3GTGI

Backtracked rna polymerase ii complex with 12mer rna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna hybrid
total genus 9
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtgI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtgI02
2JNYA 3GCFA 1TWAI 1X3ZA 2JS4A 2YU9I 4A3LI 4NBGA 1ZB8A 2JA7I 2E2JI 1RLYA 4BBRI 5C44I 1VLAA 4A3KI 2P3YA 3HOYI 2KPIA 1NUIA 2AKLA 3Q87A 1I6HI 3S17I 3M3YI 3VMIA 1USPB 4NBEA 4A3BI 2R93I 3HOVI 4NB8A 2DE6A 1Y1VI 3CQZI 4XX2A 1Y1VS 3VMHA 1WCMI 5FLMI 3PO2I 4A3EI 3HOZI 3GTLI 1PFTA 2E2II 3VB9A 4BXXI 5C3EI 4A3DI 5C4XI 3S16I 3HOWI 2NVQI 1TFIA 3K7AI 3VMGA 4BBSI 4A3FI 3I4NI 3S2HI 3PO3I 4X6AI 4NBHA 1Y1WI 3RZOI 1TWGI 3PO3S 2DE5A 4Y7NI 1TWFI 1I50I 4A3GI 2HF1A 3M4OI 4NOZA 3D6WA 3I4MI 2JA6I 3H3VJ 1X3WA 3GTMI 3GTGI 4NBAA 4BY7I 1K83I 2VUMI 2JA5I 4NBDA 3GTMS 4A3CI 2B63I 2DE7A 1ZB9A 3GTJI 4NB9A 5C4JI 3RZDI 3S14I 3LUSA 2R7ZI 1TWHI 3ESWA 3S1RI 3I07A 3U50C 4MH4A 3GTKI 4A3MI 1L1OC 5IP9I 1QYPA 3S15I 2R92I 1USPA 3EERA 1R9TI 2NVXI 2JA8I 4QTTA 3S2DI 3GTOI 2F4MA 5IP7I 2NVTI 2RBLA 4Y52I 4NBFA 2NVYI 1N2FA 3H0GI 3GTQI 2JR6A 3HOXI 1RO4A 3HOUI 4NBBA 2F4OA 2BJOA 4A93I 2K5RA 4QTUA 2J6AA 4A3JI 4A3II 4NBCA 1LQLA 3S1MI 1TWCI 3GTPI 3S1QI 1ML8A 5CM2M 2E2HI 1WW9A 3GKQA 1YUAA 3S1NI 1DL6A 4BY1I 2PK7A 1SFOI 1I3QI 3FKII
chains in the Genus database with same CATH superfamily
3GCFA 2E7ZA 1YI2Z 4NBGA 1ZB8A 4DGLA 2AYDA 2V3VA 1Y8CA 2P3YA 1K8A2 1VQK1 1RO0A 3S17I 3M3YI 4MXUA 1S721 1VQOZ 3VMIA 2LEXA 4NBEA 1VQ61 3CCUZ 3HOVI 3NDJA 4DK1A 3MONA 2DE6A 3J81b 1YUKA 4CL1A 1AA6A 3HOZI 3GTLI 1NJI2 3VB9A 3J7A4 2OTJ1 5T67A 3BG0B 3G711 1KC82 2M6NA 3G4SZ 3VMGA 1YHQ1 3KIFA 4BBSI 4E2XA 5D1OA 4HGZA 3PO3I 1TWGI 3PO3S 3MZLB 4A3GI 3M4OI 2O4HA 3OW2Y 1JJ2Z 3GTGI 2JMOA 4A3CI 2O53A 2QRDB 3CC41 4MRIA 2RPRA 4HGYA 3S14I 1S7MA 3F3FC 3ESWA 3S1RI 2Y0SA 3CC7Z 4MH4A 2VPXA 3S15I 5IP9I 3CMA1 1USPA 1NP6A 3CCR1 1VQ7Z 2NVYI 1VQ9Z 3HOUI 1Z01A 4NBBA 1Z02A 2JIQA 4QTUA 4A3JI 4A3II 1VQMZ 5D1PA 2QREB 3CCE1 1Q822 4E30A 1VQ51 2QLVB 1WW9A 3CPWY 2GU2A 2W03A 3S1NI 1K731 3FKII 4RS4A 2VPZA 2JNYA 1VQ4Z 1YI21 4MD9A 1X3ZA 2JA7I 1VQLZ 4BBRI 2RIQA 4E2ZA 1YITZ 4A3KI 4E31A 2V8KA 2KPIA 3D2LA 1VQO1 3CCU1 2QA4Z 1Q861 4NB8A 1KQSZ 2IZ4A 