3GTGI

Backtracked rna polymerase ii complex with 12mer rna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 9
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtgI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtgI02
3I07A 3GTQI 2F4MA 3S1NI 2JR6A 1TWGI 2JNYA 3ESWA 3S1MI 1Y1VS 3M3YI 4A3BI 3GTLI 2R93I 3HOZI 3GTGI 1L1OC 3HOYI 1TWCI 1N2FA 2VUMI 3CQZI 3FKII 3GTOI 3U50C 3HOVI 1I50I 1ZB8A 5C4XI 1TWAI 2NVYI 4X6AI 4NBHA 1RLYA 4QTTA 1Y1WI 4BBSI 3GCFA 2F4OA 1TWHI 2KPIA 1ZB9A 2JA7I 3VMIA 4Y7NI 4A3JI 1ML8A 3GTKI 1QYPA 1K83I 3I4MI 3RZOI 5C4JI 4NBBA 4NBDA 3S17I 4A3II 2JA5I 3VMHA 3GTMS 1USPB 1WW9A 2NVTI 4A3CI 4NBEA 2E2HI 2R92I 5C44I 2JA6I 3PO3I 1LQLA 4BY1I 3S1RI 4A3DI 4NBGA 4NB8A 1I6HI 5FLMI 3PO2I 4NOZA 3H0GI 3D6WA 3S2DI 2NVXI 1DL6A 3EERA 2E2JI 4A93I 2E2II 2P3YA 1YUAA 2J6AA 2YU9I 3M4OI 1TWFI 4A3FI 2DE6A 2K5RA 3S14I 4A3MI 4A3GI 3GTPI 1USPA 4QTUA 5CM2M 1NUIA 1PFTA 4XX2A 3H3VJ 1WCMI 1SFOI 2DE5A 3HOUI 3GTJI 4BBRI 4NBAA 3HOWI 3HOXI 2DE7A 1Y1VI 4NBFA 4Y52I 4A3EI 2B63I 5IP9I 2PK7A 2NVQI 3RZDI 4NBCA 1RO4A 1VLAA 4NB9A 3VMGA 3S1QI 4A3LI 3I4NI 2HF1A 3LUSA 3K7AI 5IP7I 2AKLA 3S2HI 1X3WA 4A3KI 2JS4A 3GKQA 4BXXI 2R7ZI 3S16I 1R9TI 3PO3S 3S15I 2RBLA 1TFIA 1I3QI 3GTMI 2JA8I 4BY7I 1X3ZA 4MH4A 3VB9A 3Q87A 2BJOA 5C3EI
chains in the Genus database with same CATH superfamily
1NP6A 3EEDA 1TWGI 1W2BZ 2LEXA 3J81b 3M3YI 3J81f 3GTGI 1L1OC 1KQSZ 3CQZI 2JIRA 1VQ8Z 1RLYA 3CD6Z 1Y1WI 3OW2Y 1TWHI 2KPIA 4Y7NI 3MZKB 1YIJ1 5C4JI 1VQ71 1QVGZ 3GTMS 2NVTI 3G6EZ 4A3CI 2V8JA 2R92I 2QLVB 5C44I 3P5JB 3MONA 1S721 3PO3I 1VQ41 4NFRA 2JMOA 1FDOA 4NB8A 4NBGA 4HH4A 3CCRZ 1VQL1 1Q7Y1 4RVFA 3G711 3PO2I 2LIYA 2Q51A 3CCQZ 1JWHC 1M902 1WJ2A 1WZNA 2V8KA 2J6AA 2P28A 3M4OI 3JAMb 5AN9F 4A3FI 4MD7A 2JIPA 2VUGA 2VPWA 3GTPI 2QA4Z 1Q16A 4QTUA 3CCLZ 1WIIA 2IV2X 1W2BY 1PFTA 3H3VJ 2OZKA 4EWCA 2QA41 4BBRI 2DE7A 1RO0A 3CCS1 1K8A1 2GTIA 3CC71 3I4NI 3CCL1 1YJW1 1JJ2Y 3GKQA 1M901 2G2KA 4E31A 4E2YA 5A2Qb 1VQ4Z 3CPWY 4MD9A 1I3QI 3CMA1 3CCV1 3NDJA 1Q821 3CXCY 3NFZA 2RT9A 5C3EI 2JIQA 2QRDB 3F3PC 3S1MI 4A3BI 3GTLI 4E2WA 1N2FA 1YJWZ 1YJ9Z 3OW2Z 5FLXb 1ZB8A 2I3CA 2NVYI 1YJN1 4HGZA 4X6AI 1AA6A 3GCFA 1YI2Z 2F4OA 3CMEZ 1RQFA 1QYPA 2M6NA 1VQP1 