4RS4A

Crystal structure and mutational analysis of the endoribonuclease from human coronavirus 229e
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
347
structure length
341
Chain Sequence
SGLENIAFNVVNKGSFVSADGELPVAISGDKVFVRDGNTDNLVFVNKTSLPTNIAFELFAKRKVGLTPPLSILKNLGVVATYKFVLWDYEAERPLTSFTKSVCGYTDFAEDVCTCYDNSIQGSYERFTLSTNAVLFSATAVKAGGKSLPAIKLNFGMLNGNAIATVIKNINWFVYVRKDGKPVDHYDGFYTQGRNLQDFLPRSTMEEDFLNMDMGVFIQKYGLEDFNFEHVVYGDVSKTTLGGLHLSISQVRLSKMGILKAEEFVAASDITLKCCTVTYLNDPSSKTVCTYMDLLLDDFVSVLKSLDLTVVSKVHEVIIDNKPWRWMLWCKDNAVATFYPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridylate-specific endoribonuclease
publication title Crystal structure and mutational analysis of the endoribonuclease from human coronavirus 229E
rcsb
source organism Human coronavirus 229e
molecule tags Hydrolase
total genus 76
structure length 341
sequence length 347
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4rs4A01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rs4A02
2GTIA 2RHBA 2H85A 2GTHA 2OZKA 4RS4A 4S1TA
chains in the Genus database with same CATH superfamily
3ZE2B 1XTBA 2CGEA 3KTAB 4ZHSA 3NBFA 4LF5B 5LXTF 3CH5A 3P5BA 5SY4A 2PL5A 4GH5A 4EL5A 2VXYA 3DMFA 4GMGA 4MAFA 4MVJH 4D4HA 2VH2A 5CHYA 1HT2E 4WZAA 5ALSA 4HAIA 3VZCA 3PO3S 2VUGA 3ECCA 3UXYA 3QEBZ 4MARA 1DAPA 2WZQA 2YVAA 4QEKA 2WHRA 3FIJA 3M6WA 1OR8A 1PSWA 2C7VA 2NUPB 3A2MA 2H3EA 4UNNA 1MB2A 4QWMA 5HIIA 5IARA 4EPVA 2ZZNA 4Q18A 1EMDA 3T1YB 1WDLA 2P5SA 1KDTA 3KWJA 4M0LA 3OJFA 2HXGA 1RKVA 3GDFA 4O4IA 5DYNA 3VVBA 3ESWA 2DBQA 3GFRA 3BSYA 1EJBA 1GHTA 3DF9A 1HQKA 1BFDA 1KEEA 3R75A 1FMLA 1RI5A 4IO0A 2CT8A 2JIBA 3B2EA 1GQ2A 2ZIZA 3BE4A 4LHZA 4W1PA 4XLZA 4AZ0B 4CR7A 3GUHA 4EYSA 1VQNZ 1AHNA 1M76A 3EQ6A 3LBIA 2R8ZA 3M82A 4RHEA 1P8JA 1QO0D 2IYZA 3T7DA 4RC9A 2WR8A 2YMPA 2AI1A 3F6CA 5COAA 3GJ5A 3O26A 2PUVA 3H9EO 4FFSA 1G9TA 1D3AA 1CZLA 1XZHA 2FK8A 1YS7A 2FMXA 3EPHA 4H6XA 1YMUA 2H4WA 2NUTB 2YRXA 1GVNB 3Q3HA 2KJQA 4NOMA 8LDHA 3GLGA 3E2MA 1YVPA 1IHOA 1QORA 1ABEA 4NMHA 2J33A 4MI9A 5K3BA 2JLCA 3ZW7A 4RS3A 2HPZA 3KFVA 3WDSA 2ZUFA 1F3OA 1QV9A 1V9CA 2ANBA 2CE7A 1JUDA 3OZXA 1GPUA 2A1TS 4EW2A 4QA9A 1T8YA 2DY1A 2G4VA 3FTQA 2B63I 4LX8A 3WTCA 1COWA 3S2HI 3B6KA 3SZMA 2L82A 3TOXA 4AWAA 1X7GA 4QIHA 4EYQA 2W8BA 4QGGA 2EFGA 2ODTX 5E9JA 4F84A 1FFEA 2JIOA 1K731 3HCWA 1NV9A 3SX2A 5HP4A 2Z6UA 1R0YA 2GQ0A 4M0MA 1RMYA 3HKCB 2R7AA 2JIDA 3D2CA 2AMJA 5AW1A 4Z54A 4CQJA 2ZE7A 1KMHB 4P4GA 1GZSA 2PM9A 2C04A 5EIFA 1K7FB 1Q57A 3EGCA 4BE9A 1VSBA 3MLAA 3MBIA 4M55A 1C8KA 1SPBS 3Q9UA 4MW4A 1Z02A 4MUGA 2JVJA 4D9NA 5HW0A 3BGIA 5AVUA 2PGNA 1J0BA 1NUAA 3PDHA 1JZQA 1Y3DE 2DUMA 1J6UA 4LJ6A 5HM8A 5L4SA 3NTQA 2E4UA 1A1VA 2A9VA 1EVJA 4RZSA 1G42A 2GM4A 2CD9A 3FLBA 3A4VA 3J81b 5DULA 4KRGA 4DXAA 1H23A 3EGWA 4ZOLB 1KE2A 3ZHVA 1NSFA 4B48A 3U3MA 3DMTA 4PY2A 1K7XB 2PU5A 3H65A 3LWDA 3N87A 1I9GA 4QDJA 4UNQA 3T3EA 3G1TA 2GN9A 5GVSA 1NJGA 1E2EA 1I3OA 4TUYB 4URUR 2MMCA 5EHXA 5LLSA 1O6CA 3KLMX 5KYTA 4NATA 3MAAC 3DTTA 3LQKA 4RY8A 4B71A 3BMOB 2WKQA 3T3GA 1A9RA 1MC4A 2ZSEA 3BL8A 3T54A 3KU4A 4D4IA 3C6MA 1O4WA 3B9BA 3C3YA 3MTIA 1N5KA 3MUEA 4AZWA 1YCFA 4HFMA 2JA8I 2XCUA 2ZU6A 4XGQA 4V1CI 3WMWA 2ORIA 3ABQB 3GHYA 3E8XA 3KNZA 4MCAA 4MVJE 4LDQA 4EJMA 3AFGA 3LRTA 1EUDA 1ZRHA 5A9SA 4TT8A 4NMLA 4LYYA 1MOPA 4Y7CA 1L1RA 2W6NA 3FUUA 4O2BF 5E6RA 3QY9A 5EQFA 5TGZA 3ASZA 2XNJA 3BYZA 4E5VA 4FLFA 4OGKA 3CX4A 1NRWA 3GAFA 1MN6A 7REQB 3NHBA 3RS0A 1VSTA 2YXBA 4I46A 3EIHA 4OH1A 4WBNF 3HRKA 4EMBA 1EP1B 5FF9A 4R8RA 3LW8A 3G85A 3L8CA 4O3FA 4OHKA 1V1MB 5EMMA 3RUAA 1U7ZA 4EO7A 2QLVB 1RD4A 4L16A 1OIWA 2DWUA 2I80A 2NQ8A 4JQZA 2FR1A 1LNSA 1F2TA 1WDWB 2H4FA 5AHKA 4GF5A 2QX9A 4PSAA 3VDRA 3WKCA 4G1CA 2NU6B 3QG5A 3ZVKA 1XJQA 2QN6A 1VQ61 3D2LA 4WZBB 2Q50A 1Z4LA 5IAKA 1IXKA 3D6JA 2KSQA 3GLKA 5IWAB 1KPGA 3PE3A 5ENDA 1ZICA 2FEOA 2HDHA 3L1KA 4PHGA 4QRDA 4BNTA 1D07A 4B6GA 3A3OA 5CNIA 1JSZA 1HLGA 2A0XA 2A86A 2Y0PA 3K92A 4ZYYA 3PEWA 1TWCI 1G21B 5LBIA 1J00A 4XR4A 4FGKA 1WVIA 2AN3A 4AZTA 5BYBA 3NU1A 4TM7A 2QRQA 1G2PA 4L8VA 2BGGA 3P2KA 4DGSA 1FDRA 4LK2A 3A0UA 4ZJZA 3OPXA 4I19A 1X13A 4Q66C 5FWYA 3AUJB 4B6SA 3T3MB 4JJZA 1XA3A 4RTOA 1DFHA 1JR3A 2BFBB 3HDHA 2VUHB 2ZZKA 5IT0A 3VAYA 4FB4A 1CHNA 3FJOA 4KITB 1I3LA 1K1EA 2KM1A 4NMMA 4XX1A 4WXHA 1OMOA 3ADOA 1KMQA 1DL6A 2AYXA 2C9ZA 3O8LA 1JG3A 5EIHA 2QRNA 3TWOA 3VO1A 4U0JA 2CLEB 4J16C 1DS6A 3QKIA 1O9BA 5AO9A 1HM5A 2RI0A 3IPLA 4Q34A 2VHWA 3AFMA 4MRSA 4V1CA 4R5HA 3LC1O 4YCDA 4MVJF 3PNLA 1JU4A 1OFTA 2WJ6A 3DD5A 3PNMA 1IB0A 4N40A 1CDZA 4OXKA 4PZUA 5GV8A 3SS7X 3WLPA 2C7RA 4QGSA 1Y4SA 3I9FA 4QNRA 4TQGA 1N1MA 3SYTA 1QG0A 2M2IA 1GKIA 5DBHX 2UUOA 3RS5A 2W93A 1KK0A 1R3DA 2RGDA 3FCUB 4I9GA 4RK5A 2WU0A 2X19A 3D6FA 3Q88A 3V9AA 2IT1A 4M0KA 5KWVA 3JQAB 3LSYA 2FEMA 1L3CA 1B6GA 1OQAA 1U02A 2WU8A 5AJUA 2NVBA 3B8EA 4LF6B 3R7WB 3HDJA 3MN1A 3OZTA 5T67A 4KMSA 3LYHA 4H77A 5GY7A 4YV7A 3FWNA 2PLWA 4ISBA 1G3RA 1RE0A 3EIWA 5J4KA 3M6XA 5I3CA 3FPKA 3UGJA 4OGFA 2ZPUA 2CBZA 1RJFA 4L78A 5AJVB 1LY1A 1ZO8A 3G7NA 1NMEA 1U7TA 2FGJA 2IYTA 1AQUA 421PA 2ODBA 3IYLW 3N0RA 3F1KA 3BG1B 1XRQA 4ZVQA 8AT1A 5KHAA 4J7AA 3PNBA 3DCYA 3UFXA 1PJRA 4HGPA 1TTTA 4HS4A 