1Y1WI

Complete rna polymerase ii elongation complex
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*AP*GP*TP*AP*CP*TP*TP*AP*CP*GP*CP*CP*TP*GP*GP*TP*CP*AP
publication title Complete RNA Polymerase II Elongation Complex Structure and Its Interactions with NTP and TFIIS
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1y1wI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1y1wI02
4A3CI 4NB9A 3HOYI 3CQZI 1TWFI 3Q87A 4Y52I 4NBBA 2P3YA 3PO3I 4BBRI 1ML8A 5IP7I 1L1OC 3GTLI 4NBAA 2R93I 3RZOI 4NBFA 4NOZA 2JA8I 5C3EI 1R9TI 3PO2I 3VMGA 5C4JI 3S15I 4Y7NI 2JS4A 4A3FI 3HOZI 3GTMI 4BY7I 1QYPA 1Y1VI 4NBEA 4QTTA 4A3DI 1PFTA 1VLAA 1K83I 2DE6A 5IP9I 1TWAI 3D6WA 3H3VJ 2NVXI 4NBCA 4NB8A 4A3GI 2J6AA 3H0GI 3VMIA 5C44I 3GTQI 3GTPI 1I3QI 1RLYA 3S2HI 4A3JI 2R92I 3I07A 4A3KI 5C4XI 3GKQA 5FLMI 3I4NI 4NBDA 4NBHA 4XX2A 4QTUA 3S17I 1Y1WI 1NUIA 4BBSI 4MH4A 3M3YI 3HOUI 3GTGI 3HOVI 1I6HI 2AKLA 3S2DI 3HOXI 2DE5A 4NBGA 2KPIA 3LUSA 1TWGI 2E2HI 3VMHA 1LQLA 2NVQI 4A93I 3S14I 2JA5I 3FKII 3GTOI 2F4OA 3VB9A 3EERA 1X3WA 1DL6A 1SFOI 2F4MA 1TFIA 1TWCI 2JR6A 2JA6I 3S1QI 2RBLA 1RO4A 5CM2M 1USPB 3GCFA 2VUMI 3ESWA 2NVYI 4A3BI 1WW9A 3HOWI 4A3EI 2YU9I 4A3II 2DE7A 2JA7I 1ZB9A 3S1MI 2E2II 3S16I 1WCMI 1I50I 3M4OI 3RZDI 1TWHI 2R7ZI 1N2FA 1ZB8A 4BXXI 2NVTI 3GTKI 3PO3S 1YUAA 2E2JI 4A3LI 4X6AI 4BY1I 3S1RI 2PK7A 1X3ZA 3K7AI 1USPA 2BJOA 2K5RA 2HF1A 4A3MI 3GTMS 3GTJI 3S1NI 1Y1VS 2B63I 3I4MI 2JNYA 3U50C
chains in the Genus database with same CATH superfamily
4NB9A 4NH1C 3HOYI 3CQZI 1QVGY 1TWFI 5A2Qb 2OZKA 3Q87A 3PO3I 1FDOA 3FQQA 2R93I 4NOZA 1QVFZ 1R9TI 3PO2I 3OW2Y 3VMGA 2JS4A 1VQK1 4BY7I 1PFTA 3J81f 2DE6A 1YJW1 1M901 4HGYA 2NVXI 4NBCA 5LL6f 3CMEZ 3KIFA 1W2BY 3VMIA 5C44I 4A3GI 3I07A 4MD9A 1Q862 3I4NI 3CD61 4QTUA 3G4SZ 1JJ2Z 3CMAZ 1YITZ 3IF8A 2AKLA 1RNIA 1RQFA 1VQLZ 4NBGA 1K9M2 2KPIA 5D1PA 4E32A 2NVQI 1Q7Y2 1KD12 3EEDA 1ZH1A 3QWUA 4RVFA 3EERA 1Z01A 2F4MA 1TFIA 5FLXf 1Z03A 3NFZA 4EWCA 5CM2M 1USPB 1YJN1 5IT9f 3TE5B 3CCQZ 4A3BI 1VQ41 3HOWI 3CCR1 1VQ81 2O4HA 2DE7A 3CCM1 2QLVB 3S16I 3F3PC 4RVGA 4RV9A 1YIJZ 1N8R1 1KQSY 1VQ5Z 2RPRA 3GTKI 2IZ3A 2QA4Z 4DQYB 3PO3S 1YUAA 2E9HA 1P9NA 3CPWZ 1VQNZ 1VQ6Z 3J7A4 1VQM1 1X3ZA 1M1K2 3K7AI 2K5RA 1YJ9Z 