2B63I

Complete rna polymerase ii-rna inhibitor complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords 31-MER
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2b63I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2b63I02
2KPIA 4A3FI 2P3YA 2NVYI 4X6AI 5C3EI 1I6HI 1ML8A 3RZOI 1LQLA 3Q87A 3S1MI 2K5RA 4NBCA 3GCFA 1TWCI 3LUSA 4A3BI 3HOZI 4A3II 2YU9I 1TWFI 3HOUI 3GTPI 3ESWA 2R93I 3VB9A 4QTUA 5FLMI 3GTOI 1TWGI 3GTMS 1Y1VI 3GTGI 1I3QI 2BJOA 1SFOI 4NBFA 2JR6A 2F4MA 5CM2M 4Y7NI 4A3KI 1TWHI 4NBDA 2RBLA 4NOZA 1USPA 4NBGA 3GKQA 4NBBA 3HOWI 1DL6A 4A3EI 1Y1VS 2R7ZI 4A3LI 1X3WA 1RLYA 3S2HI 1USPB 2JA5I 2NVXI 1WW9A 5IP7I 4MH4A 2E2JI 1X3ZA 2E2HI 3GTMI 3EERA 2JNYA 4NB9A 2B63I 3GTQI 3VMGA 3S2DI 1I50I 5C44I 2NVQI 3VMHA 3K7AI 1TWAI 2PK7A 1VLAA 4BY1I 2DE7A 5C4JI 2DE6A 3FKII 2NVTI 3GTLI 1RO4A 5IP9I 2JA7I 3HOYI 3D6WA 2JS4A 4NB8A 2HF1A 3HOVI 1ZB8A 2JA6I 3GTJI 2AKLA 4BY7I 5C4XI 3M4OI 4NBAA 3HOXI 3I4NI 1L1OC 2F4OA 3S1NI 1PFTA 3PO2I 4A3JI 1NUIA 2E2II 1WCMI 1R9TI 4A3GI 3H0GI 3PO3S 2J6AA 4A3MI 4BBRI 4A93I 3RZDI 3S14I 1Y1WI 4A3DI 4BBSI 3S1RI 3H3VJ 3U50C 4XX2A 1N2FA 3I07A 4NBEA 3GTKI 4BXXI 3S1QI 2R92I 1TFIA 4A3CI 4QTTA 3S16I 1ZB9A 3PO3I 1YUAA 4NBHA 2VUMI 2JA8I 1QYPA 3S17I 4Y52I 3VMIA 3CQZI 3I4MI 3S15I 1K83I 2DE5A 3M3YI
chains in the Genus database with same CATH superfamily
2KPIA 3CC2Z 3CCJZ 4A3FI 1VQLZ 1S721 2NVYI 1N8R1 2K3RA 3MONA 3G4S1 1VQ8Z 1Q7Y2 1I6HI 1ML8A 3RZOI 1YJW1 4NBCA 2V3VA 4NH1C 4A3II 1TWFI 1M901 2R93I 3VB9A 2RIQA 2JIQA 1WZNA 1Y1VI 2OOXB 2BJOA 1KC81 4A3KI 1TWHI 2O53A 1VQKZ 4MRIA 2G2KA 1USPA 1YJNZ 1YITZ 2QRDB 1Y1VS 2R7ZI 2AYDA 1RLYA 1USPB 2JA5I 2NVXI 5IP7I 4MH4A 2JNYA 1FDIA 3CC41 1N8R2 3G71Z 3S2DI 4NFRA 1VQP1 2E7ZA 4EWCA 4MONA 1WJ2A 1QXFA 1K9M1 2NVTI 3GTLI 5IP9I 3HOYI 3G6E1 1M902 3HOVI 2QA41 3CPWY 3GTJI 3KIHA 3G4SZ 4BY7I 3CCVZ 1KRLA 4NBAA 1Q812 1K8A1 1L1OC 4DQYB 3CXCZ 3S1NI 2OTJ1 1YJWZ 3CC21 2I3CA 3FQMA 1WCMI 1KQSY 2JIMA 1VQ7Z 1NP6A 1QF8A 2IZ4A 4A93I 3CME1 2VPYA 4A3DI 3D9XA 3OW2Z 3I07A 5IT9b 3S1QI 2R92I 1Q7Y1 1TFIA 3S16I 1K9M2 1QYPA 1YIT1 3VTNA 3I56Z 3CQZI 5IT9f 3I4MI 3S15I 1K83I 2JIOA 2P3YA 3IF8A 1VQPZ 2K5RA 1Q822 2GTHA 4MD9A 1M1K1 3GCFA 3EEDA 3LUSA 1YI21 2VF1A 3MZLB 