4RV9A 3PO2I 1VQ8Z 1FDIA 1M1K1 2E2II 5C4XI 2JIPA 3BG1B 3HOWI 5T6BA 3G4S1 3NFZA 2IZ3A 3K7AI 2GTIA 1N8R2 2RT9A 4A3FI 2V8IA 3S2HI 3MZKB 3CMEZ 1I50I 2K3RA 2OOYB 3IF8A 1K83I 1M901 2VUMI 2JA5I 1QVFZ 1P9NA 2B63I 4NB9A 2LIYA 2VPYA 5LL6f 3TDHB 1QVFY 2Q51A 3IFUA 1KD11 1RO2A 2R7ZI 3JAMf 4NH1C 3U50C 3CC71 5A2Qf 1WIIA 1L1OC 1QYPA 3FQQA 3CCMZ 1JWHC 2NVXI 1VQ71 5IT9f 4E32A 2F4MA 1Q7Y2 2PMZA 2RBLA 4MONA 3CXCZ 3VTNA 1N2FA 1VQ91 3HOXI 1K8A1 4NFRA 2F4OA 3CXCY 1JJ2Y 2BJOA 3CC2Z 2J6AA 3CCSZ 1VQM1 3S1MI 3T4NB 3S1QI 5CM2M 5FLXf 3GKQA 3QWUA 4E2WA 1NJI1 1I3QI 1YIJZ 1VQ41 4TNUA 1KC81 2YU9I 3IX0A 4A3LI 2H85A 1VQL1 2E2JI 1YIT1 4S1TA 3HOYI 2QKDA 4EWCA 4RVDA 2AKLA 3Q87A 2QA41 1Q812 4A3BI 2ZAEB 3D9XA 2VUGA 3CCQZ 1WCMI 5FLMI 1VQ81 4A3EI 2QRCB 4DQYB 1QF8A 3JAMb 4BXXI 2E9HA 2Q4ZA 4HH4A 5C3EI 3CCVZ 5A2Qb 1YJNZ 1KRLA 3G6EZ 5IT9b 4MD7A 4X6AI 1Y1WI 3I55Z 3RZOI 3CME1 4Y7NI 2HF1A 3EEDA 3D6WA 1X3WA 2P28A 2GTHA 3GTMI 4BY7I 3GTMS 1KQSY 3CCJZ 1ZB9A 3GTJI 2JIMA 3RZDI 1Q821 1YJ9Z 3LUSA 2VPWA 2RHBA 5FLXb 2WB1A 4A3MI 1WZNA 3CCM1 3EERA 1R9TI 2JA8I 4QTTA 3S2DI 3CD6Z 4AYBA 5IP7I 2JR6A 1RO4A 1Z03A 2OTLZ 3NH4A 3CC21 1VQPZ 3CCS1 4A93I 2K5RA 1K9M1 1YJWZ 3I56Z 2QEXZ 3HKZA 5D1OB 2OOXB 1TWCI 3NH5A 4E2YA 3J80f 4E33A 2QR1B 1YUAA 1DL6A 1YIJ1 3IR7A 3CCLZ 1SFOI 1TWAI 3KIHA 2JS4A 2V8JA 1N8R1 2G2KA 1RLYA 4MD8A 5C44I 2R6MA 1QVGZ 1VLAA 1NUIA 2VF1A 1WJ2A 2V45A 1QVGY 1I6HI 1VQKZ 3OW2Z 1USPB 1S72Z 2R93I 1VQ6Z 1Y1VI 3CQZI 1QXFA 1Y1VS 4XX2A 3CCQ1 1W2BZ 3VMHA 2M48A 2NAPA 1PFTA 3CCV1 5T64A 1W2BY 1K732 2EGTA 4A3DI 3S16I 2OTJZ 1YJN1 2NVQI 2WAQA 1TFIA 3G71Z 2OZKA 3G6E1 2KI7B 2I3CA 1Q16A 3I551 1YHQZ 3I4NI 1Q7Y1 4NBHA 2PM9A 2DE5A 2IV2X 1TWFI 4NOZA 3I4MI 2JA6I 3H3VJ 3TE5B 4NBAA 2HU9A 4NBDA 3CCJ1 1Q862 4RVFA 3FQMA 3J81f 2YADA 5AN9F 2DE7A 1YJ91 5C4JI 3CC4Z 4RVHA 4RVGA 1X0TA 1TWHI 1M1K2 3I07A 3J80b 3CPWZ 2LFUA 3GTKI 2R92I 2W04A 3CMAZ 1ZH1A 1VQN1 3CD61 2JIRA 3CCRZ 2JIOA 3GTOI 2NVTI 4Y52I 1FDOA 4NBFA 3H0GI 3GTQI 2OTL1 1SIWA 1VQP1 1YJW1 1M902 3P5JB 3I561 1Q811 2QEX1 4NBCA 1LQLA 3CCEZ 1K9M2 1ML8A 3GTPI 2E2HI 1KD12 1VQ5Z 3NH8A 3CCL1 2JUBA 4BY1I 2PK7A 3NDIA 1RQFA 3F3PC 1RNIA 1VQNZ
chains in the Genus database with same CATH topology