2KI7B 3CCJ1 3S1NI 1K731 1X0TA 3U50C 2JUBA 3T4NB 1VQ91 1S72Z 2QR1B 2P3YA 4MONA 2E7ZA 5IP7I 4NBAA 3CCE1 5C3EI 3J80f 4A3FI 3HOZI 3GTMI 3J81b 1NJI1 3JAMf 4QTTA 1Y8CA 3CPWY 1K83I 2LEXA 3H3VJ 2Y0SA 2QKDA 2J6AA 3GTQI 2I3CA 3NH8A 3MONA 1RLYA 3S2HI 1Z02A 3CCL1 3IFUA 1VQ71 1YHQ1 5FLMI 1NUIA 3NH4A 2YADA 2RHBA 1WJ2A 4MXUA 3M3YI 3I56Z 2JIRA 3S2DI 3KIHA 2JIPA 3CC21 2VPYA 3D9XA 1Q811 3LUSA 4A93I 2E2HI 2V8KA 1Q821 5D1OA 3FKII 2F4OA 5FLXb 3VB9A 2PM9A 1X3WA 2H85A 1VQO1 4RVHA 1TWCI 2JR6A 2JA6I 5IT9b 2JMOA 3CCU1 1QF8A 3BG1B 4MD7A 1VQ7Z 1QVFY 3ESWA 2VUMI 2NVYI 3G6E1 4A3II 3CC71 2JA7I 2E2II 1WCMI 3P5JB 1VQKZ 1K8A1 2R7ZI 1ZB8A 1NJI2 1KRLA 4BXXI 1VQP1 1YJWZ 3CCV1 4E30A 4BY1I 2Q4ZA 1JWHC 1RO0A 2VF1A 4A3MI 1JJ2Y 1WIIA 3GTMS 1YI21 4DGLA 2OOXB 3TDHB 3CD6Z 2JIOA 2OTL1 2VUGA 4Y52I 4NBBA 2LIYA 3J80b 1ML8A 1L1OC 4E33A 3D2LA 2V45A 2JA8I 3JAMb 3CC41 1Q812 4Y7NI 4TNUA 1M902 3I551 4NBEA 2VPZA 1Q822 1VLAA 2IZ4A 4NFRA 5IP9I 3D6WA 2OTJ1 3G711 4NB8A 3NDIA 2QEX1 5D1OB 1YJNZ 1AA6A 2R92I 2V8JA 2GTHA 5C4XI 3GKQA 1VQ4Z 3CCRZ 4XX2A 2GTIA 1VQ8Z 3S17I 3CCMZ 1Y1WI 1YUKA 4E2YA 2VPWA 3GTGI 1Q861 3HOVI 1QVGZ 1I6HI 1Q16A 2V3VA 2Q51A 4E31A 3HKZA 4RS4A 1VQMZ 1LQLA 3MZLB 3S14I 3GTOI 3CCJZ 1K9M1 3MZKB 2NAPA 1Q7Y1 1KD11 3CME1 4HH4A 3S1QI 1VQ9Z 2RBLA 4E2WA 3GCFA 3NDJA 2EGTA 4MD8A 1N8R2 1WW9A 2GU2A 3G4S1 3CCEZ 2YU9I 2WB1A 1ZB9A 4DK1A 2ZAEB 3CMA1 1NP6A 3VTNA 1YIT1 1I50I 4RVDA 3RZDI 1TWHI 2OOYB 2M6NA 2JIQA 1VQL1 2NVTI 3NH5A 1K732 4X6AI 3F3FC 3S1RI 2PK7A 2K3RA 2AYDA 3CXCZ 3GTJI 3CCLZ 1SIWA 2B63I 1YHQZ 3I4MI 1M1K1 4A3CI 3IX0A 1KC81 2O53A 3CCQ1 4BBRI 3GTLI 4CL1A 5A2Qf 3CC2Z 3RZOI 4NBFA 4S1TA 1QXFA 2W04A 5C4JI 3S15I 1YIJ1 1QYPA 1Y1VI 4A3DI 1VQ51 2WAQA 3CCS1 1KQSZ 4HGZA 2QA41 3CXCY 1TWAI 1VQOZ 1VQN1 1VQ61 3H0GI 2V8IA 3CCUZ 4E2XA 1YJ91 1I3QI 3GTPI 4A3JI 3BG0B 4A3KI 3G6EZ 4NBDA 4NBHA 2W03A 3CC7Z 1FDIA 4BBSI 2JIMA 4MH4A 2P28A 2IV2X 3HOUI 1S721 3HOXI 2QREB 2DE5A 2QRDB 1S7MA 1VQPZ 4E2ZA 3CCVZ 1TWGI 3VMHA 2JA5I 4AYBA 3CCSZ 1YI2Z 2VPXA 3IR7A 1DL6A 1SFOI 2PMZA 3FQMA 2QRCB 2OTLZ 1RO4A 2HU9A 5T67A 1KC82 1K8A2 4A3EI 2RT9A 2RIQA 3S1MI 3CC4Z 5T64A 3I561 3M4OI 3I55Z 1WZNA 5T6BA 1N2FA 3OW2Z 2LFUA 4MRIA 1RO2A 2OTJZ 2E2JI 4A3LI 3G71Z 2QEXZ 1USPA 2BJOA 2M48A 2HF1A 5AN9F 1Y1VS 1W2BZ 2G2KA 2JNYA 2R6MA