3TDHB 1K9M1 3RZOI 3VTNA 2W03A 5T64A 4NBBA 3CCU1 3G71Z 4A3II 4DQYB 3VMHA 3F3FC 1USPB 1WW9A 4NBEA 2JIOA 3BG0B 2QKDA 1FDIA 1VQ7Z 3H0GI 1VQK1 3S2DI 1DL6A 4DGLA 2YADA 1K8A2 3CCJ1 1JJ2Z 1ZH1A 4E2ZA 2OTJ1 4A3MI 2QEX1 1USPA 3MZLB 1NUIA 2OTL1 1WCMI 1YIJZ 1S72Z 1KD12 1YHQ1 2E7ZA 4HGYA 1K732 4NBAA 4S1TA 3HOXI 1Y1VI 4Y52I 2B63I 2VF1A 5IP9I 2NVQI 3RZDI 1VLAA 4NB9A 4A3LI 2HF1A 3IX0A 5IP7I 2AKLA 1X3WA 1VQN1 3D9XA 2M48A 1R9TI 3PO3S 2KI7B 3GTMI 4RS4A 1VQNZ 3CME1 1VQKZ 3I551 3CPWZ 3GTQI 4MXUA 1QVFY 2PM9A 2F4MA 2OOXB 1YJNZ 4AYBA 2Q4ZA 1Z01A 2JNYA 3KIFA 4E32A 3HOZI 3KIHA 2AYDA 1TWCI 3CCR1 1VQLZ 2GTHA 1YUKA 3NH4A 2VUMI 5D1OB 3FKII 3QWUA 3GTOI 3U50C 3NDIA 3G4S1 1I50I 1VQ91 1YITZ 4NBHA 4QTTA 1Q811 1NJI2 2WAQA 3D2LA 3VMIA 3I561 4A3JI 1VQM1 3GTKI 3CC4Z 3CMAZ 1NJI1 3FQMA 2JA5I 1YJ91 2QEXZ 1Z02A 1VQ51 2JA6I 3IF8A 1LQLA 3CC7Z 1KRLA 5D1OA 2RIQA 1N8R1 4BY1I 1VQMZ 4MD8A 3I56Z 3FQQA 1I6HI 5FLMI 2QRCB 2E9HA 4NOZA 3D6WA 3CCMZ 3IFUA 1VQ61 2E2JI 1VQ81 2Y0SA 3JAMf 2VPXA 2OOYB 1KC81 2W04A 1K9M2 2K5RA 2DE6A 1QVFZ 3S14I 5CM2M 4XX2A 3CCUZ 5D1PA 1P9NA 2O53A 1S7MA 3CCM1 1VQ6Z 2DE5A 4NH1C 1KQSY 2PK7A 2R6MA 1RO4A 3VMGA 2QREB 4DK1A 3LUSA 4TNUA 3S2HI 5T6BA 1Q861 4A3KI 2NAPA 3S16I 3J80b 3S15I 1YHQZ 4RVGA 2V8IA 2JA8I 3NH8A 2OTLZ 1X3ZA 4MH4A 3J7A4 3NH5A 3CXCZ 3Q87A 1Y8CA 2BJOA 1N8R2 5FLXf 1QF8A 4E2XA 3I07A 1M1K2 2V45A 3S1NI 2JR6A 5T67A 3ESWA 1QXFA 1Y1VS 4E33A 2H85A 2R93I 1X0TA 3IR7A 3HOYI 4MRIA 3TE5B 3G6E1 3BG1B 2EGTA 4CL1A 2GU2A 3HOVI 5C4XI 1TWAI 3CC41 2K3RA 4BBSI 3CCSZ 3I55Z 2ZAEB 1Q822 1ZB9A 2JA7I 5A2Qf 1ML8A 3J80f 3CD61 1K83I 1VQPZ 3I4MI 4RVDA 4NBDA 3S17I 1SIWA 1M1K1 1RNIA 2V3VA 2VPYA 1K731 2E2HI 1KD11 2IZ4A 5IT9b 2QR1B 3S1RI 1VQ5Z 4A3DI 2IZ3A 1YI21 1Q812 1VQOZ 1Q862 2NVXI 3EERA 4A93I 4E30A 5LL6f 2JIMA 2PMZA 2E2II 2P3YA 1YUAA 3CCEZ 2YU9I 1TWFI 3CCQ1 4RV9A 2OTJZ 4A3GI 2WB1A 2RHBA 3CCVZ 1SFOI 2O4HA 1Q7Y2 3HOUI 3GTJI 1VQO1 3HOWI 5IT9f 2LFUA 4NBFA 4RVHA 1KC82 4A3EI 4MONA 3CCE1 2JUBA 1QVGY 4NBCA 1RO2A 1VQ9Z 3G4SZ 3S1QI 2VPZA 3K7AI 3HKZA 2RPRA 2JS4A 3CC2Z 4BXXI 2HU9A 2R7ZI 2RBLA 1YIT1 1TFIA 4BY7I 1Z03A 3T4NB 3CCJZ 3VB9A 3CC21
chains in the Genus database with same CATH topology