1WIIA 3HOZI 3HOUI 3G6EZ 1YHQ1 3GTOI 2QA4Z 1TWGI 5D1OA 1SFOI 5CM2M 2F4MA 4Y7NI 3P5JB 2RPRA 4NBDA 3CCEZ 3HKZA 4NBGA 3GKQA 4NBBA 2OTJZ 4S1TA 5D1OB 2H85A 3CCV1 5T67A 4RVDA 1WW9A 2E2JI 2E2HI 1VQOZ 2QR1B 3EERA 3CMEZ 1VQ71 3GTQI 2IZ3A 1I50I 4MD7A 2NVQI 3CCL1 3IR7A 1Q811 4BY1I 1M1K2 1YJ91 4RVGA 2DE6A 3FKII 2Q51A 3CPWZ 4NB8A 1ZH1A 2OOYB 2O4HA 1P9NA 2HU9A 3I561 2AKLA 3NDIA 3I4NI 3HOXI 2W04A 1KQSZ 2JIRA 4A3JI 2E2II 2OZKA 1YI2Z 2V8IA 1R9TI 3H0GI 3NFZA 4RV9A 2J6AA 2RHBA 2VPXA 4BBRI 4HGZA 3IX0A 1YHQZ 3T4NB 1Y1WI 4MXUA 1YUKA 4BXXI 2E9HA 1VQ5Z 1RNIA 2V45A 1ZB9A 3CCE1 2VPWA 1Q821 2YADA 2QREB 2QEX1 2GTIA 3CCQ1 1JJ2Y 1VQO1 2PM9A 3JAMb 5AN9F 1YIJ1 4RS4A 4DK1A 3Q87A 3S1MI 3CCLZ 1TWCI 1YJ9Z 1K731 4A3BI 1JWHC 3JAMf 2V8JA 3ESWA 3QWUA 5FLMI 5T6BA 3GTMS 3GTGI 1I3QI 3NH4A 4NBFA 3J81b 2LFUA 4E33A 3J80b 2RBLA 4NOZA 1QVGY 1VQNZ 5LL6f 1DL6A 3CCUZ 2VUGA 1Z03A 3CCR1 1W2BY 3J81f 4A3LI 3S2HI 3J80f 1X3ZA 3CCM1 1VQ61 4NB9A 2LIYA 5D1PA 1Q16A 5C44I 3VMHA 3CD6Z 1TWAI 4E31A 1NJI2 1VQ91 5C4JI 1K732 2M6NA 1Q862 1RO4A 2JA7I 1VQ51 2HF1A 3J7A4 1S7MA 3CCSZ 2QEXZ 2QKDA 3NH5A 4RVHA 3CCQZ 5C4XI 1VQM1 1YIJZ 2F4OA 1PFTA 3PO2I 3NH8A 4TNUA 2QLVB 2IV2X 4DGLA 2GU2A 4CL1A 3PO3S 1FDOA 4A3MI 3CMAZ 3RZDI 3FQQA 2P28A 3H3VJ 1RO2A 3U50C 4XX2A 3I551 3CCRZ 1QVFY 2WAQA 3F3PC 4QTTA 3TE5B 2V8KA 1VQN1 2VUMI 2JA8I 1Z02A 3CCU1 3CC7Z 4Y52I 4E2XA 3CCMZ 1JJ2Z 3M3YI 1VQ6Z 2M48A 4X6AI 5C3EI 4MD8A 4E2ZA 1LQLA 1KD12 4RVFA 3NDJA 2RT9A 1VQ9Z 2Q4ZA 1AA6A 1VQ41 2YU9I 3MZKB 3GTPI 3CD61 4QTUA 3F3FC 1RO0A 2JIPA 1QVGZ 1SIWA 2JR6A 3BG1B 2EGTA 4E2WA 1VQMZ 4E30A 1W2BZ 4AYBA 3CCS1 3HOWI 1Y8CA 4A3EI 4E32A 2NAPA 5A2Qb 2OTL1 1X3WA 1X0TA 2QRCB 1S72Z 1NJI1 3GTMI 1KC82 1Q861 2VPZA 5A2Qf 3CCJ1 1VQL1 1Z01A 2B63I 3CMA1 1VQ81 3VMGA 3I55Z 3K7AI 2PK7A 1VLAA 4HH4A 2DE7A 3BG0B 1RQFA 3D6WA 2JS4A 2WB1A 5FLXb 1ZB8A 2JA6I 2W03A 3CC71 2R6MA 4HGYA 3M4OI 1VQK1 5FLXf 1YJN1 1NUIA 3CXCY 3TDHB 2PMZA 1VQ4Z 4A3GI 2Y0SA 3KIFA 3D2LA 3CC4Z 3S14I 1K8A2 3IFUA 4BBSI 3S1RI 2JMOA 1QVFZ 1N2FA 4NBEA 3G711 3GTKI 2JUBA 2ZAEB 3OW2Y 4A3CI 3PO3I 1YUAA 4NBHA 1KD11 2OTLZ 3S17I 5T64A 3VMIA 2KI7B 2DE5A 2LEXA 4E2YA
chains in the Genus database with same CATH topology