chains in the Genus database with same CATH topology
4NB9A 4NH1C 3HOYI 3CQZI 1QVGY 1TWFI 5A2Qb 2OZKA 3Q87A 3PO3I 3FQQA 2R93I 4NOZA 1QVFZ 1R9TI 3PO2I 3OW2Y 3VMGA 2JS4A 1VQK1 4BY7I 1PFTA 3J81f 2DE6A 1YJW1 1M901 4HGYA 2NVXI 4NBCA 5LL6f 3CMEZ 3KIFA 1W2BY 3VMIA 5C44I 4A3GI 3I07A 4MD9A 1Q862 3I4NI 3CD61 4QTUA 3G4SZ 1JJ2Z 3CMAZ 1YITZ 3IF8A 2AKLA 1RNIA 1RQFA 1VQLZ 4NBGA 1K9M2 2KPIA 5D1PA 4E32A 2NVQI 1Q7Y2 1KD12 3EEDA 1ZH1A 3QWUA 4RVFA 3EERA 1Z01A 2F4MA 1TFIA 5FLXf 1Z03A 3NFZA 4EWCA 5CM2M 1USPB 1YJN1 5IT9f 3TE5B 3CCQZ 4A3BI 1VQ41 3HOWI 3CCR1 1VQ81 2O4HA 2DE7A 3CCM1 2QLVB 3S16I 3F3PC 4RVGA 4RV9A 1YIJZ 1N8R1 1KQSY 1VQ5Z 2RPRA 3GTKI 2IZ3A 2QA4Z 4DQYB 3PO3S 1YUAA 2E9HA 1P9NA 3CPWZ 1VQNZ 1VQ6Z 3J7A4 1VQM1 1X3ZA 1M1K2 3K7AI 2K5RA 1YJ9Z 2KI7B 3CCJ1 3S1NI 1K731 1X0TA 3U50C 2JUBA 3T4NB 1VQ91 1S72Z 2QR1B 2P3YA 4MONA 5IP7I 4NBAA 3CCE1 5C3EI 3J80f 4A3FI 3HOZI 3GTMI 3J81b 1NJI1 3JAMf 4QTTA 3CPWY 1K83I 3H3VJ 2Y0SA 2QKDA 2J6AA 3GTQI 2I3CA 3NH8A 3MONA 1RLYA 3S2HI 1Z02A 3CCL1 3IFUA 1VQ71 1YHQ1 5FLMI 1NUIA 3NH4A 2YADA 2RHBA 4MXUA 3M3YI 3I56Z 3S2DI 3KIHA 3CC21 3D9XA 1Q811 3LUSA 4A93I 2E2HI 2V8KA 1Q821 5D1OA 3FKII 2F4OA 5FLXb 3VB9A 2PM9A 1X3WA 2H85A 1VQO1 4RVHA 1TWCI 2JR6A 2JA6I 5IT9b 2JMOA 3CCU1 1QF8A 3BG1B 4MD7A 1VQ7Z 1QVFY 3ESWA 2VUMI 2NVYI 3G6E1 4A3II 3CC71 2JA7I 2E2II 1WCMI 3P5JB 1VQKZ 1K8A1 2R7ZI 1ZB8A 1NJI2 1KRLA 4BXXI 1VQP1 1YJWZ 3CCV1 4E30A 4BY1I 2Q4ZA 1JWHC 1RO0A 2VF1A 4A3MI 1JJ2Y 1WIIA 3GTMS 1YI21 4DGLA 2OOXB 3TDHB 3CD6Z 2OTL1 2VUGA 4Y52I 4NBBA 2LIYA 3J80b 1ML8A 1L1OC 4E33A 2JA8I 3JAMb 3CC41 1Q812 4Y7NI 4TNUA 1M902 3I551 4NBEA 1Q822 1VLAA 2IZ4A 4NFRA 5IP9I 3D6WA 2OTJ1 3G711 4NB8A 3NDIA 2QEX1 5D1OB 1YJNZ 2R92I 2V8JA 2GTHA 5C4XI 3GKQA 1VQ4Z 3CCRZ 4XX2A 2GTIA 1VQ8Z 3S17I 3CCMZ 1Y1WI 1YUKA 4E2YA 3GTGI 1Q861 3HOVI 1QVGZ 1I6HI 2Q51A 4E31A 3HKZA 4RS4A 1VQMZ 1LQLA 3MZLB 3S14I 3GTOI 3CCJZ 1K9M1 3MZKB 1Q7Y1 1KD11 3CME1 4HH4A 3S1QI 1VQ9Z 2RBLA 4E2WA 3GCFA 3NDJA 2EGTA 4MD8A 1N8R2 1WW9A 2GU2A 3G4S1 3CCEZ 2YU9I 2WB1A 1ZB9A 4DK1A 2ZAEB 3CMA1 1NP6A 3VTNA 1YIT1 1I50I 4RVDA 3RZDI 1TWHI 2OOYB 2M6NA 1VQL1 2NVTI 3NH5A 1K732 4X6AI 3F3FC 3S1RI 2PK7A 2K3RA 3CXCZ 3GTJI 3CCLZ 2B63I 1YHQZ 3I4MI 