRBA 1O0SA 2FSUA 1JDZA 3UG7A 4AP9A 5BMVB 4DA4A 2R79A 2VQSA 4S35A 3SR4A 3VGJA 3UH1A 4NBEA 2OV3A 4G1CA 1NAHA 4CF6A 3I09A 4BO6A 4CV0A 2OVFA 5ELLA 3PEWA 3ZW9A 1AS2A 3E35A 3LY9A 3ODGA 5T3UA 1S4MA 4UBMA 4RMJA 4YRMA 1EJ6A 4LS3A 5L7YA 5T7BA 2O0HA 4IDDA 4RK6A 1PJTA 1DC6A 3M7IA 1HLGA 3SKYA 2ATCA 4TWRA 1YZQA 5CB6A 3S1AA 1M2GA 4LVUA 5MN5A 4ZCLA 1MO3A 1T10A 1R4NA 4HL6A 4YACA 1GAJA 2F1RA 4L7QA 3SIXA 1DXHA 2PMKA 1U3CA 3HI6A 1G8SA 4G9BA 4LRWA 2P0EA 1GPAA 4FNGA 2P2NA 1G38A 4Q4AA 3EC7A 3HQ4O 4YECA 4V0OA 1TQ8A 1JHOA 1LK0A 2PWBA 3ECAA 3JYNA 5AWFC 1UBOS 3AUSA 3BTSA 3KLMX 5HMLA 1XK7A 3HADA 4EB6B 5F76A 3IHKA 3KSUA 1LSUA 1QH9A 4Z9BA 1K8ZB 4MINA 4GOLD 3A37A 4KLNA 5KYWB 5JJCA 4FUQA 2YWEA 4NR0A 4XLTA 2P6NA 5CXXA 4ZMSA 7AT1A 5H4GA 1B23P 5IUKC 3VMHA 4GR5A 4EY6A 3WLPA 2BI8A 4KYTA 5BN5B 3EX7C 3I83A 1SRRA 2FRDA 4DMCA 3FFAA 1E2DA 4G0ZA 3M1YA 1GO2A 2DLNA 2ZYDA 1X2BA 4XW2A 1YJ91 1O6FA 1USGA 2NIPA 1D9XA 3WK8A 3BIOA 4A6XA 2GCPA 1N1MA 4WQMA 4YRRA 4AJHA 4EFNA 2WKPA 4XWGA 4HATA 4F06A 3FOWA 1LQLA 1WVGA 5CLFA 1YAJA 5KUTA 4G0XA 4DN6A 1BG6A 4L74A 3VQTA 3ORSA 1FYEA 1GL3A 5HKAA 2IODA 4R2WA 4X3PA 3I9V6 5P8WA 2YMLA 2X14A 1E18A 1KS9A 4Z3DA 2WFZA 4Q3DA 3CCVZ 1A88A 5ITZA 3OHMA 4D0NA 2OZEA 3UKJA 2QA41 5GV8A 4B45A 5BRJA 4N9WA 1DUSA 1HT2E 1NYRA 5BPFA 5C3MA 4BMDA 1XL1A 2GM4A 1TXGA 2V7WA 4JP5A 1GTZA 2IYZA 1WW9A 1ZH1A 3FLMA 4N4AA 4TL7A 1L3IA 4BV9A 1C50A 2QTFA 4Q9IA 3RUEA 1DXQA 3LLCA 1IH8A 1ONBA 3PXXA 2OFPA 4GL2A 4B3MB 1SVKA 1THZA 3TRDA 2EU8A 4Q00A 3QBEA 3ZI4A 2WVJA 4V1CA 2KI7B 1XX6A 5D1NA 3KB8A 4K8OA 3V48A 4RFSB 4ZVTA 4NCAA 1ZI8A 3JAMb 3HPRA 4GVXA 3FF1A 3IO3A 2Q28A 1X1CA 3TLEA 4C04A 3JQAD 1E1YA 4OUDB 2I7XA 3MTDA 4X6AI 2EW1A 3QVOA 4TXMA 2OYSA 3SCZA 1ZL0A 3MWDB 4MPTA 2FG6C 1FDIA 1NVVQ 4R1LA 3WL6A 3IBFA 3ZV6A 4E14A 5KS2A 1S3FA 2EFJA 2RHDA 3M6AA 1ULHA 3K70D 2ZYTX 3LSYA 3UJCA 1IY2A 4F5YA 3CLUC 1J24A 1FE8A 4OL0A 2NUTB 3RRZA 1SC4A 3C7AA 1QQAA 4FMCB 4P32A 1U8TA 3A36A 3OQJA 3FZYA 1UWLA 1M2FA 4NARA 3D2BA 1U9JA 4B7AA 2ZT8A 5FV4A 1RABA 4HQRA 4M89A 4EYSA 4RENA 7ADHA 5IN4A 2JIMA 1A9PA 4FHEA 1HNXB 1L3BA 4MD7A 1FS6A 2VDKB 3BZUA 4KXNA 1KI7A 3X1ZA 1ZD4A 1JWBB 3PL1A 3LQ2A 3ASZA 3CZCA 1FFAA 1MH1A 2HK9A 2I8LA 1WDTA 3EK2A 3OT1B 4OA8A 1RI2A 4K9RA 4I0WB 3RC7A 1AGRA 2DVMA 2WSYB 5DP2A 2BJOA 1AKNA 2ZTSA 5DGTA 3HK2A 1QVRA 5H81A 1UK7A 3WHPA 1W0JD 2F3RA 3RLIA 3WVNA 2M2IA 1IN1A 4IR7A 4HNUA 5BXQC 1AF4A 2GN8A 3MUNA 1HRDA 3R2JA 1X42A 4L5YA 2OYCA 1E5TA 1F9EA 1ZOIA 3OU2A 4GRDA 1BH6A 1JI0A 3MT0A 4OQXA 3ZEAA 1NRJB 4HLCA 3DMYA 4A0HA 5TMDA 3FPAA 3W0LB 4POAA 4YASA 3WLLA 5FOQA 5E7IA 4DKXA 1Q95A 3FHJA 4G36A 2TMYA 2JA6I 1HYGA 1PBNA 5CT6A 3M4NA 1WKCA 2FP4B 3FUWA 4FYHA 4NOKA 