3GTGI

Backtracked rna polymerase ii complex with 12mer rna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 9
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtgI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtgI02
2E2JI 2E2HI 4NBDA 5C44I 3H3VJ 3S1QI 1K83I 4NBBA 4XX2A 4A3FI 4Y7NI 3GTKI 1Y1WI 1LQLA 1L1OC 2JR6A 5IP7I 2F4MA 3VMHA 5C4XI 4NBAA 1ML8A 2DE6A 2JA6I 2PK7A 3RZOI 1N2FA 1X3ZA 3I4NI 2VUMI 3M4OI 3ESWA 4NBEA 2HF1A 3S2HI 2NVYI 3HOZI 4NBGA 1I3QI 1YUAA 4MH4A 4BXXI 1I6HI 2B63I 2K5RA 2J6AA 3FKII 2BJOA 4QTUA 1ZB8A 1Y1VI 1NUIA 4A3DI 5FLMI 4A3CI 4X6AI 4Y52I 1ZB9A 1TWFI 3S1RI 3PO3S 3K7AI 3GTJI 1USPB 4NBHA 2NVTI 1TFIA 4BBSI 3Q87A 1USPA 1PFTA 3HOXI 3HOVI 4NBFA 3H0GI 3HOWI 4BBRI 3EERA 3GTGI 1VLAA 3I4MI 3HOUI 3S16I 4A3KI 4NBCA 5C3EI 1X3WA 1WCMI 4A3GI 3LUSA 3U50C 1DL6A 2DE7A 1Y1VS 1TWHI 2KPIA 3I07A 2JA5I 2JS4A 2JA8I 4QTTA 3PO2I 2JA7I 2R92I 3M3YI 3GTMI 3HOYI 4A3JI 3VB9A 3GTLI 3RZDI 4BY1I 1TWCI 4A93I 2JNYA 3GTOI 2NVQI 4A3LI 3CQZI 1R9TI 2NVXI 2RBLA 2YU9I 3S2DI 1SFOI 3VMIA 1RO4A 4NB9A 2P3YA 5IP9I 3GKQA 2R7ZI 1I50I 4A3EI 3S15I 3GCFA 2DE5A 3GTPI 3GTQI 3S1MI 3S17I 3PO3I 1TWGI 4NOZA 1TWAI 4A3II 4BY7I 4A3MI 2E2II 2R93I 1RLYA 3VMGA 3S14I 5C4JI 5CM2M 3GTMS 4A3BI 2F4OA 3D6WA 2AKLA 1WW9A 3S1NI 4NB8A 1QYPA
chains in the Genus database with same CATH superfamily
1RNIA 3S1QI 3H3VJ 1KD12 4XX2A 2IZ4A 1VQL1 2F4MA 5C4XI 3CCJ1 2W04A 3EEDA 2JA6I 2G2KA 4S1TA 3RZOI 2OZKA 1X3ZA 2OTJZ 1M902 1N8R2 3M4OI 3FQMA 1YHQZ 3T4NB 4RS4A 2RPRA 3HKZA 2QR1B 4MH4A 3JAMb 4TNUA 1VQ41 4MD8A 1NP6A 2V8KA 3CCRZ 2B63I 2I3CA 1RQFA 4A3CI 3OW2Z 1YITZ 4Y52I 4HGYA 3K7AI 4E31A 3GTJI 3CCE1 2OTL1 1KC82 3VTNA 1K8A1 3BG0B 2VPXA 3GTGI 3HOUI 3S16I 4A3KI 2QLVB 3CCV1 4MRIA 2QRDB 4A3GI 3J81f 5IT9b 2HU9A 1Z03A 2QEX1 3U50C 2V3VA 3BG1B 1Q7Y1 2IV2X 5LL6f 3G6EZ 2DE7A 1NJI2 4RVDA 2JS4A 2JA8I 2JA7I 2EGTA 1RO0A 2V8IA 4A3JI 3GTOI 1R9TI 2NVXI 2RBLA 4E2ZA 3CD6Z 3CC41 3MZLB 4RVGA 1SFOI 4E2WA 1YIJ1 1KQSZ 1Q822 1K9M2 1Y8CA 1WIIA 1VQK1 1Q811 1VQ8Z 3IX0A 2R7ZI 3GCFA 2WAQA 2V45A 4A3II 4BY7I 1WZNA 1S721 4E33A 1QXFA 1RLYA 2OOXB 5CM2M 3G4SZ 2F4OA 1W2BY 2JIMA 3CC2Z 2GTIA 1VQM1 5A2Qb 5C44I 3KIHA 1VQ6Z 1ML8A 1YJ91 3CC71 3NH8A 2Q4ZA 1Z02A 2HF1A 