3GCFA 1YI2Z 4NBGA 1ZB8A 4DGLA 2P3YA 1K8A2 1VQK1 1RO0A 3S17I 3M3YI 4MXUA 1S721 1VQOZ 3VMIA 4NBEA 1VQ61 3CCUZ 3HOVI 3NDJA 4DK1A 3MONA 2DE6A 3J81b 1YUKA 4CL1A 3HOZI 3GTLI 1NJI2 3VB9A 3J7A4 2OTJ1 5T67A 3BG0B 3G711 1KC82 2M6NA 3G4SZ 3VMGA 1YHQ1 3KIFA 4BBSI 4E2XA 5D1OA 4HGZA 3PO3I 1TWGI 3PO3S 3MZLB 4A3GI 3M4OI 2O4HA 3OW2Y 1JJ2Z 3GTGI 2JMOA 4A3CI 2O53A 2QRDB 3CC41 4MRIA 2RPRA 4HGYA 3S14I 1S7MA 3F3FC 3S1RI 3ESWA 2Y0SA 3CC7Z 4MH4A 3S15I 5IP9I 3CMA1 1USPA 1NP6A 3CCR1 1VQ7Z 2NVYI 1VQ9Z 3HOUI 1Z01A 4NBBA 1Z02A 4QTUA 4A3JI 4A3II 1VQMZ 5D1PA 2QREB 3CCE1 1Q822 4E30A 1VQ51 2QLVB 1WW9A 3CPWY 2GU2A 2W03A 3S1NI 1K731 3FKII 4RS4A 2JNYA 1VQ4Z 1YI21 4MD9A 1X3ZA 2JA7I 1VQLZ 4BBRI 2RIQA 4E2ZA 1YITZ 4A3KI 4E31A 2V8KA 2KPIA 1VQO1 3CCU1 2QA4Z 1Q861 4NB8A 1KQSZ 2IZ4A 4RV9A 3PO2I 1VQ8Z 1M1K1 2E2II 5C4XI 3BG1B 3HOWI 5T6BA 3G4S1 3NFZA 2IZ3A 3K7AI 2GTIA 1N8R2 2RT9A 4A3FI 2V8IA 3S2HI 3MZKB 3CMEZ 1I50I 2K3RA 2OOYB 3IF8A 1K83I 1M901 2VUMI 2JA5I 1QVFZ 1P9NA 2B63I 4NB9A 2LIYA 5LL6f 3TDHB 1QVFY 2Q51A 3IFUA 1KD11 1RO2A 2R7ZI 3JAMf 4NH1C 3U50C 3CC71 5A2Qf 1WIIA 1L1OC 1QYPA 3FQQA 3CCMZ 1JWHC 2NVXI 1VQ71 5IT9f 4E32A 2F4MA 1Q7Y2 2PMZA 2RBLA 4MONA 3CXCZ 3VTNA 1N2FA 1VQ91 3HOXI 1K8A1 4NFRA 2F4OA 3CXCY 1JJ2Y 2BJOA 3CC2Z 2J6AA 3CCSZ 1VQM1 3S1MI 3T4NB 3S1QI 5CM2M 5FLXf 3GKQA 3QWUA 4E2WA 1NJI1 1I3QI 1YIJZ 1VQ41 4TNUA 1KC81 2YU9I 3IX0A 4A3LI 2H85A 1VQL1 2E2JI 1YIT1 4S1TA 3HOYI 2QKDA 4EWCA 4RVDA 2AKLA 3Q87A 2QA41 1Q812 4A3BI 2ZAEB 3D9XA 2VUGA 3CCQZ 1WCMI 5FLMI 1VQ81 4A3EI 2QRCB 4DQYB 1QF8A 3JAMb 4BXXI 2E9HA 2Q4ZA 4HH4A 5C3EI 3CCVZ 5A2Qb 1YJNZ 1KRLA 3G6EZ 5IT9b 4MD7A 4X6AI 1Y1WI 3I55Z 3RZOI 3CME1 4Y7NI 2HF1A 3EEDA 3D6WA 1X3WA 2P28A 2GTHA 3GTMI 4BY7I 3GTMS 1KQSY 3CCJZ 1ZB9A 3GTJI 3RZDI 1Q821 1YJ9Z 3LUSA 2RHBA 5FLXb 2WB1A 4A3MI 3CCM1 3EERA 1R9TI 2JA8I 4QTTA 3S2DI 3CD6Z 4AYBA 5IP7I 2JR6A 1RO4A 1Z03A 2OTLZ 3NH4A 3CC21 1VQPZ 3CCS1 4A93I 2K5RA 1K9M1 1YJWZ 3I56Z 2QEXZ 3HKZA 5D1OB 2OOXB 1TWCI 3NH5A 4E2YA 3J80f 4E33A 2QR1B 1YUAA 1DL6A 1YIJ1 3CCLZ 1SFOI 1TWAI 3KIHA 2JS4A 2V8JA 1N8R1 2G2KA 1RLYA 4MD8A 5C44I 2R6MA 1QVGZ 1VLAA 1NUIA 2VF1A 1QVGY 1I6HI 1VQKZ 3OW2Z 1USPB 1S72Z 2R93I 1VQ6Z 1Y1VI 3CQZI 1Y1VS 4XX2A 3CCQ1 1W2BZ 3VMHA 2M48A 1PFTA 3CCV1 5T64A 