4R0NA 5H16A 4ZJUA 3B7PA 1ABBA 3LUDA 2MSEB 5EP2A 3V1MA 1A0OA 3UT0A 1U2DA 2FPMA 3E9NA 4QDKA 3RHSA 3SGLA 4JBXA 2IYRA 2ZAIA 2IP2A 1EFPA 2VJAA 4FEYA 4HDQB 3RHZA 5JSUA 5LD2B 2YVUA 2V9ZA 2O2YA 3HRKA 4MI3A 4BZXA 4CE6A 5K9ZA 1K83I 2AOUA 1OLSB 3NNDA 5EHGA 1E64A 4J8PA 1K2VN 3P4XA 3RVJA 4GSKA 4B6JA 1JTFA 2R8RA 2VQDA 4J1NA 3DWFA 4TMVA 5DHFA 1PQPA 2G06A 3LYAA 1NY6A 3FYCA 5E1DA 4QPJC 3R3SA 1HT3A 2NVBA 4FJ0A 5CX1A 3WAGA 3DZFA 5ADVA 2W37A 4RHYA 1NC1A 3UXHA 4XOIA 3PQ2A 2X0RA 3QKRB 3NC4A 2QD1A 3PRHA 2YXLA 5NLLA 3NBKA 4A3EI 1H42A 4R2HA 2OAQ1 3CEMA 2X58A 3K20A 1ONOA 4RYLA 1URPA 3AGPA 4GPTA 5EYPB 1KWGA 5TNXA 1VYHA 2IDJA 4BXOB 1WEKA 3HN2A 4IIUA 4MWOA 3ZWXA 1V6AA 2FW0A 1BA3A 3KPVA 1D5WA 4UFOA 5CVCA 5LZ4A 1ZVMA 1ZCAA 1I5EA 5KJ6A 1O3YA 2XVAA 2EEPA 5SZKB 3L4BC 3U6BA 2Q3HA 2BFDA 3D6JA 4D45A 2X40A 4M9ZA 4AZ3B 4ZZ1A 1QK4A 2NU6A 3CCL1 2V97A 2V8KA 1NQWA 4TSFA 4QFBA 3KOMA 1CNMA 5JSQA 3VA7A 3SBEA 3T61A 2AH5A 3DR5A 2EJCA 2LFUA 3I30X 1RWXA 4UBLA 5EIWA 3P9YA 2I71A 1FRVA 2HO5A 4IRMA 4RDCA 4QTUB 4QGHA 5EWMA 4KV9A 4UEJA 5F1PA 4DA0A 1IM8A 3WLRA 3H9EO 1NJ1A 3PNPA 1USVA 2GEVA 1VJ1A 1A2OA 2FWBA 2BONA 2CLKB 2Q07A 4FEAA 4I19A 3W5JA 3RYCB 3U56A 3T1NA 1ZAYA 3N58A 1YVRA 3HE3A 2W71A 3R5XA 3RR2A 3RTBA 4OBWA 4N47A 3BFPA 5K3FA 3DL4A 5AJYA 1V39A 1NUIA 5DISB 3ENQA 5G4KB 1WTCA 2J9GA 3LBHA 4GD3Q 3LFHA 4O4HF 1ACLA 1IDOA 1UODA 3ED1A 3JZFA 1QIHA 4FIDA 1TO2E 2AFIB 4KUEA 3KWMA 4UNSA 4I9HA 4E13A 3R3HA 1NVDA 3CCSZ 1DEHA 2RIPA 2XQJA 5CGQB 3KL2A 4TS4A 4D3FA 3W06A 1P39A 4C5AA 5F1YA 2QZZA 2OQ2A 4KXLA 3W6NA 2UZ4A 4M37A 1XMVA 5GVSA 3N28A 4PGMA 1K5GA 1OWMA 2ZATA 1JDSA 3B7WA 2PZGA 1AXEA 2HCTA 3EZGA 4Z51A 3AL2A 1QHHA 4CLOA 3U61B 4PQGA 5IARA 1TUBA 4ZMBA 3Q8LA 4YI5A 3SF0A 2OOYB 4BYGA 2TRSB 5ALZA 3H4VA 1YC5A 2A5DA 5D1PA 3L5KA 3W1VA 4ESHA 4V2UA 3CMA1 2EJVA 1VL6A 2VAMA 4PPYA 1N92A 2CF6A 4RDIA 1JU3A 4JODA 2UYHA 3LPMA 3F3FC 3BD7A 3GBSA 1BMFA 1QFMA 1SXHA 3DEFA 3SJUA 1IRXA 1UBKS 2UYCA 3VR4D 3ZCRA 3OEHD 3AUKA 2IYFA 5FPYA 4P31A 5BV0A 1OYWA 5CYGA 3VR4H 2UUOA 2Z2IA 3NTRA 2SBTA 2VJCA 1P0QA 2ATIA 4DRZA 1XJWA 3QOXA 4PGGA 1WXHA 4P4SA 3WFIA 4EYKA 1HX7A 4HGRA 4D0RA 2E2II 4Y2PA 3I9V1 5AVSA 3ZE1B 3HCCA 1CERA 5DRYA 4Q1EA 4YONB 2XY4A 5EP1A 1QK3A 5KSPA 2J9FB 1T8UA 2H2AA 1UWCA 2PGDA 2IOQA 4GL4A 2BFEB 2PM8A 3MCAA 4NCHA 4DSUA 2HA5A 1KQFA 3TQFA 2UVDA 1E6CA 2W58A 3MJTA 4ES6A 2DE5A 2IVFA 1S8AA 3EMDA 3KKKA 3NO4A 3R7AA 4C7OB 2VHJA 2Z1MA 1IB0A 4XIYA 5FYDA 4C76A 3WRYA 1E2JA 2HGSA 1Y8RB 2YHSA 1SHZA 3D3KA 3VTKA 4HB4A 3QLTA 4Y0VA 3OLVA 4X8HA 3VDQA 3TJZA 3RVQA 4MX8A 1NVKA 3AU8A 2WF6A 2CFRA 4KEAA 1HOXA 4OJMX 1XZMA 2M1XA 2ZI7A 2Q2OA 4LNAA 3FQQA 3BSWA 3PA6A 5CITA 2UZIR 1SVIA 4J1QA 