1S721

Refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title The Roles of Ribosomal Proteins in the Structure, Assembly and Evolution of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1s72100
3G711 1M901 3CXCY 3CCU1 3CCE1 3CMAZ 3CD61 1M1K2 1YHQZ 3I56Z 3CCMZ 1Q862 1K9M1 1VQLZ 3CCSZ 1YJNZ 3G4SZ 1VQO1 3CPWZ 1W2BY 1KD12 1YJWZ 1M902 1YIJ1 3CXCZ 1K731 1K9M2 1VQ9Z 1VQ61 1JJ2Y 3CCRZ 1VQ7Z 1KD11 3I551 3CCJ1 1YIT1 3CCS1 1S721 1W2BZ 1K732 1VQN1 2OTJ1 1VQ51 1QVGY 1VQ41 1YJW1 1VQM1 1KQSY 1VQP1 2QEX1 3CCVZ 3CC71 1VQK1 2OTL1 2QA41 3CC21 1VQ71 1YI21 1QVFY 1QVGZ 3CCQZ 3CMA1 1KQSZ 3CC4Z 3CMEZ 1NJI1 1VQ8Z 1YHQ1 3I561 3CCM1 1VQL1 1YJN1 3G71Z 3G4S1 3CCUZ 3CCEZ 3CD6Z 1K8A1 3CCV1 3G6EZ 1Q7Y1 3OW2Y 1NJI2 1JJ2Z 1QVFZ 1VQOZ 1VQ91 3CCR1 3CCLZ 3CME1 1Q811 1K8A2 1YIJZ 1Q7Y2 1VQ6Z 1YJ9Z 3OW2Z 1N8R1 1KC81 3G6E1 3I55Z 3CCJZ 1YITZ 1Q812 1S72Z 1VQNZ 2OTJZ 1VQ5Z 1VQ4Z 1VQMZ 1Q821 1VQPZ 2QEXZ 3CCL1 1N8R2 1M1K1 1KC82 3CC7Z 1VQKZ 2OTLZ 1Q861 3CCQ1 2QA4Z 3CC2Z 3CC41 3CPWY 1YJ91 1VQ81 1Q822 1YI2Z
chains in the Genus database with same CATH superfamily
3CXCY 2GTHA 1M1K2 4EWCA 4A3JI 3CCSZ 3GTMI 2O53A 2F4MA 5IP7I 1KD12 1X3ZA 2QR1B 1M902 2YU9I 3HOUI 2R92I 4DGLA 3CXCZ 1VQ9Z 3K7AI 3J81b 2JIPA 3CCRZ 2RHBA 3ESWA 2AKLA 2HU9A 3I551 1S721 3S2HI 1NUIA 2VF1A 4NOZA 2QEX1 1Y1VS 4NBBA 3CCVZ 3CC71 2E2HI 3GTOI 2QA41 5LL6f 1Y1VI 3CC4Z 1VQ8Z 4MD7A 3G71Z 3S1NI 3CD6Z 1QYPA 2NVQI 2W04A 3NDIA 2OOYB 2V45A 2DE7A 2WB1A 3OW2Y 5IP9I 1VQOZ 1TWCI 1VQ91 3HOVI 3CCR1 3JAMf 2YADA 4A3BI 5A2Qf 5T64A 2M6NA 3CME1 1K8A2 3U50C 1Q16A 2JR6A 1TWGI 1Q7Y2 4BY7I 1AA6A 2LFUA 1Z03A 3OW2Z 1YUAA 1ZB8A 4HH4A 4NFRA 4A3II 3BG1B 4A93I 1YITZ 4CL1A 4RVHA 3S14I 1VQNZ 1TWHI 