2B63I

Complete rna polymerase ii-rna inhibitor complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 31-MER
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/rna
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2b63I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2b63I02
4QTTA 2DE5A 3S15I 2JS4A 2E2JI 1VLAA 3VB9A 4A3II 1RLYA 1I50I 2RBLA 4BBSI 4A3LI 5C3EI 4Y52I 4NBCA 1TWAI 3LUSA 2P3YA 2JA8I 4NBFA 2JA7I 4NB8A 1Y1WI 4NBBA 5C4JI 3HOYI 5C4XI 3GTKI 1USPA 2E2II 5IP7I 3S16I 1RO4A 2R92I 3ESWA 1LQLA 5C44I 3U50C 2PK7A 2NVQI 4A3DI 3GTPI 1USPB 2HF1A 2K5RA 3HOWI 3S1RI 4A3EI 1ML8A 4BXXI 4XX2A 4MH4A 5IP9I 1I6HI 3VMGA 1WW9A 2NVYI 4Y7NI 3CQZI 4QTUA 3S2DI 3H3VJ 3PO3I 1YUAA 4NBHA 4NOZA 1I3QI 2YU9I 4A3CI 1R9TI 4A3BI 2JA5I 1ZB8A 3GKQA 4A3MI 1X3ZA 3PO3S 2NVXI 1X3WA 2DE7A 3VMIA 1N2FA 2KPIA 2F4MA 3I07A 4A3GI 4BBRI 3I4NI 4BY7I 2R93I 1PFTA 2AKLA 3PO2I 2JNYA 4BY1I 4NBGA 1NUIA 3HOZI 1TFIA 3GTMI 4NBAA 1TWGI 3RZOI 4NBEA 3GCFA 4NB9A 2BJOA 1SFOI 3S1NI 1TWHI 1L1OC 3Q87A 2JA6I 2J6AA 3H0GI 3M4OI 3GTQI 1WCMI 3GTMS 3VMHA 3GTOI 1Y1VI 2R7ZI 3S2HI 3S1QI 3HOVI 3FKII 5FLMI 1TWCI 1QYPA 1TWFI 4A3KI 1DL6A 2F4OA 3S17I 1Y1VS 3GTLI 4A3JI 2DE6A 4A3FI 3M3YI 1K83I 3HOUI 5CM2M 3K7AI 3RZDI 2E2HI 3GTJI 3I4MI 3HOXI 2NVTI 2VUMI 3S14I 4A93I 2B63I 1ZB9A 4NBDA 4X6AI 3S1MI 3EERA 3D6WA 2JR6A 3GTGI
chains in the Genus database with same CATH superfamily
2QKDA 2O4HA 1RLYA 3CCMZ 4BBSI 4TNUA 1YHQ1 1KRLA 3CMEZ 3CCL1 2VPXA 3LUSA 3NFZA 4E31A 3JAMb 1USPA 2E7ZA 3CCUZ 2E2II 2G2KA 1QXFA 1YUKA 2PK7A 2NVQI 3CMA1 2IZ4A 2HF1A 3HOWI 2JUBA 1RO2A 1ML8A 1VQOZ 3G6E1 3BG0B 1I6HI 3G711 2NVYI 2VPWA 3J80f 1KD11 1YJW1 1K9M2 2OTJZ 1YIJ1 1YUAA 4NOZA 1R9TI 3JAMf 4E32A 3CCV1 3GKQA 2VF1A 1P9NA 4MD7A 3PO3S 5LL6f 1S72Z 2NAPA 2RIQA 4A3GI 5T67A 1VQLZ 2JIRA 2AYDA 1KQSY 1S7MA 3CCEZ 3GTMI 3NH5A 3D2LA 4NFRA 3Q87A 2WAQA 3GTQI 1Z01A 3VMHA 3GTOI 1YJWZ 1VQ71 1QYPA 1VQMZ 2F4OA 3GTLI 1K8A1 1K83I 3K7AI 3RZDI 3I4MI 2Q51A 3S14I 3F3PC 2K3RA 3CCM1 3CCJZ 2QRDB 4QTTA 3NDJA 2DE5A 3CME1 3S15I 1YJNZ 3F3FC 4HH4A 3CXCZ 1Y8CA 3CCU1 2OOYB 4NBCA 1TWAI 2PM9A 2P3YA 2JA8I 2JA7I 4NB8A 4MD8A 1M1K1 3NH8A 1QVGY 4E2YA 5IT9b 2GU2A 2R92I 1VQO1 3U50C 4RV9A 3EEDA 1VQ8Z 3S1RI 4A3EI 