5FQOA 4QHYA 4EATA 4D79A 4ACAA 3C6XA 4HNHA 4BQSA 5CYOA 3VR3A 2J3KA 1Z2CA 4I1SA 1R0LA 1AQIA 1Y6ZA 3TTVA 4NZNA 2BEUB 2D2EA 5C44I 1M9NA 4REMA 3R7LA 3UAOA 2QF7A 4H60A 2JFNA 4RD4A 1Y4ZA 1FCJA 1OMOA 2W0MA 3F6EX 4PAWA 3THOA 1Q7TA 2PS9A 3BRQA 4OHMA 1TFUA 1XZKA 1G41A 4EYQA 3QPAA 3ZJ4A 3EIFA 3BS4A 5FP0A 2Q6TA 4N6NA 2FJ0A 3RHTA 2J6AA 5FLXb 1I5OA 4YA6A 4W5RA 3LQFA 4HNVA 2WLSA 2AOVA 1BDIA 4JR1A 2QEXZ 1DKRA 3GMDA 1GUZA 4ZQCB 4F84A 1P0IA 3ASVA 1FDVA 1FF9A 1WUKS 2QKDA 1Y3IA 4MRSA 1AH2A 1GNQA 2KSQA 2XF8A 1WUIS 1UKBA 3HCWA 4QJ3A 5GZ3A 1W2HA 3IVAA 1KO5A 1LSOA 2YINC 3DDSA 1IJEA 5HILA 2JIRA 1XAJA 3L7DA 1T8TA 5C9ZA 4KAJA 2IUFA 3QMPA 4U7FA 4NOJA 1CQJB 3BMNB 3G2PA 5CDHA 2YJ3A 3KYJB 3ZIDA 4QFDA 5ALWA 1X92A 1K8QA 3BD9A 1PJZA 1QIKA 5CM2Z 3MJCA 5FH9A 5DKFA 3WGZA 5FO1A 1WXEA 1Z06A 4JQOA 5AUQA 2VF2A 3H17A 4KKVA 1PGJA 5ALFA 3AUTA 4MCIA 1QX4A 3OSUA 3QVVA 2WWYA 1C3XA 2IXBA 3HU5A 1XC7A 2ZIXA 3OQ1A 1M2KA 4WFQA 1SC1A 4PXAA 1A8PA 1KFBB 5G40A 3B1VA 3SKXA 4DMRA 4AS3A 2ZEJA 3G7NA 5AIAA 4OHYA 3KZXA 2R1ZA 3QVXA 4N8SA 1KAMA 4ALKA 1TMKA 2BEWA 2QDXA 1Z5UA 4N3GA 3CS3A 3TE5B 1PJRA 4Y2TA 5C3UA 5A4KA 1R6BX 1Y1PA 4NFRA 2VNAA 3BGDA 3N8DA 2R8ZA 2OCYC 1KZ6A 2O5VA 3AUXA 3EFEA 3PCRB 1LF5A 5LZ7A 3UK7A 3W78A 3O8RA 2ZWVA 3HV2A 1XZBA 4LHXA 4OQLA 4QGFA 4QRHA 1CZUA 2JAPA 2YUTA 3GTKI 3PCTA 1IZZA 1X7YA 1XDUA 3DMGA 4C05A 2CC2A 1YDFA 1ZD9A 5H70A 1LPPA 1EQAA 3FTQA 4FNAA 4OF4A 3VHXB 1QG6A 1V41E 1A9YA 1M3SA 2ZWPA 4JHLA 5BVGA 5K0BA 2QM8A 4MR8A 4P7GA 1M8PA 3G8DA 1F4VA 2DHQA 1J8FA 2G70A 3K3PA 1A8HA 4JFAA 4MLDA 3GC6A 4BEBA 5KU7A 4JVOA 1N5LA 3ZXUB 1ZVKA 3KYCA 4HVCA 2MSWA 4Q6BA 3Q4GA 1GGMA 4ISCA 3UA3A 2GJ9A 3NEJA 4DK1A 2J0VA 5B4TA 2EG9A 1K6MA 3GT0A 1OGYA 2Y93A 4YGYA 3WGQA 1J97A 1NXVA 4YVFA 2RHOA 2YYAA 3CC2Z 1R74A 2WF9A 2WPDD 1W8IA 3KZKA 4AZTA 3TXXA 1MG5A 5AM3A 3HEMA 4ND8A 1H1TA 1UJCA 3ICOA 1JLKA 3PUKA 1I14A 4HBGA 3RS4A 3FGZA 1RM3A 2GUWA 1R50A 2QL6A 2I6SA 1R5BA 4IJVA 2C3YA 4UEWA 4E11A 4M21A 2XDQB 2XD9A 3HA2A 4EGJA 1CRPA 1QFJA 1EX6A 4OBXA 2RK4A 2V0NA 1P3Y1 3DAPA 1U02A 1BGVA 2IUTA 3KLBA 4MWDA 5FPHA 2RAVA 5HKKD 2V9PA 5AVJA 3WV5A 1RMYA 1WQ3A 1N0HA 1E7SA 4KREA 2ILVA 4RWEA 1ZMBA 1Q14A 3DVAA 2GM3A 2PWPA 2Y99A 3BDAA 3D59A 3VPGA 4D82A 2J31A 1H65A 2Y05A 3PD7A 2QRHA 1XCLA 5CM8B 4ARVA 1Z0AA 5JYCA 1R9MA 3BXPA 4D4HA 4K9NA 4RLSA 2NXNA 3SICE 4EJSC 5FWXB 5K8IA 2IZ7A 1B73A 1WPGA 2P2YA 2ECFA 2W6JD 2X19A 4L4RA 4LJ8A 1FIUA 4NCBA 2NZ2A 5L51A 1QDEA 4UE2A 1DC7A 1Q2XA 3RH0A 2A9KA 1HEYA 4CDMA 3THWA 4PONA 4FGKA 4D9NA 5KNBA 3D1LA 3LW7A 3PGA1 5EUCA 3ZGVA 4IJUA 3ESBA 3L7NA 3PBKA 1YJWZ 1F48A 1UIRA 2PCLA 3QVJA 5UKDA 4EYEA 3V7UA 4DLSA 3ZK9A 5DWVA 3UKOA 1Y3FE 5BOVA 4TXHA 1J70A 2PK7A 