1K731 2PMZA 2NVYI 1X0TA 3CPWZ 2M6NA 3J80f 2JIPA 1KD11 4BXXI 1I6HI 5D1OB 2OTJ1 2QKDA 3CCSZ 3I56Z 1ZB8A 2LFUA 4RV9A 1Y1VI 2AYDA 1ZB9A 3MONA 3CCU1 1YHQ1 3PO3S 1VQNZ 2PM9A 4DK1A 2JIRA 3I55Z 3F3PC 2NVTI 3HOVI 4NBFA 3CCQZ 1N8R1 1P9NA 1QVFZ 3CMEZ 1RO2A 4NBCA 5C3EI 3TE5B 1FDOA 5FLXb 1QF8A 3NDJA 4AYBA 1ZH1A 4MONA 2JIQA 1TWHI 2JA5I 3CCJZ 3M3YI 4QTTA 1YUKA 3GTMI 3RZDI 1TWCI 3G711 3CQZI 3NDIA 3VMIA 3G6E1 2QREB 4NB9A 3JAMf 4EWCA 3J81b 2P3YA 3CCL1 1I50I 4A3EI 2QRCB 3S17I 1VQ5Z 1TWGI 2VF1A 2VPWA 3CD61 2E2II 3S14I 2V8JA 3J7A4 5D1PA 1WW9A 2OTLZ 1QVGY 2E2HI 4NBDA 1YJWZ 1K83I 3F3FC 4Y7NI 1Q7Y2 5IT9f 1LQLA 1L1OC 2JR6A 3IFUA 4NBAA 2DE6A 2PK7A 1N2FA 1YJNZ 3CC21 2VUMI 1JWHC 2ZAEB 3ESWA 3CMAZ 1S7MA 1VQ61 1Q812 3HOZI 2LIYA 4NBGA 1QVGZ 2LEXA 3CC4Z 3D2LA 1JJ2Y 2K5RA 3CXCY 2J6AA 3FKII 2NAPA 2BJOA 5D1OA 1VQ91 3IF8A 4A3DI 5T64A 4X6AI 1TWFI 2QA4Z 2E7ZA 2O53A 1USPB 3NH5A 4NBHA 4BBSI 3Q87A 3HOXI 2P28A 1SIWA 1S72Z 1W2BZ 1VQPZ 3EERA 1VLAA 3I4MI 3QWUA 3CCS1 3I561 4DQYB 4HH4A 3CCMZ 1YI2Z 5T6BA 1WCMI 1VQMZ 1VQN1 1DL6A 1JJ2Z 2Y0SA 4MXUA 1M1K2 3I551 3P5JB 3CCQ1 1Y1VS 1Q862 2KPIA 2OOYB 3CME1 3PO2I 2JMOA 1VQ7Z 2R92I 4E2XA 3HOYI 2VPYA 3GTLI 1K732 4BY1I 4A93I 1YJ9Z 3CC7Z 4A3LI 2R6MA 1M901 1VQOZ 3CCR1 2M48A 4HGZA 1Z01A 1YIT1 3GKQA 2RIQA 3OW2Y 3S15I 3GTPI 3PO3I 4E30A 1VQLZ 3MZKB 2R93I 1FDIA 5C4JI 3GTMS 4A3BI 3D6WA 3NH4A 4MD9A 2AKLA 3CCUZ 1KC81 4A3MI 4NB8A 3KIFA 1QYPA 2E2JI 2H85A 3FQQA 2JUBA 4NBBA 4A3FI 1VQ51 3GTKI 1Y1WI 5FLXf 5IP7I 1AA6A 3VMHA 4RVHA 3NFZA 1WJ2A 5T67A 1VQ4Z 1K8A2 3I4NI 1Q16A 2GTHA 1YJW1 4RVFA 1NJI1 4NBEA 3S2HI 3CCEZ 2RT9A 1KQSY 3G71Z 1VQ81 5AN9F 1I3QI 1YUAA 2KI7B 4MD7A 1YJN1 4NH1C 1Q821 1K9M1 4QTUA 2VUGA 2VPZA 2Q51A 3CCVZ 1NUIA 3G4S1 4E32A 2E9HA 5FLMI 3CMA1 3CCLZ 3S1RI 2W03A 4DGLA 2QEXZ 1TFIA 1USPA 1PFTA 2GU2A 3H0GI 3HOWI 4BBRI 2RHBA 3TDHB 1X3WA 2QA41 3LUSA 1YIJZ 2K3RA 1VQKZ 3I07A 1VQP1 3VB9A 4NFRA 2IZ3A 2JNYA 2NVQI 3CCM1 1YI21 2WB1A 2YU9I 1KRLA 3D9XA 5A2Qf 3S2DI 2YADA 3CPWY 1RO4A 5IP9I 3J80b 1VQ71 2O4HA 4CL1A 2DE5A 3CXCZ 3GTQI 3S1MI 2JIOA 1M1K1 4NOZA 1TWAI 3IR7A 1VQO1 3VMGA 1Q861 1VQ9Z 1QVFY 3S1NI 4E2YA
chains in the Genus database with same CATH topology