1P5JA 3K9WA 4Q3EA 3WLRA 5FBRB 2F9MA 5ER9A 1C7JA 3TCKA 1JEDA 5JASA 4X0EA 1F8GA 1NBOA 4KOAA 3IFUA 1IL0A 1HH4A 2WK1A 4F9GA 2YASA 2R68A 1Z2EA 3HGQA 3S2IA 3SJBA 1YR9A 3EZ6A 4NJMA 2ZWOA 1RQPA 3WFZA 3K4QA 4UHFA 4IICA 3PPYA 5H83A 1DAHA 1SC9A 2KB0A 1Y6RA 4OHZA 2OK7A 3D1LA 2P3LA 4WXRA 2YS7A 2OFOA 3TJMA 3DAPA 2BZSA 3Q6MA 1RMTA 1ZXBA 3KXDA 1TVCA 4Y9SA 3RZOI 3I12A 5CR9A 2PH7A 3TLZA 2A3NA 3ILYA 3S3TA 1QQ5A 1UZLA 3D54D 2UVPA 2CNBA 1ZG3A 2JD1A 3QHAA 4F4HA 1JHRA 3DMPA 4OP1A 1DBSA 5EYPB 3VZRA 3EWIA 4ZFNA 1JLSA 1USIA 1PT6A 2J3IA 1OD6A 3AG5A 3IQFA 1E3IA 2B37A 4FDAA 5F21A 2QSYA 1L7NA 1WXHA 3IP5A 4NCNA 4EHDA 3DLHA 3K7EA 5I7EA 5KWJA 1S5PA 3DEZA 3DYIA 4XIYA 5BVHA 3IEKA 3I2GA 1UPUA 3IL2A 2PK3A 2ZRDA 5JMPA 1NA5A 1YQUA 4NARA 5J2TB 2PIDA 4MUIA 1O9HA 1Z34A 1OBVA 3I6ZA 4X91A 3VZPA 4JLVA 4HVCA 4HEHA 5GP1A 3MWDA 4GI2A 3RT7A 4K05A 4I1IA 1PS9A 3KZXA 2WZCA 4GOND 4CGYA 4AK9A 5KHOC 1NN3A 1PL6A 3PR1A 2VC2B 4INAA 1JR3D 4QNMA 2O50A 4GR4A 4CN8A 4Z49A 5CIQA 4ZARA 4C5BA 5IM4F 5FCDA 3CRQA 1Y1SA 2VIIA 4L6CA 2ZSUA 4EELA 2QMQA 3OC6A 1M2HA 4IKPA 4WK0B 4DF3A 3KKQA 3T3IA 3CJTA 4QRHA 1A8HA 3C7DB 2B4AA 2FPOA 4XQEA 2DP4E 1AHPA 4LIPD 2AZDA 1WW3A 4WK6A 3KETA 4M36A 4B6RA 1RW4A 4OYLA 1AB5A 3O38A 4B4DA 4CKZA 3THXA 2YU9I 3KKLA 3FHJA 2IEYA 1ULAA 2WD7A 3V80A 2ZANA 1F5NA 3G9TA 2W58A 3OHPA 1XKTA 3CCS1 2YOGA 1DDGA 1WRBA 2P4SA 1USPA 4HGYA 1NJ5A 1GITA 2H65A 1D04A 4XWTA 5HE9A 1HQCA 1SMKA 3O1JC 4C78A 4GPIB 1X70A 2X3FA 2JGAA 3OLZA 1Y1VI 1EJ6A 2OCIA 4EHIA 4X65B 4HWPA 4DJFC 4DA4A 3AM5A 5CA1F 4ZT7A 3EUEA 1H2HA 2WWRA 4CI0B 3FBTA 2PT5A 3LVRE 5B1YA 1Y9JA 1WLYA 1YZVA 2ZUSA 3CZAA 1H05A 4X6LA 3FB1A 3W5BA 3U7FB 4BWGA 1G9XA 1YXMA 2JAWA 4KNVA 1O0BA 1RM5A 4ZI2A 1U4NA 1RYDA 3BGWA 3E7DA 4HNHA 4KIWA 3JARA 1FIUA 3OJOA 1J7JA 2QAJA 1XZQA 3EH2A 3FCSB 3L92A 1R9GA 2AJ8A 2OAEA 3PS9A 1CJSA 4RKQA 4DCCA 1ZJYA 5EVCA 4F93B 1E1YA 1A5TA 1IFXA 4OXXA 1DKOA 3UCXA 4Y3UA 1U8AA 3GVXA 3SBXA 1V9SA 3EZLA 3RK0A 1YCHA 2Z2IA 4J1QA 5DNUA 3P9YA 5G40A 3B70A 2O57A 1OB5A 2GTHA 2UYGA 1F2DA 5DH9A 4BQNA 1V2GA 3IBGA 4F96A 4TZ6A 1QH1A 1KO1A 3ERCA 3QUCA 3TI9A 3BXPA 4RVOA 3PWZA 3HOZI 2IZ6A 1E3QA 3I6BA 2IU3A 4CM5A 1ECBA 1A2QA 5JCJA 4BO8A 1OYOA 1U3DA 3PEFA 3IIJA 4AO8A 4F2PA 3UH0A 3EEYA 5GQSA 4BRZA 4QSMA 1V5WA 2J87A 4EHLA 5JNTA 3WQBA 1L1FA 2Q7OE 1NXSA 2W2NA 1EXMA 4N0EA 3VMGA 3TNJA 1IM8A 2GH1A 3L84A 3R7NA 1KH3A 3IP3A 4G5RA 1EBBA 1G2IA 1LDNA 2FF5A 1DTSA 3LGXA 3VJKA 4EPXA 4EPTA 3I2IA 4JB2A 3GRVA 4P2GA 1VLVA 1QQ7A 3BQMB 1Q7GA 1U9JA 1HE1C 1Q861 1EAYA 2BRUC 2HYDA 3H1PA 1XG5A 4HI0E 4U7HA 1XQ9A 1LWNA 1DHTA 1B74A 1SU7A 2Q5QA 1S2GA 2ECQA 3C5VA 3OPYI 5DHTA 1UBJS 2CL6X 5EINA 2PUDA 2YJ6A 4F7DA 1NDUA 3AFOA 3BCUA 3FZYA 2AS0A 5JS7A 2XHEA 2ZTLA 2AQKA 5A7HA 2FPGB 1VLHA 2O0HA 3SFTA 2JLAA 4NE7A 3UMRA 4R40A 1HYBA 2FPKA 2VDUE 1Z3IX 2WYHA 2NVTI 2D59A 4NB8A 2ZR0A 4YRQA 3VR6A 3U44A 1AIPA 2OGSA 3AV3A 5FI0B 1U5BA 1XAGA 2X4DA 1XLTC 5CXUA 3AKDA 1CVRA 5TQ2A 1QXFA 2WFLB 4NBLA 1ODCA 4MRNA 4NNOA 3FFXA 5F7OA 3M6VA 1XLTA 5EJGA 5KYWB 4A3KI 2DYKA 4JLKA 1LQ2A 2Y9MB 1JKFA 2I5PO 1NXTA 1NKVA 1XPJA 2EZ4A 3QLJA 3RBVA 1RC1A 1RXEA 5BUZA 1S2IA 2V74B 2VUIB 3OEHA 4I5GA 4P53A 3H2JA 4MQLA 4AICA 1Z83A 5TLSA 2Q6VA 4CTNA 3JQCA 3NOOA 1ZMRA 3JASA 1KQNA 4WEOA 1Y8CA 1W5BA 1PJQA 4GP7A 2EG5A 2ZJ7A 1FTGA 4XYLA 1FW8A 2V1XA 4PLWA 1DKLA 4QD3A 4TLEA 3GZJA 2R84A 3ON5A 4A3FI 2C99A 3L7AA 4NC9A 2G1UA 4RYLA 2C3YA 4ADSG 2JEOA 3DDWA 1KDYA 1BE0A 2AFIA 3EX7C 1CD5A 1NOJA 3UENA 2XQKA 3I1JA 1M1XB 3AETB 4U00A 3OO0A 4MWBA 3EG5A 3TLAA 3BF7A 1PT8A 2X5NA 4YQEA 3AJ8A 4RK0A 5HRCA 5DM2A 2YMQA 4KO4S 1O08A 4PYIA 2G08A 2J6CA 5J47A 3ENVA 1JR2A 2NUBA 4B6EA 4GWGA 1H2AS 1YI1A 4AXBA 4OM7A 3TLYA 2BFEA 3MLBA 2I1QA 1M1UA 2CB0A 3OWXA 4MRVA 4R41A 4ZPJA 5AUOB 2H92A 3OPYA 3TLMA 5K8VA 2OCBA 3CKLA 1QZ3A 1TC1A 2PD3A 3DXZA 4JZYA 2QENA 2XQGA 2ERXA 1WXIA 1X15A 1HWYA 1M34B 1CZUA 4RPLA 3OCYA 4P7FA 4OHMA 5F73A 3ROTA 5IWCA 4DR4B 2G1AA 1IJFA 2GLTA 4RZXA 5IDYA 1EWYA 2H31A 2Q3JA 3D6TB 4I4TB 3G9XA 3GMSA 4O4IF 4PHTA 5FWAA 3H11B 3QFSA 1Z73A 4DSNA 4BGDA 1Q19A 1O95C 1UXGA 4RF4A 5KB3A 2XT0A 1FP4B 2ZAEB 3TAHA 4B4KA 4D6YA 2VXBA 1BO6A 5IKEA 2JGNA 5JCJD 3MWFA 4WAUA 3TVYA 1A1SA 4CL2A 3FNIA 3OIUA 3JVIA 3PGKA 4NNJA 2C1ZA 2WM9B 3BGVA 2CYBA 3WIVA 2Z58A 3NIGB 1Z0KA 4DYVA 5K9ZA 4TZ0A 2E55A 4Q6WA 3LIPA 1QAMA 3PT9A 1FSFA 4OGGA 1KE1A 3SJUA 1RYHA 1F9AA 3VU1A 3ND9A 1EYZA 4E7OA 5B64A 4ODIA 1NF8A 2FH5B 2XUQA 5G4KB 3W7VA 4BP8A 1OZHA 1U65A 2ATEA 3VPAA 2R62A 4Y30A 3S70A 4LZWA 5KNCA 3NBUA 3EGIA 4O2RA 4Q01A 4AQ7A 1E66A 1E6CA 3S29A 1QDEA 4M37A 4ENWA 1O8CA 2VN8A 2ZIAA 4HNQA 3ELWA 3RRFA 1HK7A 3ZY2A 3MGBA 3RTGA 4DR6B 3ADKA 5EMNA 1MX3A 4DV7B 2CEKA 2VQDA 4TVBA 3V2IA 4WLUA 2K2QB 3IQZA 2AA3A 2E3JA 3Q7QA 3G9QA 2QEX1 2OEPA 3VR6D 2O53A 4TKVA 2ISCA 4GM0A 3IEPA 2VA9A 3NOQA 4UCQA 4UMFA 1GUAA 2SCUB 2VSQA 1QIJA 1ZCAA 3NAQA 1H1TA 4HPWA 4PQEA 4QO7A 3WL6A 2PZ8A 1CZHA 4EHFA 5BV8A 4F9FA 2X5JO 3IT3A 2QQEA 2X0IA 1CBUA 1WR8A 4K9RA 3PQ4A 3ZE7A 4K1XA 3K1YA 1ICEA 4LSZA 2QDXA 1PWZA 2JZNA 4XJTA 3BIWA 4DJ5X 1Y6FA 3HVIA 3VH1A 3KQUA 3TL6A 4MV6A 3CCVZ 5H68A 3LUFA 3DR5A 3MPOA 3G711 4JQOA 4LGVA 4QOFA 5K3FB 3AVXA 4GLOA 4F4JA 5CFNA 1N2BA 2OCPA 3BK2A 5ED0A 3RSGA 3ZE1B 2FY8A 3LVQE 