2B63I

Complete rna polymerase ii-rna inhibitor complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 31-MER
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/rna
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2b63I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2b63I02
3S2DI 1USPB 4NBBA 3M3YI 3PO2I 3EERA 1R9TI 2P3YA 3HOWI 2JA5I 1X3WA 2R7ZI 3GKQA 5C4JI 1N2FA 3S1RI 3HOVI 3VMHA 2DE6A 1X3ZA 4NBAA 3H0GI 3GCFA 2E2HI 3S1NI 2DE5A 1RO4A 1TWHI 3S1QI 1I3QI 4BXXI 2JR6A 3I07A 2BJOA 2K5RA 3D6WA 3S14I 3PO3I 4BY1I 4A3DI 5C3EI 4MH4A 1I50I 1NUIA 3GTMS 1ZB8A 4BBRI 3PO3S 4NBGA 4Y52I 1LQLA 3FKII 3Q87A 4A3MI 2JA8I 1TWGI 1YUAA 1QYPA 3LUSA 3HOXI 4A3EI 2B63I 4A3LI 1USPA 2DE7A 1Y1VI 2NVTI 3HOZI 4QTUA 3VMGA 3VMIA 5FLMI 4A93I 2NVQI 4A3JI 3I4NI 3VB9A 2JS4A 2HF1A 4NBCA 2NVXI 3U50C 4NOZA 2VUMI 4NB8A 3GTKI 3I4MI 2KPIA 2YU9I 1WW9A 2RBLA 3RZDI 5IP9I 4NBHA 4A3FI 1DL6A 1ZB9A 1TWAI 4A3BI 1I6HI 2JA7I 2JNYA 2J6AA 4BY7I 2F4MA 2E2II 2PK7A 3M4OI 4Y7NI 4NBEA 1Y1VS 4BBSI 1PFTA 2NVYI 4NBDA 5C4XI 2R92I 3S16I 3RZOI 3GTJI 4A3CI 3HOUI 3S2HI 5C44I 1WCMI 1RLYA 4NBFA 2AKLA 3GTOI 1VLAA 3S15I 1ML8A 3S1MI 3H3VJ 4XX2A 1Y1WI 4A3KI 1K83I 2R93I 3HOYI 4A3II 5CM2M 2E2JI 3GTPI 3GTLI 4X6AI 3K7AI 1TWCI 1L1OC 1TFIA 3GTQI 1TWFI 4QTTA 2F4OA 3GTGI 3S17I 3CQZI 5IP7I 1SFOI 3ESWA 3GTMI 2JA6I 4A3GI 4NB9A
chains in the Genus database with same CATH superfamily
3EERA 1W2BZ 1KQSZ 2VPZA 1X3WA 3CCLZ 2JA5I 3HOWI 2NAPA 1VQ6Z 1S721 1N2FA 3VMHA 2DE6A 3I561 1TWHI 2QRCB 1K8A1 1VQ51 2Y0SA 5A2Qf 3GTMS 1QVGZ 1ZB8A 2LFUA 4NH1C 3PO3S 1KQSY 3FKII 3Q87A 1VQ7Z 3CCMZ 1Q7Y1 3IX0A 4A3EI 3FQMA 3QWUA 2DE7A 4MD9A 2V8JA 1Q812 1Q822 3CCR1 1K732 3VMIA 4NBCA 4S1TA 3NH5A 2QEXZ 4HH4A 1M901 4RVFA 4E30A 1YJN1 1Z03A 2KPIA 1QVFY 1WW9A 1VQO1 4NBHA 4A3BI 4AYBA 1Z02A 3CCVZ 2O53A 2M6NA 1Z01A 1VQ91 5AN9F 2F4MA 2E2II 3CC71 1K8A2 5T6BA 1VQN1 4BBSI 3CCU1 1N8R1 5FLXb 4A3CI 3KIHA 3GTOI 1ML8A 4E32A 3CCL1 1Q7Y2 4XX2A 3NH8A 1WZNA 2E9HA 3IF8A 3HOYI 5CM2M 3GTPI 2IZ3A 4NFRA 2YADA 4X6AI 3K7AI 3J80b 1M902 2OZKA 2F4OA 1Q862 1WIIA 1YJWZ 2JA6I 2PM9A 3MONA 1Y8CA 2JIMA 1USPB 4NBBA 1QF8A 1R9TI 2Q51A 4HGZA 1VQ71 3CCM1 3GKQA 5C4JI 1YJ9Z 3J81b 3HOVI 1P9NA 2QREB 3MZKB 1N8R2 1RO4A 1S7MA 3NH4A 4E31A 2OTLZ 4DGLA 1FDOA 1JJ2Y 1YITZ 2QEX1 4BXXI 2JR6A 3I07A 2BJOA 2JMOA 1YHQZ 4MONA 4MH4A 1VQ4Z 4BBRI 1KC82 2VPXA 2Q4ZA 3CMAZ 1NP6A 2K3RA 1VQLZ 2B63I 3CCV1 4A3LI 3IR7A 1USPA 2VUGA 2LEXA 2WAQA 1Y1VI 2GU2A 3VMGA 1NJI1 5FLMI 1RO2A 3IFUA 3VB9A 2JS4A 3CC4Z 1YUKA 4RVGA 3GTKI 1YIJZ 1QVFZ 2YU9I 2RBLA 4A3FI 1DL6A 1ZB9A 2V3VA 3G71Z 1I6HI 2JA7I 2VF1A 4BY7I 2JIPA 2W04A 4Y7NI 4NBEA 1VQMZ 3G4SZ 4NBDA 3CCJZ 5C4XI 2R92I 3F3PC 1YJW1 3S16I 3GTJI 3FQQA 1X0TA 3JAMb 1WCMI 4NBFA 4EWCA 2QR1B 1Y1WI 3CCEZ 1YJ91 1K83I 3I55Z 2R93I 2OOXB 4E33A 3CPWY 2AYDA 2V45A 2RHBA 1TWCI 2OTL1 1KRLA 1QXFA 3G6EZ 1YIT1 3GTGI 4RVDA 3S17I 5IP7I 1SFOI 3ESWA 3GTMI 1VQ8Z 2O4HA 1YHQ1 4E2YA 4NB9A 3M3YI 3PO2I 3BG1B 4DK1A 2P3YA 1VQ41 3CMEZ 3CMA1 4CL1A 1VQL1 3CCQZ 1VQ61 2EGTA 1Q16A 4NBAA 2JUBA 3H0GI 2GTHA 3S1NI 2W03A 5FLXf 3EEDA 2OTJZ 2H85A 3HKZA 4RVHA 2IZ4A 2ZAEB 1JJ2Z 2QRDB 1I3QI 5T64A 2E7ZA 2K5RA 3D6WA 3S14I 1YIJ1 4BY1I 4A3DI 5C3EI 5IT9b 3G711 4NBGA 4Y52I 4A3MI 5D1OB 1TWGI 3LUSA 4RS4A 3J80f 3OW2Z 2QLVB 2I3CA 3HOZI 2IV2X 3CCRZ 2RT9A 1VQM1 4A93I 2NVQI 4A3JI 3I4NI 3G4S1 3CCJ1 2HF1A 2NVXI 3BG0B 2RPRA 2RIQA 3MZLB 2VUMI 4NB8A 3I4MI 1RQFA 3J81f 3CXCZ 3VTNA 3RZDI 1VQKZ 3CCE1 1TWAI 5T67A 3I551 3F3FC 4RV9A 2OOYB 2JNYA 2J6AA 2LIYA 3OW2Y 1M1K1 5D1OA 1Q821 1K731 1PFTA 2NVYI 3RZOI 1VQ81 3CCSZ 2G2KA 5C44I 3S1MI 2R6MA 1VLAA 3CME1 2V8IA 3CXCY 2VPWA 3H3VJ 3CCQ1 1K9M1 5A2Qb 2KI7B 4A3II 2P28A 3CPWZ 2E2JI 3P5JB 3GTLI 2OTJ1 1VQPZ 1L1OC 2QA4Z 2HU9A 4QTTA 1RO0A 4A3GI 3S2DI 1RNIA 2GTIA 1W2BY 4MD8A 2JIOA 3CD6Z 3S1RI 3D2LA 3CC2Z 1M1K2 1X3ZA 2E2HI 3GCFA 4HGYA 4TNUA 2DE5A 5LL6f 1NJI2 1SIWA 3JAMf 3NFZA 3S1QI 1YI2Z 1Q861 4MXUA 4MD7A 3PO3I 1VQK1 1I50I 1JWHC 1NUIA 1QVGY 1K9M2 2JIRA 5D1PA 1LQLA 2JA8I 1YUAA 1QYPA 3HOXI 1S72Z 3NDJA 2NVTI 3I56Z 1WJ2A 4QTUA 3CC41 1KD11 4E2ZA 3CCS1 1VQ5Z 4NOZA 3U50C 2WB1A 3KIFA 4DQYB 5IP9I 1FDIA 2VPYA 1KC81 3TDHB 4E2XA 1VQP1 2QA41 2PK7A 3M4OI 1Y1VS 2PMZA 5IT9f 3HOUI 3S2HI 1YJNZ 3NDIA 1RLYA 2AKLA 3S15I 2JIQA 1ZH1A 3CD61 2QKDA 1VQOZ 4A3KI 3CC21 3J7A4 1VQ9Z 1AA6A 1KD12 1TFIA 3CC7Z 1TWFI 1YI21 3GTQI 3G6E1 1Q811 2V8KA 1VQNZ 2M48A 3T4NB 3CCUZ 4MRIA 4E2WA 3CQZI 3D9XA 2R7ZI 3TE5B
chains in the Genus database with same CATH topology