4DGLA 2OTJ1 2V8KA 3CC7Z 3MZKB 1KD12 3QWUA 2IZ3A 2V8IA 3CQZI 4QTUA 3J81b 4NBHA 2YU9I 1S721 3I55Z 1VQL1 3CC4Z 5A2Qf 2NVXI 1X3WA 3CCE1 2F4MA 2HU9A 4RVFA 1K731 3I4NI 3CD6Z 1QF8A 3IF8A 2AKLA 4BY1I 4NBGA 1NUIA 3HOZI 1FDOA 2QA4Z 1TFIA 4NBAA 3J81f 3RZOI 1RQFA 4NBEA 4NB9A 1VQM1 2RHBA 2JA6I 2J6AA 3H0GI 3GTMS 2R7ZI 3S2HI 2M6NA 3FKII 2OTL1 1VQ9Z 1TWFI 1KQSZ 2JIQA 1DL6A 3S17I 1K8A2 2DE6A 1WZNA 3CCJ1 4A3FI 1VQKZ 3HOUI 3IFUA 1YJN1 1Q861 3NH4A 1N8R1 4A93I 4AYBA 2JR6A 3I56Z 5D1OB 2JS4A 3D9XA 5FLXb 3CPWY 2E2JI 3CCSZ 4MONA 1VLAA 1YITZ 1FDIA 3NDIA 4A3LI 4Y52I 1M1K2 2RT9A 3CC2Z 2QR1B 2OTLZ 2E9HA 2ZAEB 4NBFA 4E33A 1Y1WI 1Q16A 2LIYA 4NBBA 3HOYI 5C4XI 1VQ81 5IP7I 3S16I 3ESWA 5C44I 3CC71 2P28A 4A3DI 2IV2X 3GTPI 1USPB 1Q811 2QREB 2K5RA 4CL1A 4BXXI 4MH4A 3CCQZ 3G4SZ 1QVGZ 3I551 1NJI1 1NP6A 2OZKA 1VQ5Z 3CC41 1VQNZ 1I3QI 1W2BY 4A3BI 2GTHA 1SIWA 2JIOA 1VQPZ 3CD61 3MONA 1Q821 4A3MI 1QVFY 1K732 3VMIA 2QA41 2M48A 1JJ2Y 2RPRA 3I07A 4BBRI 2R93I 1Q7Y1 2WB1A 3OW2Y 2H85A 1TWGI 2GTIA 2QEXZ 3FQQA 3IX0A 3GCFA 3P5JB 1VQ91 1VQ6Z 2BJOA 1KC82 1SFOI 2I3CA 3S1NI 1L1OC 5IT9f 3M4OI 1WCMI 1Y1VI 1YI2Z 3S1QI 3HOVI 5FLMI 1VQ4Z 2V45A 3TE5B 1VQK1 5T6BA 2JIMA 4RS4A 1WJ2A 3KIFA 3J80b 1WIIA 3CCRZ 1YJ9Z 4A3JI 3M3YI 1Q862 3I561 1N8R2 2E2HI 4DK1A 1RNIA 2Y0SA 3T4NB 3HOXI 2NVTI 2VUMI 3CCS1 1M901 2B63I 1YIT1 4NBDA 2LEXA 2JIPA 1KC81 3D6WA 1X0TA 2JMOA 3CC21 4HGYA 3VB9A 4A3II 1I50I 1AA6A 2YADA 2RBLA 4MXUA 4E2WA 5C3EI 5AN9F 4NH1C 2KI7B 5C4JI 3GTKI 3BG1B 1YHQZ 1RO4A 1ZH1A 3CPWZ 1LQLA 3VTNA 2O53A 3CCQ1 3CCLZ 4MRIA 3G4S1 1Q812 2QLVB 4HGZA 4E30A 2W03A 3IR7A 1VQ51 4E2ZA 1VQN1 4XX2A 3MZLB 5IP9I 1NJI2 3VMGA 1WW9A 3CMAZ 2OOXB 4Y7NI 1VQP1 1JWHC 4RVDA 3S2DI 3H3VJ 3PO3I 4A3CI 3G6EZ 3TDHB 1K9M1 3G71Z 1Q822 3KIHA 2JA5I 1ZB8A 1X3ZA 2EGTA 1YIJZ 2DE7A 1N2FA 2KPIA 4MD9A 5FLXf 2QEX1 1Q7Y2 1Z02A 4BY7I 4RVGA 1VQ61 1PFTA 3CCVZ 3PO2I 2JNYA 1W2BZ 5D1PA 1YI21 1VQ41 4EWCA 1QVFZ 1Z03A 1TWHI 1JJ2Z 2R6MA 2W04A 5T64A 3CCR1 1YJ91 3FQMA 4DQYB 2V3VA 1TWCI 2LFUA 4S1TA 3OW2Z 2QRCB 4E2XA 4A3KI 2VPZA 1Y1VS 2VUGA 2Q4ZA 3HKZA 1VQ7Z 2PMZA 3CXCY 5CM2M 1M902 2V8JA 3GTJI 5D1OA 1ZB9A 1RO0A 2VPYA 3J7A4 4X6AI 3S1MI 3EERA 4RVHA 5A2Qb 3GTGI
chains in the Genus database with same CATH topology