1NP6A 3EEDA 1TWGI 1W2BZ 3J81b 3M3YI 3J81f 3GTGI 1L1OC 1KQSZ 3CQZI 1VQ8Z 1RLYA 3CD6Z 1Y1WI 3OW2Y 1TWHI 2KPIA 4Y7NI 3MZKB 1YIJ1 5C4JI 1VQ71 1QVGZ 3GTMS 2NVTI 3G6EZ 4A3CI 2V8JA 2R92I 2QLVB 5C44I 3P5JB 3MONA 1S721 3PO3I 1VQ41 4NFRA 2JMOA 4NB8A 4NBGA 4HH4A 3CCRZ 1VQL1 1Q7Y1 4RVFA 3G711 3PO2I 2LIYA 2Q51A 3CCQZ 1JWHC 1M902 2V8KA 2J6AA 2P28A 3M4OI 3JAMb 5AN9F 4A3FI 4MD7A 2VUGA 3GTPI 2QA4Z 4QTUA 3CCLZ 1WIIA 1W2BY 1PFTA 3H3VJ 2OZKA 4EWCA 2QA41 4BBRI 2DE7A 1RO0A 3CCS1 1K8A1 2GTIA 3CC71 3I4NI 3CCL1 1YJW1 1JJ2Y 3GKQA 1M901 2G2KA 4E31A 4E2YA 5A2Qb 1VQ4Z 3CPWY 4MD9A 1I3QI 3CMA1 3CCV1 3NDJA 1Q821 3CXCY 3NFZA 2RT9A 5C3EI 2QRDB 3F3PC 3S1MI 4A3BI 3GTLI 4E2WA 1N2FA 1YJWZ 1YJ9Z 3OW2Z 5FLXb 1ZB8A 2I3CA 2NVYI 1YJN1 4HGZA 4X6AI 3GCFA 1YI2Z 2F4OA 3CMEZ 1RQFA 1QYPA 2M6NA 1VQP1 3TDHB 1K9M1 3RZOI 3VTNA 2W03A 5T64A 4NBBA 3CCU1 3G71Z 4A3II 4DQYB 3VMHA 3F3FC 1USPB 1WW9A 4NBEA 3BG0B 2QKDA 1VQ7Z 3H0GI 1VQK1 3S2DI 1DL6A 4DGLA 2YADA 1K8A2 3CCJ1 1JJ2Z 1ZH1A 4E2ZA 2OTJ1 4A3MI 2QEX1 1USPA 3MZLB 1NUIA 2OTL1 1WCMI 1YIJZ 1S72Z 1KD12 1YHQ1 4HGYA 1K732 4NBAA 4S1TA 3HOXI 1Y1VI 4Y52I 2B63I 2VF1A 5IP9I 2NVQI 3RZDI 1VLAA 4NB9A 4A3LI 2HF1A 3IX0A 5IP7I 2AKLA 1X3WA 1VQN1 3D9XA 2M48A 1R9TI 3PO3S 2KI7B 3GTMI 4RS4A 1VQNZ 3CME1 1VQKZ 3I551 3CPWZ 3GTQI 4MXUA 1QVFY 2PM9A 2F4MA 2OOXB 1YJNZ 4AYBA 2Q4ZA 1Z01A 2JNYA 3KIFA 4E32A 3HOZI 3KIHA 1TWCI 3CCR1 1VQLZ 2GTHA 1YUKA 3NH4A 2VUMI 5D1OB 3FKII 3QWUA 3GTOI 3U50C 3NDIA 3G4S1 1I50I 1VQ91 1YITZ 4NBHA 4QTTA 1Q811 1NJI2 2WAQA 3VMIA 3I561 4A3JI 1VQM1 3GTKI 3CC4Z 3CMAZ 1NJI1 3FQMA 2JA5I 1YJ91 2QEXZ 1Z02A 1VQ51 2JA6I 3IF8A 1LQLA 1KRLA 5D1OA 3CC7Z 2RIQA 1N8R1 4BY1I 1VQMZ 4MD8A 3I56Z 3FQQA 1I6HI 5FLMI 2QRCB 2E9HA 4NOZA 3D6WA 3CCMZ 3IFUA 1VQ61 2E2JI 1VQ81 2Y0SA 3JAMf 2OOYB 1KC81 2W04A 1K9M2 2K5RA 2DE6A 1QVFZ 3S14I 5CM2M 4XX2A 3CCUZ 5D1PA 1P9NA 2O53A 1S7MA 3CCM1 1VQ6Z 2DE5A 4NH1C 1KQSY 2PK7A 2R6MA 1RO4A 3VMGA 2QREB 4DK1A 3LUSA 4TNUA 3S2HI 5T6BA 1Q861 4A3KI 3S16I 3J80b 3S15I 1YHQZ 4RVGA 2V8IA 2JA8I 3NH8A 2OTLZ 1X3ZA 4MH4A 3J7A4 3NH5A 3CXCZ 3Q87A 2BJOA 1N8R2 5FLXf 1QF8A 4E2XA 3I07A 1M1K2 3S1NI 2JR6A 5T67A 3ESWA 1Y1VS 4E33A 2H85A 2R93I 1X0TA 3HOYI 4MRIA 3TE5B 3G6E1 3BG1B 2EGTA 4CL1A 2GU2A 3HOVI 5C4XI 1TWAI 3CC41 2K3RA 4BBSI 