1M1K1 4A3CI 3IX0A 1KC81 2O53A 3CCQ1 4BBRI 3GTLI 4CL1A 5A2Qf 3CC2Z 3RZOI 4NBFA 4S1TA 2W04A 5C4JI 3S15I 1YIJ1 1QYPA 1Y1VI 4A3DI 1VQ51 2WAQA 3CCS1 1KQSZ 4HGZA 2QA41 3CXCY 1TWAI 1VQOZ 1VQN1 1VQ61 3H0GI 2V8IA 3CCUZ 4E2XA 1YJ91 1I3QI 3GTPI 4A3JI 3BG0B 4A3KI 3G6EZ 4NBDA 4NBHA 2W03A 3CC7Z 4BBSI 4MH4A 2P28A 3HOUI 1S721 3HOXI 2QREB 2DE5A 2QRDB 1S7MA 1VQPZ 4E2ZA 3CCVZ 1TWGI 3VMHA 2JA5I 4AYBA 3CCSZ 1YI2Z 1DL6A 1SFOI 2PMZA 3FQMA 2QRCB 2OTLZ 1RO4A 2HU9A 5T67A 1KC82 1K8A2 4A3EI 2RT9A 2RIQA 3S1MI 3CC4Z 5T64A 3I561 3M4OI 3I55Z 5T6BA 1N2FA 3OW2Z 2LFUA 4MRIA 1RO2A 2OTJZ 2E2JI 4A3LI 3G71Z 2QEXZ 1USPA 2BJOA 2M48A 2HF1A 5AN9F 1Y1VS 1W2BZ 2G2KA 2JNYA 2R6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3C I;  4NB9 A;  3HOY I;  3CQZ I;  1TWF I;  3Q87 A;  4Y52 I;  4NBB A;  2P3Y A;  3PO3 I;  4BBR I;  1ML8 A;  5IP7 I;  1L1O C;  3GTL I;  4NBA A;  2R93 I;  3RZO I;  4NBF A;  4NOZ A;  2JA8 I;  5C3E I;  1R9T I;  3PO2 I;  3VMG A;  5C4J I;  3S15 I;  4Y7N I;  2JS4 A;  4A3F I;  3HOZ I;  3GTM I;  4BY7 I;  1QYP A;  1Y1V I;  4NBE A;  4QTT A;  4A3D I;  1PFT A;  1VLA A;  1K83 I;  2DE6 A;  5IP9 I;  1TWA I;  3D6W A;  3H3V J;  2NVX I;  4NBC A;  4NB8 A;  4A3G I;  2J6A A;  3H0G I;  3VMI A;  5C44 I;  3GTQ I;  3GTP I;  1I3Q I;  1RLY A;  3S2H I;  4A3J I;  2R92 I;  3I07 A;  4A3K I;  5C4X I;  3GKQ A;  5FLM I;  3I4N I;  4NBD A;  4NBH A;  4XX2 A;  4QTU A;  3S17 I;  1Y1W I;  1NUI A;  4BBS I;  4MH4 A;  3M3Y I;  3HOU I;  3GTG I;  3HOV I;  1I6H I;  2AKL A;  3S2D I;  3HOX I;  2DE5 A;  4NBG A;  2KPI A;  3LUS A;  1TWG I;  2E2H I;  3VMH A;  1LQL A;  2NVQ I;  4A93 I;  3S14 I;  2JA5 I;  3FKI I;  3GTO I;  2F4O A;  3VB9 A;  3EER A;  1X3W A;  1DL6 A;  1SFO I;  2F4M A;  1TFI A;  1TWC I;  2JR6 A;  2JA6 I;  3S1Q I;  2RBL A;  1RO4 A;  5CM2 M;  1USP B;  3GCF A;  2VUM I;  3ESW A;  2NVY I;  4A3B I;  1WW9 A;  3HOW I;  4A3E I;  2YU9 I;  4A3I I;  2DE7 A;  2JA7 I;  1ZB9 A;  3S1M I;  2E2I I;  3S16 I;  1WCM I;  1I50 I;  3M4O I;  3RZD I;  1TWH I;  2R7Z I;  1N2F A;  1ZB8 A;  4BXX I;  2NVT I;  3GTK I;  3PO3 S;  1YUA A;  2E2J I;  4A3L I;  4X6A I;  4BY1 I;  3S1R I;  2PK7 A;  1X3Z A;  3K7A I;  1USP A;  2BJO A;  2K5R A;  2HF1 A;  4A3M I;  3GTM S;  3GTJ I;  3S1N I;  1Y1V S;  2B63 I;  3I4M I;  2JNY A;  3U50 C; 