2NVYI 3H0GI 1Q821 1VQPZ 1FDOA 3EEDA 3GTLI 1QXFA 1N8R2 3MZKB 1Y1WI 1M1K1 1P9NA 3VB9A 2PM9A 2KPIA 1Y8CA 3CC41 3CPWY 5FLXb 4TNUA 1VQ81 2AYDA 4QTUA 4E33A 2DE5A 3G711 1M901 3CD61 4Y7NI 2ZAEB 4E2YA 5C44I 3S1MI 3CCMZ 2K3RA 1VQLZ 1YJNZ 3MONA 5D1OB 2BJOA 1VQO1 4A3GI 3CPWZ 1W2BY 3BG0B 4A3KI 1YUKA 1ZB9A 3PO2I 3S1QI 4BXXI 3GTGI 1DL6A 1KRLA 2JIQA 2VPYA 4RVDA 1JJ2Y 3I4NI 3GTMS 4NBFA 4RVGA 1QF8A 3KIFA 2O4HA 2E7ZA 3KIHA 1YIT1 1W2BZ 3HOYI 1Z02A 3Q87A 2R7ZI 1VLAA 1VQN1 1QVGY 1YJW1 4BBSI 1KQSY 1VQP1 1R9TI 1VQ71 2JNYA 1L1OC 1QVGZ 1KQSZ 5C4XI 4MONA 3CMEZ 3CCM1 2GTIA 1VQL1 3F3FC 4MD9A 1YJN1 5FLXf 2JIOA 3VMIA 2QLVB 1K8A1 5T6BA 2VPXA 1Q7Y1 2LIYA 1NJI2 2JA8I 2JMOA 3D9XA 3FKII 1Z01A 1WW9A 2HF1A 4A3EI 2OZKA 3IF8A 4NB9A 2V8JA 1RO4A 3HOWI 1N2FA 1N8R1 3P5JB 2E2JI 3GCFA 3G6E1 3T4NB 3CCJZ 1Q812 4MXUA 3J80b 2OTJZ 3LUSA 1VQ5Z 1VQ4Z 3PO3I 1KC82 1VQKZ 2OTLZ 4RV9A 3CC2Z 2JA5I 4NH1C 3MZLB 3CQZI 3D2LA 4HGYA 1YI2Z 2DE6A 2E9HA 4E2WA 3CMAZ 2RBLA 3NDJA 1RNIA 3J81f 1YHQZ 3I56Z 1USPB 3TDHB 1RLYA 4QTTA 3G4SZ 1RO2A 1JWHC 5T67A 4E30A 1YJWZ 1K83I 2NAPA 1K9M2 4MH4A 2WAQA 2LEXA 2RIQA 2I3CA 1VQ7Z 1WIIA 1PFTA 3QWUA 2JUBA 1KD11 3CCJ1 1FDIA 1ZH1A 4Y52I 1K732 3FQQA 2OTJ1 1VQ51 1VQ41 4NBHA 2RPRA 3VMGA 4NBGA 3IR7A 1VQK1 2OTL1 4A3DI 3J80f 2VPWA 3CC21 2K5RA 1X3WA 1LQLA 2NVTI 3HOXI 2B63I 1YI21 2M48A 3CMA1 2VUGA 2JA7I 1NJI1 1YHQ1 4E2ZA 5C3EI 3I561 2V8KA 5D1OA 3G4S1 3CCUZ 4A3MI 3CCEZ 3NFZA 2IV2X 2Y0SA 2V3VA 3G6EZ 4A3FI 1I6HI 1JJ2Z 2Q51A 3IX0A 2EGTA 2JIMA 3TE5B 2NVXI 1Q811 1YIJZ 4A3LI 1VQ6Z 2H85A 4DQYB 1KC81 3J7A4 4NBEA 3JAMb 3RZOI 5IT9b 5A2Qb 4HGZA 5D1PA 1VQMZ 1WJ2A 2RT9A 3CCL1 2Q4ZA 3GKQA 3RZDI 2F4OA 4MRIA 2OOXB 4E31A 3GTQI 2JIRA 2IZ3A 3GTKI 1YJ91 2V8IA 