1MQAA 2W83A 1Y9AA 3I6IA 1EDDA 1DWUA 1OA1A 2FPGA 2ORED 1E2FA 2RAUA 4WKGA 3J7AC 3QVWA 2BGUA 2OK7A 3TPZA 2GHRA 2EBWA 2P9BA 1R0KA 2J3LA 3MS4A 2GCOA 4PO9A 5DN9A 1RZRA 1N5OX 3WJ7A 3UTCA 1ZWKA 4H3VA 1UOPA 1ST3A 2IHBA 5ILQA 1D5CA 5C8YB 3WR5A 3TUJC 4W1QA 1W47A 1DUVG 1TE2A 4ON9A 5KC9A 2AFHE 3ROFA 1XCBA 2C8JA 3GEPA 4OHPA 3AO0B 4B83A 2VPZA 2AOTB 3TZLA 3AL3A 3E5NA 2O8DA 1LPSA 3NX4A 4LZWA 4K9SA 2CLIB 4FGLA 2A30A 1N3IA 4DMMA 3KOZA 4FQ7A 1TT7A 1AKEA 1YQQA 2NNWB 1REQB 2CNOA 1KMHB 2W4IA 4H31A 3QE2A 2FG7C 2AI1A 3VNQA 2H1LA 1NONA 3D3NA 3VMGA 1DE0A 3MS7A 3K6KA 3L77A 3WGLA 1OI2A 3L4BA 4KO3S 1XZNA 4F4HA 5CDFA 1LI4A 3OF2A 1MDFA 1VPLA 3HPQA 3IQIX 3HP1A 1HE3A 1NN3A 2FPOA 2PR2A 2YXPX 3I6MA 3TR0A 4A0GA 1KO8A 1HL3A 4M46A 2I80A 4WWHA 1ECFA 3HSKA 2XWSA 4QE3A 2V45A 3BMCA 1A95A 5LLTA 5AQEA 3OU6A 1MGOA 3NOOA 4F8EA 1KSFX 3DKRA 5AJWA 2B3TA 1N5KA 1OI7A 3CCJZ 4CV1A 2PT9A 1OREA 3FYTA 3JWGA 3LT2A 3W8NA 3WMXA 2BM8A 1MA0A 4HLNA 3QKTA 4B2IA 3ZJ5A 4E7PA 4M1YA 4EKNB 4O4HA 3MIZA 4DG9A 5LMUB 3O5AA 3TFOA 2DSTA 1N8NA 2CXRA 1B16A 4MGKR 5DE3A 4H1TA 5GP1A 4CGZA 3ZLTA 2Y76A 2PXXA 3UICA 5IXJA 4W9NA 3JQ8A 2LE0A 4J7AA 16PKA 2JCSA 2WU4A 3NOXA 4KR9A 5DI3B 2G9RA 1ZS9A 4YCLA 4C7JA 1EWVA 4OLJA 4IEIA 2ZREA 3NAZA 3KEFA 4M1EA 2ZSAA 1M6NA 1RT9A 1MEOA 2P9FA 3R9XA 2XI4A 1FZTA 4XASA 4KR6A 1PV2A 2IA5A 4BNNA 3LG2A 3AI7A 2X15A 4M8KA 1XZEA 2QN9A 2B3DA 2Y4OA 3UXMA 4X65B 1I3NA 3LU1A 1A8IA 1INLA 1ONPA 2B37A 2ZJ0A 1VQLZ 1Y1WI 1Q91A 3DLTA 3I4NI 4GI7A 5DHUA 3W8EA 2BJHA 2DE6A 4U2KA 4EX7A 1QE5A 3IUQA 4DDTA 2C7OA 2IIQA 1XYVA 3DO6A 4ZAZA 4KG7A 1DQYA 1WMAA 5ER6A 4E21A 3R9IA 5IP7I 4QBHA 3GUHA 2RG1A 3O95A 1VA5A 4NENB 3FZQA 4HFNA 3QVGA 4U2EA 3VKFA 3WIUA 2VRBA 3C5WP 3MRTA 3OJEA 3SZLA 4JKIA 4BVJA 4JJ6A 4X44A 3FYDA 3MQ2A 4EOGA 1AKMA 1DAOA 4YMLA 3GVIA 2E2WA 5K3SA 3NAGA 2KHZA 3QKWA 3CUWA 4KAXA 4M1SA 1C0EA 1T13A 5K99A 2Z9BA 5A9SA 3TOVA 5DZSA 3D6VA 4INPA 4TSRA 1EXMA 4ARCA 4RPGA 5EWLA 3AI3A 1T9BA 1KI2A 2WFLA 3JS5A 2TS1A 2O4HA 1K9SA 1RRGA 1O6CA 1TK2A 3Q41A 2I78A 3RFTA 3SZOA 4ABYA 3VVBA 3QEAZ 4LF5B 3I0ZA 2OOXB 1K4KA 2QPAA 3L6CA 4J03A 5D7BA 1F2TB 2PG3A 4UPEA 3UAGA 4UFPA 3HYNA 3OF5A 3TSYA 3TYXA 5K0CA 4HEA6 4AQ7A 1GTL1 1QDUA 3FRHA 3IA7A 4RVHA 2IV3A 1OSNA 3W6ZA 1S3SA 3B5EA 4CKEA 3DT6A 4ENTA 1T2CA 1VKNA 3U0BA 2EWMA 4RULA 2VBCA 3BJIC 1KZYC 4KUGA 4O4JF 5K5EA 3AU9A 4RM2A 3WDMA 4AB1A 3TLYA 2HCRA 4J3NA 3VR6A 3ZGYA 1BTOA 4ZO7A 2OGTA 4HNRA 4MUYA 2LGJA 1CUWA 3LECA 2BGIA 5ICMA 3CC7Z 3Q3JB 4UDYX 5DK4A 2OMEA 5AW3A 3FYUC 5FOWA 3ZDAA 1V26A 1DAFA 2CJYA 3WAKA 3FNGA 3R7NA 1ULTA 2WUFA 1CU1A 3FWZA 3UF0A 5IJ0A 1GL9B 3A58B 3VSCA 1EP9A 5KNCD 4EKGA 8AT1A 1UH5A 2RARA 3DB1A 4UBNA 5KNCH 4A5SA 5FTJA 