#chains in the Genus database with same CATH topology
 4NB9 A;  4NH1 C;  3HOY I;  3CQZ I;  1QVG Y;  1TWF I;  5A2Q b;  2OZK A;  3Q87 A;  3PO3 I;  1FDO A;  3FQQ A;  2R93 I;  4NOZ A;  1QVF Z;  1R9T I;  3PO2 I;  3OW2 Y;  3VMG A;  2JS4 A;  1VQK 1;  4BY7 I;  1PFT A;  3J81 f;  2DE6 A;  1YJW 1;  1M90 1;  4HGY A;  2NVX I;  4NBC A;  5LL6 f;  3CME Z;  3KIF A;  1W2B Y;  3VMI A;  5C44 I;  4A3G I;  3I07 A;  4MD9 A;  1Q86 2;  3I4N I;  3CD6 1;  4QTU A;  3G4S Z;  1JJ2 Z;  3CMA Z;  1YIT Z;  3IF8 A;  2AKL A;  1RNI A;  1RQF A;  1VQL Z;  4NBG A;  1K9M 2;  2KPI A;  5D1P A;  4E32 A;  2NVQ I;  1Q7Y 2;  1KD1 2;  3EED A;  1ZH1 A;  3QWU A;  4RVF A;  3EER A;  1Z01 A;  2F4M A;  1TFI A;  5FLX f;  1Z03 A;  3NFZ A;  4EWC A;  5CM2 M;  1USP B;  1YJN 1;  5IT9 f;  3TE5 B;  3CCQ Z;  4A3B I;  1VQ4 1;  3HOW I;  3CCR 1;  1VQ8 1;  2O4H A;  2DE7 A;  3CCM 1;  2QLV B;  3S16 I;  3F3P C;  4RVG A;  4RV9 A;  1YIJ Z;  1N8R 1;  1KQS Y;  1VQ5 Z;  2RPR A;  3GTK I;  2IZ3 A;  2QA4 Z;  4DQY B;  3PO3 S;  1YUA A;  2E9H A;  1P9N A;  3CPW Z;  1VQN Z;  1VQ6 Z;  3J7A 4;  1VQM 1;  1X3Z A;  1M1K 2;  3K7A I;  2K5R A;  1YJ9 Z;  2KI7 B;  3CCJ 1;  3S1N I;  1K73 1;  1X0T A;  3U50 C;  2JUB A;  3T4N B;  1VQ9 1;  1S72 Z;  2QR1 B;  2P3Y A;  4MON A;  2E7Z A;  5IP7 I;  4NBA A;  3CCE 1;  5C3E I;  3J80 f;  4A3F I;  3HOZ I;  3GTM I;  3J81 b;  1NJI 1;  3JAM f;  4QTT A;  1Y8C A;  3CPW Y;  1K83 I;  2LEX A;  3H3V J;  2Y0S A;  2QKD A;  2J6A A;  3GTQ I;  2I3C A;  3NH8 A;  3MON A;  1RLY A;  3S2H I;  1Z02 A;  3CCL 1;  3IFU A;  1VQ7 1;  1YHQ 1;  5FLM I;  1NUI A;  3NH4 A;  2YAD A;  2RHB A;  1WJ2 A;  4MXU A;  3M3Y I;  3I56 Z;  2JIR A;  3S2D I;  3KIH A;  2JIP A;  3CC2 1;  2VPY A;  3D9X A;  1Q81 1;  3LUS A;  4A93 I;  2E2H I;  2V8K A;  1Q82 1;  5D1O A;  3FKI I;  2F4O A;  5FLX b;  3VB9 A;  2PM9 A;  1X3W A;  2H85 A;  1VQO 1;  4RVH A;  1TWC I;  2JR6 A;  2JA6 I;  5IT9 b;  2JMO A;  3CCU 1;  1QF8 A;  3BG1 B;  4MD7 A;  1VQ7 Z;  1QVF Y;  3ESW A;  2VUM I;  2NVY I;  3G6E 1;  4A3I I;  3CC7 1;  2JA7 I;  2E2I I;  1WCM I;  3P5J B;  1VQK Z;  1K8A 1;  2R7Z I;  1ZB8 A;  1NJI 2;  1KRL A;  4BXX I;  1VQP 1;  1YJW Z;  3CCV 1;  4E30 A;  4BY1 I;  