2QKDA 4A3CI 3PO3S 4MD8A 3CCU1 3NH8A 3CCE1 1I50I 2J6AA 2PMZA 4RS4A 1Q862 1K9M1 3GTPI 5AN9F 2JS4A 2VUMI 1X0TA 4E2XA 4AYBA 2IZ4A 2GU2A 1RO0A 2QREB 4E32A 1YIJ1 1K731 2R6MA 3EERA 1ML8A 1VQ61 1SIWA 4NB8A 3GTJI 3I07A 1WZNA 1I3QI 3S2DI 1WCMI 3CCS1 1SFOI 2QRCB 4S1TA 1VQM1 2QRDB 3NH5A 3M4OI 3S15I 2R93I 3VTNA 3M3YI 5IT9f 3H3VJ 1TWFI 3I4MI 1QVFY 1TWAI 3CCQZ 2E2II 1USPA 3F3PC 2JA6I 4X6AI 1S7MA 1NP6A 3IFUA 4RVFA 3S16I 4DK1A 3CCV1 2KI7B 4BY1I 4NBCA 1QVFZ 1RQFA 4NBAA 3CCLZ 1TFIA 3HOZI 3D6WA 3HKZA 3NH4A 5FLMI 2PK7A 4NBDA 5CM2M 5C4JI 3FQMA 1YJ9Z 3I55Z 1S72Z 4BBRI 2G2KA 3VMHA 2P28A 2QEXZ 2P3YA 2W03A 3S1RI 3CC7Z 1Q861 3CCQ1 2QA4Z 3S17I 4XX2A 2VPZA 1Q822
chains in the Genus database with same CATH topology
3CXCY 2GTHA 1M1K2 4EWCA 4A3JI 3CCSZ 3GTMI 2O53A 2F4MA 5IP7I 1KD12 1X3ZA 2QR1B 1M902 2YU9I 3HOUI 2R92I 4DGLA 3CXCZ 1VQ9Z 3K7AI 3J81b 3CCRZ 2RHBA 3ESWA 2AKLA 2HU9A 3I551 1S721 3S2HI 1NUIA 2VF1A 4NOZA 2QEX1 1Y1VS 4NBBA 3CCVZ 3CC71 2E2HI 3GTOI 2QA41 5LL6f 1Y1VI 3CC4Z 1VQ8Z 4MD7A 3G71Z 3S1NI 3CD6Z 1QYPA 2NVQI 2W04A 3NDIA 2OOYB 2DE7A 2WB1A 3OW2Y 5IP9I 1VQOZ 1TWCI 1VQ91 3HOVI 3CCR1 3JAMf 2YADA 4A3BI 5A2Qf 5T64A 2M6NA 3CME1 1K8A2 3U50C 2JR6A 1TWGI 1Q7Y2 4BY7I 2LFUA 1Z03A 3OW2Z 1YUAA 1ZB8A 4HH4A 4NFRA 4A3II 3BG1B 4A93I 1YITZ 4CL1A 4RVHA 3S14I 1VQNZ 1TWHI 2NVYI 3H0GI 1Q821 1VQPZ 3EEDA 3GTLI 1N8R2 3MZKB 1Y1WI 1M1K1 1P9NA 3VB9A 2PM9A 2KPIA 3CC41 3CPWY 5FLXb 4TNUA 1VQ81 4QTUA 4E33A 2DE5A 3G711 1M901 3CD61 4Y7NI 2ZAEB 4E2YA 5C44I 3S1MI 3CCMZ 2K3RA 1VQLZ 1YJNZ 3MONA 5D1OB 2BJOA 1VQO1 4A3GI 3CPWZ 1W2BY 3BG0B 4A3KI 1YUKA 1ZB9A 3PO2I 3S1QI 4BXXI 3GTGI 1DL6A 1KRLA 4RVDA 1JJ2Y 3I4NI 3GTMS 4NBFA 4RVGA 1QF8A 3KIFA 2O4HA 3KIHA 1YIT1 