1W2BY 1K732 2EGTA 4A3DI 3S16I 2OTJZ 1YJN1 2NVQI 2WAQA 1TFIA 3G71Z 2OZKA 3G6E1 2KI7B 2I3CA 3I551 1YHQZ 3I4NI 1Q7Y1 4NBHA 2PM9A 2DE5A 1TWFI 4NOZA 3I4MI 2JA6I 3H3VJ 3TE5B 4NBAA 2HU9A 4NBDA 3CCJ1 1Q862 4RVFA 3FQMA 3J81f 2YADA 5AN9F 2DE7A 1YJ91 5C4JI 3CC4Z 4RVHA 4RVGA 1X0TA 1TWHI 1M1K2 3I07A 3J80b 3CPWZ 2LFUA 3GTKI 2R92I 2W04A 3CMAZ 1ZH1A 1VQN1 3CD61 3CCRZ 3GTOI 2NVTI 4Y52I 4NBFA 3H0GI 3GTQI 2OTL1 1VQP1 1YJW1 1M902 3P5JB 3I561 1Q811 2QEX1 4NBCA 1LQLA 3CCEZ 1K9M2 1ML8A 3GTPI 2E2HI 1KD12 1VQ5Z 3NH8A 3CCL1 2JUBA 4BY1I 2PK7A 3NDIA 1RQFA 3F3PC 1RNIA 1VQNZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNY A;  3GCF A;  1TWA I;  1X3Z A;  2JS4 A;  2YU9 I;  4A3L I;  4NBG A;  1ZB8 A;  2JA7 I;  2E2J I;  1RLY A;  4BBR I;  5C44 I;  1VLA A;  4A3K I;  2P3Y A;  3HOY I;  2KPI A;  1NUI A;  2AKL A;  3Q87 A;  1I6H I;  3S17 I;  3M3Y I;  3VMI A;  1USP B;  4NBE A;  4A3B I;  2R93 I;  3HOV I;  4NB8 A;  2DE6 A;  1Y1V I;  3CQZ I;  4XX2 A;  1Y1V S;  3VMH A;  1WCM I;  5FLM I;  3PO2 I;  4A3E I;  3HOZ I;  3GTL I;  1PFT A;  2E2I I;  3VB9 A;  4BXX I;  5C3E I;  4A3D I;  5C4X I;  3S16 I;  3HOW I;  2NVQ I;  1TFI A;  3K7A I;  3VMG A;  4BBS I;  4A3F I;  3I4N I;  3S2H I;  3PO3 I;  4X6A I;  4NBH A;  1Y1W I;  3RZO I;  1TWG I;  3PO3 S;  2DE5 A;  4Y7N I;  1TWF I;  1I50 I;  4A3G I;  2HF1 A;  3M4O I;  4NOZ A;  3D6W A;  3I4M I;  2JA6 I;  3H3V J;  1X3W A;  3GTM I;  3GTG I;  4NBA A;  4BY7 I;  1K83 I;  2VUM I;  2JA5 I;  4NBD A;  3GTM S;  4A3C I;  2B63 I;  2DE7 A;  1ZB9 A;  3GTJ I;  4NB9 A;  5C4J I;  3RZD I;  3S14 I;  3LUS A;  2R7Z I;  1TWH I;  3ESW A;  3S1R I;  3I07 A;  3U50 C;  4MH4 A;  3GTK I;  4A3M I;  1L1O C;  5IP9 I;  1QYP A;  3S15 I;  2R92 I;  1USP A;  3EER A;  1R9T I;  2NVX I;  2JA8 I;  4QTT A;  3S2D I;  3GTO I;  2F4M A;  5IP7 I;  2NVT I;  2RBL A;  4Y52 I;  4NBF A;  2NVY I;  1N2F A;  3H0G I;  3GTQ I;  2JR6 A;  3HOX I;  1RO4 A;  3HOU I;  4NBB A;  2F4O A;  2BJO A;  4A93 I;  2K5R A;  4QTU A;  2J6A A;  4A3J I;  4A3I I;  4NBC A;  1LQL A;  3S1M I;  1TWC I;  3GTP I;  3S1Q I;  1ML8 A;  5CM2 M;  2E2H I;  1WW9 A;  3GKQ A;  1YUA A;  3S1N I;  1DL6 A;  4BY1 I;  2PK7 A;  1SFO I;  1I3Q I;  3FKI I; 