2Q4Z A;  1JWH C;  1RO0 A;  2VF1 A;  4A3M I;  1JJ2 Y;  1WII A;  3GTM S;  1YI2 1;  4DGL A;  2OOX B;  3TDH B;  3CD6 Z;  2JIO A;  2OTL 1;  2VUG A;  4Y52 I;  4NBB A;  2LIY A;  3J80 b;  1ML8 A;  1L1O C;  4E33 A;  3D2L A;  2V45 A;  2JA8 I;  3JAM b;  3CC4 1;  1Q81 2;  4Y7N I;  4TNU A;  1M90 2;  3I55 1;  4NBE A;  2VPZ A;  1Q82 2;  1VLA A;  2IZ4 A;  4NFR A;  5IP9 I;  3D6W A;  2OTJ 1;  3G71 1;  4NB8 A;  3NDI A;  2QEX 1;  5D1O B;  1YJN Z;  1AA6 A;  2R92 I;  2V8J A;  2GTH A;  5C4X I;  3GKQ A;  1VQ4 Z;  3CCR Z;  4XX2 A;  2GTI A;  1VQ8 Z;  3S17 I;  3CCM Z;  1Y1W I;  1YUK A;  4E2Y A;  2VPW A;  3GTG I;  1Q86 1;  3HOV I;  1QVG Z;  1I6H I;  1Q16 A;  2V3V A;  2Q51 A;  4E31 A;  3HKZ A;  4RS4 A;  1VQM Z;  1LQL A;  3MZL B;  3S14 I;  3GTO I;  3CCJ Z;  1K9M 1;  3MZK B;  2NAP A;  1Q7Y 1;  1KD1 1;  3CME 1;  4HH4 A;  3S1Q I;  1VQ9 Z;  2RBL A;  4E2W A;  3GCF A;  3NDJ A;  2EGT A;  4MD8 A;  1N8R 2;  1WW9 A;  2GU2 A;  3G4S 1;  3CCE Z;  2YU9 I;  2WB1 A;  1ZB9 A;  4DK1 A;  2ZAE B;  3CMA 1;  1NP6 A;  3VTN A;  1YIT 1;  1I50 I;  4RVD A;  3RZD I;  1TWH I;  2OOY B;  2M6N A;  2JIQ A;  1VQL 1;  2NVT I;  3NH5 A;  1K73 2;  4X6A I;  3F3F C;  3S1R I;  2PK7 A;  2K3R A;  2AYD A;  3CXC Z;  3GTJ I;  3CCL Z;  1SIW A;  2B63 I;  1YHQ Z;  3I4M I;  1M1K 1;  4A3C I;  3IX0 A;  1KC8 1;  2O53 A;  3CCQ 1;  4BBR I;  3GTL I;  4CL1 A;  5A2Q f;  3CC2 Z;  3RZO I;  4NBF A;  4S1T A;  1QXF A;  2W04 A;  5C4J I;  3S15 I;  1YIJ 1;  1QYP A;  1Y1V I;  4A3D I;  1VQ5 1;  2WAQ A;  3CCS 1;  1KQS Z;  4HGZ A;  2QA4 1;  3CXC Y;  1TWA I;  1VQO Z;  1VQN 1;  1VQ6 1;  3H0G I;  2V8I A;  3CCU Z;  4E2X A;  1YJ9 1;  1I3Q I;  3GTP I;  4A3J I;  3BG0 B;  4A3K I;  3G6E Z;  4NBD A;  4NBH A;  2W03 A;  3CC7 Z;  1FDI A;  4BBS I;  2JIM A;  4MH4 A;  2P28 A;  2IV2 X;  3HOU I;  1S72 1;  3HOX I;  2QRE B;  2DE5 A;  2QRD B;  1S7M A;  1VQP Z;  4E2Z A;  3CCV Z;  1TWG I;  3VMH A;  2JA5 I;  4AYB A;  3CCS Z;  1YI2 Z;  2VPX A;  3IR7 A;  1DL6 A;  1SFO I;  2PMZ A;  3FQM A;  2QRC B;  2OTL Z;  1RO4 A;  2HU9 A;  5T67 A;  1KC8 2;  1K8A 2;  4A3E I;  2RT9 A;  2RIQ A;  3S1M I;  3CC4 Z;  5T64 A;  3I56 1;  3M4O I;  3I55 Z;  1WZN A;  5T6B A;  1N2F A;  3OW2 Z;  2LFU A;  4MRI A;  1RO2 A;  2OTJ Z;  2E2J I;  4A3L I;  3G71 Z;  2QEX Z;  1USP A;  2BJO A;  2M48 A;  2HF1 A;  5AN9 F;  1Y1V S;  1W2B Z;  2G2K A;  2JNY A;  2R6M A; 