1RNIA 3S1QI 3H3VJ 1KD12 4XX2A 2IZ4A 1VQL1 2F4MA 5C4XI 3CCJ1 2W04A 3EEDA 2JA6I 2G2KA 4S1TA 3RZOI 2OZKA 1X3ZA 2OTJZ 1M902 1N8R2 3M4OI 3FQMA 1YHQZ 3T4NB 4RS4A 2RPRA 3HKZA 2QR1B 4MH4A 3JAMb 4TNUA 1VQ41 4MD8A 1NP6A 2V8KA 3CCRZ 2B63I 2I3CA 1RQFA 4A3CI 3OW2Z 1YITZ 4Y52I 4HGYA 3K7AI 4E31A 3GTJI 3CCE1 2OTL1 1KC82 3VTNA 1K8A1 3BG0B 3GTGI 3HOUI 3S16I 4A3KI 2QLVB 3CCV1 4MRIA 2QRDB 4A3GI 3J81f 5IT9b 2HU9A 1Z03A 2QEX1 3U50C 3BG1B 1Q7Y1 5LL6f 3G6EZ 2DE7A 1NJI2 4RVDA 2JS4A 2JA8I 2JA7I 2EGTA 1RO0A 2V8IA 4A3JI 3GTOI 1R9TI 2NVXI 2RBLA 4E2ZA 3CD6Z 3CC41 3MZLB 4RVGA 1SFOI 4E2WA 1YIJ1 1KQSZ 1Q822 1K9M2 1VQK1 1WIIA 1Q811 1VQ8Z 3IX0A 2R7ZI 3GCFA 2WAQA 4A3II 4BY7I 1S721 4E33A 1RLYA 2OOXB 5CM2M 3G4SZ 2F4OA 1W2BY 3CC2Z 2GTIA 1VQM1 5A2Qb 5C44I 3KIHA 1VQ6Z 1ML8A 1YJ91 3CC71 3NH8A 2Q4ZA 1Z02A 2HF1A 1K731 2PMZA 2NVYI 1X0TA 3CPWZ 2M6NA 3J80f 1KD11 4BXXI 1I6HI 5D1OB 2OTJ1 2QKDA 3CCSZ 3I56Z 1ZB8A 2LFUA 4RV9A 1Y1VI 1ZB9A 3MONA 1YHQ1 3CCU1 3PO3S 1VQNZ 2PM9A 4DK1A 3I55Z 3F3PC 2NVTI 3HOVI 4NBFA 3CCQZ 1N8R1 1P9NA 1QVFZ 3CMEZ 1RO2A 4NBCA 5C3EI 3TE5B 5FLXb 1QF8A 3NDJA 4AYBA 1ZH1A 4MONA 1TWHI 2JA5I 3CCJZ 3M3YI 4QTTA 1YUKA 3GTMI 3RZDI 1TWCI 3G711 3CQZI 3NDIA 3VMIA 3G6E1 2QREB 4NB9A 3JAMf 4EWCA 3J81b 2P3YA 3CCL1 1I50I 4A3EI 2QRCB 3S17I 1VQ5Z 1TWGI 2VF1A 3CD61 2E2II 3S14I 2V8JA 3J7A4 5D1PA 1WW9A 2OTLZ 1QVGY 2E2HI 4NBDA 1YJWZ 1K83I 3F3FC 4Y7NI 1Q7Y2 5IT9f 1LQLA 1L1OC 2JR6A 3IFUA 4NBAA 2DE6A 2PK7A 1N2FA 1YJNZ 3CC21 2VUMI 1JWHC 2ZAEB 3ESWA 3CMAZ 1S7MA 1VQ61 1Q812 3HOZI 2LIYA 4NBGA 1QVGZ 3CC4Z 1JJ2Y 2K5RA 2J6AA 3CXCY 3FKII 2BJOA 5D1OA 1VQ91 3IF8A 4A3DI 5T64A 4X6AI 1TWFI 2QA4Z 2O53A 1USPB 3NH5A 4NBHA 4BBSI 3Q87A 3HOXI 2P28A 1S72Z 1W2BZ 1VQPZ 3EERA 1VLAA 3I4MI 3QWUA 3CCS1 3I561 4DQYB 4HH4A 3CCMZ 1YI2Z 5T6BA 1WCMI 1VQMZ 1VQN1 1DL6A 1JJ2Z 2Y0SA 4MXUA 1M1K2 3I551 3P5JB 3CCQ1 1Y1VS 1Q862 2KPIA 2OOYB 3CME1 3PO2I 2JMOA 1VQ7Z 2R92I 4E2XA 3HOYI 3GTLI 1K732 4BY1I 4A93I 1YJ9Z 3CC7Z 4A3LI 2R6MA 1M901 1VQOZ 3CCR1 2M48A 4HGZA 1Z01A 1YIT1 3GKQA 2RIQA 3OW2Y 3S15I 3GTPI 3PO3I 4E30A 1VQLZ 3MZKB 2R93I 5C4JI 3GTMS 4A3BI 3D6WA 3NH4A 4MD9A 2AKLA 3CCUZ 1KC81 4A3MI 4NB8A 3KIFA 1QYPA 2E2JI 2H85A 3FQQA 2JUBA 4NBBA 4A3FI 1VQ51 3GTKI 1Y1WI 5FLXf 5IP7I 3VMHA 4RVHA 3NFZA 5T67A 