2KPIA 3CC2Z 3CCJZ 4A3FI 1VQLZ 1S721 2NVYI 1N8R1 2K3RA 3MONA 3G4S1 1VQ8Z 1Q7Y2 1I6HI 1ML8A 3RZOI 1YJW1 4NBCA 4NH1C 4A3II 1TWFI 1M901 2R93I 3VB9A 2RIQA 1Y1VI 2OOXB 2BJOA 1KC81 4A3KI 1TWHI 2O53A 1VQKZ 4MRIA 2G2KA 1USPA 1YJNZ 1YITZ 2QRDB 1Y1VS 2R7ZI 1RLYA 1USPB 2JA5I 2NVXI 5IP7I 4MH4A 2JNYA 3CC41 1N8R2 3G71Z 3S2DI 4NFRA 1VQP1 4EWCA 4MONA 1K9M1 2NVTI 3GTLI 5IP9I 3HOYI 3G6E1 1M902 3HOVI 2QA41 3CPWY 3GTJI 3KIHA 3G4SZ 4BY7I 3CCVZ 1KRLA 4NBAA 1Q812 1K8A1 1L1OC 4DQYB 3CXCZ 3S1NI 2OTJ1 1YJWZ 3CC21 2I3CA 3FQMA 1WCMI 1KQSY 1VQ7Z 1NP6A 1QF8A 2IZ4A 4A93I 3CME1 4A3DI 3D9XA 3OW2Z 3I07A 5IT9b 3S1QI 2R92I 1Q7Y1 1TFIA 3S16I 1K9M2 1QYPA 1YIT1 3VTNA 3I56Z 3CQZI 5IT9f 3I4MI 3S15I 1K83I 2P3YA 3IF8A 1VQPZ 2K5RA 1Q822 2GTHA 4MD9A 1M1K1 3GCFA 3EEDA 3LUSA 1YI21 2VF1A 3MZLB 1WIIA 3HOZI 3HOUI 3G6EZ 1YHQ1 3GTOI 2QA4Z 1TWGI 5D1OA 1SFOI 5CM2M 2F4MA 4Y7NI 3P5JB 2RPRA 4NBDA 3CCEZ 3HKZA 4NBGA 3GKQA 4NBBA 2OTJZ 4S1TA 5D1OB 2H85A 3CCV1 5T67A 4RVDA 1WW9A 2E2JI 2E2HI 1VQOZ 2QR1B 3EERA 3CMEZ 1VQ71 3GTQI 2IZ3A 1I50I 4MD7A 2NVQI 3CCL1 1Q811 4BY1I 1M1K2 1YJ91 4RVGA 2DE6A 3FKII 2Q51A 3CPWZ 4NB8A 1ZH1A 2OOYB 2O4HA 1P9NA 2HU9A 3I561 2AKLA 3NDIA 3I4NI 3HOXI 2W04A 1KQSZ 4A3JI 2E2II 2OZKA 1YI2Z 2V8IA 1R9TI 3H0GI 3NFZA 4RV9A 2J6AA 2RHBA 4BBRI 4HGZA 3IX0A 1YHQZ 3T4NB 1Y1WI 4MXUA 1YUKA 4BXXI 2E9HA 1VQ5Z 1RNIA 1ZB9A 3CCE1 1Q821 2YADA 2QREB 2QEX1 2GTIA 3CCQ1 1JJ2Y 1VQO1 2PM9A 3JAMb 5AN9F 1YIJ1 4RS4A 4DK1A 3Q87A 3S1MI 3CCLZ 1TWCI 1YJ9Z 1K731 4A3BI 1JWHC 3JAMf 2V8JA 3ESWA 3QWUA 5FLMI 5T6BA 3GTMS 3GTGI 1I3QI 3NH4A 4NBFA 3J81b 2LFUA 4E33A 3J80b 2RBLA 4NOZA 1QVGY 1VQNZ 5LL6f 1DL6A 3CCUZ 2VUGA 1Z03A 3CCR1 1W2BY 3J81f 4A3LI 3S2HI 3J80f 1X3ZA 3CCM1 1VQ61 4NB9A 2LIYA 5D1PA 5C44I 3VMHA 3CD6Z 1TWAI 4E31A 1NJI2 1VQ91 5C4JI 1K732 2M6NA 1Q862 1RO4A 2JA7I 1VQ51 2HF1A 3J7A4 1S7MA 3CCSZ 2QEXZ 2QKDA 3NH5A 4RVHA 3CCQZ 5C4XI 1VQM1 1YIJZ 2F4OA 1PFTA 3PO2I 3NH8A 4TNUA 2QLVB 4DGLA 2GU2A 4CL1A 3PO3S 4A3MI 3CMAZ 3RZDI 3FQQA 2P28A 3H3VJ 1RO2A 3U50C 4XX2A 3I551 3CCRZ 1QVFY 2WAQA 3F3PC 4QTTA 3TE5B 2V8KA 1VQN1 2VUMI 2JA8I 1Z02A 3CCU1 3CC7Z 4Y52I 4E2XA 3CCMZ 1JJ2Z 3M3YI 1VQ6Z 2M48A 4X6AI 5C3EI 4MD8A 4E2ZA 1LQLA 1KD12 4RVFA 3NDJA 2RT9A 1VQ9Z 2Q4ZA 1VQ41 2YU9I 3MZKB 3GTPI 3CD61 4QTUA 3F3FC 1RO0A 1QVGZ 2JR6A 3BG1B 2EGTA 4E2WA 1VQMZ 4E30A 1W2BZ 4AYBA 3CCS1 3HOWI 4A3EI 4E32A 5A2Qb 2OTL1 1X3WA 1X0TA 2QRCB 1S72Z 1NJI1 3GTMI 1KC82 1Q861 5A2Qf 3CCJ1 1VQL1 1Z01A 2B63I 3CMA1 1VQ81 3VMGA 3I55Z 3K7AI 2PK7A 1VLAA 4HH4A 2DE7A 3BG0B 1RQFA 3D6WA 2JS4A 2WB1A 5FLXb 1ZB8A 2JA6I 2W03A 3CC71 2R6MA 4HGYA 3M4OI 1VQK1 5FLXf 1YJN1 1NUIA 3CXCY 3TDHB 2PMZA 1VQ4Z 4A3GI 2Y0SA 3KIFA 3CC4Z 3S14I 1K8A2 3IFUA 4BBSI 3S1RI 2JMOA 1QVFZ 1N2FA 4NBEA 3G711 3GTKI 2JUBA 2ZAEB 3OW2Y 4A3CI 3PO3I 1YUAA 4NBHA 1KD11 2OTLZ 3S17I 5T64A 3VMIA 2KI7B 2DE5A 4E2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPI A;  4A3F I;  2P3Y A;  2NVY I;  4X6A I;  5C3E I;  1I6H I;  1ML8 A;  3RZO I;  1LQL A;  3Q87 A;  3S1M I;  2K5R A;  4NBC A;  3GCF A;  1TWC I;  3LUS A;  4A3B I;  3HOZ I;  4A3I I;  2YU9 I;  1TWF I;  3HOU I;  3GTP I;  3ESW A;  2R93 I;  3VB9 A;  4QTU A;  5FLM I;  3GTO I;  1TWG I;  3GTM S;  1Y1V I;  3GTG I;  1I3Q I;  2BJO A;  1SFO I;  4NBF A;  2JR6 A;  2F4M A;  5CM2 M;  4Y7N I;  4A3K I;  1TWH I;  4NBD A;  2RBL A;  4NOZ A;  1USP A;  4NBG A;  3GKQ A;  4NBB A;  3HOW I;  1DL6 A;  4A3E I;  1Y1V S;  2R7Z I;  4A3L I;  1X3W A;  1RLY A;  3S2H I;  1USP B;  2JA5 I;  2NVX I;  1WW9 A;  5IP7 I;  4MH4 A;  2E2J I;  1X3Z A;  2E2H I;  3GTM I;  3EER A;  2JNY A;  4NB9 A;  2B63 I;  3GTQ I;  3VMG A;  3S2D I;  1I50 I;  5C44 I;  2NVQ I;  3VMH A;  3K7A I;  1TWA I;  2PK7 A;  1VLA A;  4BY1 I;  2DE7 A;  5C4J I;  2DE6 A;  3FKI I;  2NVT I;  3GTL I;  1RO4 A;  5IP9 I;  2JA7 I;  3HOY I;  3D6W A;  2JS4 A;  4NB8 A;  2HF1 A;  3HOV I;  1ZB8 A;  2JA6 I;  3GTJ I;  2AKL A;  4BY7 I;  5C4X I;  3M4O I;  4NBA A;  3HOX I;  3I4N I;  1L1O C;  2F4O A;  3S1N I;  1PFT A;  3PO2 I;  4A3J I;  1NUI A;  2E2I I;  1WCM I;  1R9T I;  4A3G I;  3H0G I;  3PO3 S;  2J6A A;  4A3M I;  4BBR I;  4A93 I;  3RZD I;  3S14 I;  1Y1W I;  4A3D I;  4BBS I;  3S1R I;  3H3V J;  3U50 C;  4XX2 A;  1N2F A;  3I07 A;  4NBE A;  3GTK I;  4BXX I;  3S1Q I;  2R92 I;  1TFI A;  4A3C I;  4QTT A;  3S16 I;  1ZB9 A;  3PO3 I;  1YUA A;  4NBH A;  2VUM I;  2JA8 I;  1QYP A;  3S17 I;  4Y52 I;  3VMI A;  3CQZ I;  3I4M I;  3S15 I;  1K83 I;  2DE5 A;  3M3Y I; 
#chains in the Genus database with same CATH topology
 2KPI A;  3CC2 Z;  3CCJ Z;  4A3F I;  1VQL Z;  1S72 1;  2NVY I;  1N8R 1;  2K3R A;  3MON A;  3G4S 1;  1VQ8 Z;  1Q7Y 2;  1I6H I;  1ML8 A;  3RZO I;  1YJW 1;  4NBC A;  2V3V A;  4NH1 C;  4A3I I;  1TWF I;  1M90 1;  2R93 I;  3VB9 A;  2RIQ A;  2JIQ A;  1WZN A;  1Y1V I;  2OOX B;  2BJO A;  1KC8 1;  4A3K I;  1TWH I;  2O53 A;  1VQK Z;  4MRI A;  2G2K A;  1USP A;  1YJN Z;  1YIT Z;  2QRD B;  1Y1V S;  2R7Z I;  2AYD A;  1RLY A;  1USP B;  2JA5 I;  2NVX I;  5IP7 I;  4MH4 A;  2JNY A;  1FDI A;  3CC4 1;  1N8R 2;  3G71 Z;  3S2D I;  4NFR A;  1VQP 1;  2E7Z A;  4EWC A;  4MON A;  1WJ2 A;  1QXF A;  1K9M 1;  2NVT I;  3GTL I;  5IP9 I;  3HOY I;  3G6E 1;  1M90 2;  3HOV I;  2QA4 1;  3CPW Y;  3GTJ I;  3KIH A;  3G4S Z;  4BY7 I;  3CCV Z;  1KRL A;  4NBA A;  1Q81 2;  1K8A 1;  1L1O C;  4DQY B;  3CXC Z;  3S1N I;  2OTJ 1;  1YJW Z;  3CC2 1;  2I3C A;  3FQM A;  1WCM I;  1KQS Y;  2JIM A;  1VQ7 Z;  1NP6 A;  1QF8 A;  2IZ4 A;  4A93 I;  3CME 1;  2VPY A;  4A3D I;  3D9X A;  3OW2 Z;  3I07 A;  5IT9 b;  3S1Q I;  2R92 I;  1Q7Y 1;  1TFI A;  3S16 I;  1K9M 2;  1QYP A;  1YIT 1;  3VTN A;  3I56 Z;  3CQZ I;  5IT9 f;  3I4M I;  3S15 I;  1K83 I;  2JIO A;  2P3Y A;  3IF8 A;  1VQP Z;  2K5R A;  1Q82 2;  2GTH A;  4MD9 A;  1M1K 1;  3GCF A;  3EED A;  3LUS A;  1YI2 1;  2VF1 A;  3MZL B;  1WII A;  3HOZ I;  3HOU I;  3G6E Z;  1YHQ 1;  3GTO I;  2QA4 Z;  1TWG I;  5D1O A;  1SFO I;  5CM2 M;  2F4M A;  4Y7N I;  3P5J B;  2RPR A;  4NBD A;  3CCE Z;  3HKZ A;  4NBG A;  3GKQ A;  4NBB A;  2OTJ Z;  4S1T A;  5D1O B;  2H85 A;  3CCV 1;  5T67 A;  4RVD A;  1WW9 A;  2E2J I;  2E2H I;  1VQO Z;  2QR1 B;  3EER A;  3CME Z;  1VQ7 1;  3GTQ I;  2IZ3 A;  1I50 I;  4MD7 A;  2NVQ I;  3CCL 1;  3IR7 A;  1Q81 1;  4BY1 I;  1M1K 2;  1YJ9 1;  4RVG A;  2DE6 A;  3FKI I;  2Q51 A;  3CPW Z;  4NB8 A;  1ZH1 A;  2OOY B;  2O4H A;  1P9N A;  2HU9 A;  3I56 1;  2AKL A;  3NDI A;  3I4N I;  3HOX I;  2W04 A;  1KQS Z;  2JIR A;  4A3J I;  2E2I I;  2OZK A;  1YI2 Z;  2V8I A;  1R9T I;  3H0G I;  3NFZ A;  4RV9 A;  2J6A A;  2RHB A;  2VPX A;  4BBR I;  4HGZ A;  3IX0 A;  1YHQ Z;  3T4N B;  1Y1W I;  4MXU A;  1YUK A;  4BXX I;  2E9H A;  1VQ5 Z;  1RNI A;  2V45 A;  1ZB9 A;  3CCE 1;  2VPW