3CCSZ 3I55Z 2ZAEB 1Q822 1ZB9A 2JA7I 5A2Qf 1ML8A 3J80f 3CD61 1K83I 1VQPZ 3I4MI 4RVDA 4NBDA 3S17I 1M1K1 1RNIA 1K731 2E2HI 1KD11 2IZ4A 5IT9b 2QR1B 3S1RI 1VQ5Z 4A3DI 2IZ3A 1YI21 1Q812 1VQOZ 1Q862 2NVXI 3EERA 4A93I 4E30A 5LL6f 2PMZA 2E2II 2P3YA 1YUAA 3CCEZ 2YU9I 1TWFI 3CCQ1 4RV9A 2OTJZ 4A3GI 2WB1A 2RHBA 3CCVZ 1SFOI 2O4HA 1Q7Y2 3HOUI 3GTJI 1VQO1 3HOWI 5IT9f 2LFUA 4NBFA 4RVHA 1KC82 4A3EI 4MONA 3CCE1 2JUBA 1QVGY 4NBCA 1RO2A 1VQ9Z 3G4SZ 3S1QI 3K7AI 3HKZA 2RPRA 2JS4A 3CC2Z 4BXXI 2HU9A 2R7ZI 2RBLA 1YIT1 1TFIA 4BY7I 1Z03A 3T4NB 3CCJZ 3VB9A 3CC21
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I07 A;  3GTQ I;  2F4M A;  3S1N I;  2JR6 A;  1TWG I;  2JNY A;  3ESW A;  3S1M I;  1Y1V S;  3M3Y I;  4A3B I;  3GTL I;  2R93 I;  3HOZ I;  3GTG I;  1L1O C;  3HOY I;  1TWC I;  1N2F A;  2VUM I;  3CQZ I;  3FKI I;  3GTO I;  3U50 C;  3HOV I;  1I50 I;  1ZB8 A;  5C4X I;  1TWA I;  2NVY I;  4X6A I;  4NBH A;  1RLY A;  4QTT A;  1Y1W I;  4BBS I;  3GCF A;  2F4O A;  1TWH I;  2KPI A;  1ZB9 A;  2JA7 I;  3VMI A;  4Y7N I;  4A3J I;  1ML8 A;  3GTK I;  1QYP A;  1K83 I;  3I4M I;  3RZO I;  5C4J I;  4NBB A;  4NBD A;  3S17 I;  4A3I I;  2JA5 I;  3VMH A;  3GTM S;  1USP B;  1WW9 A;  2NVT I;  4A3C I;  4NBE A;  2E2H I;  2R92 I;  5C44 I;  2JA6 I;  3PO3 I;  1LQL A;  4BY1 I;  3S1R I;  4A3D I;  4NBG A;  4NB8 A;  1I6H I;  5FLM I;  3PO2 I;  4NOZ A;  3H0G I;  3D6W A;  3S2D I;  2NVX I;  1DL6 A;  3EER A;  2E2J I;  4A93 I;  2E2I I;  2P3Y A;  1YUA A;  2J6A A;  2YU9 I;  3M4O I;  1TWF I;  4A3F I;  2DE6 A;  2K5R A;  3S14 I;  4A3M I;  4A3G I;  3GTP I;  1USP A;  4QTU A;  5CM2 M;  1NUI A;  1PFT A;  4XX2 A;  3H3V J;  1WCM I;  1SFO I;  2DE5 A;  3HOU I;  3GTJ I;  4BBR I;  4NBA A;  3HOW I;  3HOX I;  2DE7 A;  1Y1V I;  4NBF A;  4Y52 I;  4A3E I;  2B63 I;  5IP9 I;  2PK7 A;  2NVQ I;  3RZD I;  4NBC A;  1RO4 A;  1VLA A;  4NB9 A;  3VMG A;  3S1Q I;  4A3L I;  3I4N I;  2HF1 A;  3LUS A;  3K7A I;  5IP7 I;  2AKL A;  3S2H I;  1X3W A;  4A3K I;  2JS4 A;  3GKQ A;  4BXX I;  2R7Z I;  3S16 I;  1R9T I;  3PO3 S;  3S15 I;  2RBL A;  1TFI A;  1I3Q I;  3GTM I;  2JA8 I;  4BY7 I;  1X3Z A;  4MH4 A;  3VB9 A;  3Q87 A;  2BJO A;  5C3E I; 
#chains in the Genus database with same CATH topology