3EERA 1W2BZ 1KQSZ 2JA5I 1X3WA 3CCLZ 3HOWI 1VQ6Z 1S721 1N2FA 3VMHA 2DE6A 3I561 1TWHI 2QRCB 1K8A1 1VQ51 2Y0SA 5A2Qf 3GTMS 1QVGZ 1ZB8A 2LFUA 4NH1C 3PO3S 1KQSY 3FKII 3Q87A 1VQ7Z 3CCMZ 1Q7Y1 3IX0A 4A3EI 3FQMA 3QWUA 2DE7A 4MD9A 2V8JA 1Q812 1Q822 3CCR1 1K732 3VMIA 4NBCA 4S1TA 3NH5A 2QEXZ 4HH4A 1M901 4RVFA 4E30A 1YJN1 1Z03A 2KPIA 1QVFY 1WW9A 1VQO1 4NBHA 4A3BI 4AYBA 1Z02A 3CCVZ 2O53A 2M6NA 1Z01A 1VQ91 5AN9F 2F4MA 2E2II 3CC71 1K8A2 5T6BA 1VQN1 4BBSI 3CCU1 1N8R1 5FLXb 4A3CI 3KIHA 3GTOI 1ML8A 4E32A 3CCL1 1Q7Y2 4XX2A 3NH8A 2E9HA 3IF8A 3HOYI 5CM2M 3GTPI 2IZ3A 4NFRA 2YADA 4X6AI 3K7AI 3J80b 1M902 2OZKA 2F4OA 1Q862 1WIIA 1YJWZ 2JA6I 2PM9A 3MONA 1USPB 4NBBA 1QF8A 1R9TI 2Q51A 4HGZA 1VQ71 3CCM1 3GKQA 5C4JI 1YJ9Z 3J81b 3HOVI 1P9NA 2QREB 3MZKB 1N8R2 1RO4A 1S7MA 3NH4A 4E31A 2OTLZ 4DGLA 1JJ2Y 1YITZ 2QEX1 4BXXI 2JR6A 3I07A 2BJOA 2JMOA 1YHQZ 4MONA 4MH4A 1VQ4Z 4BBRI 1KC82 3CMAZ 2Q4ZA 1NP6A 2K3RA 1VQLZ 2B63I 3CCV1 4A3LI 1USPA 2VUGA 2WAQA 1Y1VI 2GU2A 3VMGA 1NJI1 5FLMI 1RO2A 3IFUA 3VB9A 2JS4A 3CC4Z 1YUKA 4RVGA 3GTKI 1YIJZ 1QVFZ 2YU9I 2RBLA 4A3FI 1DL6A 1ZB9A 3G71Z 1I6HI 2JA7I 2VF1A 4BY7I 2W04A 4Y7NI 4NBEA 1VQMZ 3G4SZ 4NBDA 3CCJZ 5C4XI 2R92I 3F3PC 1YJW1 3S16I 3GTJI 3FQQA 1X0TA 3JAMb 1WCMI 4NBFA 4EWCA 2QR1B 1Y1WI 3CCEZ 1YJ91 1K83I 3I55Z 2R93I 2OOXB 4E33A 3CPWY 2RHBA 1TWCI 2OTL1 1KRLA 3G6EZ 1YIT1 3GTGI 4RVDA 3S17I 5IP7I 1SFOI 3ESWA 3GTMI 1YHQ1 1VQ8Z 2O4HA 4E2YA 4NB9A 3M3YI 3PO2I 3BG1B 4DK1A 2P3YA 1VQ41 3CMEZ 3CMA1 4CL1A 1VQL1 3CCQZ 1VQ61 2EGTA 4NBAA 2JUBA 3H0GI 2GTHA 3S1NI 2W03A 5FLXf 3EEDA 2OTJZ 2H85A 3HKZA 4RVHA 2IZ4A 2ZAEB 1JJ2Z 2QRDB 1I3QI 5T64A 2K5RA 3D6WA 3S14I 1YIJ1 4BY1I 4A3DI 5C3EI 5IT9b 3G711 4NBGA 4Y52I 4A3MI 5D1OB 1TWGI 3LUSA 4RS4A 3J80f 3OW2Z 2QLVB 2I3CA 3HOZI 3CCRZ 2RT9A 1VQM1 4A93I 2NVQI 4A3JI 3I4NI 3G4S1 3CCJ1 2HF1A 2NVXI 3BG0B 2RPRA 2RIQA 3MZLB 2VUMI 4NB8A 3I4MI 1RQFA 3J81f 3CXCZ 3VTNA 3RZDI 1VQKZ 3CCE1 1TWAI 5T67A 3I551 3F3FC 4RV9A 2OOYB 2JNYA 2J6AA 2LIYA 3OW2Y 1M1K1 5D1OA 1Q821 1K731 1PFTA 2NVYI 3RZOI 1VQ81 3CCSZ 2G2KA 5C44I 3S1MI 2R6MA 1VLAA 3CME1 2V8IA 3CXCY 3H3VJ 3CCQ1 1K9M1 5A2Qb 2KI7B 4A3II 2P28A 3CPWZ 2E2JI 3P5JB 3GTLI 2OTJ1 1VQPZ 1L1OC 2QA4Z 2HU9A 4QTTA 1RO0A 4A3GI 3S2DI 1RNIA 2GTIA 1W2BY 4MD8A 3CD6Z 3S1RI 3CC2Z 1M1K2 1X3ZA 2E2HI 3GCFA 4HGYA 4TNUA 2DE5A 5LL6f 1NJI2 3JAMf 3NFZA 3S1QI 1YI2Z 1Q861 4MXUA 4MD7A 3PO3I 1VQK1 1I50I 1JWHC 1NUIA 1QVGY 1K9M2 5D1PA 1LQLA 2JA8I 1YUAA 1QYPA 3HOXI 1S72Z 3NDJA 2NVTI 3I56Z 4QTUA 3CC41 1KD11 4E2ZA 3CCS1 1VQ5Z 4NOZA 3U50C 2WB1A 3KIFA 4DQYB 5IP9I 1KC81 3TDHB 4E2XA 1VQP1 2QA41 2PK7A 3M4OI 1Y1VS 2PMZA 5IT9f 3HOUI 3S2HI 1YJNZ 3NDIA 1RLYA 2AKLA 3S15I 1ZH1A 3CD61 2QKDA 1VQOZ 4A3KI 3CC21 3J7A4 1VQ9Z 1KD12 1TFIA 3CC7Z 1TWFI 1YI21 3GTQI 3G6E1 1Q811 2V8KA 1VQNZ 2M48A 3T4NB 3CCUZ 4MRIA 4E2WA 3CQZI 3D9XA 2R7ZI 3TE5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2D I;  1USP B;  4NBB A;  3M3Y I;  3PO2 I;  3EER A;  1R9T I;  2P3Y A;  3HOW I;  2JA5 I;  1X3W A;  2R7Z I;  3GKQ A;  5C4J I;  1N2F A;  3S1R I;  3HOV I;  3VMH A;  2DE6 A;  1X3Z A;  4NBA A;  3H0G I;  3GCF A;  2E2H I;  3S1N I;  2DE5 A;  1RO4 A;  1TWH I;  3S1Q I;  1I3Q I;  4BXX I;  2JR6 A;  3I07 A;  2BJO A;  2K5R A;  3D6W A;  3S14 I;  3PO3 I;  4BY1 I;  4A3D I;  5C3E I;  4MH4 A;  1I50 I;  1NUI A;  3GTM S;  1ZB8 A;  4BBR I;  3PO3 S;  4NBG A;  4Y52 I;  1LQL A;  3FKI I;  3Q87 A;  4A3M I;  2JA8 I;  1TWG I;  1YUA A;  1QYP A;  3LUS A;  3HOX I;  4A3E I;  2B63 I;  4A3L I;  1USP A;  2DE7 A;  1Y1V I;  2NVT I;  3HOZ I;  4QTU A;  3VMG A;  3VMI A;  5FLM I;  4A93 I;  2NVQ I;  4A3J I;  3I4N I;  3VB9 A;  2JS4 A;  2HF1 A;  4NBC A;  2NVX I;  3U50 C;  4NOZ A;  2VUM I;  4NB8 A;  3GTK I;  3I4M I;  2KPI A;  2YU9 I;  1WW9 A;  2RBL A;  3RZD I;  5IP9 I;  4NBH A;  4A3F I;  1DL6 A;  1ZB9 A;  1TWA I;  4A3B I;  1I6H I;  2JA7 I;  2JNY A;  2J6A A;  4BY7 I;  2F4M A;  2E2I I;  2PK7 A;  3M4O I;  4Y7N I;  4NBE A;  1Y1V S;  4BBS I;  1PFT A;  2NVY I;  4NBD A;  5C4X I;  2R92 I;  3S16 I;  3RZO I;  3GTJ I;  4A3C I;  3HOU I;  3S2H I;  5C44 I;  1WCM I;  1RLY A;  4NBF A;  2AKL A;  3GTO I;  1VLA A;  3S15 I;  1ML8 A;  3S1M I;  3H3V J;  4XX2 A;  1Y1W I;  4A3K I;  1K83 I;  2R93 I;  3HOY I;  4A3I I;  5CM2 M;  2E2J I;  3GTP I;  3GTL I;  4X6A I;  3K7A I;  1TWC I;  1L1O C;  1TFI A;  3GTQ I;  1TWF I;  4QTT A;  2F4O A;  3GTG I;  3S17 I;  3CQZ I;  5IP7 I;  1SFO I;  3ESW A;  3GTM I;  2JA6 I;  4A3G I;  4NB9 A; 
#chains in the Genus database with same CATH topology
 3EER A;  1W2B Z;  1KQS Z;  2VPZ A;  1X3W A;  3CCL Z;  2JA5 I;  3HOW I;  2NAP A;  1VQ6 Z;  1S72 1;  1N2F A;  3VMH A;  2DE6 A;  3I56 1;  1TWH I;  2QRC B;  1K8A 1;  1VQ5 1;  2Y0S A;  5A2Q f;  3GTM S;  1QVG Z;  1ZB8 A;  2LFU A;  4NH1 C;  3PO3 S;  1KQS Y;  3FKI I;  3Q87 A;  1VQ7 Z;  3CCM Z;  1Q7Y 1;  3IX0 A;  4A3E I;  3FQM A;  3QWU A;  2DE7 A;  4MD9 A;  2V8J A;  1Q81 2;  1Q82 2;  3CCR 1;  1K73 2;  3VMI A;  4NBC A;  4S1T A;  3NH5 A;  2QEX Z;  4HH4 A;  1M90 1;  4RVF A;  4E30 A;  1YJN 1;  1Z03 A;  2KPI A;  1QVF Y;  1WW9 A;  1VQO 1;  4NBH A;  4A3B I;  4AYB A;  1Z02 A;  3CCV Z;  2O53 A;  2M6N A;  1Z01 A;  1VQ9 1;  5AN9 F;  2F4M A;  2E2I I;  3CC7 1;  1K8A 2;  5T6B A;  1VQN 1;  4BBS I;  3CCU 1;  1N8R 1;  5FLX b;  4A3C I;  3KIH A;  3GTO I;  1ML8 A;  4E32 A;  3CCL 1;  1Q7Y 2;  4XX2 A;  3NH8 A;  1WZN A;  2E9H A;  3IF8 A;  3HOY I;  5CM2 M;  3GTP I;  2IZ3 A;  4NFR A;  2YAD A;  4X6A I;  3K7A I;  3J80 b;  1M90 2;  2OZK A;  2F4O A;  1Q86 2;  1WII A;  1YJW Z;  2JA6 I;  2PM9 A;  3MON A;  1Y8C A;  2JIM A;  1USP B;  4NBB A;  1QF8 A;  1R9T I;  2Q51 A;  4HGZ A;  1VQ7 1;  3CCM 1;  3GKQ A;  5C4J I;  1YJ9 Z;  3J81 b;  3HOV I;  1P9N A;  2QRE B;  3MZK B;  1N8R 2;  1RO4 A;  1S7M A;  3NH4 A;  4E31 A;  2OTL Z;  4DGL A;  1FDO A;  1JJ2 Y;  1YIT Z;  2QEX 1;  4BXX I;  2JR6 A;  3I07 A;  2BJO A;  2JMO A;  1YHQ Z;  4MON A;  4MH4 A;  1VQ4 Z;  4BBR I;  1KC8 2;  2VPX A;  2Q4Z A;  3CMA Z;  1NP6 A;  2K3R A;  1VQL Z;  2B63 I;  3CCV 1;  4A3L I;  3IR7 A;  1USP A;  2VUG A;  2LEX A;  2WAQ A;  1Y1V I;  2GU2 A;  3VMG A;  1NJI 1;  5FLM I;  1RO2 A;  3IFU A;  3VB9 A;  2JS4 A;  3CC4 Z;  1YUK A;  4RVG A;  3GTK I;  1YIJ Z;  1QVF Z;  2YU9 I;  2RBL A;  4A3F I;  1DL6 A;  1ZB9 A;  2V3V A;  3G71 Z;  1I6H I;  2JA7 I;  2VF1 A;  4BY7 I;  2JIP A;  2W04 A;  4Y7N I;  4NBE A;  1VQM Z;  3G4S Z;  4NBD A;  3CCJ Z;  5C4X I;  2R92 I;  3F3P C;  1YJW 1;  3S16 I;  3GTJ I;  3FQQ A;  1X0T A;  3JAM b;  1WCM I;  4NBF A;  4EWC A;  2QR1 B;  1Y1W I;  3CCE Z;  1YJ9 1;  1K83 I;  3I55 Z;  2R93 I;  2OOX B;  4E33 A;  3CPW Y;  2AYD A;  2V45 A;  2RHB A;  1TWC I;  2OTL 1;  1KRL A;  1QXF A;  3G6E Z;  1YIT 1;  3GTG I;  4RVD A;  3S17 I;  5IP7 I;  1SFO I;  3ESW A;  3GTM I;  1VQ8 Z;  2O4H A;  1YHQ 1;  4E2Y A;  4NB9 A;  3M3Y I;  3PO2 I;  3BG1 B;  4DK1 A;  2P3Y A;  1VQ4 1;  3CME Z;  3CMA 1;  4CL1 A;  1VQL 1;  3CCQ Z;  1VQ6 1;  2EGT A;  1Q16 A;  4NBA A;  2JUB A;  3H0G I;  2GTH A;  3S1N I;  2W03 A;  5FLX f;  3EED A;  2OTJ Z;  2H85 A;  3HKZ A;  4RVH A;  2IZ4 A;  2ZAE B;  1JJ2 Z;  2QRD B;  1I3Q I;  5T64 A;  2E7Z A;  2K5R A;  3D6W A;  3S14 I;  1YIJ 1;  4BY1 I;  4A3D I;  5C3E I;  5IT9 b;  3G71 1;  4NBG A;  4Y52 I;  4A3M I;  5D1O B;  1TWG I;  3LUS A;  4RS4 A;  3J80 f;  3OW2 Z;  2QLV B;  2I3C A;  3HOZ I;  2IV2 X;  3CCR Z;  2RT9 A;  1VQM 1;  4A93 I;  2NVQ I;  4A3J I;  3I4N I;  3G4S 1;  3CCJ 1;  2HF1 A;  2NVX I;  3BG0 B;  2RPR A;  2RIQ A;  3MZL B;  2VUM I;  4NB8 A;  3I4M I;  1RQF A;  3J81 f;  3CXC Z;  3VTN A;  3RZD I;  1VQK Z;  3CCE 1;  1TWA I;  5T67 A;  3I55 1;  3F3F C;  4RV9 A;  2OOY B;  2JNY A;  2J6A A;  2LIY A;  3OW2 Y;  1M1K 1;  5D1O A;  1Q82 1;  1K73 1;  1PFT A;  2NVY I;  3RZO I;  1VQ8 1;  3CCS Z;  2G2K A;  5C44 I;  3S1M I;  2R6M A;  1VLA A;  3CME 1;  2V8I A;  3CXC Y;  2VPW A;  3H3V J;  3CCQ 1;  1K9M 1;  5A2Q b;  2KI7 B;  4A3I I;  2P28 A;  3CPW Z;  2E2J I;  3P5J B;  3GTL I;  2OTJ 1;  1VQP Z;  1L1O C;  2QA4 Z;  2HU9 A;  4QTT A;  1RO0 A;  4A3G I;  3S2D I;  1RNI A;  2GTI A;  1W2B Y;  4MD8 A;  2JIO A;  3CD6 Z;  3S1R I;  3D2L A;  3CC2 Z;  1M1K 2;  1X3Z A;  2E2H I;  3GCF A;  4HGY A;  4TNU A;  2DE5 A;  5LL6 f;  1NJI 2;  1SIW A;  3JAM f;  3NFZ A;  3S1Q I;  1YI2 Z;  1Q86 1;  4MXU A;  4MD7 A;  3PO3 I;  1VQK 1;  1I50 I;  1JWH C;  1NUI A;  1QVG Y;  1K9M 2;  2JIR A;  5D1P A;  1LQL A;  2JA8 I;  1YUA A;  1QYP A;  3HOX I;  1S72 Z;  3NDJ A;  2NVT I;  3I56 Z;  1WJ2 A;  4QTU A;  3CC4 1;  1KD1 1;  4E2Z A;  3CCS 1;  1VQ5 Z;  4NOZ A;  3U50 C;  2WB1 A;  3KIF A;  4DQY B;  5IP9 I;  1FDI A;  2VPY A;  1KC8 1;  3TDH B;  4E2X A;  1VQP 1;  2QA4 1;  2PK7 A;  3M4O I;  1Y1V S;  2PMZ A;  5IT9 f;  3HOU I;  3S2H I;  1YJN Z;  3NDI A;  1RLY A;  2AKL A;  3S15 I;  2JIQ A;  1ZH1 A;  3CD6 1;  2QKD A;  1VQO Z;  4A3K I;  3CC2 1;  3J7A 4;  1VQ9 Z;  1AA6 A;  1KD1 2;  1TFI A;  3CC7 Z;  1TWF I;  1YI2 1;  3GTQ I;  3G6E 1;  1Q81 1;  2V8K A;  1VQN Z;  2M48 A;  3T4N B;  3CCU Z;  4MRI A;  4E2W A;  3CQZ I;  3D9X A;  2R7Z I;  3TE5 B; 