1W2BZ 3HOYI 1Z02A 3Q87A 2R7ZI 1VLAA 1VQN1 1QVGY 1YJW1 4BBSI 1KQSY 1VQP1 1R9TI 1VQ71 2JNYA 1L1OC 1QVGZ 1KQSZ 5C4XI 4MONA 3CMEZ 3CCM1 2GTIA 1VQL1 3F3FC 4MD9A 1YJN1 5FLXf 3VMIA 2QLVB 1K8A1 5T6BA 1Q7Y1 2LIYA 1NJI2 2JA8I 2JMOA 3D9XA 3FKII 1Z01A 1WW9A 2HF1A 4A3EI 2OZKA 3IF8A 4NB9A 2V8JA 1RO4A 3HOWI 1N2FA 1N8R1 3P5JB 2E2JI 3GCFA 3G6E1 3T4NB 3CCJZ 1Q812 4MXUA 3J80b 2OTJZ 3LUSA 1VQ5Z 1VQ4Z 3PO3I 1KC82 1VQKZ 2OTLZ 4RV9A 3CC2Z 2JA5I 4NH1C 3MZLB 3CQZI 4HGYA 1YI2Z 2DE6A 2E9HA 4E2WA 3CMAZ 2RBLA 3NDJA 1RNIA 3J81f 1YHQZ 3I56Z 1USPB 3TDHB 1RLYA 4QTTA 3G4SZ 1RO2A 1JWHC 5T67A 4E30A 1YJWZ 1K83I 1K9M2 4MH4A 2WAQA 2RIQA 2I3CA 1VQ7Z 1WIIA 1PFTA 3QWUA 2JUBA 1KD11 3CCJ1 1ZH1A 4Y52I 1K732 3FQQA 2OTJ1 1VQ51 1VQ41 4NBHA 2RPRA 3VMGA 4NBGA 1VQK1 2OTL1 4A3DI 3J80f 3CC21 2K5RA 1X3WA 1LQLA 2NVTI 3HOXI 2B63I 1YI21 2M48A 3CMA1 2VUGA 2JA7I 1NJI1 1YHQ1 4E2ZA 5C3EI 3I561 2V8KA 5D1OA 3G4S1 3CCUZ 4A3MI 3CCEZ 3NFZA 2Y0SA 3G6EZ 4A3FI 1I6HI 1JJ2Z 2Q51A 3IX0A 2EGTA 3TE5B 2NVXI 1Q811 1YIJZ 4A3LI 1VQ6Z 2H85A 4DQYB 1KC81 3J7A4 4NBEA 3JAMb 3RZOI 5IT9b 5A2Qb 4HGZA 5D1PA 1VQMZ 2RT9A 3CCL1 2Q4ZA 3GKQA 3RZDI 2F4OA 4MRIA 2OOXB 4E31A 3GTQI 2IZ3A 3GTKI 1YJ91 2V8IA 2QKDA 4A3CI 3PO3S 4MD8A 3CCU1 3NH8A 3CCE1 1I50I 2J6AA 2PMZA 4RS4A 1Q862 1K9M1 3GTPI 5AN9F 2JS4A 2VUMI 1X0TA 4E2XA 4AYBA 2IZ4A 2GU2A 1RO0A 2QREB 4E32A 1YIJ1 1K731 2R6MA 3EERA 1ML8A 1VQ61 4NB8A 3GTJI 3I07A 1I3QI 3S2DI 1WCMI 3CCS1 1SFOI 2QRCB 4S1TA 1VQM1 2QRDB 3NH5A 3M4OI 3S15I 2R93I 3VTNA 3M3YI 5IT9f 3H3VJ 1TWFI 3I4MI 1QVFY 1TWAI 3CCQZ 2E2II 1USPA 3F3PC 2JA6I 4X6AI 1S7MA 1NP6A 3IFUA 4RVFA 3S16I 4DK1A 3CCV1 2KI7B 4BY1I 4NBCA 1QVFZ 1RQFA 4NBAA 3CCLZ 1TFIA 3HOZI 3D6WA 3HKZA 3NH4A 5FLMI 2PK7A 4NBDA 5CM2M 5C4JI 3FQMA 1YJ9Z 3I55Z 1S72Z 4BBRI 2G2KA 3VMHA 2P28A 2QEXZ 2P3YA 2W03A 3S1RI 3CC7Z 1Q861 3CCQ1 2QA4Z 3S17I 4XX2A 1Q822
