1S721

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1s72100
1YIJ1 1VQO1 1W2BY 1Q821 1Q822 1VQ8Z 1VQ6Z 3CXCY 3CCQ1 3CCS1 3G71Z 2QA41 1VQ41 1YHQZ 1NJI1 1QVFY 1KC81 1YJNZ 1QVFZ 1VQ91 1KD11 3CC7Z 1VQ5Z 3CCR1 1K8A1 3G4SZ 1VQMZ 1S721 3CCMZ 1Q862 3CCVZ 1N8R2 1VQL1 3I55Z 1VQN1 1YI2Z 1YIJZ 1VQOZ 1VQ7Z 3CC41 3CCL1 2OTJ1 1M901 3CCQZ 3CCSZ 1NJI2 1KC82 1M1K1 1Q811 1QVGZ 1M1K2 3CD6Z 3I561 1VQP1 1VQK1 3G6EZ 1KD12 1K731 1K8A2 1JJ2Z 3CCE1 3CCRZ 1S72Z 2OTLZ 3CMAZ 1VQLZ 1YJN1 1YJ9Z 3OW2Y 1VQNZ 3OW2Z 3CCU1 1YIT1 2QEX1 1VQ51 1Q7Y1 1M902 3CC4Z 2QA4Z 1QVGY 1VQM1 3CME1 1VQ4Z 1K9M1 3CCLZ 2OTJZ 1YJW1 1Q812 3CCJ1 3CC21 1KQSZ 1VQ9Z 1VQKZ 1JJ2Y 3CPWZ 1K732 1VQ81 1VQ61 1VQ71 1W2BZ 3G711 1YHQ1 3CCEZ 3CXCZ 3CD61 3G6E1 3CC71 3CCUZ 1YITZ 1Q7Y2 3G4S1 2QEXZ 3CCM1 1K9M2 3CCV1 1KQSY 3CMEZ 3I551 1Q861 2OTL1 1N8R1 1YJWZ 3CMA1 3I56Z 3CCJZ 1VQPZ 1YI21 3CPWY 3CC2Z 1YJ91
chains in the Genus database with same CATH superfamily
4DK1A 3GCFA 3TE5B 3CCQ1 3BG0B 1PFTA 4E2XA 1Y1VS 2BJOA 4MD9A 1KC81 3D2LA 4NB8A 1SFOI 3GKQA 2EGTA 3ESWA 4A93I 1QYPA 4A3MI 3IX0A 5LL6f 3G4SZ 3CCMZ 3IF8A 2OOYB 1N8R2 4E2YA 4NH1C 2QR1B 1VQN1 2NVTI 4NOZA 3P5JB 3IR7A 2VPZA 1LQLA 1I6HI 4NBBA 4BY1I 2K3RA 2LIYA 3GTJI 2OZKA 1QXFA 1Q811 2PK7A 5FLXf 4MD8A 1AA6A 1Y1VI 3GTLI 3FQMA 2JIOA 5AN9F 2HU9A 3CMAZ 2NAPA 2R7ZI 2V45A 2WAQA 1NP6A 2O4HA 3CCU1 2PMZA 1Q7Y1 3CC4Z 3VMHA 1P9NA 1L1OC 3CME1 1K9M1 2OTJZ 4NBDA 1KQSZ 3HOYI 3HOWI 2QRDB 4MONA 1W2BZ 2R6MA 5FLXb 2ZAEB 1WIIA 2Q51A 3S2HI 3CCEZ 3PO2I 3CXCZ 1Y8CA 3U50C 1SIWA 3G6E1 4E2ZA 5D1PA 4E33A 1JWHC 3TDHB 3G4S1 3CCM1 2JIMA 5IT9b 1KQSY 3RZOI 4BBSI 2OTL1 1N8R1 2RIQA 4A3EI 1YJ91 2AKLA 1W2BY 1Q821 1TWGI 1VQ8Z 4A3BI 3CXCY 3NH4A 4NBHA 3MONA 2NVYI 4A3CI 1RO0A 5C4XI 2G2KA 4MD7A 3CC7Z 4A3GI 3I4NI 1Q862 4Y52I 1WCMI 2GTHA 5D1OA 4NBCA 2HF1A 1VQOZ 3VB9A 2VUMI 2F4MA 3I07A 3GTGI 3CC41 2OTJ1 2E2HI 4E2WA 5A2Qf 3CCSZ 3NH8A 2QRCB 4RVHA 3MZLB 1M1K1 1QVGZ 2E9HA 2F4OA 1Z01A 2RBLA 5IP9I 3G6EZ 4DGLA 1K8A2 3CCE1 3GTMS 2JIQA 1S72Z 4HGYA 2OTLZ 3J81f 1YJ9Z 3GTPI 4HH4A 3GTOI 1RQFA 1USPB 2QKDA 2VF1A 3HOVI 2PM9A 1VQ51 1M902 1QVGY 3CCLZ 4BBRI 2JUBA 