1VQ4Z 1K8A2 3I4NI 2GTHA 1YJW1 4RVFA 1NJI1 4NBEA 3S2HI 3CCEZ 2RT9A 1KQSY 3G71Z 1VQ81 5AN9F 1I3QI 1YUAA 2KI7B 4MD7A 1YJN1 4NH1C 1Q821 1K9M1 4QTUA 2VUGA 3CCVZ 2Q51A 1NUIA 3G4S1 4E32A 2E9HA 5FLMI 3CMA1 3CCLZ 3S1RI 2W03A 4DGLA 2QEXZ 1TFIA 1USPA 1PFTA 2GU2A 3H0GI 3HOWI 4BBRI 2RHBA 3TDHB 1X3WA 2QA41 3LUSA 1YIJZ 2K3RA 1VQKZ 1VQP1 3I07A 3VB9A 4NFRA 2IZ3A 2JNYA 2NVQI 3CCM1 1YI21 2WB1A 2YU9I 1KRLA 3D9XA 5A2Qf 3S2DI 2YADA 3CPWY 1RO4A 5IP9I 3J80b 1VQ71 2O4HA 4CL1A 2DE5A 3CXCZ 3GTQI 3S1MI 1M1K1 4NOZA 1TWAI 1VQO1 3VMGA 1Q861 1VQ9Z 1QVFY 3S1NI 4E2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2J I;  2E2H I;  4NBD A;  5C44 I;  3H3V J;  3S1Q I;  1K83 I;  4NBB A;  4XX2 A;  4A3F I;  4Y7N I;  3GTK I;  1Y1W I;  1LQL A;  1L1O C;  2JR6 A;  5IP7 I;  2F4M A;  3VMH A;  5C4X I;  4NBA A;  1ML8 A;  2DE6 A;  2JA6 I;  2PK7 A;  3RZO I;  1N2F A;  1X3Z A;  3I4N I;  2VUM I;  3M4O I;  3ESW A;  4NBE A;  2HF1 A;  3S2H I;  2NVY I;  3HOZ I;  4NBG A;  1I3Q I;  1YUA A;  4MH4 A;  4BXX I;  1I6H I;  2B63 I;  2K5R A;  2J6A A;  3FKI I;  2BJO A;  4QTU A;  1ZB8 A;  1Y1V I;  1NUI A;  4A3D I;  5FLM I;  4A3C I;  4X6A I;  4Y52 I;  1ZB9 A;  1TWF I;  3S1R I;  3PO3 S;  3K7A I;  3GTJ I;  1USP B;  4NBH A;  2NVT I;  1TFI A;  4BBS I;  3Q87 A;  1USP A;  1PFT A;  3HOX I;  3HOV I;  4NBF A;  3H0G I;  3HOW I;  4BBR I;  3EER A;  3GTG I;  1VLA A;  3I4M I;  3HOU I;  3S16 I;  4A3K I;  4NBC A;  5C3E I;  1X3W A;  1WCM I;  4A3G I;  3LUS A;  3U50 C;  1DL6 A;  2DE7 A;  1Y1V S;  1TWH I;  2KPI A;  3I07 A;  2JA5 I;  2JS4 A;  2JA8 I;  4QTT A;  3PO2 I;  2JA7 I;  2R92 I;  3M3Y I;  3GTM I;  3HOY I;  4A3J I;  3VB9 A;  3GTL I;  3RZD I;  4BY1 I;  1TWC I;  4A93 I;  2JNY A;  3GTO I;  2NVQ I;  4A3L I;  3CQZ I;  1R9T I;  2NVX I;  2RBL A;  2YU9 I;  3S2D I;  1SFO I;  3VMI A;  1RO4 A;  4NB9 A;  2P3Y A;  5IP9 I;  3GKQ A;  2R7Z I;  1I50 I;  4A3E I;  3S15 I;  3GCF A;  2DE5 A;  3GTP I;  3GTQ I;  3S1M I;  3S17 I;  3PO3 I;  1TWG I;  4NOZ A;  1TWA I;  4A3I I;  4BY7 I;  4A3M I;  2E2I I;  2R93 I;  1RLY A;  3VMG A;  3S14 I;  5C4J I;  5CM2 M;  3GTM S;  4A3B I;  2F4O A;  3D6W A;  2AKL A;  1WW9 A;  3S1N I;  4NB8 A;  1QYP A; 
#chains in the Genus database with same CATH topology
 1RNI A;  3S1Q I;  3H3V J;  1KD1 2;  4XX2 A;  2IZ4 A;  1VQL 1;  2F4M A;  5C4X I;  3CCJ 1;  2W04 A;  3EED A;  2JA6 I;  2G2K A;  4S1T A;  3RZO I;  2OZK A;  1X3Z A;  2OTJ Z;  1M90 2;  1N8R 2;  3M4O I;  3FQM A;  1YHQ Z;  3T4N B;  4RS4 A;  2RPR A;  3HKZ A;  2QR1 B;  4MH4 A;  3JAM b;  4TNU A;  1VQ4 1;  4MD8 A;  1NP6 A;  2V8K A;  3CCR Z;  2B63 I;  2I3C A;  1RQF A;  4A3C I;  3OW2 Z;  1YIT Z;  4Y52 I;  4HGY A;  3K7A I;  4E31 A;  3GTJ I;  3CCE 1;  2OTL 1;  1KC8 2;  3VTN A;  1K8A 1;  3BG0 B;  2VPX A;  3GTG I;  3HOU I;  3S16 I;  4A3K I;  2QLV B;  3CCV 1;  4MRI A;  2QRD B;  4A3G I;  3J81 f;  5IT9 b;  2HU9 A;  1Z03 A;  2QEX 1;  3U50 C;  2V3V A;  3BG1 B;  1Q7Y 1;  2IV2 X;  5LL6 f;  3G6E Z;  2DE7 A;  1NJI 2;  4RVD A;  2JS4 A;  2JA8 I;  2JA7 I;  2EGT A;  1RO0 A;  2V8I A;  4A3J I;  3GTO I;  1R9T I;  2NVX I;  2RBL A;  4E2Z A;  3CD6 Z;  3CC4 1;  3MZL B;  4RVG A;  1SFO I;  4E2W A;  1YIJ 1;  1KQS Z;  1Q82 2;  1K9M 2;  1Y8C A;  1WII A;  1VQK 1;  1Q81 1;  1VQ8 Z;  3IX0 A;  2R7Z I;  3GCF A;  2WAQ A;  2V45 A;  4A3I I;  4BY7 I;  1WZN A;  1S72 1;  4E33 A;  1QXF A;  1RLY A;  2OOX B;  5CM2 M;  3G4S Z;  2F4O A;  1W2B Y;  2JIM A;  3CC2 Z;  2GTI A;  1VQM 1;  5A2Q b;  5C44 I;  3KIH A;  1VQ6 Z;  1ML8 A;  1YJ9 1;  3CC7 1;  3NH8 A;  2Q4Z A;  1Z02 A;  2HF1 A;  1K73 1;  2PMZ A;  2NVY I;  1X0T A;  3CPW Z;  2M6N A;  3J80 f;  2JIP A;  1KD1 1;  4BXX I;  1I6H I;  5D1O B;  2OTJ 1;  2QKD A;  3CCS Z;  3I56 Z;  1ZB8 A;  2LFU A;  4RV9 A;  1Y1V I;  2AYD A;  1ZB9 A;  3MON A;  3CCU 1;  1YHQ 1;  3PO3 S;  1VQN Z;  2PM9 A;  4DK1 A;  2JIR A;  3I55 Z;  3F3P C;  2NVT I;  3HOV I;  4NBF A;  3CCQ Z;  1N8R 1;  1P9N A;  1QVF Z;  3CME Z;  1RO2 A;  4NBC A;  5C3E I;  3TE5 B;  1FDO A;  5FLX b;  1QF8 A;  3NDJ A;  4AYB A;  1ZH1 A;  4MON A;  2JIQ A;  1TWH I;  2JA5 I;  3CCJ Z;  3M3Y I;  4QTT A;  1YUK A;  3GTM I;  3RZD I;  1TWC I;  3G71 1;  3CQZ I;  3NDI A;  3VMI A;  3G6E 1;  2QRE B;  4NB9 A;  3JAM f;  4EWC A;  3J81 b;  2P3Y A;  3CCL 1;  1I50 I;  4A3E I;  2QRC B;  3S17 I;  1VQ5 Z;  1TWG I;  2VF1 A;  2VPW A;  3CD6 1;  2E2I I;  3S14 I;  2V8J A;  3J7A 4;  5D1P A;  1WW9 A;  2OTL Z;  1QVG Y;  2E2H I;  4NBD A;  1YJW Z;  