3RVSA 1OZ0A 2CBXA 2QTCA 3MIZA 4P34A 4DJTA 1P9OA 4W7HA 4B80A 1TTHA 1LC3A 2PR7A 4YJHB 1VQO1 3RM3A 3SVZA 1T36A 2FWNA 1B3RA 4YXWD 1QLHA 5HKKD 3PRKE 2IKSA 2ZLBA 5FIUA 3R7DA 4B3HA 4HV4A 2QGFA 2FZVA 2A0WA 4DV2B 2HSGA 4M87A 1F5SA 4MLPA 4TROA 1X1SA 3E5HA 3VNAA 2KI7B 1OB2A 1QVFZ 1BE8A 3S27A 1SXJD 1R66A 1K97A 1VL0A 1HQYE 1LCIA 1Y8QB 5HCIA 5AESA 4I36A 3O2NA 1OH6A 4DCOA 4QQ8A 5FTKA 3UBTA 1M7BA 3MTEA 1EH5A 2FZ5A 4BP3A 1E92A 2GXQA 4DQUA 3RWBA 2CLDX 2DGDA 5H0IA 3SPXA 1JJIA 4C0SA 5IK2A 3DXXA 3QYFA 1ZH1A 4PCUA 3ULKA 1A95A 1ZI6A 2PS3A 4IJQA 1I2ZA 4DMFA 5IKXA 3RIGA 3CMEZ 2K2WA 3AB7A 1TTQB 4PZEA 4UVGA 3ANXA 4EGFA 1JQJC 4DAOA 2ZXFA 5HG0A 2OZLB 5IM5A 3DZGA 2B8EA 5WRFA 1M2OA 1L7AA 4OI4A 2C4NA 5EXPA 4A3LI 4I8XA 2EKLA 1NVFA 1SZJG 1G0NA 5FR1A 4GZLA 4GXRA 4NBRA 2I2AA 3AEKA 2YS6A 1JSCA 2OECA 3ETNA 2C07A 4IZIA 3RR2A 1GPYA 3UJ3X 4K6CA 1ORWA 4MH0R 4ARZA 4OVKA 3WLAA 2HRBA 3OMWA 3UPUA 2IELA 2JIMA 3REQA 1PR5A 1C7EA 4Z0HO 5K0TA 5FA8A 1K8A1 1I6HI 4DTIA 1O0CA 3HA2A 4EB6A 1ZIDA 1EVKA 1OXTA 5FPYA 3FNRA 4A6XA 2VQFB 3HKBB 4QQFA 3RYTC 1I3KA 2ZJ1A 2J1LA 3T4EA 3T4XA 1H6DA 2D5CA 4WXPA 2GCIA 1P7VA 3GEDA 1KF0A 4FFLA 2UZ1A 1T5HX 4U6SA 2I4OA 3PDIA 2J4FA 2FSVC 5TPZA 1AXEA 4DV3B 2CMKA 3OQJA 1ORVA 1WXFA 3L8DA 6ADHA 1ISFA 3U4HA 2FSVA 3Q0EA 2PANA 4G85A 2OQIA 1E1KA 5LUAA 1RLYA 2FW1A 5FHQA 4BMCA 1PSZA 2H1SA 4CMJA 4YRMA 1G20B 5AVJA 1AHIA 2OD7A 2G1KA 4L7QA 3NDBB 1T0IA 5BVGA 3BF8A 1JSRA 3BWXA 3GZNA 1C7ZA 4BEWA 4FGLA 1WXDA 3ZGOA 3F4LA 3FCOA 3RT1A 2O8FA 4FQ7A 4G07A 4U5XA 1ZAYA 2ATIA 1DJMA 4O5AA 2ETVA 5K8IA 2Y05A 2YV1A 3E7WA 3NGLA 1M1K1 4ZC1A 3COYA 1KEPA 3OIDA 4XGIA 1NVEA 1UXJA 3AEZA 3STVA 3CCLZ 3AW8A 4ZOEA 4BMOB 3WGKA 3OEYA 5C4GB 5J3JA 2C8KA 3TQQA 2GPTA 4W5JA 2IDMA 1XU7A 3AK4A 2BH2A 1Y4ZA 3IPCA 3I05A 2XMCA 1IDOA 1NLZA 2F9FA 3MWLA 3TYXA 4C6SA 4KDEA 4Y2HA 1QBKC 1PEKE 1XZEA 3FI9A 3C3DA 5E8RA 4TKMA 3CKMA 5JS6A 3DLPX 4U6QA 4FYYA 4QYWA 2CHFA 2VJOA 1BG6A 1XRMA 1QG4A 3RUFA 3JVVA 3FYCA 2J0QA 3L6RA 3VR6H 5FNVA 4Y0NA 2QEQA 1CUAA 4JP5A 1Z4OA 3CEPB 4XQGA 2P91A 3K70B 1IHDA 3FFWA 3QLUC 1N9GA 2X22A 1UDBA 3E4CA 4UU1A 2G9RA 4P4TA 2XXAB 2I4LA 3QLUA 4AMUA 4PYLA 5LP6B 2FPPA 1B4DA 2GCNA 5JOQA 3KSZO 1JFRA 4OFWA 1G3MA 4XWYA 4BRUA 1THTA 1ZSNA 3OPNA 1SXHA 2GEKA 3GA7A 3F1LA 4KIFA 1QE5A 3C5CA 5JCOC 1QPZA 3C7AA 4JKIA 1ZBDA 4ONEA 2JRCA 4ON9A 3CW9A 4GMDA 4JL6A 4X63A 5IN4A 4EY4A 2GD6A 5LQNA 2Q4EA 4X7PA 2QQGA 2VP4A 3VTNA 3JWPA 4GQAA 4NYIR 5A4IS 1UJ4A 2CCKA 2FFJA 2IBTA 2HQRA 3IHKA 1IJEA 4TTRA 4PW0A 4HUQA 4IJWA 3VOAA 4BHTA 4DM4A 4AY6A 2IDKA 2XBLA 2CVOA 1KZYC 2IU6A 2NO6A 3DDCA 1WHTB 2GYVA 5JG7A 4E5UA 3A1EA 5THXA 1N2OA 4RF2A 2PGXA 4NG4A 4E15A 3PCRB 2VATA 3Q3EA 4HDQB 5BNFA 4EZIA 4EY7A 3EPLA 4ZVVA 3TSCA 3GFSA 1V7CA 4ZU1X 4DA6A 2JGEA 1JHXA 1E2KA 1I6WA 4H4CA 2WD9A 3AZOA 4UJ5A 1BCRA 4DDWA 2XKKA 1GUZA 4FWIB 4HGQA 4BRWA 3TDKA 4B84A 3A9VA 3H2BA 4QGAA 4XCVA 3ABIA 4MOWA 2WSYB 1EK5A 2BISA 1LBHA 3FWYA 1N2IA 2K5UA 1FYFA 3D8NA 4FSXA 4WERA 2EBWA 3RARA 4AULA 4DC0A 5BWCA 5JADA 3DKIA 2ZUCA 6LDHA 5TPZD 1JILA 3MCAA 4G5GA 1OIVA 3DZHA 3C3XA 1G8JA 2P2YA 3TSZA 1BU8A 3ZZTA 1RTKA 2QTFA 4R7TA 5EI5A 5BW6B 1XHEA 1ZNYA 4R6WA 2ZM6B 1JLRA 4P7GA 3MOGA 3RUEA 2XH8A 5EZQA 3D3WB 3TRIA 3VSDA 1GPAA 4A36A 3VV3A 4UTXA 1T8WA 3BE8A 3JXEA 3GLIB 2FSHA 1P4RA 1M3SA 2LKCA 4QX6A 5JS1A 4EHBA 1Z2NX 1GNLA 4GFDA 3LFUA 2E0IA 3LZCA 1B41A 1ND6A 4HNRA 4XUCA 2IYXA 1GYQA 2N47A 2NLOA 2FSIA 2RKOA 2PJRA 4CG1A 2NPIA 4KJXA 2A33A 4JI1B 4KWIA 5F78A 4PO3X 1TA0A 2HIAA 2R6R1 3H2HA 4AKIA 3AFHA 4J1NA 2B8NA 3CEMA 3D7RA 3KT3A 5DWVA 1L7VC 1KK2A 4Q03A 3U6BA 1XZ8A 1KI6B 1X8XA 2H06A 2J0VA 4HJRA 4GPBA 4L85A 5KNCH 3AHCA 1Q83A 3W5VA 3ZHCA 1WCWA 1CEYA 3JPWA 2P3YA 1Z4KA 4DABA 5HIKA 3AZPA 3BIJA 4FZJA 1KAQA 1TADA 4ARCA 1J1IA 3QPUA 5J1SB 5DK6A 4Z4IA 1BXRA 3H5TA 3WL7A 1JYSA 3EDCA 1IN8A 4RQBA 4MIYA 4TMYA 1DWQA 4E12A 4Q02A 4RPKA 5LIRA 4HS9A 3G6KA 1D0SA 3P52A 4D79A 3DTVD 5I3ZA 5D00A 3A25A 4PINA 1GNRA 3FSEA 3TBFA 3KT8A 2Q6TA 4CMEC 1CR2A 3GN1A 2QU8A 1LV7A 1NV8A 1FSZA 1TC2A 1KJZA 2ZJFA 2AUTA 3BFVA 3L6CA 4KFTA 3SIRA 3SXUA 3HEMA 3UT5B 4YJGB 4CMEA 4XVRA 4MQ4A 2MT9A 5TMPA 1QAQA 3IQDB 4BQRA 2IQIA 1LW6E 1GR1A 1Z0AA 3KIFA 3EWNA 3L0PA 4TMZA 4X1YB 1E1DA 2R1TB 5K45A 4TYYA 2B30A 1UOPA 3E4DA 5IAAA 4DSTA 1KEKA 1P19A 4X54A 3GJXC 3S2ZA 1U9CA 2Q7DA 1U3VA 2O2EA 5AM3A 4ZCTA 1RKBA 1MCZA 1UJBA 2NADA 2VUUA 3LD9A 1WZCA 4GYWA 3W04A 4KK4A 3CC41 5BV7A 5J4YA 3EEFA 5FULA 3RUDA 5DP1A 4MKRA 3C8UA 1TVKB 2GZRA 4QGHA 4NVRA 4CKEB 4INPA 2Y1FA 5JXGA 3BS4A 1OH5A 1GYRA 1P31A 3LHSA 3JVUA 3HCDA 3PC6A 1DVRA 1ODLA 3JWGA 3F6PA 4G4IA 3TIGA 4UM8B 4X61A 1NP7A 1SK8A 1G5RA 3EASA 4LI3X 5CU7A 3WA6A 1CWUA 4K7JA 1QXSA 5TB5A 3A70A 3T0GA 2VTBB 3KX2A 1RBYA 2GO1A 5KOJB 1XJWA 1JAYA 3DA8A 4LF4B 1KSHA 1VLLA 3IULA 4P4SA 5DIZA 2O8BB 2VYFA 2YIDA 2HBYA 4J4BA 4UREA 2O8CA 3OLXA 4KN6A 4UEOA 1DQZA 1YFZA 2AFIE 2A5FA 3GD7A 2C92A 3Q0TA 1PV4A 3VC7A 4YAIA 1X6VA 2P9BA 3ETCA 3W3ZB 4HLDA 2HNBA 3X2SA 1FUEA 4NNPA 3L4BA 1JDSA 3TTYA 1QOQB 3GPDG 4NCKA 4C7MA 1C1DA 2V7WA 1SXJE 4WEQA 3OQNA 2Y1OA 4J9UE 1Y6GA 1A4UA 2CLSA 4RVDA 1I0LA 3SC2A 3ZU4A 2W2LA 4X85A 1XP5A 5CT5A 1OY1A 4ZDKA 2HPHA 4YV1A 2O19A 1DO8A 1LSOA 2ZJ4A 5IVDA 4C5AA 2Q5HA 3L4JA 5KKCA 5F12A 