1QMPA 1NUQA 3QVKA 3ZWPA 1H1LA 1XZHA 3EXFB 1IXSB 1H2EA 4JJ4A 2VNSA 4ZVNA 4J49A 2FFHA 4YRZA 4CEJB 2GFQA 1HH4A 3IUYA 1UZMA 3ZNOA 3R7DA 5JR3A 1HMYA 3MJDA 2R6ZA 4DZRA 1SUFA 1SAYA 1PF7E 3IULA 2EL7A 2BKVA 5AOVA 1CUAA 1PFVA 4YP1A 1OI4A 3SYRA 4XUGB 4XD7A 1O96A 4JROA 5JCZA 3GHHA 2WFMA 4JP3A 5HGXA 2A9PA 2JJ2A 3LI2A 4JL6A 1EFVB 4TLCA 1CVLA 4EA9A 5M3BA 4P0PB 5FUVA 1ZMOA 3GN1A 3QK7A 1XXHA 3KPJA 3V4PB 5FUQA 2UYOA 5EXPA 3GCGA 3LFUA 1KPGA 1TWGI 3QLUA 621PA 3FTFA 3HKEB 4IL5A 2HO4A 3ID6C 1YQDA 2HZ7A 3UAXA 4LHSA 1N8SA 2OZKA 4DB4A 3Q1KA 2BM0A 3AF4A 4M1MA 3VKGA 1Z56C 3ZW8A 4LWPA 2QUHA 4P7JA 4I9GA 2EKLA 3JASA 3L8YA 4N39A 2GYUA 4GKBA 4QBTA 3C43A 3RC1A 2QSJA 3R6WA 3RRMA 4IQ4A 3C87A 1C9YA 1RYFA 2QUAA 4GR4A 5DULA 3E5MA 3UPDA 1W34A 2L18A 3T3IA 2F00A 3DOEA 2X1LA 4JR2A 4NJMB 2RBGA 2E9SA 3M4ZA 3ZU6A 3BMQA 2R11A 2DR3A 1A50B 3K6RA 1UM8A 3G9UA 4F2DA 1SXJC 2YRFA 3PE4A 1KE1A 3DHVA 5BV7A 1H2ZA 1UOQA 1MAUA 3KQSA 2KS6A 2WMOB 2IXAA 4G6ZA 4RKQA 1VPDA 4XFKA 3DLPX 5CNKA 4KWCA 1PP4A 2JJ1A 3EW9A 3M1LA 1E2KA 2FZLA 4R3NA 4NBKA 4WXYB 4DDMA 4RE6A 2M6NA 1OX5A 2HQ1A 5ADUS 1EXDA 3EFOB 1OFTA 2HLNA 3ZE0B 4C4PA 4LTDA 2DQKA 3G85A 2D8MA 2Z83A 4YMGA 1OBOA 2BZ0A 2HNKA 3DV0A 4A15A 4WECA 1NA5A 3BSYA 2JH9A 2IW1A 1AB5A 5FNVB 5JJLA 3DE5X 1ZEJA 3JQ9C 2CJWB 1YJ8A 2JFYA 1SA0B 2QENA 4MB2A 3ZDCA 2ZZNA 1OKKD 1C8BA 3D8SA 1FVFA 3WL5A 3ZHUA 4BPBA 4QJBA 1L1EA 1D1PA 2FX5A 4JYBA 4YAOA 1VLMA 3SE7A 2DQYA 3VU3A 4JBYA 4BQRA 3B8EA 2EEZA 3PHJA 5KYYB 3NWBA 3OF3A 5TEVA 1N7IA 1EVLA 3V4LA 4WH0A 1GU1A 1QFXA 4QLAA 3KX2A 1N1EA 5AKHA 1N32B 1FFGA 3GLHE 1PWYE 1NP7A 4AY5A 2EFYA 4LJSA 3UB2A 3IA2A 3QKSB 4F3CA 4J0IA 5H3LA 3D2CA 4AJKA 1R5JA 1R6UA 1D2MA 4O29A 1JKFA 3ISVA 1V8PA 1W0KD 2YWGA 3I12A 3GLVA 1S3GA 4LSWA 2HU2A 4WY5A 4QJ4A 4YJFB 5F5XA 1M8FA 5E4TA 2VH5R 1M8KA 1QAOA 3MNFA 4QOGA 4RTQA 1A9XA 3ESQA 3LL4A 1PFWA 2ZP1A 4I55B 2Y0DA 3G6E1 2M6RA 2RHJA 2WZCA 3I2YX 3LP6A 1CF9A 3IJPA 4TS1A 1KOGA 3NBAA 1DO8A 3EZFA 2FR0A 3IIJA 1DL5A 1R27A 4PGFA 3A3NA 3HOWI 3RC2A 4E08A 4G24A 4AKHA 1NKTA 2HK7A 3GPDG 3C85A 1C3EA 5EHNA 3W1EA 2IHZA 3LK7A 3CJQA 3RVRA 2VJKA 2ZJAA 4TXJA 2FMFA 5AKLA 2DRIA 4V0SA 3DEIA 4DA9A 3U0VA 1M901 1UWVA 5I3ZA 1AGXA 1WHTB 1V6SA 2A67A 4AG6A 3I2IA 3PGVA 1Q1QA 5DX0A 2VHWA 1FUKA 2NZJA 1A97A 2VIIA 2HU7A 4UHJA 1NAIA 1XQWA 4O1MA 4O8ZA 3RC3A 4MQ6A 5JSHA 1N8R2 1BJRE 4HG2A 4QOSA 4LF9B 1PZHA 4PFKA 2VSXA 4NV3A 5TPWB 2X0EA 1W9MA 1FSFA 2I8AA 4RIEA 1M54A 4L28A 3DUFB 1SKBA 3F49S 4HDKA 2LV8A 1RBQA 2EWWA 3H1PA 3W3AD 4DV0B 3W3AH 4GP6A 1A8QA 4QGBA 1IFXA 1I9GA 2G28A 3P9RA 1Q74A 4TMKA 4ADSG 1A69A 5IW8A 3QOYA 3BEDA 1OH6A 2XR1A 1LNZA 2W90A 3EXG1 5F1OA 1MP0A 2WTAA 1SULA 2GPTA 1QP8A 2Q3DA 