1K83 I;  3F3F C;  4Y7N I;  1Q7Y 2;  5IT9 f;  1LQL A;  1L1O C;  2JR6 A;  3IFU A;  4NBA A;  2DE6 A;  2PK7 A;  1N2F A;  1YJN Z;  3CC2 1;  2VUM I;  1JWH C;  2ZAE B;  3ESW A;  3CMA Z;  1S7M A;  1VQ6 1;  1Q81 2;  3HOZ I;  2LIY A;  4NBG A;  1QVG Z;  2LEX A;  3CC4 Z;  3D2L A;  1JJ2 Y;  2K5R A;  3CXC Y;  2J6A A;  3FKI I;  2NAP A;  2BJO A;  5D1O A;  1VQ9 1;  3IF8 A;  4A3D I;  5T64 A;  4X6A I;  1TWF I;  2QA4 Z;  2E7Z A;  2O53 A;  1USP B;  3NH5 A;  4NBH A;  4BBS I;  3Q87 A;  3HOX I;  2P28 A;  1SIW A;  1S72 Z;  1W2B Z;  1VQP Z;  3EER A;  1VLA A;  3I4M I;  3QWU A;  3CCS 1;  3I56 1;  4DQY B;  4HH4 A;  3CCM Z;  1YI2 Z;  5T6B A;  1WCM I;  1VQM Z;  1VQN 1;  1DL6 A;  1JJ2 Z;  2Y0S A;  4MXU A;  1M1K 2;  3I55 1;  3P5J B;  3CCQ 1;  1Y1V S;  1Q86 2;  2KPI A;  2OOY B;  3CME 1;  3PO2 I;  2JMO A;  1VQ7 Z;  2R92 I;  4E2X A;  3HOY I;  2VPY A;  3GTL I;  1K73 2;  4BY1 I;  4A93 I;  1YJ9 Z;  3CC7 Z;  4A3L I;  2R6M A;  1M90 1;  1VQO Z;  3CCR 1;  2M48 A;  4HGZ A;  1Z01 A;  1YIT 1;  3GKQ A;  2RIQ A;  3OW2 Y;  3S15 I;  3GTP I;  3PO3 I;  4E30 A;  1VQL Z;  3MZK B;  2R93 I;  1FDI A;  5C4J I;  3GTM S;  4A3B I;  3D6W A;  3NH4 A;  4MD9 A;  2AKL A;  3CCU Z;  1KC8 1;  4A3M I;  4NB8 A;  3KIF A;  1QYP A;  2E2J I;  2H85 A;  3FQQ A;  2JUB A;  4NBB A;  4A3F I;  1VQ5 1;  3GTK I;  1Y1W I;  5FLX f;  5IP7 I;  1AA6 A;  3VMH A;  4RVH A;  3NFZ A;  1WJ2 A;  5T67 A;  1VQ4 Z;  1K8A 2;  3I4N I;  1Q16 A;  2GTH A;  1YJW 1;  4RVF A;  1NJI 1;  4NBE A;  3S2H I;  3CCE Z;  2RT9 A;  1KQS Y;  3G71 Z;  1VQ8 1;  5AN9 F;  1I3Q I;  1YUA A;  2KI7 B;  4MD7 A;  1YJN 1;  4NH1 C;  1Q82 1;  1K9M 1;  4QTU A;  2VUG A;  2VPZ A;  2Q51 A;  3CCV Z;  1NUI A;  3G4S 1;  4E32 A;  2E9H A;  5FLM I;  3CMA 1;  3CCL Z;  3S1R I;  2W03 A;  4DGL A;  2QEX Z;  1TFI A;  1USP A;  1PFT A;  2GU2 A;  3H0G I;  3HOW I;  4BBR I;  2RHB A;  3TDH B;  1X3W A;  2QA4 1;  3LUS A;  1YIJ Z;  2K3R A;  1VQK Z;  3I07 A;  1VQP 1;  3VB9 A;  4NFR A;  2IZ3 A;  2JNY A;  2NVQ I;  3CCM 1;  1YI2 1;  2WB1 A;  2YU9 I;  1KRL A;  3D9X A;  5A2Q f;  3S2D I;  2YAD A;  3CPW Y;  1RO4 A;  5IP9 I;  3J80 b;  1VQ7 1;  2O4H A;  4CL1 A;  2DE5 A;  3CXC Z;  3GTQ I;  3S1M I;  2JIO A;  1M1K 1;  4NOZ A;  1TWA I;  3IR7 A;  1VQO 1;  3VMG A;  1Q86 1;  1VQ9 Z;  1QVF Y;  3S1N I;  4E2Y A; 