A;  1Q82 1;  2YAD A;  2QRE B;  2QEX 1;  2GTI A;  3CCQ 1;  1JJ2 Y;  1VQO 1;  2PM9 A;  3JAM b;  5AN9 F;  1YIJ 1;  4RS4 A;  4DK1 A;  3Q87 A;  3S1M I;  3CCL Z;  1TWC I;  1YJ9 Z;  1K73 1;  4A3B I;  1JWH C;  3JAM f;  2V8J A;  3ESW A;  3QWU A;  5FLM I;  5T6B A;  3GTM S;  3GTG I;  1I3Q I;  3NH4 A;  4NBF A;  3J81 b;  2LFU A;  4E33 A;  3J80 b;  2RBL A;  4NOZ A;  1QVG Y;  1VQN Z;  5LL6 f;  1DL6 A;  3CCU Z;  2VUG A;  1Z03 A;  3CCR 1;  1W2B Y;  3J81 f;  4A3L I;  3S2H I;  3J80 f;  1X3Z A;  3CCM 1;  1VQ6 1;  4NB9 A;  2LIY A;  5D1P A;  1Q16 A;  5C44 I;  3VMH A;  3CD6 Z;  1TWA I;  4E31 A;  1NJI 2;  1VQ9 1;  5C4J I;  1K73 2;  2M6N A;  1Q86 2;  1RO4 A;  2JA7 I;  1VQ5 1;  2HF1 A;  3J7A 4;  1S7M A;  3CCS Z;  2QEX Z;  2QKD A;  3NH5 A;  4RVH A;  3CCQ Z;  5C4X I;  1VQM 1;  1YIJ Z;  2F4O A;  1PFT A;  3PO2 I;  3NH8 A;  4TNU A;  2QLV B;  2IV2 X;  4DGL A;  2GU2 A;  4CL1 A;  3PO3 S;  1FDO A;  4A3M I;  3CMA Z;  3RZD I;  3FQQ A;  2P28 A;  3H3V J;  1RO2 A;  3U50 C;  4XX2 A;  3I55 1;  3CCR Z;  1QVF Y;  2WAQ A;  3F3P C;  4QTT A;  3TE5 B;  2V8K A;  1VQN 1;  2VUM I;  2JA8 I;  1Z02 A;  3CCU 1;  3CC7 Z;  4Y52 I;  4E2X A;  3CCM Z;  1JJ2 Z;  3M3Y I;  1VQ6 Z;  2M48 A;  4X6A I;  5C3E I;  4MD8 A;  4E2Z A;  1LQL A;  1KD1 2;  4RVF A;  3NDJ A;  2RT9 A;  1VQ9 Z;  2Q4Z A;  1AA6 A;  1VQ4 1;  2YU9 I;  3MZK B;  3GTP I;  3CD6 1;  4QTU A;  3F3F C;  1RO0 A;  2JIP A;  1QVG Z;  1SIW A;  2JR6 A;  3BG1 B;  2EGT A;  4E2W A;  1VQM Z;  4E30 A;  1W2B Z;  4AYB A;  3CCS 1;  3HOW I;  1Y8C A;  4A3E I;  4E32 A;  2NAP A;  5A2Q b;  2OTL 1;  1X3W A;  1X0T A;  2QRC B;  1S72 Z;  1NJI 1;  3GTM I;  1KC8 2;  1Q86 1;  2VPZ A;  5A2Q f;  3CCJ 1;  1VQL 1;  1Z01 A;  2B63 I;  3CMA 1;  1VQ8 1;  3VMG A;  3I55 Z;  3K7A I;  2PK7 A;  1VLA A;  4HH4 A;  2DE7 A;  3BG0 B;  1RQF A;  3D6W A;  2JS4 A;  2WB1 A;  5FLX b;  1ZB8 A;  2JA6 I;  2W03 A;  3CC7 1;  2R6M A;  4HGY A;  3M4O I;  1VQK 1;  5FLX f;  1YJN 1;  1NUI A;  3CXC Y;  3TDH B;  2PMZ A;  1VQ4 Z;  4A3G I;  2Y0S A;  3KIF A;  3D2L A;  3CC4 Z;  3S14 I;  1K8A 2;  3IFU A;  4BBS I;  3S1R I;  2JMO A;  1QVF Z;  1N2F A;  4NBE A;  3G71 1;  3GTK I;  2JUB A;  2ZAE B;  3OW2 Y;  4A3C I;  3PO3 I;  1YUA A;  4NBH A;  1KD1 1;  2OTL Z;  3S17 I;  5T64 A;  3VMI A;  2KI7 B;  2DE5 A;  2LEX A;  4E2Y A; 