4HGZA 3GTKI 1WW9A 1QF8A 1K83I 1VQKZ 3CPWZ 1VQ81 1VQ71 2Y0SA 3M3YI 4QTUA 5C4JI 3J7A4 1ZB9A 1N2FA 2JA6I 2JIPA 3NDJA 3K7AI 4RVDA 4DQYB 3GTMI 3CC71 3VMGA 1Z03A 1YITZ 4A3II 2QEXZ 2GU2A 1KRLA 2JMOA 4NBFA 1Q861 4MXUA 3CPWY 2YU9I 2WB1A 1TWHI 2GTIA 1VQO1 2P3YA 3PO3S 1VQ6Z 2DE7A 3FQQA 2M6NA 3CCS1 1VQ41 4RVFA 3BG1B 1YHQZ 3F3FC 1QVFY 2E2II 1VQ91 2RPRA 4MRIA 1YUKA 3S1QI 1VQ5Z 3IFUA 2VUGA 1K8A1 2NVXI 1S721 3HKZA 1ZB8A 1TWFI 4NB9A 5T6BA 1TWCI 3J80f 3CCVZ 3I55Z 4MH4A 1YI2Z 5T64A 1RO2A 1YIJZ 1WJ2A 3JAMf 4A3FI 1R9TI 1X3WA 1VQ7Z 2JA8I 1USPA 4S1TA 3CCL1 1M901 1NJI2 2Q4ZA 2OOXB 3NDIA 3PO3I 2LEXA 4BXXI 1VQK1 3S15I 1KD12 3CQZI 1JJ2Z 3CCRZ 3D9XA 2VPXA 1VQLZ 2R92I 1VLAA 1YJN1 3OW2Y 2AYDA 1DL6A 1YIT1 3J80b 2W03A 2QLVB 4E31A 2QEX1 2M48A 3KIFA 2VPWA 1VQM1 1VQ4Z 3VMIA 2JR6A 4X6AI 3JAMb 3GTQI 2JNYA 2V8JA 2RHBA 3S1NI 1VQ9Z 3M4OI 1JJ2Y 1K732 1VQ61 3EEDA 2LFUA 2J6AA 4QTTA 3NH5A 1YHQ1 1RO4A 1WZNA 1RNIA 4CL1A 3CD61 3T4NB 5FLMI 1FDIA 2P28A 3CCV1 1FDOA 3NFZA 3H0GI 4RV9A 3I551 4A3LI 1YJWZ 2E7ZA 4A3DI 1YI21 3CCJZ 2DE5A 3CC2Z 4NBEA 5A2Qb 1YIJ1 4RS4A 1Q822 3Q87A 3G71Z 2QA41 3D6WA 1NJI1 1YJNZ 1QVFZ 2V8KA 2IV2X 2V8IA 5T67A 3J81b 1KD11 3QWUA 3VTNA 2H85A 3CCR1 4AYBA 1VQMZ 2KPIA 2RT9A 4TNUA 1Y1WI 1VQL1 4A3JI 1X3ZA 5D1OB 2K5RA 3S1MI 5IT9f 2IZ4A 4E30A 5IP7I 1Q16A 3S14I 3S16I 4NBGA 3CCQZ 5C3EI 1KC82 1YUAA 3LUSA 1M1K2 3CD6Z 3I4MI 3I561 1VQP1 1X0TA 2W04A 2QREB 3S1RI 2YADA 2VPYA 1K731 3F3PC 1ML8A 3EERA 1TFIA 4NFRA 2IZ3A 2JA7I 1NUIA 4BY7I 5CM2M 1ZH1A 4Y7NI 4NBAA 2NVQI 5C44I 1VQNZ 2V3VA 3OW2Z 2KI7B 1I3QI 3RZDI 4EWCA 3MZKB 2QA4Z 3HOUI 1TWAI 1YJW1 1Q812 2B63I 3CCJ1 4E32A 4A3KI 1Z02A 3CC21 3HOXI 4RVGA 3G711 2R93I 2O53A 3S2DI 2DE6A 3KIHA 1RLYA 2E2JI 1S7MA 3HOZI 3FKII 3H3VJ 2I3CA 2JS4A 3CCUZ 1Q7Y2 1K9M2 3S17I 3CMEZ 3CMA1 2JIRA 3I56Z 4XX2A 1I50I 1VQPZ 2JA5I
chains in the Genus database with same CATH topology