2QKDA 2O4HA 1RLYA 3CCMZ 4BBSI 4TNUA 1YHQ1 1KRLA 3CMEZ 3CCL1 3LUSA 3NFZA 4E31A 3JAMb 1USPA 3CCUZ 2E2II 2G2KA 1YUKA 2PK7A 2NVQI 3CMA1 2IZ4A 2HF1A 3HOWI 2JUBA 1RO2A 1ML8A 1VQOZ 3G6E1 3BG0B 1I6HI 3G711 2NVYI 3J80f 1KD11 1YJW1 1K9M2 2OTJZ 1YIJ1 1YUAA 4NOZA 1R9TI 3JAMf 4E32A 3CCV1 3GKQA 2VF1A 1P9NA 4MD7A 3PO3S 5LL6f 1S72Z 2RIQA 4A3GI 5T67A 1VQLZ 1KQSY 1S7MA 3CCEZ 3GTMI 3NH5A 4NFRA 3Q87A 2WAQA 3GTQI 1Z01A 3VMHA 3GTOI 1YJWZ 1VQ71 1QYPA 1VQMZ 2F4OA 3GTLI 1K8A1 1K83I 3K7AI 3RZDI 3I4MI 2Q51A 3S14I 3F3PC 2K3RA 3CCM1 3CCJZ 2QRDB 4QTTA 3NDJA 2DE5A 3CME1 3S15I 1YJNZ 3F3FC 4HH4A 3CXCZ 3CCU1 2OOYB 4NBCA 1TWAI 2PM9A 2P3YA 2JA8I 2JA7I 4NB8A 4MD8A 1M1K1 3NH8A 1QVGY 4E2YA 5IT9b 2GU2A 2R92I 1VQO1 3U50C 4RV9A 3EEDA 1VQ8Z 3S1RI 4A3EI 4DGLA 2OTJ1 2V8KA 3CC7Z 3MZKB 1KD12 3QWUA 2IZ3A 2V8IA 3CQZI 4QTUA 3J81b 4NBHA 2YU9I 1S721 3I55Z 1VQL1 3CC4Z 5A2Qf 2NVXI 1X3WA 3CCE1 2F4MA 2HU9A 4RVFA 1K731 3I4NI 3CD6Z 1QF8A 3IF8A 2AKLA 4BY1I 4NBGA 1NUIA 3HOZI 2QA4Z 1TFIA 4NBAA 3J81f 3RZOI 1RQFA 4NBEA 4NB9A 1VQM1 2RHBA 2JA6I 2J6AA 3H0GI 3GTMS 2R7ZI 3S2HI 2M6NA 3FKII 2OTL1 1VQ9Z 1TWFI 1KQSZ 1DL6A 3S17I 1K8A2 2DE6A 4A3FI 3CCJ1 1VQKZ 3HOUI 3IFUA 1YJN1 1Q861 3NH4A 1N8R1 4A93I 4AYBA 2JR6A 3I56Z 5D1OB 2JS4A 3D9XA 5FLXb 3CPWY 2E2JI 3CCSZ 4MONA 1VLAA 1YITZ 3NDIA 4A3LI 4Y52I 1M1K2 2RT9A 3CC2Z 2QR1B 2OTLZ 2E9HA 2ZAEB 4NBFA 4E33A 1Y1WI 2LIYA 4NBBA 3HOYI 5C4XI 1VQ81 5IP7I 3S16I 3ESWA 5C44I 3CC71 2P28A 4A3DI 3GTPI 1USPB 1Q811 2QREB 2K5RA 4CL1A 4BXXI 4MH4A 3CCQZ 3G4SZ 1QVGZ 3I551 1NJI1 1NP6A 2OZKA 1VQ5Z 3CC41 1VQNZ 1I3QI 1W2BY 4A3BI 2GTHA 1VQPZ 3CD61 3MONA 1Q821 4A3MI 1QVFY 1K732 3VMIA 2QA41 2M48A 1JJ2Y 2RPRA 3I07A 4BBRI 2R93I 1Q7Y1 2WB1A 3OW2Y 2H85A 1TWGI 2GTIA 2QEXZ 3FQQA 3IX0A 3GCFA 3P5JB 1VQ91 1VQ6Z 2BJOA 1KC82 1SFOI 2I3CA 3S1NI 1L1OC 5IT9f 3M4OI 1WCMI 1Y1VI 1YI2Z 3S1QI 3HOVI 5FLMI 1VQ4Z 3TE5B 1VQK1 5T6BA 4RS4A 3KIFA 3J80b 1WIIA 3CCRZ 1YJ9Z 4A3JI 3M3YI 1Q862 3I561 1N8R2 2E2HI 4DK1A 1RNIA 2Y0SA 3T4NB 3HOXI 2NVTI 2VUMI 3CCS1 1M901 2B63I 1YIT1 4NBDA 1KC81 3D6WA 1X0TA 2JMOA 3CC21 4HGYA 3VB9A 4A3II 1I50I 2YADA 2RBLA 4MXUA 4E2WA 5C3EI 5AN9F 4NH1C 2KI7B 5C4JI 3GTKI 3BG1B 1YHQZ 1RO4A 1ZH1A 3CPWZ 1LQLA 3VTNA 2O53A 3CCQ1 3CCLZ 