#chains in the Genus database with same CATH topology
 3GCF A;  2E7Z A;  1YI2 Z;  4NBG A;  1ZB8 A;  4DGL A;  2AYD A;  2V3V A;  1Y8C A;  2P3Y A;  1K8A 2;  1VQK 1;  1RO0 A;  3S17 I;  3M3Y I;  4MXU A;  1S72 1;  1VQO Z;  3VMI A;  2LEX A;  4NBE A;  1VQ6 1;  3CCU Z;  3HOV I;  3NDJ A;  4DK1 A;  3MON A;  2DE6 A;  3J81 b;  1YUK A;  4CL1 A;  1AA6 A;  3HOZ I;  3GTL I;  1NJI 2;  3VB9 A;  3J7A 4;  2OTJ 1;  5T67 A;  3BG0 B;  3G71 1;  1KC8 2;  2M6N A;  3G4S Z;  3VMG A;  1YHQ 1;  3KIF A;  4BBS I;  4E2X A;  5D1O A;  4HGZ A;  3PO3 I;  1TWG I;  3PO3 S;  3MZL B;  4A3G I;  3M4O I;  2O4H A;  3OW2 Y;  1JJ2 Z;  3GTG I;  2JMO A;  4A3C I;  2O53 A;  2QRD B;  3CC4 1;  4MRI A;  2RPR A;  4HGY A;  3S14 I;  1S7M A;  3F3F C;  3ESW A;  3S1R I;  2Y0S A;  3CC7 Z;  4MH4 A;  2VPX A;  3S15 I;  5IP9 I;  3CMA 1;  1USP A;  1NP6 A;  3CCR 1;  1VQ7 Z;  2NVY I;  1VQ9 Z;  3HOU I;  1Z01 A;  4NBB A;  1Z02 A;  2JIQ A;  4QTU A;  4A3J I;  4A3I I;  1VQM Z;  5D1P A;  2QRE B;  3CCE 1;  1Q82 2;  4E30 A;  1VQ5 1;  2QLV B;  1WW9 A;  3CPW Y;  2GU2 A;  2W03 A;  3S1N I;  1K73 1;  3FKI I;  4RS4 A;  2VPZ A;  2JNY A;  1VQ4 Z;  1YI2 1;  4MD9 A;  1X3Z A;  2JA7 I;  1VQL Z;  4BBR I;  2RIQ A;  4E2Z A;  1YIT Z;  4A3K I;  4E31 A;  2V8K A;  2KPI A;  3D2L A;  1VQO 1;  3CCU 1;  2QA4 Z;  1Q86 1;  4NB8 A;  1KQS Z;  2IZ4 A;  4RV9 A;  3PO2 I;  1VQ8 Z;  1FDI A;  1M1K 1;  2E2I I;  5C4X I;  2JIP A;  3BG1 B;  3HOW I;  5T6B A;  3G4S 1;  3NFZ A;  2IZ3 A;  3K7A I;  2GTI A;  1N8R 2;  2RT9 A;  4A3F I;  2V8I A;  3S2H I;  3MZK B;  3CME Z;  1I50 I;  2K3R A;  2OOY B;  3IF8 A;  1K83 I;  1M90 1;  2VUM I;  2JA5 I;  1QVF Z;  1P9N A;  2B63 I;  4NB9 A;  2LIY A;  2VPY A;  5LL6 f;  3TDH B;  1QVF Y;  2Q51 A;  3IFU A;  1KD1 1;  1RO2 A;  2R7Z I;  3JAM f;  4NH1 C;  3U50 C;  3CC7 1;  5A2Q f;  1WII A;  1L1O C;  1QYP A;  3FQQ A;  3CCM Z;  1JWH C;  2NVX I;  1VQ7 1;  5IT9 f;  4E32 A;  2F4M A;  1Q7Y 2;  2PMZ A;  2RBL A;  4MON A;  3CXC Z;  3VTN A;  1N2F A;  1VQ9 1;  3HOX I;  1K8A 1;  4NFR A;  2F4O A;  3CXC Y;  1JJ2 Y;  2BJO A;  3CC2 Z;  2J6A A;  3CCS Z;  1VQM 1;  3S1M I;  3T4N B;  3S1Q I;  5CM2 M;  5FLX f;  3GKQ A;  3QWU A;  4E2W A;  1NJI 1;  1I3Q I;  1YIJ Z;  1VQ4 1;  4TNU A;  1KC8 1;  2YU9 I;  