The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
76
|
sequence length |
347
|
structure length |
341
|
Chain Sequence |
b'SGLENIAFNVVNKGSFVSADGELPVAISGDKVFVRDGNTDNLVFVNKTSLPTNIAFELFAKRKVGLTPPLSILKNLGVVATYKFVLWDYEAERPLTSFTKSVCGYTDFAEDVCTCYDNSIQGSYERFTLSTNAVLFSATAVKAGGKSLPAIKLNFGMLNGNAIATVIKNINWFVYVRKDGKPVDHYDGFYTQGRNLQDFLPRSTMEEDFLNMDMGVFIQKYGLEDFNFEHVVYGDVSKTTLGGLHLSISQVRLSKMGILKAEEFVAASDITLKCCTVTYLNDPSSKTVCTYMDLLLDDFVSVLKSLDLTVVSKVHEVIIDNKPWRWMLWCKDNAVATFYPQ'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Uridylate-specific endoribonuclease
|
molecule tags |
Hydrolase
|
source organism |
Human coronavirus 229e
|
publication title |
Crystal structure and mutational analysis of the endoribonuclease from human coronavirus 229E
rcsb |
total genus |
76
|
structure length |
341
|
sequence length |
347
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature |
ec
2.7.7.48: RNA-directed RNA polymerase. |
pdb deposition date | 2014-11-06 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Single Sheet | N-terminal domain of TfIIb | N-terminal domain of TfIIb | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |