3GTGI

Backtracked rna polymerase ii complex with 12mer rna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna hybrid
total genus 9
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtgI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtgI02
4NOZA 1DL6A 3I4NI 2KPIA 3GTGI 4NBGA 4QTTA 3GTKI 1K83I 1ZB8A 2NVYI 4A3LI 3M4OI 1L1OC 5CM2M 3PO2I 2JA7I 2VUMI 5C3EI 2R92I 2JNYA 3S1RI 3Q87A 5C4XI 3RZDI 4Y7NI 4Y52I 3HOYI 1N2FA 1LQLA 3HOWI 4A3KI 3VMHA 3S17I 2F4MA 3VMGA 3EERA 4NBCA 1SFOI 3FKII 2NVXI 3GTOI 3HOXI 1YUAA 1USPA 2NVQI 1X3ZA 1I50I 1QYPA 3I4MI 2JA6I 3S14I 3VMIA 1TFIA 3CQZI 2JR6A 3H0GI 1RO4A 2DE5A 2AKLA 2R7ZI 2K5RA 3ESWA 1PFTA 3I07A 1Y1WI 2F4OA 4NBFA 3VB9A 3M3YI 2YU9I 3S1QI 4A3MI 4A3GI 1RLYA 2JS4A 3U50C 2J6AA 3S2HI 1WCMI 2P3YA 2JA8I 3HOZI 4NBDA 5C4JI 2HF1A 1X3WA 1I6HI 4BXXI 3D6WA 1VLAA 3S1NI 3PO3I 1Y1VI 3S2DI 1TWHI 2E2JI 3GKQA 1TWCI 3S1MI 3GTPI 1TWFI 2B63I 3PO3S 1Y1VS 2PK7A 5IP7I 4NB8A 1TWGI 4A3II 1NUIA 2E2II 4NBAA 4BY1I 2RBLA 3HOVI 3GTJI 3HOUI 4A3CI 4NB9A 5C44I 3S16I 1USPB 3GTLI 3H3VJ 3GTMI 1R9TI 4A3BI 4X6AI 5FLMI 4XX2A 4A3JI 4A93I 4A3DI 4MH4A 1I3QI 4BBRI 3GTMS 3RZOI 3GCFA 2NVTI 4BY7I 1WW9A 2JA5I 4QTUA 1ZB9A 4NBEA 2DE7A 4NBHA 4NBBA 2E2HI 1ML8A 2DE6A 3GTQI 1TWAI 4A3EI 3LUSA 4BBSI 4A3FI 3S15I 2R93I 5IP9I 2BJOA 3K7AI
chains in the Genus database with same CATH superfamily
1DL6A 2ZAEB 3I4NI 2KPIA 2WB1A 4NBGA 5AN9F 3G6E1 4RVHA 1FDOA 4RVGA 3CCVZ 1RO2A 2W03A 2QA41 2VPYA 2OTLZ 3CCLZ 2GTIA 5C3EI 2JNYA 3CC4Z 3RZDI 4Y7NI 4S1TA 4Y52I 3HOYI 3QWUA 2F4MA 1SFOI 1YITZ 1FDIA 2NVQI 2IZ4A 1Z02A 1I50I 3CC7Z 3T4NB 2JA6I 2JIRA 1YJNZ 3H0GI 2Q4ZA 2R7ZI 5T6BA 2OTJZ 1S72Z 1Y1WI 2NAPA 1Q822 1NJI2 2YU9I 4EWCA 1VQ81 1QVFY 2QRDB 3F3FC 1YJWZ 1VQNZ 4NBDA 1JWHC 3PO3I 1Y1VI 1YHQZ 3NH5A 3CCV1 2E2JI 1TWFI 3PO3S 1Y1VS 1Y8CA 2PK7A 3IR7A 3I55Z 3EEDA 3CXCY 3CXCZ 3KIHA 4NBAA 3BG0B 1YIJZ 2RBLA 3HOVI 5T64A 1M1K1 3HOUI 1VQ6Z 4NFRA 4NB9A 2RPRA 1YIT1 2QEXZ 4A3BI 4MD8A 4XX2A 4A3JI 4DGLA 4A93I 2E7ZA 4BBRI 2E9HA 3RZOI 5A2Qb 3CPWY 3CPWZ 2GU2A 2RHBA 1WW9A 3KIFA 3P5JB 3G6EZ 2JA5I 1S721 2Q51A 2DE7A 1VQ9Z 4NBHA 2QA4Z 1K732 3JAMf 3GTQI 4A3EI 2VPWA 1W2BY 3LUSA 1W2BZ 4MD7A 1YJW1 1VQN1 2O53A 2QKDA 2QREB 5T67A 4NOZA 1KD12 3GTGI 1YHQ1 2K3RA 4QTTA 1SIWA 2QRCB 3MONA 3PO2I 2QR1B 3I551 2VUMI 3F3PC 3CCE1 1WZNA 1S7MA 4E30A 1YIJ1 2VF1A 1VQOZ 3IX0A 1VQ61 3HOWI 1VQMZ 1Q862 3VMGA 4E33A 3EERA 2OOYB 2VUGA 2VPXA 3FKII 4NH1C 1YUAA 1Q821 1NJI1 2HU9A 3I4MI 1TFIA 1RO4A 3ESWA 1VQ91 1ZH1A 4NBFA 1VQPZ 2Y0SA 3HKZA 2W04A 1RLYA 4MONA 3U50C 2G2KA 5IT9f 2P3YA 2LEXA 3D2LA 3HOZI 1X3WA 1VLAA 3S2DI 4MD9A 3GTPI 5IP7I 5D1PA 1TWGI 1VQO1 4BY1I 1VQM1 2LIYA 2AYDA 3S16I 3GTLI 2YADA 1R9TI 1RO0A 1X0TA 2LFUA 1KRLA 1VQLZ 1K731 1QVGY 3G4S1 1QVGZ 4BY7I 2RT9A 3J80b 1P9NA 1ZB9A 1VQP1 4NBEA 5LL6f 1KD11 1JJ2Y 1JJ2Z 3CCEZ 1TWAI 4E2ZA 1NP6A 3JAMb 4BBSI 1M902 3J7A4 2M6NA 1KC82 4RV9A 3OW2Z 3IFUA 3G71Z 2PM9A 3GTKI 1ZB8A 4MXUA 2NVYI 4A3LI 1Q861 1L1OC 5FLXb 1QXFA 2JA7I 1VQ7Z 2KI7B 3FQMA 4HGYA 2R92I 3CCM1 3CMEZ 5C4XI 1K8A2 3J81b 1VQ41 2GTHA 3NH4A 4A3KI 3CCR1 3S17I 1K9M2 1Q7Y2 2V8KA 4NBCA 1YUKA 1VQL1 2NVXI 4E2WA 1USPA 3CCQZ 2P28A 1X3ZA 1QYPA 1N8R2 3S14I 3D9XA 3VMIA 2DE5A 2K5RA 2VPZA 2F4OA 3VB9A 4A3MI 1YI2Z 1VQ5Z 1AA6A 4A3GI 4E2YA 2JS4A 2J6AA 3CCUZ 2JIQA 3S2HI 2JA8I 3G711 4E32A 5C4JI 4BXXI 1I6HI 3D6WA 5A2Qf 1WJ2A 3CC2Z 1TWHI 3VTNA 3G4SZ 3S1MI 1VQ71 3MZKB 4E2XA 2R6MA 4CL1A 1RNIA 3CME1 2JMOA 3MZLB 1VQKZ 4RS4A 2V45A 5C44I 1USPB 2I3CA 3CCQ1 1WIIA 4RVFA 4A3DI 4MH4A 1M901 2NVTI 4RVDA 4AYBA 3CD6Z 2H85A 3BG1B 4QTUA 1KC81 2V3VA 3CMAZ 1VQ51 1YI21 1ML8A 2V8IA 3CCMZ 3NDIA 3CCU1 4A3FI 2QLVB 1VQ4Z 3S15I 2EGTA 2BJOA 3K7AI 4TNUA 3CCRZ 2V8JA 1K8A1 3CC21 1K83I 3M4OI 5CM2M 1K9M1 1Q7Y1 2OZKA 2JUBA 3TDHB 1Q812 1N8R1 1VQK1 3S1RI 3Q87A 3FQQA 1N2FA 3CCJZ 1LQLA 1QVFZ 1QF8A 3VMHA 3OW2Y 1Z01A 3HOXI 3GTOI 2PMZA 3NH8A 3CQZI 2JR6A 3CD61 2AKLA 4MRIA 3CCL1 2OTL1 3CCSZ 3CMA1 1Z03A 4DK1A 1PFTA 3CC41 3I07A 3M3YI 2IV2X 5D1OA 3I56Z 3S1QI 1Q16A 1YJ9Z 1WCMI 3CC71 2HF1A 1YJN1 3S1NI 2OOXB 4HGZA 3J80f 4HH4A 2OTJ1 3GKQA 1TWCI 3NDJA 2B63I 4NB8A 2JIOA 4A3II 1NUIA 2M48A 2E2II 3CCJ1 1RQFA 3GTJI 4A3CI 4E31A 3H3VJ 3GTMI 5IT9b 4X6AI 5FLMI 2O4HA 3IF8A 2JIMA 1I3QI 2WAQA 5FLXf 3GTMS 1KQSY 3GCFA 1KQSZ 3CCS1 4DQYB 1M1K2 2IZ3A 3TE5B 2RIQA 5D1OB 2JIPA 3I561 3J81f 4NBBA 2E2HI 2DE6A 1YJ91 1VQ8Z 2QEX1 2R93I 5IP9I 3NFZA 1Q811
chains in the Genus database with same CATH topology
1DL6A 2ZAEB 3I4NI 2KPIA 2WB1A 4NBGA 5AN9F 3G6E1 4RVHA 4RVGA 3CCVZ 1RO2A 2W03A 2QA41 2OTLZ 3CCLZ 2GTIA 5C3EI 2JNYA 3CC4Z 3RZDI 4Y7NI 4S1TA 4Y52I 3HOYI 3QWUA 2F4MA 1SFOI 1YITZ 2NVQI 2IZ4A 1Z02A 1I50I 3CC7Z 3T4NB 2JA6I 1YJNZ 3H0GI 2Q4ZA 2R7ZI 5T6BA 2OTJZ 1S72Z 1Y1WI 1Q822 1NJI2 2YU9I 4EWCA 1VQ81 1QVFY 2QRDB 3F3FC 1YJWZ 1VQNZ 4NBDA 1JWHC 3PO3I 1Y1VI 1YHQZ 3NH5A 3CCV1 2E2JI 1TWFI 3PO3S 1Y1VS 2PK7A 3I55Z 3EEDA 3CXCY 3CXCZ 3KIHA 4NBAA 3BG0B 1YIJZ 2RBLA 3HOVI 5T64A 1M1K1 3HOUI 1VQ6Z 4NFRA 4NB9A 2RPRA 1YIT1 2QEXZ 4A3BI 4MD8A 4XX2A 4A3JI 4DGLA 4A93I 4BBRI 2E9HA 3RZOI 5A2Qb 3CPWY 3CPWZ 2GU2A 2RHBA 1WW9A 3KIFA 3P5JB 3G6EZ 2JA5I 1S721 2Q51A 2DE7A 1VQ9Z 4NBHA 2QA4Z 1K732 3JAMf 3GTQI 4A3EI 1W2BY 3LUSA 1W2BZ 4MD7A 1YJW1 1VQN1 2O53A 2QKDA 2QREB 5T67A 4NOZA 1KD12 3GTGI 1YHQ1 2K3RA 4QTTA 2QRCB 3MONA 3PO2I 2QR1B 3I551 2VUMI 3F3PC 3CCE1 1S7MA 4E30A 1YIJ1 2VF1A 1VQOZ 3IX0A 1VQ61 3HOWI 1VQMZ 1Q862 3VMGA 4E33A 3EERA 2OOYB 2VUGA 3FKII 4NH1C 1Q821 1YUAA 1NJI1 2HU9A 3I4MI 1TFIA 1RO4A 3ESWA 1VQ91 1ZH1A 4NBFA 1VQPZ 2Y0SA 3HKZA 2W04A 1RLYA 4MONA 3U50C 2G2KA 5IT9f 2P3YA 3HOZI 1X3WA 1VLAA 3S2DI 4MD9A 3GTPI 5IP7I 5D1PA 1TWGI 1VQO1 4BY1I 1VQM1 2LIYA 3S16I 3GTLI 2YADA 1R9TI 1RO0A 1X0TA 2LFUA 1KRLA 1VQLZ 1K731 1QVGY 3G4S1 1QVGZ 4BY7I 2RT9A 3J80b 1P9NA 1ZB9A 1VQP1 4NBEA 5LL6f 1KD11 1JJ2Y 1JJ2Z 3CCEZ 1TWAI 4E2ZA 1NP6A 3JAMb 4BBSI 1M902 3J7A4 2M6NA 1KC82 4RV9A 3OW2Z 3IFUA 3G71Z 2PM9A 3GTKI 1ZB8A 4MXUA 2NVYI 4A3LI 1Q861 1L1OC 5FLXb 2JA7I 1VQ7Z 2KI7B 3FQMA 4HGYA 2R92I 3CCM1 3CMEZ 5C4XI 1K8A2 3J81b 1VQ41 2GTHA 3NH4A 4A3KI 3CCR1 3S17I 1K9M2 1Q7Y2 2V8KA 4NBCA 1YUKA 1VQL1 2NVXI 4E2WA 1USPA 3CCQZ 2P28A 1X3ZA 1QYPA 1N8R2 3S14I 3D9XA 3VMIA 2DE5A 2K5RA 2F4OA 3VB9A 4A3MI 1YI2Z 1VQ5Z 4A3GI 4E2YA 2JS4A 2J6AA 3CCUZ 3S2HI 2JA8I 3G711 4E32A 5C4JI 4BXXI 1I6HI 3D6WA 5A2Qf 3CC2Z 1TWHI 3VTNA 3G4SZ 3S1MI 1VQ71 3MZKB 4E2XA 2R6MA 4CL1A 1RNIA 3CME1 2JMOA 3MZLB 1VQKZ 4RS4A 5C44I 1USPB 2I3CA 3CCQ1 1WIIA 4RVFA 4A3DI 4MH4A 1M901 2NVTI 4RVDA 4AYBA 3CD6Z 2H85A 3BG1B 4QTUA 1KC81 3CMAZ 1VQ51 1YI21 1ML8A 2V8IA 3CCMZ 3NDIA 3CCU1 4A3FI 2QLVB 1VQ4Z 3S15I 2EGTA 2BJOA 3K7AI 4TNUA 3CCRZ 2V8JA 1K8A1 3CC21 1K83I 3M4OI 5CM2M 1K9M1 1Q7Y1 2OZKA 2JUBA 3TDHB 1Q812 1N8R1 1VQK1 3S1RI 3Q87A 3FQQA 1N2FA 3CCJZ 1LQLA 1QVFZ 1QF8A 3VMHA 3OW2Y 1Z01A 3HOXI 3GTOI 2PMZA 3NH8A 3CQZI 2JR6A 3CD61 2AKLA 4MRIA 3CCL1 2OTL1 3CCSZ 3CMA1 1Z03A 4DK1A 1PFTA 3CC41 3I07A 3M3YI 3S1QI 5D1OA 3I56Z 1YJ9Z 1WCMI 3CC71 2HF1A 1YJN1 3S1NI 2OOXB 4HGZA 3J80f 4HH4A 2OTJ1 3GKQA 1TWCI 3NDJA 2B63I 4NB8A 4A3II 1NUIA 2M48A 2E2II 3CCJ1 1RQFA 3GTJI 4A3CI 4E31A 3H3VJ 3GTMI 5IT9b 4X6AI 5FLMI 2O4HA 3IF8A 1I3QI 2WAQA 5FLXf 3GTMS 1KQSY 3GCFA 1KQSZ 3CCS1 4DQYB 1M1K2 2IZ3A 3TE5B 2RIQA 5D1OB 3I561 3J81f 4NBBA 2E2HI 2DE6A 1YJ91 1VQ8Z 2QEX1 2R93I 5IP9I 3NFZA 1Q811
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NOZ A;  1DL6 A;  3I4N I;  2KPI A;  3GTG I;  4NBG A;  4QTT A;  3GTK I;  1K83 I;  1ZB8 A;  2NVY I;  4A3L I;  3M4O I;  1L1O C;  5CM2 M;  3PO2 I;  2JA7 I;  2VUM I;  5C3E I;  2R92 I;  2JNY A;  3S1R I;  3Q87 A;  5C4X I;  3RZD I;  4Y7N I;  4Y52 I;  3HOY I;  1N2F A;  1LQL A;  3HOW I;  4A3K I;  3VMH A;  3S17 I;  2F4M A;  3VMG A;  3EER A;  4NBC A;  1SFO I;  3FKI I;  2NVX I;  3GTO I;  3HOX I;  1YUA A;  1USP A;  2NVQ I;  1X3Z A;  1I50 I;  1QYP A;  3I4M I;  2JA6 I;  3S14 I;  3VMI A;  1TFI A;  3CQZ I;  2JR6 A;  3H0G I;  1RO4 A;  2DE5 A;  2AKL A;  2R7Z I;  2K5R A;  3ESW A;  1PFT A;  3I07 A;  1Y1W I;  2F4O A;  4NBF A;  3VB9 A;  3M3Y I;  2YU9 I;  3S1Q I;  4A3M I;  4A3G I;  1RLY A;  2JS4 A;  3U50 C;  2J6A A;  3S2H I;  1WCM I;  2P3Y A;  2JA8 I;  3HOZ I;  4NBD A;  5C4J I;  2HF1 A;  1X3W A;  1I6H I;  4BXX I;  3D6W A;  1VLA A;  3S1N I;  3PO3 I;  1Y1V I;  3S2D I;  1TWH I;  2E2J I;  3GKQ A;  1TWC I;  3S1M I;  3GTP I;  1TWF I;  2B63 I;  3PO3 S;  1Y1V S;  2PK7 A;  5IP7 I;  4NB8 A;  1TWG I;  4A3I I;  1NUI A;  2E2I I;  4NBA A;  4BY1 I;  2RBL A;  3HOV I;  3GTJ I;  3HOU I;  4A3C I;  4NB9 A;  5C44 I;  3S16 I;  1USP B;  3GTL I;  3H3V J;  3GTM I;  1R9T I;  4A3B I;  4X6A I;  5FLM I;  4XX2 A;  4A3J I;  4A93 I;  4A3D I;  4MH4 A;  1I3Q I;  4BBR I;  3GTM S;  3RZO I;  3GCF A;  2NVT I;  4BY7 I;  1WW9 A;  2JA5 I;  4QTU A;  1ZB9 A;  4NBE A;  2DE7 A;  4NBH A;  4NBB A;  2E2H I;  1ML8 A;  2DE6 A;  3GTQ I;  1TWA I;  4A3E I;  3LUS A;  4BBS I;  4A3F I;  3S15 I;  2R93 I;  5IP9 I;  2BJO A;  3K7A I; 
#chains in the Genus database with same CATH topology
 1DL6 A;  2ZAE B;  3I4N I;  2KPI A;  2WB1 A;  4NBG A;  5AN9 F;  3G6E 1;  4RVH A;  1FDO A;  4RVG A;  3CCV Z;  1RO2 A;  2W03 A;  2QA4 1;  2VPY A;  2OTL Z;  3CCL Z;  2GTI A;  5C3E I;  2JNY A;  3CC4 Z;  3RZD I;  4Y7N I;  4S1T A;  4Y52 I;  3HOY I;  3QWU A;  2F4M A;  1SFO I;  1YIT Z;  1FDI A;  2NVQ I;  2IZ4 A;  1Z02 A;  1I50 I;  3CC7 Z;  3T4N B;  2JA6 I;  2JIR A;  1YJN Z;  3H0G I;  2Q4Z A;  2R7Z I;  5T6B A;  2OTJ Z;  1S72 Z;  1Y1W I;  2NAP A;  1Q82 2;  1NJI 2;  2YU9 I;  4EWC A;  1VQ8 1;  1QVF Y;  2QRD B;  3F3F C;  1YJW Z;  1VQN Z;  4NBD A;  1JWH C;  3PO3 I;  1Y1V I;  1YHQ Z;  3NH5 A;  3CCV 1;  2E2J I;  1TWF I;  3PO3 S;  1Y1V S;  1Y8C A;  2PK7 A;  3IR7 A;  3I55 Z;  3EED A;  3CXC Y;  3CXC Z;  3KIH A;  4NBA A;  3BG0 B;  1YIJ Z;  2RBL A;  3HOV I;  5T64 A;  1M1K 1;  3HOU I;  1VQ6 Z;  4NFR A;  4NB9 A;  2RPR A;  1YIT 1;  2QEX Z;  4A3B I;  4MD8 A;  4XX2 A;  4A3J I;  4DGL A;  4A93 I;  2E7Z A;  4BBR I;  2E9H A;  3RZO I;  5A2Q b;  3CPW Y;  3CPW Z;  2GU2 A;  2RHB A;  1WW9 A;  3KIF A;  3P5J B;  3G6E Z;  2JA5 I;  1S72 1;  2Q51 A;  2DE7 A;  1VQ9 Z;  4NBH A;  2QA4 Z;  1K73 2;  3JAM f;  3GTQ I;  4A3E I;  2VPW A;  1W2B Y;  3LUS A;  1W2B Z;  4MD7 A;  1YJW 1;  1VQN 1;  2O53 A;  2QKD A;  2QRE B;  5T67 A;  4NOZ A;  1KD1 2;  3GTG I;  1YHQ 1;  2K3R A;  4QTT A;  1SIW A;  2QRC B;  3MON A;  3PO2 I;  2QR1 B;  3I55 1;  2VUM I;  3F3P C;  3CCE 1;  1WZN A;  1S7M A;  4E30 A;  1YIJ 1;  2VF1 A;  1VQO Z;  3IX0 A;  1VQ6 1;  3HOW I;  1VQM Z;  1Q86 2;  3VMG A;  4E33 A;  3EER A;  2OOY B;  2VUG A;  2VPX A;  3FKI I;  4NH1 C;  1YUA A;  1Q82 1;  1NJI 1;  2HU9 A;  3I4M I;  1TFI A;  1RO4 A;  3ESW A;  1VQ9 1;  1ZH1 A;  4NBF A;  1VQP Z;  2Y0S A;  3HKZ A;  2W04 A;  1RLY A;  4MON A;  3U50 C;  2G2K A;  5IT9 f;  2P3Y A;  2LEX A;  3D2L A;  3HOZ I;  1X3W A;  1VLA A;  3S2D I;  4MD9 A;  3GTP I;  5IP7 I;  5D1P A;  1TWG I;  1VQO 1;  4BY1 I;  1VQM 1;  2LIY A;  2AYD A;  3S16 I;  3GTL I;  2YAD A;  1R9T I;  1RO0 A;  1X0T A;  2LFU A;  1KRL A;  1VQL Z;  1K73 1;  1QVG Y;  3G4S 1;  1QVG Z;  4BY7 I;  2RT9 A;  3J80 b;  1P9N A;  1ZB9 A;  1VQP 1;  4NBE A;  5LL6 f;  1KD1 1;  1JJ2 Y;  1JJ2 Z;  3CCE Z;  1TWA I;  4E2Z A;  1NP6 A;  3JAM b;  4BBS I;  1M90 2;  3J7A 4;  2M6N A;  1KC8 2;  4RV9 A;  3OW2 Z;  3IFU A;  3G71 Z;  2PM9 A;  3GTK I;  1ZB8 A;  4MXU A;  2NVY I;  4A3L I;  1Q86 1;  1L1O C;  5FLX b;  1QXF A;  2JA7 I;  1VQ7 Z;  2KI7 B;  3FQM A;  4HGY A;  2R92 I;  3CCM 1;  3CME Z;  5C4X I;  1K8A 2;  3J81 b;  1VQ4 1;  2GTH A;  3NH4 A;  4A3K I;  3CCR 1;  3S17 I;  1K9M 2;  1Q7Y 2;  2V8K A;  4NBC A;  1YUK A;  1VQL 1;  2NVX I;  4E2W A;  1USP A;  3CCQ Z;  2P28 A;  1X3Z A;  1QYP A;  1N8R 2;  3S14 I;  3D9X A;  3VMI A;  2DE5 A;  2K5R A;  2VPZ A;  2F4O A;  3VB9 A;  4A3M I;  1YI2 Z;  1VQ5 Z;  1AA6 A;  4A3G I;  4E2Y A;  2JS4 A;  2J6A A;  3CCU Z;  2JIQ A;  3S2H I;  2JA8 I;  3G71 1;  4E32 A;  5C4J I;  4BXX I;  1I6H I;  3D6W A;  5A2Q f;  1WJ2 A;  3CC2 Z;  1TWH I;  3VTN A;  3G4S Z;  3S1M I;  1VQ7 1;  3MZK B;  4E2X A;  2R6M A;  4CL1 A;  1RNI A;  3CME 1;  2JMO A;  3MZL B;  1VQK Z;  4RS4 A;  2V45 A;  5C44 I;  1USP B;  2I3C A;  3CCQ 1;  1WII A;  4RVF A;  4A3D I;  4MH4 A;  1M90 1;  2NVT I;  4RVD A;  4AYB A;  3CD6 Z;  2H85 A;  3BG1 B;  4QTU A;  1KC8 1;  2V3V A;  3CMA Z;  1VQ5 1;  1YI2 1;  1ML8 A;  2V8I A;  3CCM Z;  3NDI A;  3CCU 1;  4A3F I;  2QLV B;  1VQ4 Z;  3S15 I;  2EGT A;  2BJO A;  3K7A I;  4TNU A;  3CCR Z;  2V8J A;  1K8A 1;  3CC2 1;  1K83 I;  3M4O I;  5CM2 M;  1K9M 1;  1Q7Y 1;  2OZK A;  2JUB A;  3TDH B;  1Q81 2;  1N8R 1;  1VQK 1;  3S1R I;  3Q87 A;  3FQQ A;  1N2F A;  3CCJ Z;  1LQL A;  1QVF Z;  1QF8 A;  3VMH A;  3OW2 Y;  1Z01 A;  3HOX I;  3GTO I;  2PMZ A;  3NH8 A;  3CQZ I;  2JR6 A;  3CD6 1;  2AKL A;  4MRI A;  3CCL 1;  2OTL 1;  3CCS Z;  3CMA 1;  1Z03 A;  4DK1 A;  1PFT A;  3CC4 1;  3I07 A;  3M3Y I;  2IV2 X;  5D1O A;  3I56 Z;  3S1Q I;  1Q16 A;  1YJ9 Z;  1WCM I;  3CC7 1;  2HF1 A;  1YJN 1;  3S1N I;  2OOX B;  4HGZ A;  3J80 f;  4HH4 A;  2OTJ 1;  3GKQ A;  1TWC I;  3NDJ A;  2B63 I;  4NB8 A;  2JIO A;  4A3I I;  1NUI A;  2M48 A;  2E2I I;  3CCJ 1;  1RQF A;  3GTJ I;  4A3C I;  4E31 A;  3H3V J;  3GTM I;  5IT9 b;  4X6A I;  5FLM I;  2O4H A;  3IF8 A;  2JIM A;  1I3Q I;  2WAQ A;  5FLX f;  3GTM S;  1KQS Y;  3GCF A;  1KQS Z;  3CCS 1;  4DQY B;  1M1K 2;  2IZ3 A;  3TE5 B;  2RIQ A;  5D1O B;  2JIP A;  3I56 1;  3J81 f;  4NBB A;  2E2H I;  2DE6 A;  1YJ9 1;  1VQ8 Z;  2QEX 1;  2R93 I;  5IP9 I;  3NFZ A;  1Q81 1; 
#chains in the Genus database with same CATH homology
 1DL6 A;  2ZAE B;  3I4N I;  2KPI A;  2WB1 A;  4NBG A;  5AN9 F;  3G6E 1;  4RVH A;  4RVG A;  3CCV Z;  1RO2 A;  2W03 A;  2QA4 1;  2OTL Z;  3CCL Z;  2GTI A;  5C3E I;  2JNY A;  3CC4 Z;  3RZD I;  4Y7N I;  4S1T A;  4Y52 I;  3HOY I;  3QWU A;  2F4M A;  1SFO I;  1YIT Z;  2NVQ I;  2IZ4 A;  1Z02 A;  1I50 I;  3CC7 Z;  3T4N B;  2JA6 I;  1YJN Z;  3H0G I;  2Q4Z A;  2R7Z I;  5T6B A;  2OTJ Z;  1S72 Z;  1Y1W I;  1Q82 2;  1NJI 2;  2YU9 I;  4EWC A;  1VQ8 1;  1QVF Y;  2QRD B;  3F3F C;  1YJW Z;  1VQN Z;  4NBD A;  1JWH C;  3PO3 I;  1Y1V I;  1YHQ Z;  3NH5 A;  3CCV 1;  2E2J I;  1TWF I;  3PO3 S;  1Y1V S;  2PK7 A;  3I55 Z;  3EED A;  3CXC Y;  3CXC Z;  3KIH A;  4NBA A;  3BG0 B;  1YIJ Z;  2RBL A;  3HOV I;  5T64 A;  1M1K 1;  3HOU I;  1VQ6 Z;  4NFR A;  4NB9 A;  2RPR A;  1YIT 1;  2QEX Z;  4A3B I;  4MD8 A;  4XX2 A;  4A3J I;  4DGL A;  4A93 I;  4BBR I;  2E9H A;  3RZO I;  5A2Q b;  3CPW Y;  3CPW Z;  2GU2 A;  2RHB A;  1WW9 A;  3KIF A;  3P5J B;  3G6E Z;  2JA5 I;  1S72 1;  2Q51 A;  2DE7 A;  1VQ9 Z;  4NBH A;  2QA4 Z;  1K73 2;  3JAM f;  3GTQ I;  4A3E I;  1W2B Y;  3LUS A;  1W2B Z;  4MD7 A;  1YJW 1;  1VQN 1;  2O53 A;  2QKD A;  2QRE B;  5T67 A;  4NOZ A;  1KD1 2;  3GTG I;  1YHQ 1;  2K3R A;  4QTT A;  2QRC B;  3MON A;  3PO2 I;  2QR1 B;  3I55 1;  2VUM I;  3F3P C;  3CCE 1;  1S7M A;  4E30 A;  1YIJ 1;  2VF1 A;  1VQO Z;  3IX0 A;  1VQ6 1;  3HOW I;  1VQM Z;  1Q86 2;  3VMG A;  4E33 A;  3EER A;  2OOY B;  2VUG A;  3FKI I;  4NH1 C;  1Q82 1;  1YUA A;  1NJI 1;  2HU9 A;  3I4M I;  1TFI A;  1RO4 A;  3ESW A;  1VQ9 1;  1ZH1 A;  4NBF A;  1VQP Z;  2Y0S A;  3HKZ A;  2W04 A;  1RLY A;  4MON A;  3U50 C;  2G2K A;  5IT9 f;  2P3Y A;  3HOZ I;  1X3W A;  1VLA A;  3S2D I;  4MD9 A;  3GTP I;  5IP7 I;  5D1P A;  1TWG I;  1VQO 1;  4BY1 I;  1VQM 1;  2LIY A;  3S16 I;  3GTL I;  2YAD A;  1R9T I;  1RO0 A;  1X0T A;  2LFU A;  1KRL A;  1VQL Z;  1K73 1;  1QVG Y;  3G4S 1;  1QVG Z;  4BY7 I;  2RT9 A;  3J80 b;  1P9N A;  1ZB9 A;  1VQP 1;  4NBE A;  5LL6 f;  1KD1 1;  1JJ2 Y;  1JJ2 Z;  3CCE Z;  1TWA I;  4E2Z A;  1NP6 A;  3JAM b;  