#chains in the Genus database with same CATH homology
 1RNI A;  3S1Q I;  3H3V J;  1KD1 2;  4XX2 A;  2IZ4 A;  1VQL 1;  2F4M A;  5C4X I;  3CCJ 1;  2W04 A;  3EED A;  2JA6 I;  2G2K A;  4S1T A;  3RZO I;  2OZK A;  1X3Z A;  2OTJ Z;  1M90 2;  1N8R 2;  3M4O I;  3FQM A;  1YHQ Z;  3T4N B;  4RS4 A;  2RPR A;  3HKZ A;  2QR1 B;  4MH4 A;  3JAM b;  4TNU A;  1VQ4 1;  4MD8 A;  1NP6 A;  2V8K A;  3CCR Z;  2B63 I;  2I3C A;  1RQF A;  4A3C I;  3OW2 Z;  1YIT Z;  4Y52 I;  4HGY A;  3K7A I;  4E31 A;  3GTJ I;  3CCE 1;  2OTL 1;  1KC8 2;  3VTN A;  1K8A 1;  3BG0 B;  3GTG I;  3HOU I;  3S16 I;  4A3K I;  2QLV B;  3CCV 1;  4MRI A;  2QRD B;  4A3G I;  3J81 f;  5IT9 b;  2HU9 A;  1Z03 A;  2QEX 1;  3U50 C;  3BG1 B;  1Q7Y 1;  5LL6 f;  3G6E Z;  2DE7 A;  1NJI 2;  4RVD A;  2JS4 A;  2JA8 I;  2JA7 I;  2EGT A;  1RO0 A;  2V8I A;  4A3J I;  3GTO I;  1R9T I;  2NVX I;  2RBL A;  4E2Z A;  3CD6 Z;  3CC4 1;  3MZL B;  4RVG A;  1SFO I;  4E2W A;  1YIJ 1;  1KQS Z;  1Q82 2;  1K9M 2;  1VQK 1;  1WII A;  1Q81 1;  1VQ8 Z;  3IX0 A;  2R7Z I;  3GCF A;  2WAQ A;  4A3I I;  4BY7 I;  1S72 1;  4E33 A;  1RLY A;  2OOX B;  5CM2 M;  3G4S Z;  2F4O A;  1W2B Y;  3CC2 Z;  2GTI A;  1VQM 1;  5A2Q b;  5C44 I;  3KIH A;  1VQ6 Z;  1ML8 A;  1YJ9 1;  3CC7 1;  3NH8 A;  2Q4Z A;  1Z02 A;  2HF1 A;  1K73 1;  2PMZ A;  2NVY I;  1X0T A;  3CPW Z;  2M6N A;  3J80 f;  1KD1 1;  4BXX I;  1I6H I;  5D1O B;  2OTJ 1;  2QKD A;  3CCS Z;  3I56 Z;  1ZB8 A;  2LFU A;  4RV9 A;  1Y1V I;  1ZB9 A;  3MON A;  1YHQ 1;  3CCU 1;  3PO3 S;  1VQN Z;  2PM9 A;  4DK1 A;  3I55 Z;  3F3P C;  2NVT I;  3HOV I;  4NBF A;  3CCQ Z;  1N8R 1;  1P9N A;  1QVF Z;  3CME Z;  1RO2 A;  4NBC A;  5C3E I;  3TE5 B;  5FLX b;  1QF8 A;  3NDJ A;  4AYB A;  1ZH1 A;  4MON A;  1TWH I;  2JA5 I;  3CCJ Z;  3M3Y I;  4QTT A;  1YUK A;  3GTM I;  3RZD I;  1TWC I;  3G71 1;  3CQZ I;  3NDI A;  3VMI A;  3G6E 1;  2QRE B;  4NB9 A;  3JAM f;  4EWC A;  3J81 b;  2P3Y A;  3CCL 1;  1I50 I;  4A3E I;  2QRC B;  3S17 I;  1VQ5 Z;  1TWG I;  2VF1 A;  3CD6 1;  2E2I I;  3S14 I;  2V8J A;  3J7A 4;  5D1P A;  1WW9 A;  2OTL Z;  1QVG Y;  2E2H I;  4NBD A;  1YJW Z;  1K83 I;  3F3F