#chains in the Genus database with same CATH homology
 3EER A;  1W2B Z;  1KQS Z;  2JA5 I;  1X3W A;  3CCL Z;  3HOW I;  1VQ6 Z;  1S72 1;  1N2F A;  3VMH A;  2DE6 A;  3I56 1;  1TWH I;  2QRC B;  1K8A 1;  1VQ5 1;  2Y0S A;  5A2Q f;  3GTM S;  1QVG Z;  1ZB8 A;  2LFU A;  4NH1 C;  3PO3 S;  1KQS Y;  3FKI I;  3Q87 A;  1VQ7 Z;  3CCM Z;  1Q7Y 1;  3IX0 A;  4A3E I;  3FQM A;  3QWU A;  2DE7 A;  4MD9 A;  2V8J A;  1Q81 2;  1Q82 2;  3CCR 1;  1K73 2;  3VMI A;  4NBC A;  4S1T A;  3NH5 A;  2QEX Z;  4HH4 A;  1M90 1;  4RVF A;  4E30 A;  1YJN 1;  1Z03 A;  2KPI A;  1QVF Y;  1WW9 A;  1VQO 1;  4NBH A;  4A3B I;  4AYB A;  1Z02 A;  3CCV Z;  2O53 A;  2M6N A;  1Z01 A;  1VQ9 1;  5AN9 F;  2F4M A;  2E2I I;  3CC7 1;  1K8A 2;  5T6B A;  1VQN 1;  4BBS I;  3CCU 1;  1N8R 1;  5FLX b;  4A3C I;  3KIH A;  3GTO I;  1ML8 A;  4E32 A;  3CCL 1;  1Q7Y 2;  4XX2 A;  3NH8 A;  2E9H A;  3IF8 A;  3HOY I;  5CM2 M;  3GTP I;  2IZ3 A;  4NFR A;  2YAD A;  4X6A I;  3K7A I;  3J80 b;  1M90 2;  2OZK A;  2F4O A;  1Q86 2;  1WII A;  1YJW Z;  2JA6 I;  2PM9 A;  3MON A;  1USP B;  4NBB A;  1QF8 A;  1R9T I;  2Q51 A;  4HGZ A;  1VQ7 1;  3CCM 1;  3GKQ A;  5C4J I;  1YJ9 Z;  3J81 b;  3HOV I;  1P9N A;  2QRE B;  3MZK B;  1N8R 2;  1RO4 A;  1S7M A;  3NH4 A;  4E31 A;  2OTL Z;  4DGL A;  1JJ2 Y;  1YIT Z;  2QEX 1;  4BXX I;  2JR6 A;  3I07 A;  2BJO A;  2JMO A;  1YHQ Z;  4MON A;  4MH4 A;  1VQ4 Z;  4BBR I;  1KC8 2;  3CMA Z;  2Q4Z A;  1NP6 A;  2K3R A;  1VQL Z;  2B63 I;  3CCV 1;  4A3L I;  1USP A;  2VUG A;  2WAQ A;  1Y1V I;  2GU2 A;  3VMG A;  1NJI 1;  5FLM I;  1RO2 A;  3IFU A;  3VB9 A;  2JS4 A;  3CC4 Z;  1YUK A;  4RVG A;  3GTK I;  1YIJ Z;  1QVF Z;  2YU9 I;  2RBL A;  4A3F I;  1DL6 A;  1ZB9 A;  3G71 Z;  1I6H I;  2JA7 I;  2VF1 A;  4BY7 I;  2W04 A;  4Y7N I;  4NBE A;  1VQM Z;  3G4S Z;  4NBD A;  3CCJ Z;  5C4X I;  2R92 I;  3F3P C;  1YJW 1;  3S16 I;  3GTJ I;  3FQQ A;  1X0T A;  3JAM b;  1WCM I;  4NBF A;  4EWC A;  2QR1 B;  1Y1W I;  3CCE Z;  1YJ9 1;  1K83 I;  3I55 Z;  2R93 I;  2OOX B;  4E33 A;  3CPW Y;  2RHB A;  1TWC I;  2OTL 1;  1KRL A;  3G6E Z;  1YIT 1;  3GTG I;  4RVD A;  3S17 I;  5IP7 