4MRIA 3G4S1 1Q812 2QLVB 4HGZA 4E30A 2W03A 1VQ51 4E2ZA 1VQN1 4XX2A 3MZLB 5IP9I 1NJI2 3VMGA 1WW9A 3CMAZ 2OOXB 4Y7NI 1VQP1 1JWHC 4RVDA 3S2DI 3H3VJ 3PO3I 4A3CI 3G6EZ 3TDHB 1K9M1 3G71Z 1Q822 3KIHA 2JA5I 1ZB8A 1X3ZA 2EGTA 1YIJZ 2DE7A 1N2FA 2KPIA 4MD9A 5FLXf 2QEX1 1Q7Y2 1Z02A 4BY7I 4RVGA 1VQ61 1PFTA 3CCVZ 3PO2I 2JNYA 1W2BZ 5D1PA 1YI21 1VQ41 4EWCA 1QVFZ 1Z03A 1TWHI 1JJ2Z 2R6MA 2W04A 5T64A 3CCR1 1YJ91 3FQMA 4DQYB 1TWCI 2LFUA 4S1TA 3OW2Z 2QRCB 4E2XA 4A3KI 1Y1VS 2VUGA 2Q4ZA 3HKZA 1VQ7Z 2PMZA 3CXCY 5CM2M 1M902 2V8JA 3GTJI 5D1OA 1ZB9A 1RO0A 3J7A4 4X6AI 3S1MI 3EERA 4RVHA 5A2Qb 3GTGI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QTT A;  2DE5 A;  3S15 I;  2JS4 A;  2E2J I;  1VLA A;  3VB9 A;  4A3I I;  1RLY A;  1I50 I;  2RBL A;  4BBS I;  4A3L I;  5C3E I;  4Y52 I;  4NBC A;  1TWA I;  3LUS A;  2P3Y A;  2JA8 I;  4NBF A;  2JA7 I;  4NB8 A;  1Y1W I;  4NBB A;  5C4J I;  3HOY I;  5C4X I;  3GTK I;  1USP A;  2E2I I;  5IP7 I;  3S16 I;  1RO4 A;  2R92 I;  3ESW A;  1LQL A;  5C44 I;  3U50 C;  2PK7 A;  2NVQ I;  4A3D I;  3GTP I;  1USP B;  2HF1 A;  2K5R A;  3HOW I;  3S1R I;  4A3E I;  1ML8 A;  4BXX I;  4XX2 A;  4MH4 A;  5IP9 I;  1I6H I;  3VMG A;  1WW9 A;  2NVY I;  4Y7N I;  3CQZ I;  4QTU A;  3S2D I;  3H3V J;  3PO3 I;  1YUA A;  4NBH A;  4NOZ A;  1I3Q I;  2YU9 I;  4A3C I;  1R9T I;  4A3B I;  2JA5 I;  1ZB8 A;  3GKQ A;  4A3M I;  1X3Z A;  3PO3 S;  2NVX I;  1X3W A;  2DE7 A;  3VMI A;  1N2F A;  2KPI A;  2F4M A;  3I07 A;  4A3G I;  4BBR I;  3I4N I;  4BY7 I;  2R93 I;  1PFT A;  2AKL A;  3PO2 I;  2JNY A;  4BY1 I;  4NBG A;  1NUI A;  3HOZ I;  1TFI A;  3GTM I;  4NBA A;  1TWG I;  3RZO I;  4NBE A;  3GCF A;  4NB9 A;  2BJO A;  1SFO I;  3S1N I;  1TWH I;  1L1O C;  3Q87 A;  2JA6 I;  2J6A A;  3H0G I;  3M4O I;  3GTQ I;  1WCM I;  3GTM S;  3VMH A;  3GTO I;  1Y1V I;  2R7Z I;  3S2H I;  3S1Q I;  3HOV I;  3FKI I;  5FLM I;  1TWC I;  1QYP A;  1TWF I;  4A3K I;  1DL6 A;  2F4O A;  3S17 I;  1Y1V S;  3GTL I;  4A3J I;  2DE6 A;  4A3F I;  3M3Y I;  1K83 I;  3HOU I;  5CM2 M;  3K7A I;  3RZD I;  2E2H I;  3GTJ I;  3I4M I;  3HOX I;  2NVT I;  2VUM I;  3S14 I;  4A93 I;  2B63 I;  1ZB9 A;  4NBD A;  4X6A I;  3S1M I;  3EER A;  3D6W A;  2JR6 A;  3GTG I; 