2QZ4A 3CNQS 2VP3A 3EEFA 4MR7B 3UWDA 2PJZA 2NGRA 2IPMA 4JU9A 2PZFA 1PTKA 3AB7A 3K05A 4K03A 2BEKA 1Z4MA 2CLCX 4P33A 5AW6A 2HBQA 4H7DA 2Z2XA 2YYZA 1D2RA 3NWEA 4I46A 2OFFA 1BD3A 2R0QC 1MNAA 1KYZA 4MR9A 4Q9JA 4Z8YA 2V55B 3IC5A 3JQEA 1B0ZA 3W7BA 2G9VA 1HG0A 3QZUA 4NY1A 2R4UA 4PO1A 1G8PA 1F9AA 1NJ5A 4EENA 3DXZA 1N2IA 4H3HB 4Q39A 1Z7WA 2AV6A 2Q50A 4MUXA 2IIBA 1MJGM 1H3FA 3AM3A 3MN1A 3IH5A 3W34A 4YMHA 5TMBA 3O9MA 3RVBA 4Q1CA 1YE5A 3JVEA 4PC2A 1FLDA 2Q3CA 1H4SA 1XAIA 4NBHA 4TTJA 4CCSA 2BCEA 3LLMA 3LX6A 2VJMA 5BN3A 3RZOI 1P5ZB 2NUPA 5F7OA 2IL1A 3KUKA 4HEA1 1MRZA 2QIOA 2MSDB 2WUDA 3B6EA 2MWMA 4IIDA 3ZBQA 5K8UA 1GTRA 1V11A 3HCAA 3PSHA 1SNYA 1X74A 2Q0XA 4PTZA 1V8BA 4ZP1A 4A3II 5FBRB 5E95A 3IVCA 3H05A 5BRNA 4ZYXA 2XXAA 4OH1A 2E4ZA 3ENKA 3CCM1 4DCMA 5HQTA 2YHBA 2LTAA 4GC9A 4LBZA 3W05A 5H80A 4BB0A 3W5SA 3ZZTA 3EGXA 3GRAA 4C08A 4AL4A 1DAEA 4QULA 1YS1X 2V6BA 3BG5A 2A86A 4YY3B 3HU1A 3KK0A 3PWZA 3VTZA 1JG2A 4DILA 4EJMA 2XOKD 4JWKA 3RJ9A 1ZH4A 1AHPA 1EDBA 5E1MA 3SS7X 3AI1A 5IKMA 4K2AA 5CFMA 3A3YA 1SB8A 2QNIA 3RS8A 1ZIDA 2VR1A 3BXXA 4FT4A 4ND3A 2Q3FA 4LOKA 4UASA 2WWIA 5J63A 4KRGA 4ARZB 2ON6A 4PFSA 3IPYA 5K6AA 5LQUA 1WCMI 2C2YA 1AIPA 3GUZA 3KQPA 4L8LA 4K87A 3P5JB 2JFBA 3GMSA 2DSNA 3NHFA 4D8VA 3GWGA 2C9ZA 2GPSA 2A1IA 4NNPA 1JE0A 4ZQEA 4Z1MA 1R16A 3X1YA 5C18A 5DYYA 3F3MA 2R1TA 1FSZA 4KXYA 1PJ2A 2ODTX 4AO6A 4FYYA 2R7MA 4ENPA 1VQ71 4IDNA 5FX2A 3F4LA 3MZKB 3VC1A 4BBRI 4S1NA 2ZSIA 4WDQA 3V32A 1EBFA 1T5IA 1KNQA 1GCGA 4F6CA 4QU0A 1PD0A 3CVJA 1TZ2A 3R76A 1ENZA 4ZKDA 2Y1EA 1JR6A 2REQB 2DHCA 4EPYA 3RK4A 2NACA 2XVYA 3GFSA 4N8DA 5GWXA 1MOPA 3EAGA 3NFYA 2B61A 2YWBA 4K05A 4ZC8A 3CJRA 3FY4A 4KVAA 4PCVA 4BRUA 3OQNA 4FKBA 4HQFA 2H5JA 1Z6GA 4FDLA 2CDNA 5HUJA 3GQBA 4WI1A 1B3RA 5KYGA 3FSEA 1YOBA 2RMKA 3P4UA 1JG7A 3WS7A 2W2KA 2JVJA 2O9JA 3Q3CA 4MO9A 3PE6A 2COKA 4K40A 3KELA 2W6OA 3DMDA 5IAEA 4ZI5A 1TYAE 4UNRA 2F1IA 2WHQA 2R68A 3FDZA 3OD1A 4KFTA 5JO9A 5T5QA 2IPOA 3O92A 5DLPA 4BV3A 1WCWA 2GD6A 4ZMRA 3KEOA 3G0DA 4YNBA 4O4JA 3MUOA 3GLFE 3UNXA 1GYQA 2Q6KA 1Q92A 3FPLA 3FMOB 3IBCA 4I1VA 2DY1A 5EFZA 5J4VA 1YB1A 4L2IA 1PJLA 1DJOA 4LOAA 5L53A 1QRSA 3TQOA 1J09A 4YCBA 3USCS 1HORA 4URWR 1SZDA 2MR5A 1QAQA 2JFQA 1RS0A 4K9QA 7REQB 4AMZA 2DQSA 1COZA 2WV7A 3DPUA 3OZIA 4PZLA 4AXXA 2GGSA 3S16I 2D5AA 4DGQA 3Q2OA 3N0WA 4OQYA 1QP4A 3Q11A 1FLVA 1KIAA 1O54A 3UJ7A 2XT6A 2GRUA 2C3OA 4PZPA 1VBFA 1YL7A 3HYSA 3CURA 4PF1A 2XX3A 2POQX 2Z2ZA 3A9UA 2NUAB 4EF6A 4P38A 1XCMA 2NT3A 4QUIA 1FFWA 2HN9A 3Q7TA 2D06A 1Z8HA 3RVNA 1P8AA 1OXKB 3DC7A 4EPRA 4GZMA 1YF3A 2XUIA 2ID7A 5SZJA 5JATA 4P36A 4K81B 5E4JA 2H4JA 3V8MA 3I9LA 5J5VA 3WWYA 4HX9A 4MRIA 1IHUA 2RDMA 2CHFA 