I;  1SFO I;  3ESW A;  3GTM I;  1YHQ 1;  1VQ8 Z;  2O4H A;  4E2Y A;  4NB9 A;  3M3Y I;  3PO2 I;  3BG1 B;  4DK1 A;  2P3Y A;  1VQ4 1;  3CME Z;  3CMA 1;  4CL1 A;  1VQL 1;  3CCQ Z;  1VQ6 1;  2EGT A;  4NBA A;  2JUB A;  3H0G I;  2GTH A;  3S1N I;  2W03 A;  5FLX f;  3EED A;  2OTJ Z;  2H85 A;  3HKZ A;  4RVH A;  2IZ4 A;  2ZAE B;  1JJ2 Z;  2QRD B;  1I3Q I;  5T64 A;  2K5R A;  3D6W A;  3S14 I;  1YIJ 1;  4BY1 I;  4A3D I;  5C3E I;  5IT9 b;  3G71 1;  4NBG A;  4Y52 I;  4A3M I;  5D1O B;  1TWG I;  3LUS A;  4RS4 A;  3J80 f;  3OW2 Z;  2QLV B;  2I3C A;  3HOZ I;  3CCR Z;  2RT9 A;  1VQM 1;  4A93 I;  2NVQ I;  4A3J I;  3I4N I;  3G4S 1;  3CCJ 1;  2HF1 A;  2NVX I;  3BG0 B;  2RPR A;  2RIQ A;  3MZL B;  2VUM I;  4NB8 A;  3I4M I;  1RQF A;  3J81 f;  3CXC Z;  3VTN A;  3RZD I;  1VQK Z;  3CCE 1;  1TWA I;  5T67 A;  3I55 1;  3F3F C;  4RV9 A;  2OOY B;  2JNY A;  2J6A A;  2LIY A;  3OW2 Y;  1M1K 1;  5D1O A;  1Q82 1;  1K73 1;  1PFT A;  2NVY I;  3RZO I;  1VQ8 1;  3CCS Z;  2G2K A;  5C44 I;  3S1M I;  2R6M A;  1VLA A;  3CME 1;  2V8I A;  3CXC Y;  3H3V J;  3CCQ 1;  1K9M 1;  5A2Q b;  2KI7 B;  4A3I I;  2P28 A;  3CPW Z;  2E2J I;  3P5J B;  3GTL I;  2OTJ 1;  1VQP Z;  1L1O C;  2QA4 Z;  2HU9 A;  4QTT A;  1RO0 A;  4A3G I;  3S2D I;  1RNI A;  2GTI A;  1W2B Y;  4MD8 A;  3CD6 Z;  3S1R I;  3CC2 Z;  1M1K 2;  1X3Z A;  2E2H I;  3GCF A;  4HGY A;  4TNU A;  2DE5 A;  5LL6 f;  1NJI 2;  3JAM f;  3NFZ A;  3S1Q I;  1YI2 Z;  1Q86 1;  4MXU A;  4MD7 A;  3PO3 I;  1VQK 1;  1I50 I;  1JWH C;  1NUI A;  1QVG Y;  1K9M 2;  5D1P A;  1LQL A;  2JA8 I;  1YUA A;  1QYP A;  3HOX I;  1S72 Z;  3NDJ A;  2NVT I;  3I56 Z;  4QTU A;  3CC4 1;  1KD1 1;  4E2Z A;  3CCS 1;  1VQ5 Z;  4NOZ A;  3U50 C;  2WB1 A;  3KIF A;  4DQY B;  5IP9 I;  1KC8 1;  3TDH B;  4E2X A;  1VQP 1;  2QA4 1;  2PK7 A;  3M4O I;  1Y1V S;  2PMZ A;  5IT9 f;  3HOU I;  3S2H I;  1YJN Z;  3NDI A;  1RLY A;  2AKL A;  3S15 I;  1ZH1 A;  3CD6 1;  2QKD A;  1VQO Z;  4A3K I;  3CC2 1;  3J7A 4;  1VQ9 Z;  1KD1 2;  1TFI A;  3CC7 Z;  1TWF I;  1YI2 1;  3GTQ I;  3G6E 1;  1Q81 1;  2V8K A;  1VQN Z;  2M48 A;  3T4N B;  3CCU Z;  4MRI A;  4E2W A;  3CQZ I;  3D9X A;  2R7Z I;  3TE5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...