#chains in the Genus database with same CATH homology
 2KPI A;  3CC2 Z;  3CCJ Z;  4A3F I;  1VQL Z;  1S72 1;  2NVY I;  1N8R 1;  2K3R A;  3MON A;  3G4S 1;  1VQ8 Z;  1Q7Y 2;  1I6H I;  1ML8 A;  3RZO I;  1YJW 1;  4NBC A;  4NH1 C;  4A3I I;  1TWF I;  1M90 1;  2R93 I;  3VB9 A;  2RIQ A;  1Y1V I;  2OOX B;  2BJO A;  1KC8 1;  4A3K I;  1TWH I;  2O53 A;  1VQK Z;  4MRI A;  2G2K A;  1USP A;  1YJN Z;  1YIT Z;  2QRD B;  1Y1V S;  2R7Z I;  1RLY A;  1USP B;  2JA5 I;  2NVX I;  5IP7 I;  4MH4 A;  2JNY A;  3CC4 1;  1N8R 2;  3G71 Z;  3S2D I;  4NFR A;  1VQP 1;  4EWC A;  4MON A;  1K9M 1;  2NVT I;  3GTL I;  5IP9 I;  3HOY I;  3G6E 1;  1M90 2;  3HOV I;  2QA4 1;  3CPW Y;  3GTJ I;  3KIH A;  3G4S Z;  4BY7 I;  3CCV Z;  1KRL A;  4NBA A;  1Q81 2;  1K8A 1;  1L1O C;  4DQY B;  3CXC Z;  3S1N I;  2OTJ 1;  1YJW Z;  3CC2 1;  2I3C A;  3FQM A;  1WCM I;  1KQS Y;  1VQ7 Z;  1NP6 A;  1QF8 A;  2IZ4 A;  4A93 I;  3CME 1;  4A3D I;  3D9X A;  3OW2 Z;  3I07 A;  5IT9 b;  3S1Q I;  2R92 I;  1Q7Y 1;  1TFI A;  3S16 I;  1K9M 2;  1QYP A;  1YIT 1;  3VTN A;  3I56 Z;  3CQZ I;  5IT9 f;  3I4M I;  3S15 I;  1K83 I;  2P3Y A;  3IF8 A;  1VQP Z;  2K5R A;  1Q82 2;  2GTH A;  4MD9 A;  1M1K 1;  3GCF A;  3EED A;  3LUS A;  1YI2 1;  2VF1 A;  3MZL B;  1WII A;  3HOZ I;  3HOU I;  3G6E Z;  1YHQ 1;  3GTO I;  2QA4 Z;  1TWG I;  5D1O A;  1SFO I;  5CM2 M;  2F4M A;  4Y7N I;  3P5J B;  2RPR A;  4NBD A;  3CCE Z;  3HKZ A;  4NBG A;  3GKQ A;  4NBB A;  2OTJ Z;  4S1T A;  5D1O B;  2H85 A;  3CCV 1;  5T67 A;  4RVD A;  1WW9 A;  2E2J I;  2E2H I;  1VQO Z;  2QR1 B;  3EER A;  3CME Z;  1VQ7 1;  3GTQ I;  2IZ3 A;  1I50 I;  4MD7 A;  2NVQ I;  3CCL 1;  1Q81 1;  4BY1 I;  1M1K 2;  1YJ9 1;  4RVG A;  2DE6 A;  3FKI I;  2Q51 A;  3CPW Z;  4NB8 A;  1ZH1 A;  2OOY B;  2O4H A;  1P9N A;  2HU9 A;  3I56 1;  2AKL A;  3NDI A;  3I4N I;  3HOX I;  2W04 A;  1KQS Z;  4A3J I;  2E2I I;  2OZK A;  1YI2 Z;  2V8I A;  1R9T I;  3H0G I;  3NFZ A;  4RV9 A;  2J6A A;  2RHB A;  4BBR I;  4HGZ A;  3IX0 A;  1YHQ Z;  3T4N B;  1Y1W I;  4MXU A;  1YUK A;  4BXX I;  2E9H A;  1VQ5 Z;  1RNI A;  1ZB9 A;  3CCE 1;  1Q82 1;  2YAD A;  2QRE B;  