3IX0 A;  4A3L I;  2H85 A;  1VQL 1;  2E2J I;  1YIT 1;  4S1T A;  3HOY I;  2QKD A;  4EWC A;  4RVD A;  2AKL A;  3Q87 A;  2QA4 1;  1Q81 2;  4A3B I;  2ZAE B;  3D9X A;  2VUG A;  3CCQ Z;  1WCM I;  5FLM I;  1VQ8 1;  4A3E I;  2QRC B;  4DQY B;  1QF8 A;  3JAM b;  4BXX I;  2E9H A;  2Q4Z A;  4HH4 A;  5C3E I;  3CCV Z;  5A2Q b;  1YJN Z;  1KRL A;  3G6E Z;  5IT9 b;  4MD7 A;  4X6A I;  1Y1W I;  3I55 Z;  3RZO I;  3CME 1;  4Y7N I;  2HF1 A;  3EED A;  3D6W A;  1X3W A;  2P28 A;  2GTH A;  3GTM I;  4BY7 I;  3GTM S;  1KQS Y;  3CCJ Z;  1ZB9 A;  3GTJ I;  2JIM A;  3RZD I;  1Q82 1;  1YJ9 Z;  3LUS A;  2VPW A;  2RHB A;  5FLX b;  2WB1 A;  4A3M I;  1WZN A;  3CCM 1;  3EER A;  1R9T I;  2JA8 I;  4QTT A;  3S2D I;  3CD6 Z;  4AYB A;  5IP7 I;  2JR6 A;  1RO4 A;  1Z03 A;  2OTL Z;  3NH4 A;  3CC2 1;  1VQP Z;  3CCS 1;  4A93 I;  2K5R A;  1K9M 1;  1YJW Z;  3I56 Z;  2QEX Z;  3HKZ A;  5D1O B;  2OOX B;  1TWC I;  3NH5 A;  4E2Y A;  3J80 f;  4E33 A;  2QR1 B;  1YUA A;  1DL6 A;  1YIJ 1;  3IR7 A;  3CCL Z;  1SFO I;  1TWA I;  3KIH A;  2JS4 A;  2V8J A;  1N8R 1;  2G2K A;  1RLY A;  4MD8 A;  5C44 I;  2R6M A;  1QVG Z;  1VLA A;  1NUI A;  2VF1 A;  1WJ2 A;  2V45 A;  1QVG Y;  1I6H I;  1VQK Z;  3OW2 Z;  1USP B;  1S72 Z;  2R93 I;  1VQ6 Z;  1Y1V I;  3CQZ I;  1QXF A;  1Y1V S;  4XX2 A;  3CCQ 1;  1W2B Z;  3VMH A;  2M48 A;  2NAP A;  1PFT A;  3CCV 1;  5T64 A;  1W2B Y;  1K73 2;  2EGT A;  4A3D I;  3S16 I;  2OTJ Z;  1YJN 1;  2NVQ I;  2WAQ A;  1TFI A;  3G71 Z;  2OZK A;  3G6E 1;  2KI7 B;  2I3C A;  1Q16 A;  3I55 1;  1YHQ Z;  3I4N I;  1Q7Y 1;  4NBH A;  2PM9 A;  2DE5 A;  2IV2 X;  1TWF I;  4NOZ A;  3I4M I;  2JA6 I;  3H3V J;  3TE5 B;  4NBA A;  2HU9 A;  4NBD A;  3CCJ 1;  1Q86 2;  4RVF A;  3FQM A;  3J81 f;  2YAD A;  5AN9 F;  2DE7 A;  1YJ9 1;  5C4J I;  3CC4 Z;  4RVH A;  4RVG A;  1X0T A;  1TWH I;  1M1K 2;  3I07 A;  3J80 b;  3CPW Z;  2LFU A;  3GTK I;  2R92 I;  2W04 A;  3CMA Z;  1ZH1 A;  1VQN 1;  3CD6 1;  2JIR A;  3CCR Z;  2JIO A;  3GTO I;  2NVT I;  4Y52 I;  1FDO A;  4NBF A;  3H0G I;  3GTQ I;  2OTL 1;  1SIW A;  1VQP 1;  1YJW 1;  1M90 2;  3P5J B;  3I56 1;  1Q81 1;  2QEX 1;  4NBC A;  1LQL A;  3CCE Z;  1K9M 2;  1ML8 A;  3GTP I;  2E2H I;  1KD1 2;  1VQ5 Z;  3NH8 A;  3CCL 1;  2JUB A;  4BY1 I;  2PK7 A;  3NDI A;  1RQF A;  3F3P C;  1RNI A;  1VQN Z; 