 1NP6 A;  3EED A;  1TWG I;  1W2B Z;  2LEX A;  3J81 b;  3M3Y I;  3J81 f;  3GTG I;  1L1O C;  1KQS Z;  3CQZ I;  2JIR A;  1VQ8 Z;  1RLY A;  3CD6 Z;  1Y1W I;  3OW2 Y;  1TWH I;  2KPI A;  4Y7N I;  3MZK B;  1YIJ 1;  5C4J I;  1VQ7 1;  1QVG Z;  3GTM S;  2NVT I;  3G6E Z;  4A3C I;  2V8J A;  2R92 I;  2QLV B;  5C44 I;  3P5J B;  3MON A;  1S72 1;  3PO3 I;  1VQ4 1;  4NFR A;  2JMO A;  1FDO A;  4NB8 A;  4NBG A;  4HH4 A;  3CCR Z;  1VQL 1;  1Q7Y 1;  4RVF A;  3G71 1;  3PO2 I;  2LIY A;  2Q51 A;  3CCQ Z;  1JWH C;  1M90 2;  1WJ2 A;  1WZN A;  2V8K A;  2J6A A;  2P28 A;  3M4O I;  3JAM b;  5AN9 F;  4A3F I;  4MD7 A;  2JIP A;  2VUG A;  2VPW A;  3GTP I;  2QA4 Z;  1Q16 A;  4QTU A;  3CCL Z;  1WII A;  2IV2 X;  1W2B Y;  1PFT A;  3H3V J;  2OZK A;  4EWC A;  2QA4 1;  4BBR I;  2DE7 A;  1RO0 A;  3CCS 1;  1K8A 1;  2GTI A;  3CC7 1;  3I4N I;  3CCL 1;  1YJW 1;  1JJ2 Y;  3GKQ A;  1M90 1;  2G2K A;  4E31 A;  4E2Y A;  5A2Q b;  1VQ4 Z;  3CPW Y;  4MD9 A;  1I3Q I;  3CMA 1;  3CCV 1;  3NDJ A;  1Q82 1;  3CXC Y;  3NFZ A;  2RT9 A;  5C3E I;  2JIQ A;  2QRD B;  3F3P C;  3S1M I;  4A3B I;  3GTL I;  4E2W A;  1N2F A;  1YJW Z;  1YJ9 Z;  3OW2 Z;  5FLX b;  1ZB8 A;  2I3C A;  2NVY I;  1YJN 1;  4HGZ A;  4X6A I;  1AA6 A;  3GCF A;  1YI2 Z;  2F4O A;  3CME Z;  1RQF A;  1QYP A;  2M6N A;  1VQP 1;  3TDH B;  1K9M 1;  3RZO I;  3VTN A;  2W03 A;  5T64 A;  4NBB A;  3CCU 1;  3G71 Z;  4A3I I;  4DQY B;  3VMH A;  3F3F C;  1USP B;  1WW9 A;  4NBE A;  2JIO A;  3BG0 B;  2QKD A;  1FDI A;  1VQ7 Z;  3H0G I;  1VQK 1;  3S2D I;  1DL6 A;  4DGL A;  2YAD A;  1K8A 2;  3CCJ 1;  1JJ2 Z;  1ZH1 A;  4E2Z A;  2OTJ 1;  4A3M I;  2QEX 1;  1USP A;  3MZL B;  1NUI A;  2OTL 1;  1WCM I;  1YIJ Z;  1S72 Z;  1KD1 2;  1YHQ 1;  2E7Z A;  4HGY A;  1K73 2;  4NBA A;  4S1T A;  3HOX I;  1Y1V I;  4Y52 I;  2B63 I;  2VF1 A;  5IP9 I;  2NVQ I;  3RZD I;  1VLA A;  4NB9 A;  4A3L I;  2HF1 A;  3IX0 A;  5IP7 I;  2AKL A;  1X3W A;  1VQN 1;  3D9X A;  2M48 A;  1R9T I;  3PO3 S;  2KI7 B;  3GTM I;  4RS4 A;  1VQN Z;  3CME 1;  1VQK Z;  3I55 1;  3CPW Z;  3GTQ I;  4MXU A;  1QVF Y;  2PM9 A;  2F4M A;  2OOX B;  1YJN Z;  4AYB A;  2Q4Z A;  1Z01 A;  2JNY A;  3KIF A;  4E32 A;  3HOZ I;  3KIH A;  2AYD A;  1TWC I;  3CCR 1;  1VQL Z;  2GTH A;  1YUK A;  3NH4 A;  2VUM I;  5D1O B;  3FKI I;  3QWU A;  3GTO I;  3U50 C;  3NDI A;  3G4S 1;  1I50 I;  1VQ9 1;  1YIT Z;  4NBH A;  4QTT A;  1Q81 1;  1NJI 2;  2WAQ A;  3D2L A;  3VMI A;  3I56 1;  4A3J I;  1VQM 1;  3GTK I;  3CC4 Z;  3CMA Z;  1NJI 1;  3FQM A;  2JA5 I;  1YJ9 1;  2QEX Z;  1Z02 A;  1VQ5 1;  2JA6 I;  3IF8 A;  1LQL A;  3CC7 Z;  1KRL A;  5D1O A;  2RIQ A;  1N8R 1;  4BY1 I;  1VQM Z;  4MD8 A;  3I56 Z;  3FQQ A;  1I6H I;  5FLM I;  2QRC B;  2E9H A;  4NOZ A;  3D6W A;  3CCM Z;  3IFU A;  1VQ6 1;  2E2J I;  1VQ8 1;  2Y0S A;  3JAM f;  2VPX A;  2OOY B;  1KC8 1;  2W04 A;  1K9M 2;  2K5R A;  2DE6 A;  1QVF Z;  3S14 I;  5CM2 M;  4XX2 A;  3CCU Z;  5D1P A;  1P9N A;  2O53 A;  1S7M A;  3CCM 1;  1VQ6 Z;  2DE5 A;  4NH1 C;  1KQS Y;  2PK7 A;  2R6M A;  1RO4 A;  3VMG A;  2QRE B;  4DK1 A;  3LUS A;  4TNU A;  3S2H I;  5T6B A;  1Q86 1;  4A3K I;  2NAP A;  3S16 I;  3J80 b;  3S15 I;  1YHQ Z;  4RVG A;  2V8I A;  2JA8 I;  3NH8 A;  2OTL Z;  1X3Z A;  4MH4 A;  3J7A 4;  3NH5 A;  3CXC Z;  3Q87 A;  1Y8C A;  2BJO A;  1N8R 2;  5FLX f;  1QF8 A;  4E2X A;  3I07 A;  1M1K 2;  2V45 A;  3S1N I;  2JR6 A;  5T67 A;  3ESW A;  1QXF A;  1Y1V S;  4E33 A;  2H85 A;  2R93 I;  1X0T A;  3IR7 A;  3HOY I;  4MRI A;  3TE5 B;  3G6E 1;  3BG1 B;  2EGT A;  4CL1 A;  2GU2 A;  3HOV I;  5C4X I;  1TWA I;  3CC4 1;  2K3R A;  4BBS I;  3CCS Z;  3I55 Z;  2ZAE B;  1Q82 2;  1ZB9 A;  2JA7 I;  5A2Q f;  1ML8 A;  3J80 f;  3CD6 1;  1K83 I;  1VQP Z;  3I4M I;  4RVD A;  4NBD A;  3S17 I;  1SIW A;  1M1K 1;  1RNI A;  2V3V A;  2VPY A;  1K73 1;  2E2H I;  1KD1 1;  2IZ4 A;  5IT9 b;  2QR1 B;  3S1R I;  1VQ5 Z;  4A3D I;  2IZ3 A;  1YI2 1;  1Q81 2;  1VQO Z;  1Q86 2;  2NVX I;  3EER A;  4A93 I;  4E30 A;  5LL6 f;  2JIM A;  2PMZ A;  2E2I I;  2P3Y A;  1YUA A;  3CCE Z;  2YU9 I;  1TWF I;  3CCQ 1;  4RV9 A;  2OTJ Z;  4A3G I;  2WB1 A;  2RHB A;  3CCV Z;  1SFO I;  2O4H A;  1Q7Y 2;  3HOU I;  3GTJ I;  1VQO 1;  3HOW I;  5IT9 f;  2LFU A;  4NBF A;  4RVH A;  1KC8 2;  4A3E I;  4MON A;  3CCE 1;  2JUB A;  1QVG Y;  4NBC A;  1RO2 A;  1VQ9 Z;  3G4S Z;  3S1Q I;  2VPZ A;  3K7A I;  3HKZ A;  2RPR A;  2JS4 A;  3CC2 Z;  4BXX I;  2HU9 A;  2R7Z I;  2RBL A;  1YIT 1;  1TFI A;  4BY7 I;  1Z03 A;  3T4N B;  3CCJ Z;  3VB9 A;  3CC2 1; 
#chains in the Genus database with same CATH homology
 1NP6 A;  3EED A;  1TWG I;  1W2B Z;  3J81 b;  3M3Y I;  3J81 f;  3GTG I;  1L1O C;  1KQS Z;  3CQZ I;  1VQ8 Z;  1RLY A;  3CD6 Z;  1Y1W I;  3OW2 Y;  1TWH I;  2KPI A;  4Y7N I;  3MZK B;  1YIJ 1;  5C4J I;  1VQ7 1;  1QVG Z;  3GTM S;  2NVT I;  3G6E Z;  4A3C I;  2V8J A;  2R92 I;  2QLV B;  5C44 I;  3P5J B;  3MON A;  1S72 1;  3PO3 I;  1VQ4 1;  4NFR A;  2JMO A;  4NB8 A;  4NBG A;  4HH4 A;  3CCR Z;  1VQL 1;  1Q7Y 1;  4RVF A;  3G71 1;  3PO2 I;  2LIY A;  2Q51 A;  3CCQ Z;  1JWH C;  1M90 2;  2V8K A;  2J6A A;  2P28 A;  3M4O I;  3JAM b;  5AN9 F;  4A3F I;  4MD7 A;  2VUG A;  3GTP I;  2QA4 Z;  4QTU A;  3CCL Z;  1WII A;  1W2B Y;  1PFT A;  3H3V J;  2OZK A;  4EWC A;  2QA4 1;  4BBR I;  2DE7 A;  1RO0 A;  3CCS 1;  1K8A 1;  2GTI A;  3CC7 1;  3I4N I;  3CCL 1;  1YJW 1;  1JJ2 Y;  3GKQ A;  1M90 1;  2G2K A;  4E31 A;  4E2Y A;  5A2Q b;  1VQ4 Z;  3CPW Y;  4MD9 A;  1I3Q I;  3CMA 1;  3CCV 1;  3NDJ A;  1Q82 1;  3CXC Y;  3NFZ A;  2RT9 A;  5C3E I;  2QRD B;  3F3P C;  3S1M I;  4A3B I;  3GTL I;  4E2W A;  1N2F A;  1YJW Z;  1YJ9 Z;  3OW2 Z;  5FLX b;  1ZB8 A;  2I3C A;  2NVY I;  1YJN 1;  4HGZ A;  4X6A I;  3GCF A;  1YI2 Z;  2F4O A;  3CME Z;  1RQF A;  1QYP A;  2M6N A;  1VQP 1;  3TDH B;  1K9M 1;  3RZO I;  3VTN A;  2W03 A;  5T64 A;  4NBB A;  3CCU 1;  3G71 Z;  4A3I I;  4DQY B;  3VMH A;  3F3F C;  1USP B;  1WW9 A;  4NBE A;  3BG0 B;  2QKD A;  1VQ7 Z;  3H0G I;  1VQK 1;  3S2D I;  1DL6 A;  4DGL A;  2YAD A;  1K8A 2;  3CCJ 1;  1JJ2 Z;  1ZH1 A;  4E2Z A;  2OTJ 1;  4A3M I;  2QEX 1;  1USP A;  3MZL B;  1NUI A;  2OTL 1;  1WCM I;  1YIJ Z;  1S72 Z;  1KD1 2;  1YHQ 1;  4HGY A;  1K73 2;  4NBA A;  4S1T A;  3HOX I;  1Y1V I;  4Y52 I;  2B63 I;  2VF1 A;  5IP9 I;  2NVQ I;  3RZD I;  1VLA A;  4NB9 A;  4A3L I;  2HF1 A;  3IX0 A;  5IP7 I;  2AKL A;  1X3W A;  1VQN 1;  3D9X A;  2M48 A;  1R9T I;  3PO3 S;  2KI7 B;  3GTM I;  4RS4 A;  1VQN Z;  3CME 1;  1VQK Z;  3I55 1;  3CPW Z;  3GTQ I;  4MXU A;  1QVF Y;  2PM9 A;  2F4M A;  2OOX B;  1YJN Z;  4AYB A;  2Q4Z A;  1Z01 A;  2JNY A;  3KIF A;  4E32 A;  3HOZ I;  3KIH A;  1TWC I;  3CCR 