C;  4Y7N I;  1Q7Y 2;  5IT9 f;  1LQL A;  1L1O C;  2JR6 A;  3IFU A;  4NBA A;  2DE6 A;  2PK7 A;  1N2F A;  1YJN Z;  3CC2 1;  2VUM I;  1JWH C;  2ZAE B;  3ESW A;  3CMA Z;  1S7M A;  1VQ6 1;  1Q81 2;  3HOZ I;  2LIY A;  4NBG A;  1QVG Z;  3CC4 Z;  1JJ2 Y;  2K5R A;  2J6A A;  3CXC Y;  3FKI I;  2BJO A;  5D1O A;  1VQ9 1;  3IF8 A;  4A3D I;  5T64 A;  4X6A I;  1TWF I;  2QA4 Z;  2O53 A;  1USP B;  3NH5 A;  4NBH A;  4BBS I;  3Q87 A;  3HOX I;  2P28 A;  1S72 Z;  1W2B Z;  1VQP Z;  3EER A;  1VLA A;  3I4M I;  3QWU A;  3CCS 1;  3I56 1;  4DQY B;  4HH4 A;  3CCM Z;  1YI2 Z;  5T6B A;  1WCM I;  1VQM Z;  1VQN 1;  1DL6 A;  1JJ2 Z;  2Y0S A;  4MXU A;  1M1K 2;  3I55 1;  3P5J B;  3CCQ 1;  1Y1V S;  1Q86 2;  2KPI A;  2OOY B;  3CME 1;  3PO2 I;  2JMO A;  1VQ7 Z;  2R92 I;  4E2X A;  3HOY I;  3GTL I;  1K73 2;  4BY1 I;  4A93 I;  1YJ9 Z;  3CC7 Z;  4A3L I;  2R6M A;  1M90 1;  1VQO Z;  3CCR 1;  2M48 A;  4HGZ A;  1Z01 A;  1YIT 1;  3GKQ A;  2RIQ A;  3OW2 Y;  3S15 I;  3GTP I;  3PO3 I;  4E30 A;  1VQL Z;  3MZK B;  2R93 I;  5C4J I;  3GTM S;  4A3B I;  3D6W A;  3NH4 A;  4MD9 A;  2AKL A;  3CCU Z;  1KC8 1;  4A3M I;  4NB8 A;  3KIF A;  1QYP A;  2E2J I;  2H85 A;  3FQQ A;  2JUB A;  4NBB A;  4A3F I;  1VQ5 1;  3GTK I;  1Y1W I;  5FLX f;  5IP7 I;  3VMH A;  4RVH A;  3NFZ A;  5T67 A;  1VQ4 Z;  1K8A 2;  3I4N I;  2GTH A;  1YJW 1;  4RVF A;  1NJI 1;  4NBE A;  3S2H I;  3CCE Z;  2RT9 A;  1KQS Y;  3G71 Z;  1VQ8 1;  5AN9 F;  1I3Q I;  1YUA A;  2KI7 B;  4MD7 A;  1YJN 1;  4NH1 C;  1Q82 1;  1K9M 1;  4QTU A;  2VUG A;  3CCV Z;  2Q51 A;  1NUI A;  3G4S 1;  4E32 A;  2E9H A;  5FLM I;  3CMA 1;  3CCL Z;  3S1R I;  2W03 A;  4DGL A;  2QEX Z;  1TFI A;  1USP A;  1PFT A;  2GU2 A;  3H0G I;  3HOW I;  4BBR I;  2RHB A;  3TDH B;  1X3W A;  2QA4 1;  3LUS A;  1YIJ Z;  2K3R A;  1VQK Z;  1VQP 1;  3I07 A;  3VB9 A;  4NFR A;  2IZ3 A;  2JNY A;  2NVQ I;  3CCM 1;  1YI2 1;  2WB1 A;  2YU9 I;  1KRL A;  3D9X A;  5A2Q f;  3S2D I;  2YAD A;  3CPW Y;  1RO4 A;  5IP9 I;  3J80 b;  1VQ7 1;  2O4H A;  4CL1 A;  2DE5 A;  3CXC Z;  3GTQ I;  3S1M I;  1M1K 1;  4NOZ A;  1TWA I;  1VQO 1;  3VMG A;  1Q86 1;  1VQ9 Z;  1QVF Y;  3S1N I;  4E2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...