#chains in the Genus database with same CATH topology
 2QKD A;  2O4H A;  1RLY A;  3CCM Z;  4BBS I;  4TNU A;  1YHQ 1;  1KRL A;  3CME Z;  3CCL 1;  2VPX A;  3LUS A;  3NFZ A;  4E31 A;  3JAM b;  1USP A;  2E7Z A;  3CCU Z;  2E2I I;  2G2K A;  1QXF A;  1YUK A;  2PK7 A;  2NVQ I;  3CMA 1;  2IZ4 A;  2HF1 A;  3HOW I;  2JUB A;  1RO2 A;  1ML8 A;  1VQO Z;  3G6E 1;  3BG0 B;  1I6H I;  3G71 1;  2NVY I;  2VPW A;  3J80 f;  1KD1 1;  1YJW 1;  1K9M 2;  2OTJ Z;  1YIJ 1;  1YUA A;  4NOZ A;  1R9T I;  3JAM f;  4E32 A;  3CCV 1;  3GKQ A;  2VF1 A;  1P9N A;  4MD7 A;  3PO3 S;  5LL6 f;  1S72 Z;  2NAP A;  2RIQ A;  4A3G I;  5T67 A;  1VQL Z;  2JIR A;  2AYD A;  1KQS Y;  1S7M A;  3CCE Z;  3GTM I;  3NH5 A;  3D2L A;  4NFR A;  3Q87 A;  2WAQ A;  3GTQ I;  1Z01 A;  3VMH A;  3GTO I;  1YJW Z;  1VQ7 1;  1QYP A;  1VQM Z;  2F4O A;  3GTL I;  1K8A 1;  1K83 I;  3K7A I;  3RZD I;  3I4M I;  2Q51 A;  3S14 I;  3F3P C;  2K3R A;  3CCM 1;  3CCJ Z;  2QRD B;  4QTT A;  3NDJ A;  2DE5 A;  3CME 1;  3S15 I;  1YJN Z;  3F3F C;  4HH4 A;  3CXC Z;  1Y8C A;  3CCU 1;  2OOY B;  4NBC A;  1TWA I;  2PM9 A;  2P3Y A;  2JA8 I;  2JA7 I;  4NB8 A;  4MD8 A;  1M1K 1;  3NH8 A;  1QVG Y;  4E2Y A;  5IT9 b;  2GU2 A;  2R92 I;  1VQO 1;  3U50 C;  4RV9 A;  3EED A;  1VQ8 Z;  3S1R I;  4A3E I;  4DGL A;  2OTJ 1;  2V8K A;  3CC7 Z;  3MZK B;  1KD1 2;  3QWU A;  2IZ3 A;  2V8I A;  3CQZ I;  4QTU A;  3J81 b;  4NBH A;  2YU9 I;  1S72 1;  3I55 Z;  1VQL 1;  3CC4 Z;  5A2Q f;  2NVX I;  1X3W A;  3CCE 1;  2F4M A;  2HU9 A;  4RVF A;  1K73 1;  3I4N I;  3CD6 Z;  1QF8 A;  3IF8 A;  2AKL A;  4BY1 I;  4NBG A;  1NUI A;  3HOZ I;  1FDO A;  2QA4 Z;  1TFI A;  4NBA A;  3J81 f;  3RZO I;  1RQF A;  4NBE A;  4NB9 A;  1VQM 1;  2RHB A;  2JA6 I;  2J6A A;  3H0G I;  3GTM S;  2R7Z I;  3S2H I;  2M6N A;  3FKI I;  2OTL 1;  1VQ9 Z;  1TWF I;  1KQS Z;  2JIQ A;  1DL6 A;  3S17 I;  1K8A 2;  2DE6 A;  1WZN A;  3CCJ 1;  4A3F I;  1VQK Z;  3HOU I;  3IFU A;  1YJN 1;  1Q86 1;  3NH4 A;  1N8R 1;  4A93 I;  4AYB A;  2JR6 A;  3I56 Z;  5D1O B;  2JS4 A;  3D9X A;  5FLX b;  3CPW Y;  2E2J I;  3CCS Z;  4MON A;  1VLA A;  1YIT Z;  1FDI A;  3NDI A;  4A3L I;  4Y52 I;  1M1K 2;  2RT9 A;  3CC2 Z;  2QR1 B;  2OTL Z;  2E9H A;  2ZAE B;  4NBF A;  4E33 