3UAVA 3HFRA 5JISA 1JAHA 1AN9A 1G18A 4TRJA 2EZ9A 2G06A 3ZLJA 5FNZA 5G1PA 3ZGLA 5EIXA 1I1NA 1S8NA 1W25A 1EBUA 4OUDB 4MXUA 4FMPA 2DBVO 1W8DA 2QM3A 4WZ6A 1PUIA 5C34B 1DB3A 4IGAA 2LCQA 4C0HA 3U4MA 2F00A 2D2EA 5L7YA 3QMWA 2R751 2JEYA 1PN3A 2RH4A 1YJAA 1Q0QA 4Q9HA 4CCSA 1BROA 1MX5A 1IN5A 4FE4A 2PNJA 2CXXA 3SJCA 2GYYA 3X1JA 1RFGE 1T9AA 1RAEA 3F46A 4LFBB 1NVVQ 3WWDA 1TEVA 3HU3A 2V65A 1JXMA 1QP8A 2IBMA 4MUNA 4XB2A 1O8BA 1REQB 3S2FA 5ALVA 3I9V6 2C3MA 2R79A 3UFBA 5HQ3A 5HF9A 3E15A 1IMOA 1D7OA 1KRWA 3H2KA 5LZ7A 5LZ5A 4MDHA 2CHQA 1SQGA 2GBPA 3ONNA 4QU5A 4UAUA 3GGPA 3PQ8A 4FINA 2YICA 4URXR 2MDTA 2GN8A 3DE4X 1CFJA 1VJCA 3IUMA 3QUTA 4KFRA 5CNKA 3MWEB 3GARA 1AK9A 2B7LA 4HLNA 3U3DA 3FOAA 4DA8A 2VK1A 4RTJA 2AH5A 4OHWA 3B5JA 3V8PA 4X6UA 3TMYA 4B3XA 3WRVA 3MSXA 1NF2A 2Z6VA 5DMHA 3SZRA 3H4TA 3VTKA 3WYBA 1N6RA 3GIWA 4N18A 2ZOSA 1HX7A 4EGJA 3RSZA 2NZ8A 5EPEA 5CA0B 1Q3TA 3GTPI 2GPWA 2YWCA 2PKRA 3HABA 1GNQA 3GFOA 4YROA 4FDLA 3OCJA 3G2HA 3B53X 3MQ2A 5TT0A 5CXSA 1UMCB 4OHVA 2V6IA 3PITA 2G8LA 4DIBA 1G17A 2DE6A 1A9XB 3BAFA 2A9KA 2JI9A 4M1KA 4XE5A 4MICA 4J2HA 2VJPA 1LLDA 4IDFA 1TWAI 1K3TA 2C57A 1AUQA 3KLOA 3QE0A 5EMJA 4AO6A 3HXOA 1DI0A 2HRCA 3W5UA 5SZIA 2VBIA 1EFHA 3CCFA 3KR2A 2ECKA 4PS0A 5KQPA 3CE6A 4TRRA 2NT3A 1Y1KE 4GZMA 3ZZ1A 4DCPA 3TTUA 4FMDF 4LF8B 4DG8A 3VB9A 1VI6A 1I94B 2D1FA 3UOAB 3LC0A 4M9QA 1FLDA 3W2HA 1U0BB 1ILEA 1QOZA 2G07A 3TI7A 1YUMA 1U8YA 5IP5A 4Z7QB 1O94C 1X3SA 3ZYCA 2B35A 3WYDA 5FI1B 4CM3A 2PZBA 1FS6A 8ATCA 2RAFA 4NXMB 4CF7A 3F9RA 4ZRDA 1BJTA 1O94A 2B9EA 1X1CA 4D9CA 5IX8A 2DLCX 5FLYA 1RVV1 3I52A 1T1SA 1ZHHA 3FYSA 2QX4A 4CR6A 3FR7A 1NX6A 1UPFA 3O8BA 3DOHA 3NXSA 1IY2A 1KOJA 1VLMA 1EA7A 1T43A 4UHEA 1PLKA 3MRVA 3VGJA 2XUDA 1J8VA 3UPTA 4YRRA 2SECE 2ST1A 4G5HA 3RVNA 2E2JI 1PFUA 3TEJA 2W2LD 2YCLA 2RK6A 4R1LA 5IXJA 4YT8A 5BN3B 2D2FA 3G68A 4A27A 1YUBA 4BKMA 1VXRA 4C7KA 3LXMA 2L42A 4LGMA 4U7FA 3INGA 4FS8A 1QYWA 3LXUX 4R3UC 3LCRA 2PMDA 4ZQHA 2YHAA 1W88A 4I5DA 2HQSA 4E5KA 1M901 4EQ6A 5BSWA 4Z3KA 1TPZA 3FPLA 2HA4A 4CQMA 4ZTZB 3KOMA 3HRHA 1HE8B 4KQKA 4P9NA 4IKOA 4QJIA 3S5UA 1QH8B 3RUHA 2J4CA 3ZHRA 1D5CA 3UHPA 5BN4B 1NVAA 3FVQA 2QP4A 4ZT5A 4MLZA 3SD7A 1KTIA 2PUAA 2QVLA 1WSDA 3CR3C 3KOXA 4ZEXA 4Z9XA 2IHUA 1NMSA 2IFTA 2QKDA 2PRJA 3O73A 2PRSA 3BIFA 4YMTA 3AUYA 1A4RA 2PLFA 3WHKA 4J6FA 3S1LA 5CDFE 2VWQA 4XVQA 5F7JA 3J80b 1DOZA 1JIXA 1G5TA 3WBJA 2PUGA 1M8GA 1A82A 721PA 3KXPA 3NX4A 3WAKA 2PSHA 3H8JA 2W48A 3O4HA 4QOSA 2PZAA 3SN6A 3LYUA 1TYBE 3MAJA 3TCXB 5M7EA 2CUTA 1H0SA 3NTUA 4DWWA 4UXHA 3OTIA 5SZJA 5AXAA 1LBSA 3P9KA 4LPKA 2X0DA 4BBJA 4QFDA 2FHPA 1MQ8B 3ZU2A 2A9QA 4I6GA 5IZCA 1XC7A 4BQEA 4ZZ1A 5MFZA 3OU2A 1W35A 4NFSA 3DYVA 5FD8A 4OQMA 5DI3A 3TW6A 5AYVA 3BJRA 4MQEB 2I1WA 3WS7A 4F6RA 5EHQA 1IONA 4PN3A 1DG9A 3DO6A 2OUKA 2P1DA 3NXKA 3F5MA 1YRHA 4OK3A 3Q3JB 2QQFA 2VJYA 3GKQA 3Q6IA 1GU7A 3ORQA 2WHXA 4ENQA 3ILVA 2QUHA 1XDZA 3FYDA 5LOVA 1J9ZA 1VHWA 5TDHA 3VVLA 4BO9A 4N41A 4MQ5A 1ZLXA 3NHFA 2AYDA 1YE3A 3K94A 4JK3A 4O4LB 5DV9A 3HB5X 4L4UA 1E8NA 4OKSA 5AP9A 2XA2A 2K3RA 3EFOB 2P3QA 3RPEA 1Z6XA 4D4LA 4Q3CA 2C2MA 1H69A 3F6YA 3KELA 1EU1A 1O0SA 3PPIA 2DHQA 2IHKA 1NQUA 3JATB 3FNBA 1JHOA 3PYLA 3G2JA 3NQ41 4MJXA 3WAJA 2Q07A 4XD2A 1GQRA 3BJEA 3BRSA 2X9LA 1JQLB 1VDMA 1NP3A 5A7FA 5A4MS 4RGYA 2OSBA 3I28A 1N33B 2ONZA 3S1SA 4NBGA 1O94D 2NUPA 4O63O 2BI8A 3TF5A 3QITA 5T6BA 3AEQB 1P0IA 5EEGA 1E5XA 5A4KA 4JEIA 4N49A 2JH8A 2HRDA 5EIBC 4PLCA 4PPGA 2NU9B 3D02A 4HX9A 1Z36A 3UAOA 1TEZA 4NXNB 3IE1A 4TYPA 1JQ3A 2K6GA 3UCFA 1JE1A 2QLLA 2QRCB 3WJ2A 3M4JA 1FL9A 1YHNA 1C0EA 2Q2QA 4HEJA 3AY7A 2FDXA 1XCLA 4TTQA 5HFAA 1A5AB 1LBIA 5DM60 2GZ3A 5LQAA 4PYJA 4RTPA 1W0JA 4ESEA 4LXGA 5SY9A 3CTPA 2XTNA 3KYDB 2OGTA 3JD3A 3K30A 4MJ3A 2O8DA 5FLXb 1I5EA 4Y6QA 1I4LD 3CW2A 5B2FA 2DFNA 2OENG 1FJXA 2Q41A 1T9KA 1ODTC 4P7JA 4MRMA 3ELDA 3QPAA 4OJNA 4Z7JA 3IVRA 4ZDJA 4P22A 4FGZA 1TEXA 2QJTA 1L6RA 1IEWA 2CLFB 2ZRBA 2GK3A 1N0HA 3MINB 1MR3F 4HDCA 2NUTA 1CIVA 4BV2A 4NV1A 3ZU6A 5D8DA 4UEKA 1R18A 5ISMA 4Y2JA 2ET6A 3GAAA 4CKCB 1LQLA 2BKXA 4PC6A 4CNBA 3CEHA 4G01B 1X74A 4CKWB 4NYMR 3WNDA 1KO8A 4X1IB 3WQHA 4F5ZA 1L7RA 3DWGA 3KZVA 3RBZA 4IRMA 1TM7E 1W85A 1AA6A 1LRKA 2FP4B 5D86A 1ZUHA 2NXCA 1EVIA 4MS3B 4UTZA 4G1BA 4XIIA 1M5RA 1LDGA 3IPXA 4KCGA 2RHBA 1UBHS 2HWUA 3LP8A 4KFSA 3WGVA 4FHGA 1ZS9A 4IL5A 3I9OA 1NSTA 1SHJA 3L6OO 1Y3HA 4JUIA 5E6UA 5JD4A 4ZGGA 4PQYA 3FTFA 1QVGZ 1VKOA 3B3AA 4INOA 1Q6YA 5I7OA 3RABA 1VA4A 1NR5A 4QQNA 1KJIA 3HZOA 4PIMA 4YDHB 1P9WA 2Z9DA 4M1TA 4ZA2A 2W8ZA 4X8HA 3OUTA 3R6TA 3QA3E 2J3MA 4D92A 5B1HA 3OICA 1MXHA 5AIAA 1U2RA 5FNVF 1WY5A 4GLLA 1J2RA 3STXA 2D5BA 1R4ZA 2CFSA 1TYZA 1JFTA 2PMWB 4MXDA 3TNFA 4AL4A 1XXHB 4RADA 4Y9RA 3OI7A 4NBUA 5IUNC 1B8NA 2MYUA 4R8MA 2A92A 3MHPA 1DQYA 4E5MA 1PHRA 3ISTA 1J9GA 5I5GA 4JA2A 4EX6A 1T3TA 4RS4A 2QMOA 3GO4A 3OOJA 1OXMA 1DKMA 3UATA 3L8YA 2RHWA 5LWHA 1NRIA 2B2XA 3MZKB 1UFQA 2OHOA 2QPLA 3F6RA 4FIZA 4MTCA 4OHXA 2IHTA 5AUQA 3QOYA 2IOYA 4N8DA 3AVQA 3AVUA 4P3NA 1JXOA 5KVAA 1RZUA 5HS4A 3GAZA 5MHTA 2VCEA 3BMOA 1RIIA 1VOTA 3CZQA 3I04A 4YUVA 4C3UA 4D25A 2EYQA 4BX8A 1IG3A 1SHZA 4AUKA 2D8MA 1DXYA 1OAKA 2Q1WA 4RSGA 4JVLA 4GT1A 4C01A 3CX6A 2XUGA 1F60A 1CRPA 