1;  1VQL Z;  2GTH A;  1YUK A;  3NH4 A;  2VUM I;  5D1O B;  3FKI I;  3QWU A;  3GTO I;  3U50 C;  3NDI A;  3G4S 1;  1I50 I;  1VQ9 1;  1YIT Z;  4NBH A;  4QTT A;  1Q81 1;  1NJI 2;  2WAQ A;  3VMI A;  3I56 1;  4A3J I;  1VQM 1;  3GTK I;  3CC4 Z;  3CMA Z;  1NJI 1;  3FQM A;  2JA5 I;  1YJ9 1;  2QEX Z;  1Z02 A;  1VQ5 1;  2JA6 I;  3IF8 A;  1LQL A;  1KRL A;  5D1O A;  3CC7 Z;  2RIQ A;  1N8R 1;  4BY1 I;  1VQM Z;  4MD8 A;  3I56 Z;  3FQQ A;  1I6H I;  5FLM I;  2QRC B;  2E9H A;  4NOZ A;  3D6W A;  3CCM Z;  3IFU A;  1VQ6 1;  2E2J I;  1VQ8 1;  2Y0S A;  3JAM f;  2OOY B;  1KC8 1;  2W04 A;  1K9M 2;  2K5R A;  2DE6 A;  1QVF Z;  3S14 I;  5CM2 M;  4XX2 A;  3CCU Z;  5D1P A;  1P9N A;  2O53 A;  1S7M A;  3CCM 1;  1VQ6 Z;  2DE5 A;  4NH1 C;  1KQS Y;  2PK7 A;  2R6M A;  1RO4 A;  3VMG A;  2QRE B;  4DK1 A;  3LUS A;  4TNU A;  3S2H I;  5T6B A;  1Q86 1;  4A3K I;  3S16 I;  3J80 b;  3S15 I;  1YHQ Z;  4RVG A;  2V8I A;  2JA8 I;  3NH8 A;  2OTL Z;  1X3Z A;  4MH4 A;  3J7A 4;  3NH5 A;  3CXC Z;  3Q87 A;  2BJO A;  1N8R 2;  5FLX f;  1QF8 A;  4E2X A;  3I07 A;  1M1K 2;  3S1N I;  2JR6 A;  5T67 A;  3ESW A;  1Y1V S;  4E33 A;  2H85 A;  2R93 I;  1X0T A;  3HOY I;  4MRI A;  3TE5 B;  3G6E 1;  3BG1 B;  2EGT A;  4CL1 A;  2GU2 A;  3HOV I;  5C4X I;  1TWA I;  3CC4 1;  2K3R A;  4BBS I;  3CCS Z;  3I55 Z;  2ZAE B;  1Q82 2;  1ZB9 A;  2JA7 I;  5A2Q f;  1ML8 A;  3J80 f;  3CD6 1;  1K83 I;  1VQP Z;  3I4M I;  4RVD A;  4NBD A;  3S17 I;  1M1K 1;  1RNI A;  1K73 1;  2E2H I;  1KD1 1;  2IZ4 A;  5IT9 b;  2QR1 B;  3S1R I;  1VQ5 Z;  4A3D I;  2IZ3 A;  1YI2 1;  1Q81 2;  1VQO Z;  1Q86 2;  2NVX I;  3EER A;  4A93 I;  4E30 A;  5LL6 f;  2PMZ A;  2E2I I;  2P3Y A;  1YUA A;  3CCE Z;  2YU9 I;  1TWF I;  3CCQ 1;  4RV9 A;  2OTJ Z;  4A3G I;  2WB1 A;  2RHB A;  3CCV Z;  1SFO I;  2O4H A;  1Q7Y 2;  3HOU I;  3GTJ I;  1VQO 1;  3HOW I;  5IT9 f;  2LFU A;  4NBF A;  4RVH A;  1KC8 2;  4A3E I;  4MON A;  3CCE 1;  2JUB A;  1QVG Y;  4NBC A;  1RO2 A;  1VQ9 Z;  3G4S Z;  3S1Q I;  3K7A I;  3HKZ A;  2RPR A;  2JS4 A;  3CC2 Z;  4BXX I;  2HU9 A;  2R7Z I;  2RBL A;  1YIT 1;  1TFI A;  4BY7 I;  1Z03 A;  3T4N B;  3CCJ Z;  3VB9 A;  3CC2 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...