A;  1Y1W I;  1Q16 A;  2LIY A;  4NBB A;  3HOY I;  5C4X I;  1VQ8 1;  5IP7 I;  3S16 I;  3ESW A;  5C44 I;  3CC7 1;  2P28 A;  4A3D I;  2IV2 X;  3GTP I;  1USP B;  1Q81 1;  2QRE B;  2K5R A;  4CL1 A;  4BXX I;  4MH4 A;  3CCQ Z;  3G4S Z;  1QVG Z;  3I55 1;  1NJI 1;  1NP6 A;  2OZK A;  1VQ5 Z;  3CC4 1;  1VQN Z;  1I3Q I;  1W2B Y;  4A3B I;  2GTH A;  1SIW A;  2JIO A;  1VQP Z;  3CD6 1;  3MON A;  1Q82 1;  4A3M I;  1QVF Y;  1K73 2;  3VMI A;  2QA4 1;  2M48 A;  1JJ2 Y;  2RPR A;  3I07 A;  4BBR I;  2R93 I;  1Q7Y 1;  2WB1 A;  3OW2 Y;  2H85 A;  1TWG I;  2GTI A;  2QEX Z;  3FQQ A;  3IX0 A;  3GCF A;  3P5J B;  1VQ9 1;  1VQ6 Z;  2BJO A;  1KC8 2;  1SFO I;  2I3C A;  3S1N I;  1L1O C;  5IT9 f;  3M4O I;  1WCM I;  1Y1V I;  1YI2 Z;  3S1Q I;  3HOV I;  5FLM I;  1VQ4 Z;  2V45 A;  3TE5 B;  1VQK 1;  5T6B A;  2JIM A;  4RS4 A;  1WJ2 A;  3KIF A;  3J80 b;  1WII A;  3CCR Z;  1YJ9 Z;  4A3J I;  3M3Y I;  1Q86 2;  3I56 1;  1N8R 2;  2E2H I;  4DK1 A;  1RNI A;  2Y0S A;  3T4N B;  3HOX I;  2NVT I;  2VUM I;  3CCS 1;  1M90 1;  2B63 I;  1YIT 1;  4NBD A;  2LEX A;  2JIP A;  1KC8 1;  3D6W A;  1X0T A;  2JMO A;  3CC2 1;  4HGY A;  3VB9 A;  4A3I I;  1I50 I;  1AA6 A;  2YAD A;  2RBL A;  4MXU A;  4E2W A;  5C3E I;  5AN9 F;  4NH1 C;  2KI7 B;  5C4J I;  3GTK I;  3BG1 B;  1YHQ Z;  1RO4 A;  1ZH1 A;  3CPW Z;  1LQL A;  3VTN A;  2O53 A;  3CCQ 1;  3CCL Z;  4MRI A;  3G4S 1;  1Q81 2;  2QLV B;  4HGZ A;  4E30 A;  2W03 A;  3IR7 A;  1VQ5 1;  4E2Z A;  1VQN 1;  4XX2 A;  3MZL B;  5IP9 I;  1NJI 2;  3VMG A;  1WW9 A;  3CMA Z;  2OOX B;  4Y7N I;  1VQP 1;  1JWH C;  4RVD A;  3S2D I;  3H3V J;  3PO3 I;  4A3C I;  3G6E Z;  3TDH B;  1K9M 1;  3G71 Z;  1Q82 2;  3KIH A;  2JA5 I;  1ZB8 A;  1X3Z A;  2EGT A;  1YIJ Z;  2DE7 A;  1N2F A;  2KPI A;  4MD9 A;  5FLX f;  2QEX 1;  1Q7Y 2;  1Z02 A;  4BY7 I;  4RVG A;  1VQ6 1;  1PFT A;  3CCV Z;  3PO2 I;  2JNY A;  1W2B Z;  5D1P A;  1YI2 1;  1VQ4 1;  4EWC A;  1QVF Z;  1Z03 A;  1TWH I;  1JJ2 Z;  2R6M A;  2W04 A;  5T64 A;  3CCR 1;  1YJ9 1;  3FQM A;  4DQY B;  2V3V A;  1TWC I;  2LFU A;  4S1T A;  3OW2 Z;  2QRC B;  4E2X A;  4A3K I;  2VPZ A;  1Y1V S;  2VUG A;  2Q4Z A;  3HKZ A;  1VQ7 Z;  2PMZ A;  3CXC Y;  5CM2 M;  1M90 2;  2V8J A;  3GTJ I;  5D1O A;  1ZB9 A;  1RO0 A;  2VPY A;  3J7A 4;  4X6A I;  3S1M I;  3EER A;  4RVH A;  5A2Q b;  3GTG I; 