#chains in the Genus database with same CATH homology
 4NB9 A;  4NH1 C;  3HOY I;  3CQZ I;  1QVG Y;  1TWF I;  5A2Q b;  2OZK A;  3Q87 A;  3PO3 I;  3FQQ A;  2R93 I;  4NOZ A;  1QVF Z;  1R9T I;  3PO2 I;  3OW2 Y;  3VMG A;  2JS4 A;  1VQK 1;  4BY7 I;  1PFT A;  3J81 f;  2DE6 A;  1YJW 1;  1M90 1;  4HGY A;  2NVX I;  4NBC A;  5LL6 f;  3CME Z;  3KIF A;  1W2B Y;  3VMI A;  5C44 I;  4A3G I;  3I07 A;  4MD9 A;  1Q86 2;  3I4N I;  3CD6 1;  4QTU A;  3G4S Z;  1JJ2 Z;  3CMA Z;  1YIT Z;  3IF8 A;  2AKL A;  1RNI A;  1RQF A;  1VQL Z;  4NBG A;  1K9M 2;  2KPI A;  5D1P A;  4E32 A;  2NVQ I;  1Q7Y 2;  1KD1 2;  3EED A;  1ZH1 A;  3QWU A;  4RVF A;  3EER A;  1Z01 A;  2F4M A;  1TFI A;  5FLX f;  1Z03 A;  3NFZ A;  4EWC A;  5CM2 M;  1USP B;  1YJN 1;  5IT9 f;  3TE5 B;  3CCQ Z;  4A3B I;  1VQ4 1;  3HOW I;  3CCR 1;  1VQ8 1;  2O4H A;  2DE7 A;  3CCM 1;  2QLV B;  3S16 I;  3F3P C;  4RVG A;  4RV9 A;  1YIJ Z;  1N8R 1;  1KQS Y;  1VQ5 Z;  2RPR A;  3GTK I;  2IZ3 A;  2QA4 Z;  4DQY B;  3PO3 S;  1YUA A;  2E9H A;  1P9N A;  3CPW Z;  1VQN Z;  1VQ6 Z;  3J7A 4;  1VQM 1;  1X3Z A;  1M1K 2;  3K7A I;  2K5R A;  1YJ9 Z;  2KI7 B;  3CCJ 1;  3S1N I;  1K73 1;  1X0T A;  3U50 C;  2JUB A;  3T4N B;  1VQ9 1;  1S72 Z;  2QR1 B;  2P3Y A;  4MON A;  5IP7 I;  4NBA A;  3CCE 1;  5C3E I;  3J80 f;  4A3F I;  3HOZ I;  3GTM I;  3J81 b;  1NJI 1;  3JAM f;  4QTT A;  3CPW Y;  1K83 I;  3H3V J;  2Y0S A;  2QKD A;  2J6A A;  3GTQ I;  2I3C A;  3NH8 A;  3MON A;  1RLY A;  3S2H I;  1Z02 A;  3CCL 1;  3IFU A;  1VQ7 1;  1YHQ 1;  5FLM I;  1NUI A;  3NH4 A;  2YAD A;  2RHB A;  4MXU A;  3M3Y I;  3I56 Z;  3S2D I;  3KIH A;  3CC2 1;  3D9X A;  1Q81 1;  3LUS A;  4A93 I;  2E2H I;  2V8K A;  1Q82 1;  5D1O A;  3FKI I;  2F4O A;  5FLX b;  3VB9 A;  2PM9 A;  1X3W A;  2H85 A;  1VQO 1;  4RVH A;  1TWC I;  2JR6 A;  2JA6 I;  5IT9 b;  2JMO A;  3CCU 1;  1QF8 A;  3BG1 B;  4MD7 A;  1VQ7 Z;  1QVF Y;  3ESW A;  2VUM I;  2NVY I;  3G6E 1;  4A3I I;  3CC7 1;  2JA7 I;  2E2I I;  1WCM I;  3P5J B;  1VQK Z;  1K8A 1;  2R7Z I;  1ZB8 A;  1NJI 2;  1KRL A;  4BXX I;  1VQP 1;  1YJW Z;  3CCV 1;  4E30 A;  4BY1 I;  