1OXVA 2Q4BA 3CX6A 4KC0A 4CIXA 4DEXA 3I6YA 3OZFA 4YWJA 1JDBB 2VTKA 3STWA 1ES9A 1KZ4A 4C6HA 2QV7A 5LYYA 2CB0A 1NY5A 4RNDB 4KR3A 3IMCA 1LJUA 2Q1TA 4ZCIA 4W5WA 5JHHB 2JBHA 3HJCA 1EDZA 2I65A 3II6X 5CMLA 3URMA 4ZYTA 4LC9A 5DTMA 2GHIA 5ICFA 5B3KA 3PFHA 1ZOPA 2G2KA 5D1OA 1JSLA 1L7PA 3KIHA 1S2GA 1X39A 2A4MA 2UZ1B 1YI2Z 2V7UA 3EDCA 4XYLA 4ROSA 5EA2A 3NIFB 5ELXA 1BQ4A 1E2EA 3JD4A 3DXYA 3F74A 3U44A 3MRXA 4ZVPA 1JALA 4NHOA 4KLAA 3T9EA 2XXAB 3PWSA 3V9PA 3L0PA 2CN1A 4B8YA 3GOQA 4ARSA 1W6UA 4YXWA 1V1MB 1WWKA 1W46A 3D81A 2Q5EA 4OK3A 3S28A 3WMRA 3QVMA 2NYVA 2O8BA 1IHPA 2NQTA 1VIYA 2FK7A 3PQ4A 4GGMX 3LWZA 4PYKA 4HDAA 1IG3A 1C29B 5FLMI 1U5BB 3I5AA 3IDFA 4LISA 4Q4HA 5KHLB 1UK8A 1KPHA 3G82C 2F59A 1YGPA 3AB8A 1M34E 3NHMA 3N05A 4H7PA 3FNRA 4DQKA 4CXMA 2V0CA 1FP2A 4RANA 5F9MA 2PMDA 4E2XA 4BMPB 1FRZA 3DEAA 3GDWA 4MJ3A 1CNEA 1ZGAA 2BLNA 3OPQA 4NBNA 1V7ZA 2O53A 5E38A 4YREA 3WSVA 1WB9A 5EHQA 1MH9A 3ZD6A 1OU4A 1IBCA 1YA8A 3D43A 4X5OA 1JIUA 3MUFA 3SI7A 1CPYA 5DWQA 2ZYAA 4PHGA 5F12A 4GMDA 5J2TB 4O2AB 2OHXA 5TC4A 4RE5A 3AUJB 4BECA 1M6WA 3SX0A 3WJAA 2Q3BA 2IXGA 1DB3A 5AKYA 5BSEA 4EBFA 2XCLA 2Q1XA 3C3AA 2QLBA 3G1TA 2GN9A 1HFWA 1WOYA 1NMXA 3LBNA 3WYAA 2WPNA 4R1NA 5HR5A 4O0MA 2Z9CA 3GJ5A 1C9JA 4CG3A 2ORYA 1F6WA 1SEPA 2R7ZI 2NT4A 5ESRA 3VZCA 2OCGA 1U63A 2HPVA 1GP2A 1IZ8A 3I5UA 2APJA 1X7DA 1ISPA 2FEMA 1XTUA 3N2YA 2TECE 5IKOA 3TQHA 4B2YA 5L3QB 1YCDA 1I6HI 1E4YA 2GBFA 5AM2A 2X4IA 2OD7A 3ZV3A 5BORA 2Q3EA 1ENYA 4KO4S 3S15I 2YJTD 4IW3B 2ACEA 5HM8A 1KI4A 3Q3VA 3L93A 5FWYA 1Q20A 3S0JA 3E7PA 3IO5A 5CIWA 3SJBA 1JFTA 1Z7YA 1SR8A 1T9DA 3LC1O 1NR1A 1SUBA 3GU3A 3BOSA 3JQAB 2X2FA 3HKDA 3OTWA 1KEPA 1QLJA 1T2DA 2NSJA 2YXNA 3AIIA 3EIHA 2IYTA 3M6WA 3STXA 3UK2A 3BREA 3OCVA 3ZCSA 5J5AA 3GAMA 3M1IA 3U4GA 3D7KA 5BMVF 4DLLA 4X1IB 5FUWA 2YS7A 3IQGX 5AM1A 3GYBA 3S4YA 2DF8A 3ZS8A 4D5GA 4L0CA 3SYMA 2YY5A 1VG8A 5EHZA 1Z2EA 3FPGA 1X87A 4JLOA 3TLAA 3E9RA 1JLLA 5KDOA 2FPUA 2HA7A 4JT8A 3T5BA 5AXDA 1PDWA 5EZYA 1IULA 3PU6A 1NKVA 1NLYA 4MWEA 4RIFA 4BZWA 1U1IA 2V7VA 3IP9A 1YBHA 5SYAA 3ZIUA 1N78A 1TM5E 1JQAA 2BTQA 4IOKA 1JJBA 3LLUA 3SE0A 2DQZA 4BQEA 3P9SA 5EI5A 4X0EA 4AYTA 4CETA 3ROTA 4CF4A 4D7AA 3BD6A 3KDSE 4ZZIA 1D6MA 4N3CA 1ZRNA 2OCPA 1J22A 1RRPA 4N0QA 3Q10A 1J7JA 3T7IA 4NYIQ 4QKQA 3PJRA 4S1VA 3HFRA 4I8XA 4H4DA 5JIBA 4MV3A 1PJSA 1FNSA 3TW4A 4WMLA 1L5OA 4B7XA 1BWPA 4N01A 5BWLA 1DC5A 1E98A 1YL6A 1FTSA 1NJ6A 2VBFA 3NP9A 3KFLA 1XLTC 4G4SO 4MIYA 3F97A 3P0JA 4KXVA 3DFKA 1EA5A 1XYYA 1CY4A 1MVNA 1V4NA 1N0IA 3V7WA 3AZOA 3GRFA 4RVDA 1IHOA 1X8JA 4A3LI 1XDSA 2PRSA 3EEDA 1DBWA 1SC3A 3C4JA 3GO4A 3NYQA 1RO2A 3PDIB 4KR0A 1JPNA 3K5HA 2R5FA 1RPNA 1B8PA 2HIGA 