#chains in the Genus database with same CATH homology
 2QKD A;  2O4H A;  1RLY A;  3CCM Z;  4BBS I;  4TNU A;  1YHQ 1;  1KRL A;  3CME Z;  3CCL 1;  3LUS A;  3NFZ A;  4E31 A;  3JAM b;  1USP A;  3CCU Z;  2E2I I;  2G2K A;  1YUK A;  2PK7 A;  2NVQ I;  3CMA 1;  2IZ4 A;  2HF1 A;  3HOW I;  2JUB A;  1RO2 A;  1ML8 A;  1VQO Z;  3G6E 1;  3BG0 B;  1I6H I;  3G71 1;  2NVY I;  3J80 f;  1KD1 1;  1YJW 1;  1K9M 2;  2OTJ Z;  1YIJ 1;  1YUA A;  4NOZ A;  1R9T I;  3JAM f;  4E32 A;  3CCV 1;  3GKQ A;  2VF1 A;  1P9N A;  4MD7 A;  3PO3 S;  5LL6 f;  1S72 Z;  2RIQ A;  4A3G I;  5T67 A;  1VQL Z;  1KQS Y;  1S7M A;  3CCE Z;  3GTM I;  3NH5 A;  4NFR A;  3Q87 A;  2WAQ A;  3GTQ I;  1Z01 A;  3VMH A;  3GTO I;  1YJW Z;  1VQ7 1;  1QYP A;  1VQM Z;  2F4O A;  3GTL I;  1K8A 1;  1K83 I;  3K7A I;  3RZD I;  3I4M I;  2Q51 A;  3S14 I;  3F3P C;  2K3R A;  3CCM 1;  3CCJ Z;  2QRD B;  4QTT A;  3NDJ A;  2DE5 A;  3CME 1;  3S15 I;  1YJN Z;  3F3F C;  4HH4 A;  3CXC Z;  3CCU 1;  2OOY B;  4NBC A;  1TWA I;  2PM9 A;  2P3Y A;  2JA8 I;  2JA7 I;  4NB8 A;  4MD8 A;  1M1K 1;  3NH8 A;  1QVG Y;  4E2Y A;  5IT9 b;  2GU2 A;  2R92 I;  1VQO 1;  3U50 C;  4RV9 A;  3EED A;  1VQ8 Z;  3S1R I;  4A3E I;  4DGL A;  2OTJ 1;  2V8K A;  3CC7 Z;  3MZK B;  1KD1 2;  3QWU A;  2IZ3 A;  2V8I A;  3CQZ I;  4QTU A;  3J81 b;  4NBH A;  2YU9 I;  1S72 1;  3I55 Z;  1VQL 1;  3CC4 Z;  5A2Q f;  2NVX I;  1X3W A;  3CCE 1;  2F4M A;  2HU9 A;  4RVF A;  1K73 1;  3I4N I;  3CD6 Z;  1QF8 A;  3IF8 A;  2AKL A;  4BY1 I;  4NBG A;  1NUI A;  3HOZ I;  2QA4 Z;  1TFI A;  4NBA A;  3J81 f;  3RZO I;  1RQF A;  4NBE A;  4NB9 A;  1VQM 1;  2RHB A;  2JA6 I;  2J6A A;  3H0G I;  3GTM S;  2R7Z I;  3S2H I;  2M6N A;  3FKI I;  2OTL 1;  1VQ9 Z;  1TWF I;  1KQS Z;  1DL6 A;  3S17 I;  1K8A 2;  2DE6 A;  4A3F I;  3CCJ 1;  1VQK Z;  3HOU I;  3IFU A;  1YJN 1;  1Q86 1;  3NH4 A;  1N8R 1;  4A93 I;  4AYB A;  2JR6 A;  3I56 Z;  5D1O B;  2JS4 A;  3D9X A;  5FLX b;  3CPW Y;  2E2J I;  3CCS Z;  4MON A;  1VLA A;  1YIT Z;  3NDI A;  4A3L I;  4Y52 I;  1M1K 2;  2RT9 A;  3CC2 Z;  2QR1 B;  2OTL Z;  2E9H A;  2ZAE B;  4NBF A;  4E33 A;  1Y1W I;  2LIY