2Q4Z A;  1JWH C;  1RO0 A;  2VF1 A;  4A3M I;  1JJ2 Y;  1WII A;  3GTM S;  1YI2 1;  4DGL A;  2OOX B;  3TDH B;  3CD6 Z;  2OTL 1;  2VUG A;  4Y52 I;  4NBB A;  2LIY A;  3J80 b;  1ML8 A;  1L1O C;  4E33 A;  2JA8 I;  3JAM b;  3CC4 1;  1Q81 2;  4Y7N I;  4TNU A;  1M90 2;  3I55 1;  4NBE A;  1Q82 2;  1VLA A;  2IZ4 A;  4NFR A;  5IP9 I;  3D6W A;  2OTJ 1;  3G71 1;  4NB8 A;  3NDI A;  2QEX 1;  5D1O B;  1YJN Z;  2R92 I;  2V8J A;  2GTH A;  5C4X I;  3GKQ A;  1VQ4 Z;  3CCR Z;  4XX2 A;  2GTI A;  1VQ8 Z;  3S17 I;  3CCM Z;  1Y1W I;  1YUK A;  4E2Y A;  3GTG I;  1Q86 1;  3HOV I;  1QVG Z;  1I6H I;  2Q51 A;  4E31 A;  3HKZ A;  4RS4 A;  1VQM Z;  1LQL A;  3MZL B;  3S14 I;  3GTO I;  3CCJ Z;  1K9M 1;  3MZK B;  1Q7Y 1;  1KD1 1;  3CME 1;  4HH4 A;  3S1Q I;  1VQ9 Z;  2RBL A;  4E2W A;  3GCF A;  3NDJ A;  2EGT A;  4MD8 A;  1N8R 2;  1WW9 A;  2GU2 A;  3G4S 1;  3CCE Z;  2YU9 I;  2WB1 A;  1ZB9 A;  4DK1 A;  2ZAE B;  3CMA 1;  1NP6 A;  3VTN A;  1YIT 1;  1I50 I;  4RVD A;  3RZD I;  1TWH I;  2OOY B;  2M6N A;  1VQL 1;  2NVT I;  3NH5 A;  1K73 2;  4X6A I;  3F3F C;  3S1R I;  2PK7 A;  2K3R A;  3CXC Z;  3GTJ I;  3CCL Z;  2B63 I;  1YHQ Z;  3I4M I;  1M1K 1;  4A3C I;  3IX0 A;  1KC8 1;  2O53 A;  3CCQ 1;  4BBR I;  3GTL I;  4CL1 A;  5A2Q f;  3CC2 Z;  3RZO I;  4NBF A;  4S1T A;  2W04 A;  5C4J I;  3S15 I;  1YIJ 1;  1QYP A;  1Y1V I;  4A3D I;  1VQ5 1;  2WAQ A;  3CCS 1;  1KQS Z;  4HGZ A;  2QA4 1;  3CXC Y;  1TWA I;  1VQO Z;  1VQN 1;  1VQ6 1;  3H0G I;  2V8I A;  3CCU Z;  4E2X A;  1YJ9 1;  1I3Q I;  3GTP I;  4A3J I;  3BG0 B;  4A3K I;  3G6E Z;  4NBD A;  4NBH A;  2W03 A;  3CC7 Z;  4BBS I;  4MH4 A;  2P28 A;  3HOU I;  1S72 1;  3HOX I;  2QRE B;  2DE5 A;  2QRD B;  1S7M A;  1VQP Z;  4E2Z A;  3CCV Z;  1TWG I;  3VMH A;  2JA5 I;  4AYB A;  3CCS Z;  1YI2 Z;  1DL6 A;  1SFO I;  2PMZ A;  3FQM A;  2QRC B;  2OTL Z;  1RO4 A;  2HU9 A;  5T67 A;  1KC8 2;  1K8A 2;  4A3E I;  2RT9 A;  2RIQ A;  3S1M I;  3CC4 Z;  5T64 A;  3I56 1;  3M4O I;  3I55 Z;  5T6B A;  1N2F A;  3OW2 Z;  2LFU A;  4MRI A;  1RO2 A;  2OTJ Z;  2E2J I;  4A3L I;  3G71 Z;  2QEX Z;  1USP A;  2BJO A;  2M48 A;  2HF1 A;  5AN9 F;  1Y1V S;  1W2B Z;  2G2K A;  2JNY A;  2R6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...