4BBS I;  1M90 2;  3J7A 4;  2M6N A;  1KC8 2;  4RV9 A;  3OW2 Z;  3IFU A;  3G71 Z;  2PM9 A;  3GTK I;  1ZB8 A;  4MXU A;  2NVY I;  4A3L I;  1Q86 1;  1L1O C;  5FLX b;  2JA7 I;  1VQ7 Z;  2KI7 B;  3FQM A;  4HGY A;  2R92 I;  3CCM 1;  3CME Z;  5C4X I;  1K8A 2;  3J81 b;  1VQ4 1;  2GTH A;  3NH4 A;  4A3K I;  3CCR 1;  3S17 I;  1K9M 2;  1Q7Y 2;  2V8K A;  4NBC A;  1YUK A;  1VQL 1;  2NVX I;  4E2W A;  1USP A;  3CCQ Z;  2P28 A;  1X3Z A;  1QYP A;  1N8R 2;  3S14 I;  3D9X A;  3VMI A;  2DE5 A;  2K5R A;  2F4O A;  3VB9 A;  4A3M I;  1YI2 Z;  1VQ5 Z;  4A3G I;  4E2Y A;  2JS4 A;  2J6A A;  3CCU Z;  3S2H I;  2JA8 I;  3G71 1;  4E32 A;  5C4J I;  4BXX I;  1I6H I;  3D6W A;  5A2Q f;  3CC2 Z;  1TWH I;  3VTN A;  3G4S Z;  3S1M I;  1VQ7 1;  3MZK B;  4E2X A;  2R6M A;  4CL1 A;  1RNI A;  3CME 1;  2JMO A;  3MZL B;  1VQK Z;  4RS4 A;  5C44 I;  1USP B;  2I3C A;  3CCQ 1;  1WII A;  4RVF A;  4A3D I;  4MH4 A;  1M90 1;  2NVT I;  4RVD A;  4AYB A;  3CD6 Z;  2H85 A;  3BG1 B;  4QTU A;  1KC8 1;  3CMA Z;  1VQ5 1;  1YI2 1;  1ML8 A;  2V8I A;  3CCM Z;  3NDI A;  3CCU 1;  4A3F I;  2QLV B;  1VQ4 Z;  3S15 I;  2EGT A;  2BJO A;  3K7A I;  4TNU A;  3CCR Z;  2V8J A;  1K8A 1;  3CC2 1;  1K83 I;  3M4O I;  5CM2 M;  1K9M 1;  1Q7Y 1;  2OZK A;  2JUB A;  3TDH B;  1Q81 2;  1N8R 1;  1VQK 1;  3S1R I;  3Q87 A;  3FQQ A;  1N2F A;  3CCJ Z;  1LQL A;  1QVF Z;  1QF8 A;  3VMH A;  3OW2 Y;  1Z01 A;  3HOX I;  3GTO I;  2PMZ A;  3NH8 A;  3CQZ I;  2JR6 A;  3CD6 1;  2AKL A;  4MRI A;  3CCL 1;  2OTL 1;  3CCS Z;  3CMA 1;  1Z03 A;  4DK1 A;  1PFT A;  3CC4 1;  3I07 A;  3M3Y I;  3S1Q I;  5D1O A;  3I56 Z;  1YJ9 Z;  1WCM I;  3CC7 1;  2HF1 A;  1YJN 1;  3S1N I;  2OOX B;  4HGZ A;  3J80 f;  4HH4 A;  2OTJ 1;  3GKQ A;  1TWC I;  3NDJ A;  2B63 I;  4NB8 A;  4A3I I;  1NUI A;  2M48 A;  2E2I I;  3CCJ 1;  1RQF A;  3GTJ I;  4A3C I;  4E31 A;  3H3V J;  3GTM I;  5IT9 b;  4X6A I;  5FLM I;  2O4H A;  3IF8 A;  1I3Q I;  2WAQ A;  5FLX f;  3GTM S;  1KQS Y;  3GCF A;  1KQS Z;  3CCS 1;  4DQY B;  1M1K 2;  2IZ3 A;  3TE5 B;  2RIQ A;  5D1O B;  3I56 1;  3J81 f;  4NBB A;  2E2H I;  2DE6 A;  1YJ9 1;  1VQ8 Z;  2QEX 1;  2R93 I;  5IP9 I;  3NFZ A;  1Q81 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...