1BXGB 3HADA 5REQB 5AWFC 1QGUB 4TXLA 4WE3A 5TY0A 3UAXA 4BJ5A 2WICA 1EINA 5CX1A 1FJGB 5GV7A 1IPEA 1QCYA 1WQ1R 1YS6A 2QNBA 4RFVA 3WY9A 1F8YA 4ECAA 2A57A 2PBFA 2FN4A 3NEPX 4K46A 5D6NA 1XCBA 1I3NA 1F7VA 3RASA 4HDSA 3H0CA 3JAMA 4MUJA 1V1MA 2XAUA 1TB4A 3KHSA 4EHJA 3HXQA 3T3DA 1A9ZA 2R5FA 2XCQA 2F3TA 1HG1A 4W1QA 4TQAA 4ZO6A 2QTAA 5DYTA 5GOZA 3X43A 3ZJYA 3EPJA 2ZRKA 1EGMB 2NU6A 4OIMA 5LB2A 3KQLA 5IDXA 1Z9BA 3ETJA 4UHDA 2I4NA 4WZBA 3R9XA 1DMSA 5I8PA 4C3OB 1AQYA 4HTFB 5JQGB 4NU8X 3R4CA 5A3RA 1YB4A 4QKQA 2RGEA 2IEZA 1MO3A 3I561 1R6DA 3F9IA 1AX9A 1GCAA 2IC5A 1D4OA 1ADGA 3Q5DA 4E1VA 2YN0A 3S99A 1XI2A 3DE5X 1SQ5A 3CRW1 2J0EA 1G21A 1NUUA 1YHYA 4QULA 4DIFA 5K6TA 3ZIDA 3PI7A 3O94A 3FFBA 3FR8A 4D3SA 4QXQA 4HSEA 1O96B 3DF7A 1T29A 2FDCA 3RVLA 2QSZA 3U62A 1E2HA 3ZWOA 1TW3A 5E6SB 3FSGD 4PVCA 1JJ7A 4LWZA 1XKQA 3ETEA 1I2AA 1C81A 1VSVA 2BFBA 2Q2OA 3STYA 3ZWWA 4ZEMA 5JW6A 3ZBTA 5H59A 3ED5A 3QUBA 3K0AB 3ROQA 2EL9A 4ZCMA 3OZUA 3RS8A 1A98A 4IXDA 3QOXA 4KPUA 2QTMA 3RKUA 5CH5A 1CJKC 4PN7A 2WHYA 3NVKI 3AR7A 3OAAA 3VR0A 5KKNB 3FBGA 2DSNA 4TT3A 5T7BA 2WYVA 5J4HA 1NW4A 2VVTA 1NVWQ 1KJQA 1NHWA 1XZJA 2NGRA 4RZUA 1E9VA 4ZAZA 4RPIA 3WGIA 4H6WA 1KFJB 2XNSA 1FPQA 1IBSA 2ZIEA 5AKXA 3WV5A 3T9FA 2KPIA 3V1TC 4ASUA 4F92B 4IR7A 3K6KA 4M7PA 3U5ZB 5D7BA 5CK4A 1YCDA 4Q3BA 4DADA 1L4LA 3HKZA 2XTAA 5HHTA 5M2QA 3VH2A 2HAEA 2XY4A 3I37X 2GYWA 3NIWA 1WLSA 5FA5A 4IJ6A 5JWRA 3JQAA 3GH3A 1J23A 1K4MA 1Z17A 3ECAA 3K35A 4G09A 1LEHA 4I3FA 3NP9A 4G8DA 4AD8A 4FW8A 3SSOA 4V03A 1W9MA 1XMSA 3R7WA 5EWJB 3NOXA 2R7KA 1AKEA 4NH0A 3RODA 3P0RA 1O97C 1NPYA 3C3KA 3RYFB 3M6UA 3KQQA 4A9AA 1H2RS 1RLMA 4XB6B 4J43A 2BKLA 2FPLA 1HE4A 2GASA 4F2GA 4EG5A 3PJGA 3ZI0A 1XRSB 4ILEA 4R51A 4WX2B 1J0EA 4M7OA 2IUSA 4TWBA 2VQ3A 5CGQB 5DGCA 5AVXA 2HJVA 1HSOA 3I9NA 2O6HA 4LTMA 2P2SA 3OFVA 1UL1X 2N1MA 4GRIA 4OI2A 4G5SA 4LNUB 1JB9A 1T2NA 1XLUA 2X5OA 3RROA 5CDUA 2FWJA 2P90A 1Z7EA 5HUJA 5ALEA 3GRUA 3ICCA 2OK8A 2WAAA 5CRIA 2B34A 1LZKA 2VHQA 2FPIB 4N0QA 1PZMA 2I78A 4KV9A 5CPFA 5AQEA 2Z04A 4C7OA 1LPOA 3NUQA 3W7AA 5ECYA 4Q16A 3HJNA 1KJ9A 4UAVA 3GCDA 1B00A 1FP7A 1H4TA 2WJWA 4Z2YA 1NC1A 1MENA 1RRPA 2IXTA 3E53A 4H16A 4UVDA 5AMXA 4QUGA 5ECGC 5K3AA 3RS9A 4DUZB 4LFAB 1II9A 3OF3A 3UK0A 2FJUA 2R1VB 2IP4A 2ZYSA 3CO0S 3PXEA 4HQFA 3SHOA 3IE2A 3CUTA 1KAGA 2JLUA 2Z6QA 1GWNA 1TU4A 3REFA 1Y5RA 4URWR 5CFZA 3T7TA 1RJEA 2CF6A 4JBYA 4L4SA 2QGNA 2VPYA 3GZ4A 3BWBA 1KQSZ 1QO7A 1ZU4A 1C7QA 2G6BA 1Z0FA 3A1FA 3GXOA 2R6DA 3KQMA 1U3TA 3PXCX 2EG9A 4JU8A 5E9WA 5BNTA 3DOIA 5EYPA 4Y1RB 1S2MA 1H2YA 2LR0A 4DLVA 3KG2A 4A8PA 3KYBA 5IEBA 3K2BA 1P5HA 3PDCA 1E2IA 3B60A 4MVJP 2HIMA 4NBKA 4CMCA 1ZGHA 2RHMA 3NATA 4ND3A 1L1EA 2F67A 4OTZA 1H93A 4PX3A 1FDTA 2BW0A 1RCTE 1TIBA 5G41A 1CUUA 3ZXXA 4CKBB 1B8VA 2IYAA 4KJZA 2IL1A 4X8LA 2JKZA 5F77A 2VRWA 4UCFA 4ACBA 4DRXB 2XCTB 3JR7A 5ULLA 4W4TA 1SBHA 3MMXA 4MB2A 1YHQZ 3R8CA 2C54A 1R88A 3TIXB 2GAIA 3C0KA 2XMRA 4GPAA 4Q4DA 4H3HB 5E8JA 3JQEA 3RSFA 4B0OA 5HUHA 1N5LA 1H9BA 3A1SA 4Y98A 4A73A 1ECGA 2PX0A 4F2HA 3IKVA 1B16A 1XVTA 3IMEA 2WWWA 3MUNA 3RTDA 2DHCA 4AS3A 2IZ7A 4UNSA 4NCHA 2R60A 2PV0A 3DZDA 2ZE6A 4TT3D 2GJ8A 3RKSA 3FCEA 3IX7A 1QOPB 4FWBA 1NL3A 4RHXA 3AW9A 1Z4JA 4TV9B 4C4OA 4KOEC 5TF0A 4X7BA 1CFZA 3NOVA 3VSAA 1E99A 2DWOA 4GG1A 2EJTA 1UC9A 3VMFA 1A5SB 1UPAA 2PZMA 1TCCA 4QSHA 5HQTA 5CCXA 5LVAA 3EAQA 3CCR1 1ZK3A 1JDJA 1KQGA 1Q821 4MS4B 3KFXA 3NYQA 5HKOA 2QAGC 2QD5A 1JKMA 4BBRI 2RI6A 2O4CA 3JQAD 5LKRA 3CISA 5M5BA 4BQSA 3ZQUA 3CIFA 4AW9A 4KUHA 2X5XA 3WSTA 4D3ZA 3CNQS 5LZ4A 4D5GA 1O4VA 4NWIA 5INTA 4HMQA 1UT8A 4BMYA 4X3PA 1QTIA 2P5UA 2WIBA 2PGAA 3BJMA 3VQTA 5LQKA 2HW8A 4KVAA 5DWDA 3DWIA 3CURA 4E70A 2EFDB 4YN3A 1O97D 1MGOA 1MH9A 2HK7A 4M9UA 4UC0A 5AKIA 3LAWA 2GNPA 1D2CA 2QDKA 3OETA 2XDQA 1KZ4A 3G2NA 2QJRA 5IXSA 2WTBA 1U9ZA 1OOEA 1TKRA 1R8JA 5F9FA 3OHSX 2F43A 2GO7A 4XI9A 3JD4A 1R00A 2B61A 2G76A 1V6SA 3AI2A 3UG6A 2I9PA 4QM6A 3FDJA 4JODA 3K71B 2DT5A 4BFYA 1CK4A 2I1LA 1MZVA 4EVRA 1EA5A 2RG7A 5K05A 1NVUQ 1PT5A 5EL0A 4G65A 4IIVA 5FOSA 4D0GA 1PR3A 5K8TA 5KTTA 1T25A 5I5EA 9MHTA 1L9XA 4HRXA 2V7TA 5C4MA 2NNWB 3ER8A 1GA6A 4OHCA 1UMDB 2ZS8A 1GUBA 4JX8A 3V1KA 5ER6A 4H35A 5ERYA 2OBFA 2QN7A 1NN5A 2APJA 3JAMb 2NSHA 4WKOA 2H16A 4J94A 2OUIA 4O08A 2Q4ZA 4YJDA 4ZCRA 4J0IA 4JXZA 4IH9A 3GJ4A 4KACA 1KBZA 4WV3A 3NFZA 5DSTA 5F51A 2FQ1A 3V7UA 4BDSA 4DG9A 5IF9A 3NONA 4RY2A 3P5JB 1G3IA 4DVGA 1NBEA 3DAHA 4BO4A 4D45A 3K9CA 3ASUA 1R9JA 3CBGA 4JYCA 1VPDA 2GF0A 1M0WA 1SN7A 3W1EA 1RKQA 1UR5A 1Z07A 1VLZA 1F3LA 4RTKA 1E1NA 1ZGBA 4UTNA 3CY6A 3VO2A 1L4FA 5JD6A 2YZ7A 3UN1A 3IUQA 4X00A 1U5CA 1K7YA 1TM2A 1FF9A 3BHIA 2YBDA 2O23A 3GFQA 4ZPXA 1IMJA 2GHIA 1BSVA 4RA6A 3OEEA 4MA4A 3UCEA 1UK6A 4G5YA 3B85A 1WDMA 3AR6A 2PSJA 2IDJA 2Z5LA 5LDHA 2ZRGA 4RA9A 4DLWA 4Q9KA 2V7QA 2XZDA 3I1YA 2QIOA 3THSA 4EK9A 4Q4JB 2I2CA 2BI7A 4C0LA 5FQNA 1P0FA 5K2MA 5B57C 3WNBA 1D2RA 3EAFA 3VH4A 3HN7A 2V3WA 1I6LA 3Q40A 2VDWA 1NF3A 5K51A 5BPFA 5G1OA 5KYWA 2UVQA 2EEZA 2VK2A 3IOCA 4PRLA 4R1UA 4XLLA 4Q7LA 4WOPA 1VGQA 1CSEE 3DV0A 1XTKA 2X42A 3E35A 1QK3A 1J39A 2Q1SA 4PR3A 3V33A 1VQ6Z 2LFUA 5KYUB 2HA7A 1PQUA 2E5FA 1ORRA 4E46A 3WK8A 2B4RO 2GD0A 1ZMBA 4CU2A 2WJ3A 4YRAA 2QW1A 