4UAUA 3D4OA 3D8RA 4X1KB 1M7HA 3ZHYA 3GLIA 1TWFI 5JT1A 3B52X 4RPCA 3C3KA 3RSLA 4RORA 1FTQA 4LI0A 1E7QA 3W5BA 1J9ZA 3E4CA 3QFRA 2HWXA 3V7NA 3HCNA 1AM4D 5B2EA 2HTFA 1WD7A 3KTOA 3FX2A 4J9VA 4ZEWA 4IMRA 5G1OA 4KE8A 1XZJA 3HY4A 5J43A 3OLZA 4OYRA 2I3CA 5C5DA 4O4JB 3UN1A 4Q66C 4FZ5A 1OWLA 3E82A 4RD3A 2GZ3A 2D3WA 1M0SA 1VYTA 1EP2B 2A0XA 1H6CA 4D5EA 3OMXA 1G21A 3AR3A 1B8NA 2C4UA 1VL8A 5BSGA 3R7WA 4B85A 2RGYA 1JX6A 1RHQA 3AM4A 1WZUA 4RK1A 3TGWA 4F5ZA 2OVBA 1RLJA 1JB9A 1P4SA 1SG9A 2UKDA 2YZGA 1ZMTA 1OC2A 4GUAA 1FFDA 4RK7A 2W4QA 3MD9A 1MJGA 4QEDA 1SUCA 1FK8A 4X3CA 3QMWA 2QSYA 4A9AA 1E5VA 4WZBE 3B48A 1NUAA 4IF6A 2CXSA 1IMOA 2I3ZA 4L6CA 1CJTC 1JHUA 5JVDA 2WV9A 1Z33A 1I3LA 3BM5A 3BRWA 3STVA 5KYNA 4GOOD 1U9CA 2MINB 4RHFA 1MNQA 2WF5A 4IGAA 2YU9I 4C6SA 4CW7A 2JLYA 5JC8A 2X2OA 3JAWA 5E7JA 1VBNA 1W76A 4PC3A 3T38A 3N8HA 3GQVA 4PVCA 2A4KA 3TCXB 2VNJA 3ICPA 3ZXSA 2PH7A 1BMFD 5D86A 4E46A 2PBLA 3VVMA 3ODPA 2JGAA 4L16A 1WM1A 1WCV1 4CV2A 3U4QB 2BFFB 1XMJA 1SHTX 1TX4B 2OOSA 3OEWA 2VWPA 4FMCF 1CKEA 3T1VA 1GD1O 4ESVA 2O54A 1Q0LA 1U04A 3BDVA 1N7GA 3ETHA 4HWRA 5LL6P 3THYB 2Q62A 4TM8A 2PAAA 1P0CA 3TIXB 2JHPA 1JIJA 2IIPA 3HO8A 5TB5A 1MC8A 4YDQA 2J32A 5I47A 4P4UA 5HWSA 2Q5IA 3AY7A 4QATA 1F3LA 2BVNA 2Z5FA 2F1JA 1UEJA 2VVTA 1U5AA 5IULC 3IEPA 3TKYA 2JB9A 2CHGA 3P32A 3W9SA 5BT8A 5DTQA 1X14A 3ZLUA 3F7TA 1NLFA 1TAHA 1YB4A 2RGAA 3T7AA 3RU2A 5CBPB 1GXSB 1S5PA 1XTBA 4G97A 4JNCA 4GYJA 1G291 2I4LA 2PWZA 3SVZA 5ED4A 1YI0A 2C3MA 1QIEA 2ZSEA 4XKJA 4YB8A 2II6A 3JATB 3JZMA 1A2KC 2KX7A 4Y2SA 3M4XA 1I30A 1N9GB 2H1IA 2E82A 4I1YA 3FROA 5GADl 1IM5A 1L8QA 1LBEA 3T99A 2O2XA 2N1MA 3S5JA 3OP1A 5AR1A 1QXSA 4KIFA 5C7YA 1OOEA 2JFGA 3VR3D 2ZOSA 3HL4A 2QAGC 3ZY6A 3BRSA 4MVJM 1I7QB 3DZJA 4LG1A 2C9BA 4BN0A 1V95A 3SN6A 1J9GA 1KFCB 1T43A 2ZUSA 1T0UA 1YBAA 3DG9A 2J6IA 4W5JA 2O8CB 3E2IA 1NVMB 1TKCA 1YITZ 2PQMA 3FUXA 3ZDXB 3G0OA 4D46A 2CSUA 1VPTA 4GMXA 2H07A 1B4DA 1DG3A 5CR9A 3EMBA 4KDRA 1D04A 3EWSA 2VAWA 1EFAA 3A3PA 4RF5A 1M6EX 4KFUA 4DDHA 5F9FA 2R62A 3L18A 1M1NA 5ERGB 4ARUA 4BFYA 4DMHA 3L4JA 2QLNA 2XF2A 3C5CA 2K87A 4HEJA 4O2RA 2PX3A 1ZJZA 4XTRA 5FNZA 3LGSA 5A4AA 2ZUCA 1XVAA 1E63A 1BVUA 4BWFB 4GR9A 5BSVA 2G80A 1J5EB 2F8TA 4BNFA 1XQ9A 4NZYA 1CEQA 2EGHA 2P65A 3N6VA 3P8ZA 2HRQA 3NT4A 3DBHA 1H85A 2BE7A 4PCUA 4IKOA 4YFVA 2ONCA 5HIMA 1O5TA 2AYZA 4AJNA 5KJFA 2A57A 2EQBA 3ZPXA 3IVRA 9LDBA 4R6XA 4LQ4A 2VHVA 4ZV7A 1Z0SA 4G1BA 3DW1X 3QHAA 4RTJA 4L85A 3WL4A 1T8SA 1X77A 2OTCA 4KAFA 5KQRA 3HP4A 1VBMA 2IU4A 4BX8A 3GZNA 2O3SA 3MTAA 5TDHA 2QXTA 4ARAA 1XQXA 5JLJA 4M22A 3TDKA 1R00A 2ZKLA 4NB8A 4G89A 1D4AA 1UPTA 1A8UA 2VDWB 4JUBA 1WTAA 4ZTBA 3I2HA 1F17A 4C7MA 2KYRA