2QEX 1;  2GTI A;  3CCQ 1;  1JJ2 Y;  1VQO 1;  2PM9 A;  3JAM b;  5AN9 F;  1YIJ 1;  4RS4 A;  4DK1 A;  3Q87 A;  3S1M I;  3CCL Z;  1TWC I;  1YJ9 Z;  1K73 1;  4A3B I;  1JWH C;  3JAM f;  2V8J A;  3ESW A;  3QWU A;  5FLM I;  5T6B A;  3GTM S;  3GTG I;  1I3Q I;  3NH4 A;  4NBF A;  3J81 b;  2LFU A;  4E33 A;  3J80 b;  2RBL A;  4NOZ A;  1QVG Y;  1VQN Z;  5LL6 f;  1DL6 A;  3CCU Z;  2VUG A;  1Z03 A;  3CCR 1;  1W2B Y;  3J81 f;  4A3L I;  3S2H I;  3J80 f;  1X3Z A;  3CCM 1;  1VQ6 1;  4NB9 A;  2LIY A;  5D1P A;  5C44 I;  3VMH A;  3CD6 Z;  1TWA I;  4E31 A;  1NJI 2;  1VQ9 1;  5C4J I;  1K73 2;  2M6N A;  1Q86 2;  1RO4 A;  2JA7 I;  1VQ5 1;  2HF1 A;  3J7A 4;  1S7M A;  3CCS Z;  2QEX Z;  2QKD A;  3NH5 A;  4RVH A;  3CCQ Z;  5C4X I;  1VQM 1;  1YIJ Z;  2F4O A;  1PFT A;  3PO2 I;  3NH8 A;  4TNU A;  2QLV B;  4DGL A;  2GU2 A;  4CL1 A;  3PO3 S;  4A3M I;  3CMA Z;  3RZD I;  3FQQ A;  2P28 A;  3H3V J;  1RO2 A;  3U50 C;  4XX2 A;  3I55 1;  3CCR Z;  1QVF Y;  2WAQ A;  3F3P C;  4QTT A;  3TE5 B;  2V8K A;  1VQN 1;  2VUM I;  2JA8 I;  1Z02 A;  3CCU 1;  3CC7 Z;  4Y52 I;  4E2X A;  3CCM Z;  1JJ2 Z;  3M3Y I;  1VQ6 Z;  2M48 A;  4X6A I;  5C3E I;  4MD8 A;  4E2Z A;  1LQL A;  1KD1 2;  4RVF A;  3NDJ A;  2RT9 A;  1VQ9 Z;  2Q4Z A;  1VQ4 1;  2YU9 I;  3MZK B;  3GTP I;  3CD6 1;  4QTU A;  3F3F C;  1RO0 A;  1QVG Z;  2JR6 A;  3BG1 B;  2EGT A;  4E2W A;  1VQM Z;  4E30 A;  1W2B Z;  4AYB A;  3CCS 1;  3HOW I;  4A3E I;  4E32 A;  5A2Q b;  2OTL 1;  1X3W A;  1X0T A;  2QRC B;  1S72 Z;  1NJI 1;  3GTM I;  1KC8 2;  1Q86 1;  5A2Q f;  3CCJ 1;  1VQL 1;  1Z01 A;  2B63 I;  3CMA 1;  1VQ8 1;  3VMG A;  3I55 Z;  3K7A I;  2PK7 A;  1VLA A;  4HH4 A;  2DE7 A;  3BG0 B;  1RQF A;  3D6W A;  2JS4 A;  2WB1 A;  5FLX b;  1ZB8 A;  2JA6 I;  2W03 A;  3CC7 1;  2R6M A;  4HGY A;  3M4O I;  1VQK 1;  5FLX f;  1YJN 1;  1NUI A;  3CXC Y;  3TDH B;  2PMZ A;  1VQ4 Z;  4A3G I;  2Y0S A;  3KIF A;  3CC4 Z;  3S14 I;  1K8A 2;  3IFU A;  4BBS I;  3S1R I;  2JMO A;  1QVF Z;  1N2F A;  4NBE A;  3G71 1;  3GTK I;  2JUB A;  2ZAE B;  3OW2 Y;  4A3C I;  3PO3 I;  1YUA A;  4NBH A;  1KD1 1;  2OTL Z;  3S17 I;  5T64 A;  3VMI A;  2KI7 B;  2DE5 A;  4E2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...