1VCHA 3EDRA 5FUBA 4GKJB 3KT6A 4HWTA 3C85A 1IWPB 1DINA 5ARBA 1EUQA 1UEXC 1XELA 3RU2A 4HOYA 1EDOA 4JWTA 3N5KA 1HDRA 3OE1A 3DMHA 3F67A 3E9MA 5E2AA 3L7BA 5K3EA 5LMNB 4DPKA 5LMZA 5B58C 1NYQA 2XNKA 1JJ2Y 5H4HA 4LMBA 1X42A 2FGKA 2KE5A 1ZC4A 2WOOA 5CURA 1H2XA 1KP2A 1PQWA 1RWOA 2YWJA 4GECA 3OY7A 1F6DA 3NDRA 1BWPA 2C3PA 3CX3A 3Q10A 4HZGA 1HEUA 1CCWA 4YP5A 3TE5B 1NU6A 4HEA6 3A11A 4JELA 1YB7A 4RTSA 1NASA 1D5WA 5G2OA 1SUSA 1DIBA 4UBNA 3ROGA 3JQ8A 2I6UA 1NUTA 1YVUA 2GAFA 2JGRA 3FNHA 4LYFA 1MQ9A 1JR6A 4A93I 3JQDA 2HADA 2CN1A 1O57A 4C20A 1G19A 2VQSA 1JJBA 2I29A 1XT6A 4L2IB 3ZWXA 2PWBA 1MG0A 3QEMB 1ETUA 4RK6A 4K6FA 2A9FA 2QPTA 4HNGA 3HOUI 1NXQA 1XDBA 3MCWA 3R5KA 4LQDA 1M34A 2QPAA 2YZGA 3SHWA 1LW7A 3WLTA 4CI9A 1VBKA 2VI5A 2YV4A 3O9MA 1JXQA 2DTEA 1VG9B 4IP0A 1LX6A 4Z3DA 2M1ZA 3AUUA 2GBLA 3LY5A 2X5KO 3C41J 4UXJA 4L9WA 3TLXA 3LUSA 2BF7A 1RZRA 1C50A 1Y5IA 2Q4RA 3DAOA 3VYSB 2V6FA 3U4IA 2ZJOA 3IQWA 4GPD1 3PF8A 1USVA 2OCYC 5TSDA 4F56A 3TG2A 3L0DA 2Y66A 4B43A 5JAUA 1EGAA 2XYPA 1EXDA 1L7EA 2EF1A 1FUUA 1KIAA 4YJFB 3LLMA 2Q28A 3U0VA 3MONA 1PDVA 3B1FA 3PUWA 1QQTA 4M9ZA 4IDGA 5C5DA 4H60A 4RORA 3WLEA 1J5EB 4ITRC 4X64B 3J81k 4QAJA 4F5YA 2OCLA 3VMHA 3ZHXA 2SHKA 3ZCTA 5L51A 2ZQYA 3GFFA 3I83A 4FM9A 2OYRA 2WT4A 4KTVE 1WDTA 1XTJA 4LOKA 4GMHA 1L5WA 3VPGA 3CONA 1DARA 4H27A 3CVWA 5IT4A 1QHHB 4R69A 4RDIA 4BAZA 5L7WA 1PFWA 1BXKA 2CB9A 4FLMA 4LE0A 3TJZA 4XQCA 4D0RA 4DMGA 5IF3A 1WEKA 2PUEA 5D2CA 1WULS 2FWAA 1W0CA 2ATVA 2CDAA 4DMCA 5F9HA 2G28A 4YEDA 1PWEA 3AUSA 3ZHZA 4IQ4A 2YWEA 1ISMA 1MRZA 4AYBA 3ZQJA 3U09A 4NCJA 1JFLA 4DHWA 1J0DA 2JI6A 2AZTA 3GJZA 2PQ2A 2TYSB 2YIJA 5LR6A 2EGGA 2CLOB 2PBRA 5I7VA 3D9XA 4EVIA 1MVLA 1G7TA 1SC1A 1YJBA 2NOAA 1UH5A 1DTEA 2IHZA 3FKJA 3IQHX 4NZPA 4LSWA 2OBNA 2QLMA 3CZCA 2D13A 2VHUA 4AY4A 2QRDB 5A6SB 1HFEL 2H7CA 1YA4A 5K3FA 2HCRA 3DE6X 1AG9A 4GYJA 1TMOA 3I1IA 3CC71 4HN9A 3P9IA 3F6BX 4P8RA 4Q47A 3SFVA 3GROA 3IUPA 4Q7MB 1C7RA 1NXOA 3IRUA 2ZT5A 5H80A 3B6MA 3KP1A 5AT1A 2HJWA 3A4IA 4WZBE 2JGJA 1KZHA 1U2GC 3ITEA 5DYIA 1NF9A 1PG2A 3C3MA 3UEOA 5A2QA 5BY2A 4YRLA 1I0ZA 3OURA 1KYWA 1U2GA 2CXHA 4I50B 5T41A 1ZQ9A 3REOA 3RSHA 1P6XA 4YPVA 1BE6A 1PBTA 1U90A 3HJUA 3DGFC 5CG2A 5K0JA 1MAAA 3FNGA 1G21E 1CF4A 3ACCA 4JYMA 4G0XA 4ZOLF 3E5RA 1QRUA 1M0EA 1W1IA 1ZA2A 1XD2B 4FR0A 3A31A 2KBEA 4MWSA 2CV2A 4DZTA 3NWPA 4GXQA 4E22A 2NIPA 2Q9BA 5TF4A 2RHGB 3RNOA 1R8YA 1YC2A 5KMGA 3X1WA 3WGGA 2QUJA 3EWSA 4LJ5A 1Q84A 4M8NE 4KSCA 4REOA 4DSAA 1J06A 1OWMA 2V5AA 2V96A 3OZGA 4Y9UA 4J3NA 1QP0A 1RTTA 2IXEA 3QBDA 3EY4A 1U9YA 2IIQA 2RONA 1SUFA 2R4UA 3INYA 3CCSZ 4FPXA 2DBZA 2PMFA 3UMSA 2NACA 4YAJA 1N32B 3HA5A 3AUAA 1D9XA 3QF7A 3TPFA 2MR6A 3HCEA 5B7PA 3SICE 2X0RA 4MKXA 4PHHA 3H1AA 4JLJA 4BMDA 2MINB 1KI2A 3CGWA 4MAAA 3NHMA 4M1WA 4EFDA 1XJ0A 1JVNA 3RAFC 1VQ91 1EGVB 1FDIA 3GP5A 3ZDAA 4UULA 4FGJA 4WJZA 3LJKA 1SBTA 3PUJA 1PQYA 1B6RA 2DC1A 4RSMA 1F4VA 1T3LA 2C97A 3HEBA 1TUEA 4R1MA 4FYPA 3GYBA 3QTLA 5AK4A 3KALA 5AKEA 3MMSA 1QIMA 3JAWB 4K1LA 4R05A 3Q1LA 5B12A 4BY7I 2JI4A 5AHOA 5L3VA 3VNQA 3BWEA 5KJ1A 2VNKA 5EPUA 2I33A 4HT3B 1CUYA 3I5YA 3D5QA 1G4AE 1KSFX 1J8QA 4IH1A 4L07A 1IBKB 1NXVA 2FSFA 1OGIA 2OOXB 1PLLA 3D43A 2QROA 2FE1A 2PL1A 3ANMA 3ISJA 4YIKA 3ZCSA 1KVTA 1P39A 3U39A 3I73A 5KPJA 1II8A 2P78A 3ROKA 2F4OA 1GZ3A 4RGBA 4CDGA 5U1PA 3KIPA 4X7MA 1MO2A 1ZD4A 1LDMA 2AX4A 1QTRA 2YINC 4R3WA 9LDTA 3QIVA 1XOIA 3W5DA 1MVNA 2JIPA 4U3JA 3I2FA 1G20A 3P32A 1TJPB 4MWZA 1GZ5A 3IDQA 5SZHB 5LDDC 2BKEA 1PTJC 3L5KA 1EHCA 2CJYA 4GS5A 3NEJA 5I9IA 3CHYA 4U2KA 4ZV7A 4JHXA 4TLDA 5HBRA 3PHLA 3IF8A 4POOA 2QE7A 3S1MI 2YH2A 4LHVA 2NQTA 4CM7A 3G0DA 4TLMB 1QKJA 3OM1A 1L5ZA 3PLNA 1V41E 1A4XA 3IC5A 1WMBA 3A1WA 3OH8A 3I6IA 1UODA 4X24A 3GP8A 4UKDA 1DRVA 3SHQA 3T1NA 1DRUA 3KFLA 1TKCA 1GIAA 2PE5A 4RDCA 3P9QA 4L0CA 3Q5EA 3VC3A 1U0TA 2Z83A 4YYEA 5BXYA 4QTTB 1M2FA 2WG0A 1GG8A 1DU4A 2DF8A 3P4XA 4PPNA 1OX6A 5T3YA 3RFVA 1M5UA 3ZK8A 3MFQA 3IT1A 4KLAA 2E9SA 2REBA 3KTDA 4K9MA 3RFXA 2EARA 4JCCA 4UCWA 5JEDA 1DC8A 2JB9A 3F8WA 3LDUA 4BQOA 4GRDA 1Y33E 1HNWB 3DV9A 2H1CA 1H3NA 1WG8A 4RZHA 2XKBA 3RJ5A 1G8GA 1P2SA 2G0AA 4TXMA 4CG0A 2P2CA 4COKA 2R6JA 3EC2A 3BHNA 2IE0A 2DECA 5CNJA 3R7BA 1JZSA 3P9RA 4BNDB 2C9YA 4OKIA 3FPCA 4RMHA 3UNXA 1CUJA 4F6CA 1G66A 1GPJA 5I7FA 1NMYA 2H2GA 5AVWA 2FETA 3LOQA 5LP6A 2C7PA 4L74A 4XSHA 2BKVA 4U63A 4QJ5A 2DFTA 2ZSAA 3A2KA 5KSPA 2RHHA 3EXG2 3IXLA 4MUMA 1G63A 5KJ6A 2ZAIA 2IS6A 5KAMA 4UHHA 3N0TA 1QO9A 2I54A 4ALKA 4Z53A 4PX2A 3OZVA 1VJRA 2X4GA 1PVDA 2OE2A 2W9XA 3W8RA 5EG5A 3FRJA 5CXQA 2QZSA 3R41A 5BSEA 1NVTA 2XD4A 4JENA 2YWFA 2VXCA 4EGCB 2DX7A 3ZWMA 3V2HA 1Z4IA 4JV5B 3WLMA 3DONA 2IVFA 4QYTA 2J0UB 2JAPA 2WD8A 4K86A 4Q7EA 1UXKA 5I4IA 1YE5A 4YAEA 4HG2A 2D1TA 1NVBA 3LG2A 3OLVA 4ZZ3A 3UJ7A 1DZIA 5HKAA 1LI5A 1CXZA 4R1QA 2YNMC 2EZ8A 4HB0A 4MUHA 1CUXA 1QF9A 3Q41A 3LQYA 5JNUA 2O1XA 1VMAA 3CCCA 4TMFA 3QM1A 1THGA 1U9IC 1TO2E 3H2SA 2C88A 2YNMA 3PF9A 3WXBA 1HURA 4DT1B 4KVZA 3CLKA 3KT0A 4PNPA 5TS2A 1U9IA 1KVSA 4D56A 3IVGA 1N8NA 3IOYA 3TZBA 3QKTA 4TQ9A 2W6JA 4MW5A 3TAUA 4NABA 1YBAA 3V8MA 5AW4A 4PWZA 4DANA 1LV8A 1ZEMA 4F3RA 1F8FA 5JNRA 3RC1A 2HYIC 2Q51A 1LK7A 2P4QA 1QM5A 4PBTA 2O9JA 3W2TA 5ERXA 4IBOA 