A;  4NBB A;  3HOY I;  5C4X I;  1VQ8 1;  5IP7 I;  3S16 I;  3ESW A;  5C44 I;  3CC7 1;  2P28 A;  4A3D I;  3GTP I;  1USP B;  1Q81 1;  2QRE B;  2K5R A;  4CL1 A;  4BXX I;  4MH4 A;  3CCQ Z;  3G4S Z;  1QVG Z;  3I55 1;  1NJI 1;  1NP6 A;  2OZK A;  1VQ5 Z;  3CC4 1;  1VQN Z;  1I3Q I;  1W2B Y;  4A3B I;  2GTH A;  1VQP Z;  3CD6 1;  3MON A;  1Q82 1;  4A3M I;  1QVF Y;  1K73 2;  3VMI A;  2QA4 1;  2M48 A;  1JJ2 Y;  2RPR A;  3I07 A;  4BBR I;  2R93 I;  1Q7Y 1;  2WB1 A;  3OW2 Y;  2H85 A;  1TWG I;  2GTI A;  2QEX Z;  3FQQ A;  3IX0 A;  3GCF A;  3P5J B;  1VQ9 1;  1VQ6 Z;  2BJO A;  1KC8 2;  1SFO I;  2I3C A;  3S1N I;  1L1O C;  5IT9 f;  3M4O I;  1WCM I;  1Y1V I;  1YI2 Z;  3S1Q I;  3HOV I;  5FLM I;  1VQ4 Z;  3TE5 B;  1VQK 1;  5T6B A;  4RS4 A;  3KIF A;  3J80 b;  1WII A;  3CCR Z;  1YJ9 Z;  4A3J I;  3M3Y I;  1Q86 2;  3I56 1;  1N8R 2;  2E2H I;  4DK1 A;  1RNI A;  2Y0S A;  3T4N B;  3HOX I;  2NVT I;  2VUM I;  3CCS 1;  1M90 1;  2B63 I;  1YIT 1;  4NBD A;  1KC8 1;  3D6W A;  1X0T A;  2JMO A;  3CC2 1;  4HGY A;  3VB9 A;  4A3I I;  1I50 I;  2YAD A;  2RBL A;  4MXU A;  4E2W A;  5C3E I;  5AN9 F;  4NH1 C;  2KI7 B;  5C4J I;  3GTK I;  3BG1 B;  1YHQ Z;  1RO4 A;  1ZH1 A;  3CPW Z;  1LQL A;  3VTN A;  2O53 A;  3CCQ 1;  3CCL Z;  4MRI A;  3G4S 1;  1Q81 2;  2QLV B;  4HGZ A;  4E30 A;  2W03 A;  1VQ5 1;  4E2Z A;  1VQN 1;  4XX2 A;  3MZL B;  5IP9 I;  1NJI 2;  3VMG A;  1WW9 A;  3CMA Z;  2OOX B;  4Y7N I;  1VQP 1;  1JWH C;  4RVD A;  3S2D I;  3H3V J;  3PO3 I;  4A3C I;  3G6E Z;  3TDH B;  1K9M 1;  3G71 Z;  1Q82 2;  3KIH A;  2JA5 I;  1ZB8 A;  1X3Z A;  2EGT A;  1YIJ Z;  2DE7 A;  1N2F A;  2KPI A;  4MD9 A;  5FLX f;  2QEX 1;  1Q7Y 2;  1Z02 A;  4BY7 I;  4RVG A;  1VQ6 1;  1PFT A;  3CCV Z;  3PO2 I;  2JNY A;  1W2B Z;  5D1P A;  1YI2 1;  1VQ4 1;  4EWC A;  1QVF Z;  1Z03 A;  1TWH I;  1JJ2 Z;  2R6M A;  2W04 A;  5T64 A;  3CCR 1;  1YJ9 1;  3FQM A;  4DQY B;  1TWC I;  2LFU A;  4S1T A;  3OW2 Z;  2QRC B;  4E2X A;  4A3K I;  1Y1V S;  2VUG A;  2Q4Z A;  3HKZ A;  1VQ7 Z;  2PMZ A;  3CXC Y;  5CM2 M;  1M90 2;  2V8J A;  3GTJ I;  5D1O A;  1ZB9 A;  1RO0 A;  3J7A 4;  4X6A I;  3S1M I;  3EER A;  4RVH A;  5A2Q b;  3GTG I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...