#chains in the Genus database with same CATH homology
 3GCF A;  1YI2 Z;  4NBG A;  1ZB8 A;  4DGL A;  2P3Y A;  1K8A 2;  1VQK 1;  1RO0 A;  3S17 I;  3M3Y I;  4MXU A;  1S72 1;  1VQO Z;  3VMI A;  4NBE A;  1VQ6 1;  3CCU Z;  3HOV I;  3NDJ A;  4DK1 A;  3MON A;  2DE6 A;  3J81 b;  1YUK A;  4CL1 A;  3HOZ I;  3GTL I;  1NJI 2;  3VB9 A;  3J7A 4;  2OTJ 1;  5T67 A;  3BG0 B;  3G71 1;  1KC8 2;  2M6N A;  3G4S Z;  3VMG A;  1YHQ 1;  3KIF A;  4BBS I;  4E2X A;  5D1O A;  4HGZ A;  3PO3 I;  1TWG I;  3PO3 S;  3MZL B;  4A3G I;  3M4O I;  2O4H A;  3OW2 Y;  1JJ2 Z;  3GTG I;  2JMO A;  4A3C I;  2O53 A;  2QRD B;  3CC4 1;  4MRI A;  2RPR A;  4HGY A;  3S14 I;  1S7M A;  3F3F C;  3S1R I;  3ESW A;  2Y0S A;  3CC7 Z;  4MH4 A;  3S15 I;  5IP9 I;  3CMA 1;  1USP A;  1NP6 A;  3CCR 1;  1VQ7 Z;  2NVY I;  1VQ9 Z;  3HOU I;  1Z01 A;  4NBB A;  1Z02 A;  4QTU A;  4A3J I;  4A3I I;  1VQM Z;  5D1P A;  2QRE B;  3CCE 1;  1Q82 2;  4E30 A;  1VQ5 1;  2QLV B;  1WW9 A;  3CPW Y;  2GU2 A;  2W03 A;  3S1N I;  1K73 1;  3FKI I;  4RS4 A;  2JNY A;  1VQ4 Z;  1YI2 1;  4MD9 A;  1X3Z A;  2JA7 I;  1VQL Z;  4BBR I;  2RIQ A;  4E2Z A;  1YIT Z;  4A3K I;  4E31 A;  2V8K A;  2KPI A;  1VQO 1;  3CCU 1;  2QA4 Z;  1Q86 1;  4NB8 A;  1KQS Z;  2IZ4 A;  4RV9 A;  3PO2 I;  1VQ8 Z;  1M1K 1;  2E2I I;  5C4X I;  3BG1 B;  3HOW I;  5T6B A;  3G4S 1;  3NFZ A;  2IZ3 A;  3K7A I;  2GTI A;  1N8R 2;  2RT9 A;  4A3F I;  2V8I A;  3S2H I;  3MZK B;  3CME Z;  1I50 I;  2K3R A;  2OOY B;  3IF8 A;  1K83 I;  1M90 1;  2VUM I;  2JA5 I;  1QVF Z;  1P9N A;  2B63 I;  4NB9 A;  2LIY A;  5LL6 f;  3TDH B;  1QVF Y;  2Q51 A;  3IFU A;  1KD1 1;  1RO2 A;  2R7Z I;  3JAM f;  4NH1 C;  3U50 C;  3CC7 1;  5A2Q f;  1WII A;  1L1O C;  1QYP A;  3FQQ A;  3CCM Z;  1JWH C;  2NVX I;  1VQ7 1;  5IT9 f;  4E32 A;  2F4M A;  1Q7Y 2;  2PMZ A;  2RBL A;  4MON A;  3CXC Z;  3VTN A;  1N2F A;  1VQ9 1;  3HOX I;  1K8A 1;  4NFR A;  2F4O A;  3CXC Y;  1JJ2 Y;  2BJO A;  3CC2 Z;  2J6A A;  3CCS Z;  1VQM 1;  3S1M I;  3T4N B;  3S1Q I;  5CM2 M;  5FLX f;  3GKQ A;  3QWU A;  4E2W A;  1NJI 1;  1I3Q I;  1YIJ Z;  1VQ4 1;  4TNU A;  1KC8 1;  2YU9 I;  3IX0 A;  