3TB4A 2WA1A 3L8GA 2WT9A 1P33A 5D3ZA 1P4HA 3VR3D 4BV9A 4AB1A 4CIXA 4GBGA 2YYSA 1FJHA 1TQHA 1ESEA 4FNMA 3UQZA 5C7OO 2ZSIA 5AHXA 1JTEA 4I3GA 2F3SA 3CNEA 1R27A 3A27A 4AU1A 4BIIA 4D4KA 1PGPA 5FTJA 3V9PA 4F4IA 3TGPA 3GPBA 3UO8B 3VAZA 2AN4A 1EK2A 4RKFA 2O2DA 1Z2OX 2ACKA 3DBRB 4NEGA 3CXCZ 3TJRA 3AV0B 2WJZB 3R1IA 3FPJA 1UWVA 2ZI6A 4L7VA 1YZQA 1P3JA 5JI3E 1QF6A 4DL9A 3S2YA 5GJVC 1KJ8A 5LIPA 4I0WB 5DSZA 3LHDA 1PYGA 4QUIA 4F4UA 5FV4A 4U7DA 1Q44A 1KFBB 2DFKB 4H9GA 4A3EI 3COZA 3FPEA 3QVJA 4MA5A 1GPWB 1UC8A 4PICA 4HLCA 4U7PB 3C3WA 1N2CE 4YPFA 3WNQA 3LTNC 3PLAE 1F2VA 1UZNA 5D87A 5IJXA 4CCYB 1LD3A 5C8DA 2ACEA 1E9FA 3E22B 4YP9A 1Z5WA 1PDOA 2PAFA 2Y0CA 4ZVNA 3T7SA 2P0AA 3CZ5A 3FKII 4NU6A 3UXHA 3QWBA 1R12A 4JD5A 4B3JA 5IJ0B 5K99A 1AK2A 2V55B 4KH0A 3IPRA 1L5GB 3S2DI 3H2GA 5ECWA 2VCHA 5L3ZA 2G1JA 2NZ2A 4RH3A 3JAKA 3S4YA 1EVYA 4L75A 5GINE 3ZLVA 1EUYA 2HU8A 2MSDB 5G3ZA 2CVFA 1N8R2 2I3BA 5BUCA 3UT5A 2F2TA 3OCWA 4YJGA 5ICFA 1GTG1 2KBFA 2DUNA 1TAHA 4BNVA 1B8PA 2ZB7A 1HMPA 3BQ9A 3Q3CA 5ALFA 2DCUA 2G36A 4X1YA 2R1TA 3ZCQA 4CIWA 3TSAA 4L4ZA 1K68A 2HY7A 4D0SA 4A8JB 1VKJA 1VSUA 3UYLA 1B2LA 4JOQA 1BMFA 1JAZA 4R31A 4D6PA 4YRBA 4QTXA 4R2WA 4K2AA 5KU1A 1Y3IA 4QXOA 3KD2A 4D26A 1JEYB 2ORYA 2P69A 2PSEA 3S0JA 4DLKA 4D44A 3RWMB 3PQCA 2RGGA 4ZTUB 1QJ4A 2YV5A 4IZOA 3RE1A 1VQOZ 2OB1A 1BOOA 4HMPA 1LKZA 2FZEA 5FP0A 2BAGA 4QBFA 1JEOA 4C05A 1KI7A 2HFKA 3IKJA 4J0QA 4X1KA 5EIAA 2IYVA 3HO6A 1BGVA 5C9ZA 3T5AA 2A9RA 1XWFA 3KSBC 2QQ0A 1SKMA 2VTBA 4LF7B 3NRCA 3FGNA 3LVFO 3G7UA 2BDEA 3MC1A 4IXWA 3IAHA 1D9ZA 2Q0SA 3KSDO 2VTKA 4OP3A 1Q7Y2 1PI3A 3WOHA 1NZFA 3W90A 2ROQA 4D97A 3PNVA 2M6KA 3PKZA 3UT6A 2BFWA 2ZTMA 3PGVA 2ODAA 2FSUA 2PH3A 3NT4A 3OQBA 4PHFA 1USGA 1ZL2A 5TARA 3UUEA 5B4UA 3GLSA 4XWKA 4YY3B 4TTSA 2BI4A 2AN9A 3U31A 4PGHA 5EZ6B 2E5LB 1CTQA 1W34A 3RD5A 4EUNA 3V3TA 5BWMA 3E7PA 4BBAA 3KV3O 4L08A 4N54A 4YRKA 3PC4A 4Z9BA 5BSHA 5C3EI 1GU1A 2ZI5A 1GDTA 4BY9E 1U28C 2ZATA 1SG9A 1T2DA 3NLLA 4ARVA 4C9BA 2BBTA 1YJCA 1CEQA 2WBLC 2GCOB 4ENUA 4RNDB 3UANA 1NI5A 5BXQC 2Z57A 1U28A 3THOA 1U7UA 2VS1A 3FM9A 1VQMZ 2GWHA 3IDZA 4LBWA 1NJI2 1WTAA 3C4JA 4L5AA 4MLDA 2GCEA 3E6AA 3KOOA 4ND1A 1AMUA 1E2PA 1GEEA 2JANA 3G2IA 1R5NA 3DFZA 4O8ZA 2IHBA 1CUHA 4TSKA 4ZZIA 1WX1A 4B79A 1HUQA 3UK1A 1M34E 1V95A 2JR6A 1PFQA 2BMEA 3JSXA 3ZY4A 4OUDA 4QJ3A 1HTBA 4FHDA 1T4GA 3QZUA 3R9IA 3U9LA 1ZUIA 3DPSA 2D0OB 5AI4A 4HWKA 3UWOA 3VDQA 1W36B 1X3ZA 3UKJA 5BOSA 5JDIA 1C1HA 4RD0A 2VZ0A 4K9PA 3Q3IA 3OIGA 4TV8B 5FOVA 4X45A 1AKYA 3LUBA 2AXPA 4BNFA 3K4PA 1KDZA 4C43A 1O89A 4R2HA 4YALA 3RBXA 1Q0UA 3CUKA 3RF7A 2WJAA 3W77A 5L3SB 1YZLA 4C2BA 1REQA 4P36A 1Y8ZA 5EIOA 3T1TA 2AEJA 1UFKA 3TLEA 3WA7A 2Q1UA 5B1DA 3FZEA 3TPCA 3PO2I 4DVJA 1UKBA 2RHRA 1T0JB 3T5CA 1RHKA 4CM8B 4N48A 1QSGA 1HFKA 5EUQB 2X4LA 2FVXA 4JL5A 2P9EA 5E4YA 3QE4A 1GRCA 1Z4PX 4FHEA 2WJPA 4MR8B 5FPHA 1TRHA 3GNLA 1ZCFA 3VJRA 3GCWA 3IX0A 3JQ7B 3MWEA 1ZPDA 2E49A 2RBGA 2Q0QA 3AUFA 2ZIXA 1NGSA 3R77A 5CJPA 2WTUA 2VHXA 4QXPA 1XRPA 1NQTA 1MU0A 5CA1B 4OFZA 4M88A 3H1EA 3UG7A 3AKCA 1PT9A 2CD7A 4JNCA 2E48A 3GGCA 1KI9A 5CA0A 5T5QA 5T8KC 5KYYA 3BH6A 1Y9EA 2P0EA 3GOHA 3RKRA 2PCLA 5T8KA 1OILA 2PSSA 4A3DI 1UMCA 4HQ0A 4IOMA 3TB6A 4ILKA 5ALOA 5ESXA 3CLTC 3D5EA 2OO3A 3H5LA 3SY8A 3G8DA 5E38A 1ZGZA 2C58A 1EVZA 4PZ9A 1GZVA 2A84A 3PQ2A 2HR1A 4XW2A 4N5IX 3OEWA 3FOEC 2ZBPA 2R8BA 3H19A 4MEAA 5CITA 3EIXA 4BWVA 5IFKA 4DB2A 4PFQA 5I45A 3JTEA 1K88A 3D4OA 1L1QA 1M6NA 2QRMA 3FMVA 4QXMA 2ZRFA 1U1FA 1WV1A 4AWBA 5FOTA 1Z2CA 3ZHQA 4CM9A 4DMHA 2CFOA 2Y76A 2JCYA 1QQAA 3P0FA 1V96A 3F4KA 5ALTA 1DBVO 4CLDA 3QPVA 1TO6A 2PD4A 3VYTB 4JA0A 1E8DA 1P1FA 4LMAA 4HEQA 1TO1E 5BR4A 5BW8A 1EFLA 2I66A 3D7LA 1Y48E 1YH3A 2GVNA 1AB6A 2D06A 1RM0A 2PXCA 5DX0A 3U48A 3C8ZA 3ZY3A 2FWMX 1DO2A 2AN1A 2GPBA 4LK3A 1CRWG 1QKIA 2NXNA 3WL5A 1GCUA 4TLBA 3DL2A 3K8ZA 4EGSA 5L7TA 3GMTA 4BL5A 4J1TA 5CW1A 1KDVA 4MQFA 3NV7A 1O3YA 4B17A 2CDCA 3QWHA 2JVIA 5EUMA 1AKVA 3RTEA 1RZ3A 1VLQA 3MILA 3ZWVA 3I9V1 5T4BA 4GICA 5D1OB 1NAHA 2D62A 1W5SA 2YVKA 3ND7A 2P8SA 4GDMA 4GEKA 4TTPA 3K53A 1LF5A 4NJEB 1NW3A 1P9LA 4A7PA 1UXHA 2E4ZA 5DKFA 4B45A 1YKGA 3ESAA 5IT9A 1TWGI 1NWHA 3HZZA 3PRJA 1VI5A 4MRAA 2WF6A 3GR6A 5AJYA 2QXTA 5BV2P 2JCGA 4PS1A 3QF4B 1XDUA 3RIEA 3BX1A 3H18A 2C4VA 1UC4B 1G5IA 3F6SA 2BMVA 3NHRA 4IEFB 4MWEA 4Q3KA 1OWNA 2VNIA 2A9OA 4E51A 4M60A 2CHUA 5FQOA 2TRSB 1PNVA 1QC5B 1AM4D 5AVTA 3HGMA 3KHUA 3NYIA 2I3AA 2OFFA 2WG2A 3V7NA 2GNAA 1P4AA 2UYYA 1V1RB 5F3DA 4BLOA 4C6TB 1QFJA 2IF0A 4M1EA 2WKSA 1CS0A 1XQXA 2AMLA 4FS3A 1UINA 4NAUA 1EKXA 3FZQA 3HRIA 2X8LA 3U4DA 3OZIA 3QELB 1HMYA 4LGCA 2FU5C 4QBKA 3KVVA 3THWA 1N3IA 2BGMA 1AJEA 1Q0TA 5KPDA 4RAOA 5ADWA 4I6EA 4J7XA 4KYUA 4PE5B 3LCCA 3QX9A 1FU7A 3SEZA 4ID9A 2WWIA 4MGKR 3IMCA 1MOZA 1KBQA 4IUCS 1QFMA 2CLCX 4YP7A 2C78A 1RAHA 2HA3A 4RXMA 3RTAA 4B87A 4EFNA 1KU6A 3QLVC 1CR0A 1NFFA 1TLLA 4YECA 4DWJA 3LBAA 1MUUA 2ZSDA 5C1PA 1D2EA 4OMUA 2HLNA 2XDAA 2C5GA 1P2TA 3KAQA 3PUYA 4J6EA 4ZYWA 3GFPA 2ON6A 1I7DA 4MQEA 1SC3A 3L40A 1CF9A 3R5HA 3JV7A 5G53C 1T1JA 3B6IA 3AVOA 2OM2A 2VWGA 4N6OA 1WUIS 2PUFA 1BH2A 1NAIA 5ICEA 3CH6A 1G20E 1MW9X 3M3YI 4MVXA 5IANA 5KDOA 2ENUA 2AVNA 5EGNA 1T9BA 3PJDA 3S55A 3SSNA 3BWDD 