4DK1A 3GCFA 3TE5B 3CCQ1 3BG0B 1PFTA 4E2XA 1Y1VS 2BJOA 4MD9A 1KC81 4NB8A 1SFOI 3GKQA 2EGTA 3ESWA 4A93I 1QYPA 4A3MI 3IX0A 5LL6f 3G4SZ 3CCMZ 3IF8A 2OOYB 1N8R2 4E2YA 4NH1C 2QR1B 1VQN1 2NVTI 4NOZA 3P5JB 1LQLA 1I6HI 4NBBA 4BY1I 2K3RA 2LIYA 3GTJI 2OZKA 1Q811 2PK7A 5FLXf 4MD8A 1Y1VI 3GTLI 3FQMA 5AN9F 2HU9A 3CMAZ 2R7ZI 2WAQA 1NP6A 2O4HA 3CCU1 2PMZA 1Q7Y1 3CC4Z 3VMHA 1P9NA 1L1OC 3CME1 1K9M1 2OTJZ 4NBDA 1KQSZ 3HOYI 3HOWI 2QRDB 4MONA 1W2BZ 2R6MA 5FLXb 2ZAEB 1WIIA 2Q51A 3S2HI 3CCEZ 3PO2I 3CXCZ 3U50C 3G6E1 4E2ZA 5D1PA 4E33A 1JWHC 3TDHB 3G4S1 3CCM1 5IT9b 1KQSY 3RZOI 4BBSI 2OTL1 1N8R1 2RIQA 4A3EI 1YJ91 2AKLA 1W2BY 1Q821 1TWGI 1VQ8Z 4A3BI 3CXCY 3NH4A 4NBHA 3MONA 2NVYI 4A3CI 1RO0A 5C4XI 2G2KA 4MD7A 3CC7Z 4A3GI 3I4NI 1Q862 4Y52I 1WCMI 2GTHA 5D1OA 4NBCA 2HF1A 1VQOZ 3VB9A 2VUMI 2F4MA 3I07A 3GTGI 3CC41 2OTJ1 2E2HI 4E2WA 5A2Qf 3CCSZ 3NH8A 2QRCB 4RVHA 3MZLB 1M1K1 1QVGZ 2E9HA 2F4OA 1Z01A 2RBLA 5IP9I 3G6EZ 4DGLA 1K8A2 3CCE1 3GTMS 1S72Z 4HGYA 2OTLZ 3J81f 1YJ9Z 3GTPI 4HH4A 3GTOI 1RQFA 1USPB 2QKDA 2VF1A 3HOVI 2PM9A 1VQ51 1M902 1QVGY 3CCLZ 4BBRI 2JUBA 4HGZA 3GTKI 1WW9A 1QF8A 1K83I 1VQKZ 3CPWZ 1VQ81 1VQ71 2Y0SA 3M3YI 4QTUA 5C4JI 3J7A4 1ZB9A 1N2FA 2JA6I 3NDJA 3K7AI 4RVDA 4DQYB 3GTMI 3CC71 3VMGA 1Z03A 1YITZ 4A3II 2QEXZ 2GU2A 1KRLA 2JMOA 4NBFA 1Q861 4MXUA 3CPWY 2YU9I 2WB1A 1TWHI 2GTIA 1VQO1 2P3YA 3PO3S 1VQ6Z 2DE7A 3FQQA 2M6NA 3CCS1 1VQ41 4RVFA 3BG1B 1YHQZ 3F3FC 1QVFY 2E2II 1VQ91 2RPRA 4MRIA 1YUKA 3S1QI 1VQ5Z 3IFUA 2VUGA 1K8A1 2NVXI 1S721 3HKZA 1ZB8A 1TWFI 4NB9A 5T6BA 1TWCI 3J80f 3CCVZ 3I55Z 4MH4A 1YI2Z 5T64A 1RO2A 1YIJZ 4A3FI 3JAMf 1R9TI 1X3WA 1VQ7Z 2JA8I 1USPA 4S1TA 3CCL1 1M901 1NJI2 2Q4ZA 2OOXB 3NDIA 3PO3I 4BXXI 1VQK1 3S15I 1KD12 3CQZI 1JJ2Z 3CCRZ 3D9XA 1VQLZ 2R92I 1VLAA 1YJN1 3OW2Y 1DL6A 1YIT1 3J80b 2W03A 2QLVB 4E31A 2QEX1 2M48A 3KIFA 1VQM1 1VQ4Z 3VMIA 2JR6A 4X6AI 3JAMb 3GTQI 2JNYA 2V8JA 2RHBA 3S1NI 1VQ9Z 3M4OI 1JJ2Y 1K732 1VQ61 3EEDA 2LFUA 2J6AA 4QTTA 3NH5A 1YHQ1 1RO4A 1RNIA 4CL1A 3CD61 3T4NB 5FLMI 2P28A 3CCV1 3NFZA 3H0GI 4RV9A 3I551 4A3LI 1YJWZ 4A3DI 1YI21 3CCJZ 2DE5A 3CC2Z 4NBEA 5A2Qb 1YIJ1 4RS4A 1Q822 3Q87A 3G71Z 2QA41 3D6WA 1NJI1 1YJNZ 1QVFZ 2V8KA 2V8IA 5T67A 3J81b 1KD11 3QWUA 3VTNA 2H85A 3CCR1 4AYBA 1VQMZ 2KPIA 2RT9A 4TNUA 1Y1WI 1VQL1 4A3JI 1X3ZA 5D1OB 2K5RA 3S1MI 5IT9f 2IZ4A 4E30A 5IP7I 3S14I 3S16I 4NBGA 3CCQZ 5C3EI 1KC82 1YUAA 3LUSA 1M1K2 3CD6Z 3I4MI 3I561 1VQP1 1X0TA 2W04A 2QREB 3S1RI 2YADA 1K731 3F3PC 1ML8A 3EERA 1TFIA 4NFRA 2IZ3A 2JA7I 1NUIA 4BY7I 5CM2M 1ZH1A 4Y7NI 4NBAA 2NVQI 5C44I 1VQNZ 3OW2Z 2KI7B 1I3QI 3RZDI 4EWCA 3MZKB 2QA4Z 3HOUI 1TWAI 1YJW1 1Q812 2B63I 3CCJ1 4E32A 4A3KI 1Z02A 3CC21 3HOXI 4RVGA 3G711 2R93I 2O53A 3S2DI 2DE6A 3KIHA 1RLYA 2E2JI 1S7MA 3HOZI 3FKII 3H3VJ 2I3CA 2JS4A 3CCUZ 1Q7Y2 1K9M2 3S17I 3CMEZ 3CMA1 3I56Z 4XX2A 1I50I 1VQPZ 2JA5I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ 1;  1VQO 1;  1W2B Y;  1Q82 1;  1Q82 2;  1VQ8 Z;  1VQ6 Z;  3CXC Y;  3CCQ 1;  3CCS 1;  3G71 Z;  2QA4 1;  1VQ4 1;  1YHQ Z;  1NJI 1;  1QVF Y;  1KC8 1;  1YJN Z;  1QVF Z;  1VQ9 1;  1KD1 1;  3CC7 Z;  1VQ5 Z;  3CCR 1;  1K8A 1;  3G4S Z;  1VQM Z;  1S72 1;  3CCM Z;  1Q86 2;  3CCV Z;  1N8R 2;  1VQL 1;  3I55 Z;  1VQN 1;  1YI2 Z;  1YIJ Z;  1VQO Z;  1VQ7 Z;  3CC4 1;  3CCL 1;  2OTJ 1;  1M90 1;  3CCQ Z;  3CCS Z;  1NJI 2;  1KC8 2;  1M1K 1;  1Q81 1;  1QVG Z;  1M1K 2;  3CD6 Z;  3I56 1;  1VQP 1;  1VQK 1;  3G6E Z;  1KD1 2;  1K73 1;  1K8A 2;  1JJ2 Z;  3CCE 1;  3CCR Z;  1S72 Z;  2OTL Z;  3CMA Z;  1VQL Z;  1YJN 1;  1YJ9 Z;  3OW2 Y;  1VQN Z;  3OW2 Z;  3CCU 1;  1YIT 1;  2QEX 1;  1VQ5 1;  1Q7Y 1;  1M90 2;  3CC4 Z;  2QA4 Z;  1QVG Y;  1VQM 1;  3CME 1;  1VQ4 Z;  1K9M 1;  3CCL Z;  2OTJ Z;  1YJW 1;  1Q81 2;  3CCJ 1;  3CC2 1;  1KQS Z;  1VQ9 Z;  1VQK Z;  1JJ2 Y;  3CPW Z;  1K73 2;  1VQ8 1;  1VQ6 1;  1VQ7 1;  1W2B Z;  3G71 1;  1YHQ 1;  3CCE Z;  3CXC Z;  3CD6 1;  3G6E 1;  3CC7 1;  3CCU Z;  1YIT Z;  1Q7Y 2;  3G4S 1;  2QEX Z;  3CCM 1;  1K9M 2;  3CCV 1;  1KQS Y;  3CME Z;  3I55 1;  1Q86 1;  2OTL 1;  1N8R 1;  1YJW Z;  3CMA 1;  3I56 Z;  3CCJ Z;  1VQP Z;  1YI2 1;  3CPW Y;  3CC2 Z;  1YJ9 1; 
#chains in the Genus database with same CATH topology
 4DK1 A;  3GCF A;  3TE5 B;  3CCQ 1;  3BG0 B;  1PFT A;  4E2X A;  1Y1V S;  2BJO A;  4MD9 A;  1KC8 1;  3D2L A;  4NB8 A;  1SFO I;  3GKQ A;  2EGT A;  3ESW A;  4A93 I;  1QYP A;  4A3M I;  3IX0 A;  5LL6 f;  3G4S Z;  3CCM Z;  3IF8 A;  2OOY B;  1N8R 2;  4E2Y A;  4NH1 C;  2QR1 B;  1VQN 1;  2NVT I;  4NOZ A;  3P5J B;  3IR7 A;  2VPZ A;  1LQL A;  1I6H I;  4NBB A;  4BY1 I;  2K3R A;  2LIY A;  3GTJ I;  2OZK A;  1QXF A;  1Q81 1;  2PK7 A;  5FLX f;  4MD8 A;  1AA6 A;  1Y1V I;  3GTL I;  3FQM A;  2JIO A;  5AN9 F;  2HU9 A;  3CMA Z;  2NAP A;  2R7Z I;  2V45 A;  2WAQ A;  1NP6 A;  2O4H A;  3CCU 1;  2PMZ A;  1Q7Y 1;  3CC4 Z;  3VMH A;  1P9N A;  1L1O C;  3CME 1;  1K9M 1;  2OTJ Z;  4NBD A;  1KQS Z;  3HOY I;  3HOW I;  2QRD B;  4MON A;  1W2B Z;  2R6M A;  5FLX b;  2ZAE B;  1WII A;  2Q51 A;  3S2H I;  3CCE Z;  3PO2 I;  3CXC Z;  1Y8C A;  3U50 C;  1SIW A;  3G6E 1;  4E2Z A;  5D1P A;  4E33 A;  1JWH C;  3TDH B;  3G4S 1;  3CCM 1;  2JIM A;  5IT9 b;  1KQS Y;  3RZO I;  4BBS I;  2OTL 1;  1N8R 1;  2RIQ A;  4A3E I;  1YJ9 1;  2AKL A;  1W2B Y;  1Q82 1;  1TWG I;  1VQ8 Z;  4A3B I;  3CXC Y;  3NH4 A;  4NBH A;  3MON A;  2NVY I;  4A3C I;  1RO0 A;  5C4X I;  2G2K A;  4MD7 A;  3CC7 Z;  4A3G I;  3I4N I;  1Q86 2;  4Y52 I;  1WCM I;  2GTH A;  5D1O A;  4NBC A;  2HF1 A;  1VQO Z;  3VB9 A;  2VUM I;  2F4M A;  3I07 A;  3GTG I;  3CC4 1;  2OTJ 1;  2E2H I;  4E2W A;  5A2Q f;  3CCS Z;  3NH8 A;  2QRC B;  4RVH A;  3MZL B;  1M1K 1;  1QVG Z;  2E9H A;  2F4O A;  1Z01 A;  2RBL A;  5IP9 I;  3G6E Z;  4DGL A;  1K8A 2;  3CCE 1;  3GTM S;  2JIQ A;  1S72 Z;  4HGY A;  2OTL Z;  3J81 f;  1YJ9 Z;  3GTP I;  4HH4 A;  3GTO I;  1RQF A;  1USP B;  2QKD A;  2VF1 A;  3HOV I;  2PM9 A;  1VQ5 1;  1M90 2;  1QVG Y;  3CCL Z;  4BBR I;  2JUB A;  4HGZ A;  3GTK I;  1WW9 A;  1QF8 A;  1K83 I;  1VQK Z;  3CPW Z;  1VQ8 1;  1VQ7 1;  2Y0S A;  3M3Y I;  4QTU A;  5C4J I;  3J7A 4;  1ZB9 A;  1N2F A;  2JA6 I;  2JIP A;  3NDJ A;  3K7A I;  4RVD A;  4DQY B;  3GTM I;  3CC7 1;  3VMG A;  1Z03 A;  1YIT Z;  4A3I I;  2QEX Z;  2GU2 A;  1KRL A;  2JMO A;  4NBF A;  1Q86 1;  4MXU A;  3CPW Y;  2YU9 I;  2WB1 A;  1TWH I;  2GTI A;  1VQO 1;  2P3Y A;  3PO3 S;  1VQ6 Z;  2DE7 A;  3FQQ A;  2M6N A;  3CCS 1;  1VQ4 1;  4RVF A;  3BG1 B;  1YHQ Z;  3F3F C;  1QVF Y;  2E2I I;  1VQ9 1;  2RPR A;  4MRI A;  1YUK A;  3S1Q I;  1VQ5 Z;  3IFU A;  2VUG A;  1K8A 1;  2NVX I;  1S72 1;  3HKZ A;  1ZB8 A;  1TWF I;  4NB9 A;  5T6B A;  1TWC I;  3J80 f;  3CCV Z;  3I55 Z;  4MH4 A;  1YI2 Z;  5T64 A;  1RO2 A;  1YIJ Z;  1WJ2 A;  3JAM f;  4A3F I;  1R9T I;  1X3W A;  1VQ7 Z;  2JA8 I;  1USP A;  4S1T A;  3CCL 1;  1M90 1;  1NJI 2;  2Q4Z A;  2OOX B;  3NDI A;  3PO3 I;  2LEX A;  4BXX I;  1VQK 1;  3S15 I;  1KD1 2;  3CQZ I;  1JJ2 Z;  3CCR Z;  3D9X A;  2VPX A;  1VQL Z;  2R92 I;  1VLA A;  1YJN 1;  3OW2 Y;  2AYD A;  1DL6 A;  1YIT 1;  3J80 b;  2W03 A;  2QLV B;  4E31 A;  2QEX 1;  2M48 A;  3KIF A;  2VPW A;  1VQM 1;  1VQ4 Z;  3VMI A;  2JR6 A;  4X6A I;  3JAM b;  3GTQ I;  2JNY A;  2V8J A;  2RHB A;  3S1N I;  1VQ9 Z;  3M4O I;  1JJ2 Y;  1K73 2;  1VQ6 1;  3EED A;  2LFU A;  2J6A A;  4QTT A;  3NH5 A;  1YHQ 1;  1RO4 A;  1WZN A;  1RNI A;  4CL1 A;  3CD6 1;  3T4N B;  5FLM I;  1FDI A;  2P28 A;  3CCV 1;  1FDO A;  3NFZ A;  3H0G I;  4RV9 A;  3I55 1;  4A3L I;  1YJW Z;  2E7Z A;  4A3D I;  1YI2 1;  3CCJ Z;  2DE5 A;  3CC2 Z;  4NBE A;  5A2Q b;  1YIJ 1;  4RS4 A;  1Q82 2;  3Q87 A;  3G71 Z;  2QA4 1;  3D6W A;  1NJI 1;  1YJN Z;  1QVF Z;  2V8K A;  2IV2 X;  2V8I A;  5T67 A;  3J81 b;  1KD1 1;  3QWU A;  3VTN A;  2H85 A;  3CCR 1;  4AYB A;  1VQM Z;  2KPI A;  2RT9 A;  4TNU A;  1Y1W I;  1VQL 1;  4A3J I;  1X3Z A;  5D1O B;  2K5R A;  3S1M I;  5IT9 f;  2IZ4 A;  4E30 A;  5IP7 I;  1Q16 A;  3S14 I;  3S16 I;  4NBG A;  3CCQ Z;  5C3E I;  1KC8 2;  1YUA A;  3LUS A;  1M1K 2;  3CD6 Z;  3I4M I;  3I56 1;  1VQP 1;  1X0T A;  2W04 A;  2QRE B;  3S1R I;  2YAD A;  2VPY A;  1K73 1;  3F3P C;  1ML8 A;  3EER A;  1TFI A;  4NFR A;  2IZ3 A;  2JA7 I;  1NUI A;  4BY7 I;  5CM2 M;  1ZH1 A;  4Y7N I;  4NBA A;  2NVQ I;  5C44 I;  1VQN Z;  2V3V A;  3OW2 Z;  2KI7 B;  1I3Q I;  3RZD I;  4EWC A;  3MZK B;  2QA4 Z;  3HOU I;  1TWA I;  1YJW 1;  1Q81 2;  2B63 I;  3CCJ 1;  4E32 A;  4A3K I;  1Z02 A;  3CC2 1;  3HOX I;  4RVG A;  3G71 1;  2R93 I;  2O53 A;  3S2D I;  2DE6 A;  3KIH A;  1RLY A;  2E2J I;  1S7M A;  3HOZ I;  3FKI I;  3H3V J;  2I3C A;  2JS4 A;  3CCU Z;  1Q7Y 2;  1K9M 2;  3S17 I;  3CME Z;  3CMA 1;  2JIR A;  3I56 Z;  4XX2 A;  1I50 I;  1VQP Z;  2JA5 I; 
#chains in the Genus database with same CATH homology
 4DK1 A;  3GCF A;  3TE5 B;  3CCQ 1;  3BG0 B;  1PFT A;  4E2X A;  1Y1V S;  2BJO A;  4MD9 A;  1KC8 1;  4NB8 A;  1SFO I;  3GKQ A;  2EGT A;  3ESW A;  4A93 I;  1QYP A;  4A3M I;  3IX0 A;  5LL6 f;  3G4S Z;  3CCM Z;  3IF8 A;  2OOY B;  1N8R 2;  4E2Y A;  4NH1 C;  2QR1 B;  1VQN 1;  2NVT I;  4NOZ A;  3P5J B;  1LQL A;  1I6H I;  4NBB A;  4BY1 I;  2K3R A;  2LIY A;  3GTJ I;  2OZK A;  1Q81 1;  2PK7 A;  5FLX f;  4MD8 A;  1Y1V I;  3GTL I;  3FQM A;  5AN9 F;  2HU9 A;  3CMA Z;  2R7Z I;  2WAQ A;  1NP6 A;  2O4H A;  3CCU 1;  2PMZ A;  1Q7Y 1;  3CC4 Z;  3VMH A;  1P9N A;  1L1O C;  3CME 1;  1K9M 1;  2OTJ Z;  4NBD A;  1KQS Z;  3HOY I;  3HOW I;  2QRD B;  4MON A;  1W2B Z;  2R6M A;  5FLX b;  2ZAE B;  1WII A;  2Q51 A;  3S2H I;  3CCE Z;  3PO2 I;  3CXC Z;  3U50 C;  3G6E 1;  4E2Z A;  5D1P A;  4E33 A;  1JWH C;  3TDH B;  3G4S 1;  3CCM 1;  5IT9 b;  1KQS Y;  3RZO I;  4BBS I;  2OTL 1;  1N8R 1;  2RIQ A;  4A3E I;  1YJ9 1;  2AKL A;  1W2B Y;  1Q82 1;  1TWG I;  1VQ8 Z;  4A3B I;  3CXC Y;  3NH4 A;  4NBH A;  3MON A;  2NVY I;  4A3C I;  1RO0 A;  5C4X I;  2G2K A;  4MD7 A;  3CC7 Z;  4A3G I;  3I4N I;  1Q86 2;  4Y52 I;  1WCM I;  2GTH A;  5D1O A;  4NBC A;  2HF1 A;  1VQO Z;  3VB9 A;  2VUM I;  2F4M A;  3I07 A;  3GTG I;  3CC4 1;  2OTJ 1;  2E2H I;  4E2W A;  5A2Q f;  3CCS Z;  3NH8 A;  2QRC B;  4RVH A;  3MZL B;  1M1K 1;  1QVG Z;  2E9H A;  2F4O A;  1Z01 A;  2RBL A;  5IP9 I;  3G6E Z;  4DGL A;  1K8A 2;  3CCE 1;  3GTM S;  1S72 Z;  4HGY A;  2OTL Z;  3J81 f;  1YJ9 Z;  3GTP I;  4HH4 A;  3GTO I;  1RQF A;  1USP B;  2QKD A;  2VF1 A;  3HOV I;  2PM9 A;  1VQ5 1;  1M90 2;  1QVG Y;  3CCL Z;  4BBR I;  2JUB A;  4HGZ A;  3GTK I;  1WW9 A;  1QF8 A;  1K83 I;  1VQK Z;  3CPW Z;  1VQ8 1;  1VQ7 1;  2Y0S A;  3M3Y I;  4QTU A;  5C4J I;  3J7A 4;  1ZB9 A;  1N2F A;  2JA6 I;  3NDJ A;  3K7A I;  4RVD A;  4DQY B;  3GTM I;  3CC7 1;  3VMG A;  1Z03 A;  1YIT Z;  4A3I I;  2QEX Z;  2GU2 A;  1KRL A;  2JMO A;  4NBF A;  1Q86 1;  4MXU A;  3CPW Y;  2YU9 I;  2WB1 A;  1TWH I;  2GTI A;  1VQO 1;  2P3Y A;  3PO3 S;  1VQ6 Z;  2DE7 A;  3FQQ A;  2M6N A;  3CCS 1;  1VQ4 1;  4RVF A;  3BG1 B;  1YHQ Z;  3F3F C;  1QVF Y;  2E2I I;  1VQ9 1;  2RPR A;  4MRI A;  1YUK A;  3S1Q I;  1VQ5 Z;  3IFU A;  2VUG A;  1K8A 1;  2NVX I;  1S72 1;  3HKZ A;  1ZB8 A;  1TWF I;  4NB9 A;  5T6B A;  1TWC I;  3J80 f;  3CCV Z;  3I55 Z;  4MH4 A;  1YI2 Z;  5T64 A;  1RO2 A;  1YIJ Z;  4A3F I;  3JAM f;  1R9T I;  1X3W A;  1VQ7 Z;  2JA8 I;  1USP A;  4S1T A;  3CCL 1;  1M90 1;  1NJI 2;  2Q4Z A;  2OOX B;  3NDI A;  3PO3 I;  4BXX I;  1VQK 1;  3S15 I;  1KD1 2;  3CQZ I;  1JJ2 Z;  3CCR Z;  3D9X A;  1VQL Z;  2R92 I;  1VLA A;  1YJN 1;  3OW2 Y;  1DL6 A;  1YIT 1;  3J80 b;  2W03 A;  2QLV B;  4E31 A;  2QEX 1;  2M48 A;  3KIF A;  1VQM 1;  1VQ4 Z;  3VMI A;  2JR6 A;  4X6A I;  3JAM b;  3GTQ I;  2JNY A;  2V8J A;  2RHB A;  3S1N I;  1VQ9 Z;  3M4O I;  1JJ2 Y;  1K73 2;  1VQ6 1;  3EED A;  2LFU A;  2J6A A;  4QTT A;  3NH5 A;  1YHQ 1;  1RO4 A;  1RNI A;  4CL1 A;  3CD6 1;  3T4N B;  5FLM I;  2P28 A;  3CCV 1;  3NFZ A;  3H0G I;  4RV9 A;  3I55 1;  4A3L I;  1YJW Z;  4A3D I;  1YI2 1;  3CCJ Z;  2DE5 A;  3CC2 Z;  4NBE A;  5A2Q b;  1YIJ 1;  4RS4 A;  1Q82 2;  3Q87 A;  3G71 Z;  2QA4 1;  3D6W A;  1NJI 1;  1YJN Z;  1QVF Z;  2V8K A;  2V8I A;  5T67 A;  3J81 b;  1KD1 1;  3QWU A;  3VTN A;  2H85 A;  3CCR 1;  4AYB A;  1VQM Z;  2KPI A;  2RT9 A;  4TNU A;  1Y1W I;  1VQL 1;  4A3J I;  1X3Z A;  5D1O B;  2K5R A;  3S1M I;  5IT9 f;  2IZ4 A;  4E30 A;  5IP7 I;  3S14 I;  3S16 I;  4NBG A;  3CCQ Z;  5C3E I;  1KC8 2;  1YUA A;  3LUS A;  1M1K 2;  3CD6 Z;  3I4M I;  3I56 1;  1VQP 1;  1X0T A;  2W04 A;  2QRE B;  3S1R I;  2YAD A;  1K73 1;  3F3P C;  1ML8 A;  3EER A;  1TFI A;  4NFR A;  2IZ3 A;  2JA7 I;  1NUI A;  4BY7 I;  5CM2 M;  1ZH1 A;  4Y7N I;  4NBA A;  2NVQ I;  5C44 I;  1VQN Z;  3OW2 Z;  2KI7 B;  1I3Q I;  3RZD I;  4EWC A;  3MZK B;  2QA4 Z;  3HOU I;  1TWA I;  1YJW 1;  1Q81 2;  2B63 I;  3CCJ 1;  4E32 A;  4A3K I;  1Z02 A;  3CC2 1;  3HOX I;  4RVG A;  3G71 1;  2R93 I;  2O53 A;  3S2D I;  2DE6 A;  3KIH A;  1RLY A;  2E2J I;  1S7M A;  3HOZ I;  3FKI I;  3H3V J;  2I3C A;  2JS4 A;  3CCU Z;  1Q7Y 2;  1K9M 2;  3S17 I;  3CME Z;  3CMA 1;  3I56 Z;  4XX2 A;  1I50 I;  1VQP Z;  2JA5 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...