4A3L I;  2H85 A;  1VQL 1;  2E2J I;  1YIT 1;  4S1T A;  3HOY I;  2QKD A;  4EWC A;  4RVD A;  2AKL A;  3Q87 A;  2QA4 1;  1Q81 2;  4A3B I;  2ZAE B;  3D9X A;  2VUG A;  3CCQ Z;  1WCM I;  5FLM I;  1VQ8 1;  4A3E I;  2QRC B;  4DQY B;  1QF8 A;  3JAM b;  4BXX I;  2E9H A;  2Q4Z A;  4HH4 A;  5C3E I;  3CCV Z;  5A2Q b;  1YJN Z;  1KRL A;  3G6E Z;  5IT9 b;  4MD7 A;  4X6A I;  1Y1W I;  3I55 Z;  3RZO I;  3CME 1;  4Y7N I;  2HF1 A;  3EED A;  3D6W A;  1X3W A;  2P28 A;  2GTH A;  3GTM I;  4BY7 I;  3GTM S;  1KQS Y;  3CCJ Z;  1ZB9 A;  3GTJ I;  3RZD I;  1Q82 1;  1YJ9 Z;  3LUS A;  2RHB A;  5FLX b;  2WB1 A;  4A3M I;  3CCM 1;  3EER A;  1R9T I;  2JA8 I;  4QTT A;  3S2D I;  3CD6 Z;  4AYB A;  5IP7 I;  2JR6 A;  1RO4 A;  1Z03 A;  2OTL Z;  3NH4 A;  3CC2 1;  1VQP Z;  3CCS 1;  4A93 I;  2K5R A;  1K9M 1;  1YJW Z;  3I56 Z;  2QEX Z;  3HKZ A;  5D1O B;  2OOX B;  1TWC I;  3NH5 A;  4E2Y A;  3J80 f;  4E33 A;  2QR1 B;  1YUA A;  1DL6 A;  1YIJ 1;  3CCL Z;  1SFO I;  1TWA I;  3KIH A;  2JS4 A;  2V8J A;  1N8R 1;  2G2K A;  1RLY A;  4MD8 A;  5C44 I;  2R6M A;  1QVG Z;  1VLA A;  1NUI A;  2VF1 A;  1QVG Y;  1I6H I;  1VQK Z;  3OW2 Z;  1USP B;  1S72 Z;  2R93 I;  1VQ6 Z;  1Y1V I;  3CQZ I;  1Y1V S;  4XX2 A;  3CCQ 1;  1W2B Z;  3VMH A;  2M48 A;  1PFT A;  3CCV 1;  5T64 A;  1W2B Y;  1K73 2;  2EGT A;  4A3D I;  3S16 I;  2OTJ Z;  1YJN 1;  2NVQ I;  2WAQ A;  1TFI A;  3G71 Z;  2OZK A;  3G6E 1;  2KI7 B;  2I3C A;  3I55 1;  1YHQ Z;  3I4N I;  1Q7Y 1;  4NBH A;  2PM9 A;  2DE5 A;  1TWF I;  4NOZ A;  3I4M I;  2JA6 I;  3H3V J;  3TE5 B;  4NBA A;  2HU9 A;  4NBD A;  3CCJ 1;  1Q86 2;  4RVF A;  3FQM A;  3J81 f;  2YAD A;  5AN9 F;  2DE7 A;  1YJ9 1;  5C4J I;  3CC4 Z;  4RVH A;  4RVG A;  1X0T A;  1TWH I;  1M1K 2;  3I07 A;  3J80 b;  3CPW Z;  2LFU A;  3GTK I;  2R92 I;  2W04 A;  3CMA Z;  1ZH1 A;  1VQN 1;  3CD6 1;  3CCR Z;  3GTO I;  2NVT I;  4Y52 I;  4NBF A;  3H0G I;  3GTQ I;  2OTL 1;  1VQP 1;  1YJW 1;  1M90 2;  3P5J B;  3I56 1;  1Q81 1;  2QEX 1;  4NBC A;  1LQL A;  3CCE Z;  1K9M 2;  1ML8 A;  3GTP I;  2E2H I;  1KD1 2;  1VQ5 Z;  3NH8 A;  3CCL 1;  2JUB A;  4BY1 I;  2PK7 A;  3NDI A;  1RQF A;  3F3P C;  1RNI A;  1VQN Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...