3NALA 2ZTHA 1DO0A 1ZMOA 1RI4A 4FI3C 5I4BA 2V9CA 2WAYA 3Q2OA 2H3HA 5KKAA 2J3EA 3IKLA 5J2UA 1GGEA 2E4XA 5F1OA 4I9UA 3ZXUB 2AEFA 2X3YA 2XSZD 3C87A 3CEAA 3EFOA 4WZAB 2HD4A 3PBKA 2J7PA 3STWA 3OSZA 1WQ4A 1GGNA 4R1TA 1G8YA 2OQRA 3EISA 3K7AI 1K9VF 1ISPA 2ZCUA 3EXEB 5AM2A 1W4ZA 4CM9D 2XRZA 2G5TA 3HB0A 3EAGA 1Z5VA 2JRLA 2R3SA 5IT5A 3L4SO 2VNHA 2O1SA 2CVHA 4ALJA 4RMGA 1XEXB 1UQRA 4QVIA 1GYPA 2QTVB 1JU9A 3GJTA 5ENVA 4LISA 3GLFB 4W7SA 3K9HA 5L45A 1SUIA 4I5IA 4QVKA 1KEEB 3MFYA 3UF0A 3KJHA 4AUNA 3U7GA 3K20A 1PDWA 1XX6A 2NU9A 1CDDA 2GBIA 4LZPA 3O7WA 4B8WA 1E2FA 1KOFA 4Y9TA 2OQ2A 4FC6A 1T3SA 5CB8A 1K2WA 3L8ZA 1FNBA 4G81A 2OO7A 2W2OA 4J49A 2B4KA 1Y3BE 1YGYA 2D1QA 2NWQA 2ZI7A 4I1YA 3IALA 3UGKA 4ER5A 2OXFA 4Y2GA 2J09A 3NVAA 1ZRNA 1YAJA 2WSSA 3A9RA 5CCBA 4BZWA 3CCBA 1XZAA 5C44I 1L5SA 2NV0A 3ICEA 2IS1A 2I7TA 3EVEA 3IAUA 2V6JA 4IX1A 1UIRA 1W8IA 4JUAA 2Z0MA 3HCNA 1GN9A 3GLGB 1JS1X 5JLJA 2LVBA 1QVZA 2BP7B 3VUEA 4JP2A 3OOEA 2IKQA 3MCVA 2BY4A 3G0BA 4V0OA 5AOBA 3ETDA 4ZGBA 4RCYA 2NTVA 1DT5A 2XE6A 3GT4A 1OLSB 4E03A 2VSFA 3H97A 1KIMA 1Y63A 2C5AA 3K31A 5FTLA 1AQJA 3TDHB 3UMJA 5SZKB 2BHSA 2AOUB 3A1VA 3HOVI 1JDVA 2J9YB 4FNAA 4FYXA 1I13A 2FWRA 3ET4A 3T4UA 4CKCA 2W8BB 1SBCA 2OL4A 2B6HA 3DZFA 4X1IA 2F8TA 4KSBA 2Q5EA 3E0XA 4E11A 3X2EA 2QW0X 4DCUA 5KUTA 3VI4B 2DVMA 2V7PA 4FD2A 5H70A 5A4FS 3GFBA 4R7ZA 3ADBA 1K732 4G1VA 3UMGA 2E4WA 4MROA 4MV0A 4M0CA 1NLMA 3RHFA 1NHGA 4FZVA 5GZ1A 5BW4A 4ZQFA 3PI6A 4RV4A 1IXRC 1MDFA 1H22A 3BXFA 4K3UA 4LYDA 4HP8A 1QR2A 1KFCB 2OILA 1WXQA 3HFJA 1UJ6A 5KYKA 3PUVA 1KS2A 3U0BA 2WU4A 4RDHA 4FEGA 4YMHA 3NPAA 2EBHX 2AG0A 1FVFA 1WPXA 2J9FB 4KAFA 2BGNA 1MNAA 2HBRA 2Y1XA 2JAUA 2J3QA 3BOSA 3IJRA 4K6KA 1Y80A 1E7MA 4FN4A 4Q00A 5C0OE 1K7SN 3LP6A 3MNFA 5CH8A 3L6BA 4FZ3A 4FBLA 5PGMA 4C4SA 3GLIE 2PT9A 1XXHA 2N3ZA 3I0ZA 2QN3A 1EUZA 3L77A 1W30A 1E3DA 2BHNA 2ACWA 1UBUS 2EQ5A 3BZBA 3ND5A 1SIBE 2BEVB 4ERNA 5LP6F 3LZ6A 2OY0A 3PGA1 1UDXA 2POQX 3LXXA 2Z2ZA 2UZ0A 1K3FA 4A91A 3CINA 4DFDA 4MCIA 2J7PD 2IIPA 3V42A 1XPOA 4NL4H 2QI9C 3AB3A 3BE5A 1GL9B 3MJRA 1FMJA 3MMPA 1OVMA 1D8TA 3PQFA 3QNUA 3I30X 4Q3AA 2C8LA 2J45A 4Z8XA 1XMXA 1ESDA 2BBOA 1NIPA 2BM1A 5KNBA 2XUHA 3MWYW 4RIEA 4WY5A 5LNK6 1E3LA 2UZ4A 2G25A 5DF1A 4ATNA 1NPTO 1BOFA 2IVZA 5HK8A 3ZE6A 1EUDB 2O6LA 5A9SB 4FOOA 5AD1A 3MTAA 1KXJA 3FD8A 3H4MA 1EFKA 5E6RB 3WWEA 3ZHOA 4ENTA 2QBYA 3C3CA 4KP7A 4KFCA 2HJSA 4OI1A 2P6PA 2VDVE 4GQBA 5REQA 2AIRA 5DHFA 3R23A 3BMCA 1Z37A 2HDWA 4FKZA 3CRNA 3G2QA 1EJ0A 4HXYA 1Z75A 4TWAA 3I5MA 3K32A 5EMKA 3KHTA 3FTCA 2AQIA 2IQ5A 2NO0A 1M2VA 2YYYA 4Z86A 4V02A 5JNLA 2AN5A 3JZMA 3DOJA 4ZYTA 5L3QA 3IHWA 1QS0A 1MT3A 2EFEB 3PHIA 4CLRB 3KM0A 1I4EB 2Y4OA 2WSSD 1FDOA 4ZCIA 3ILXA 1YF3A 3HZRA 1MF7A 1UMBA 3QVLA 4OQ4A 1WCYA 3OX3A 2ZUEA 4C87A 1GTL1 2TMKA 4UCXA 2G70A 4ZOQI 2H18A 4JB3A 4H1UA 2ATXA 4I1VA 4ZU6X 2O14A 3KKZA 1DWOA 1NJ6A 3OJCA 4IHQA 4URHA 5BRNA 3CVVA 5JY6A 2WM8A 4QBIA 1PJ2A 1ST2A 3AT1A 3OZSA 3KZ1E 4R9UC 1OE0A 2XA9A 4RK1A 1JN0A 1LZLA 3S1QI 2ZTSA 1EWKA 6PFKA 4CG3A 4E2XA 1OLUB 3EGVA 4C7BA 1JHDA 1W2HA 2YRWA 2HWKA 3NHLA 4BN4A 4D8TA 2CLLB 3IR6A 2WFAA 2O5RA 2WWXA 3PR3A 4R1OA 1FFXA 1HZJA 5DHRA 5ALDA 5EJAA 1QLWA 1TIPA 1YS2X 4MPJA 3ENKA 4F4DA 1QG6A 1O96A 2VYNA 1APBA 1WHSB 2E18A 2RT9A 2HPAA 1K5PA 4RANA 1T3HA 3BTOA 4I1SA 3UW1A 4B3MB 2H5IA 4WESA 5C8YB 1PF7E 4JUFA 3ZHYA 4WK2B 1ZL0A 2ZT8A 2TS1A 2GJ4A 3HH8A 3MM4A 3QH4A 3AKEA 4NV3A 3C8HA 2CYCA 3DTYA 3SR0A 4HAWA 4BRSA 5IDQA 1XBTA 1HF3A 3QU5A 3NH6A 3PNSA 1FNSA 2YJTD 4AX8A 4M46A 1TE2A 1NJ8A 4G9GA 4FGWA 1ZUWA 2QE6A 4BKQA 3R2JA 1UBCA 3LTEA 4LC1A 2BL4A 5EXEA 5YASA 4AURA 1CUSA 1L4YA 2BYTA 3A6FA 2XT6A 2R4TA 4JSYA 3T9DA 4TKUA 3NGMA 3TXYA 3VR5D 3PJRA 2CV0A 4ACAA 4ENRA 2O20A 4KBFA 3A14A 3WJ7A 2JFPA 3IOBA 4YMIA 4ZQIA 5HF8A 3HA7A 2CFIA 4D98A 2IYUA 5CYGA 1ZKDA 2F8MA 3DVAA 5BSRA 2VJDA 4Q37A 3RFUA 3V1UA 1P7CA 2I8AA 3SMVA 4WK4B 1WPRA 2P1ZA 5DE3A 1B0UA 4U2DA 1A76A 2RIPA 2QYTA 3PT5A 1I7QB 1WUYA 3SS8A 4N5DA 3W4IA 1U2TA 3EOAI 4G9EA 1QTNA 3T8YA 3TD6A 5FB3A 5EWJA 1ZNWA 4P83A 3SQXA 4G0UA 2RB5A 3AERB 4CM1A 2BUBA 3GEEA 3OF2A 4ZC8A 2B94A 5ELMA 2VQEB 1POWA 1DKNA 3TNLA 5ALYA 1ZH2A 2QVXX 5KNBD 5KQMA 1DUIA 5C37A 1UBRS 4C7XA 1L8XA 3LL7A 1OBFO 1T0BA 2VP2A 3HDQA 2YZKA 4DPMA 3ZJ5A 4LNUA 4EL0A 3KL4A 2J9RA 4D9EA 4CKXA 3NRJA 5EZYA 3PQDA 4NJMB 1A96A 3QX7A 3VR2A 4II7A 1Q91A 1TM1E 2W98A 4S12A 4DKXA 3E1KA 1H2WA 3R6DA 1YZUA 2ZB4A 2WF5A 4OQXA 3A28A 5FO1A 5FRDA 1T2AA 3QFHA 2R6FA 4YRZA 3FLMA 3LUHA 4B3IA 2GETA 3KWFA 4QNNA 4BGVA 3TBKA 5IDWA 1IBLB 1UAAA 4QQRA 1NVVR 1YL5A 2JGLA 4PC3A 2HSWA 3KCNA 2IZ1A 2VP9A 4P3PA 4L8WB 2OTL1 2QOEA 2ZIGA 4O1IA 4B3BA 3RU3A 1ZC3A 5AM4A 4LKOA 2JC3A 3HVJA 4H08A 3WZ2A 4HPXB 2G3YA 3MERA 1THZA 2JGDA 4LCEA 4QOJA 3TM5A 4PNEA 4OQQA 1KY5A 2WG1A 4NS1A 4OSPA 4Y1FA 3ZBQA 2XQJA 4M1QA 5BVHB 4ZWNA 3TH5A 4KR6A 1YVDA 4AF6A 2DM6A 4H15A 2YZNA 1X92A 4NBHA 2DBRA 2GZSA 3CLSC 3KBOA 3P20A 4LRTB 2JDID 5ES4B 3PVCA 1I2BA 1NQVA 2AK2A 2ATCA 5F3RA 4Z6KA 2JA1A 5KC9A 3NHPA 2BM9A 3WISA 2WABA 4S1OA 5CEJA 4MULA 3V00A 2O52A 4CKBA 4ZGWA 4U02A 4Y2PA 1M0TA 4LVOA 2J08A 3PICA 5E2BA 2VYND 1ZK1A 4XYGA 3LPDA 4J0KA 1A77A 3ZGVA 4C6RA 1E18A 5BR7A 8MHTA 2CF5A 2BEWB 1LVGA 2DPLA 3IIEA