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 1;  1M90 1;  3CXC Y;  3CCU 1;  3CCE 1;  3CMA Z;  3CD6 1;  1M1K 2;  1YHQ Z;  3I56 Z;  3CCM Z;  1Q86 2;  1K9M 1;  1VQL Z;  3CCS Z;  1YJN Z;  3G4S Z;  1VQO 1;  3CPW Z;  1W2B Y;  1KD1 2;  1YJW Z;  1M90 2;  1YIJ 1;  3CXC Z;  1K73 1;  1K9M 2;  1VQ9 Z;  1VQ6 1;  1JJ2 Y;  3CCR Z;  1VQ7 Z;  1KD1 1;  3I55 1;  3CCJ 1;  1YIT 1;  3CCS 1;  1S72 1;  1W2B Z;  1K73 2;  1VQN 1;  2OTJ 1;  1VQ5 1;  1QVG Y;  1VQ4 1;  1YJW 1;  1VQM 1;  1KQS Y;  1VQP 1;  2QEX 1;  3CCV Z;  3CC7 1;  1VQK 1;  2OTL 1;  2QA4 1;  3CC2 1;  1VQ7 1;  1YI2 1;  1QVF Y;  1QVG Z;  3CCQ Z;  3CMA 1;  1KQS Z;  3CC4 Z;  3CME Z;  1NJI 1;  1VQ8 Z;  1YHQ 1;  3I56 1;  3CCM 1;  1VQL 1;  1YJN 1;  3G71 Z;  3G4S 1;  3CCU Z;  3CCE Z;  3CD6 Z;  1K8A 1;  3CCV 1;  3G6E Z;  1Q7Y 1;  3OW2 Y;  1NJI 2;  1JJ2 Z;  1QVF Z;  1VQO Z;  1VQ9 1;  3CCR 1;  3CCL Z;  3CME 1;  1Q81 1;  1K8A 2;  1YIJ Z;  1Q7Y 2;  1VQ6 Z;  1YJ9 Z;  3OW2 Z;  1N8R 1;  1KC8 1;  3G6E 1;  3I55 Z;  3CCJ Z;  1YIT Z;  1Q81 2;  1S72 Z;  1VQN Z;  2OTJ Z;  1VQ5 Z;  1VQ4 Z;  1VQM Z;  1Q82 1;  1VQP Z;  2QEX Z;  3CCL 1;  1N8R 2;  1M1K 1;  1KC8 2;  3CC7 Z;  1VQK Z;  2OTL Z;  1Q86 1;  3CCQ 1;  2QA4 Z;  3CC2 Z;  3CC4 1;  3CPW Y;  1YJ9 1;  1VQ8 1;  1Q82 2;  1YI2 Z; 
#chains in the Genus database with same CATH topology
 3CXC Y;  2GTH A;  1M1K 2;  4EWC A;  4A3J I;  3CCS Z;  3GTM I;  2O53 A;  2F4M A;  5IP7 I;  1KD1 2;  1X3Z A;  2QR1 B;  1M90 2;  2YU9 I;  3HOU I;  2R92 I;  4DGL A;  3CXC Z;  1VQ9 Z;  3K7A I;  3J81 b;  2JIP A;  3CCR Z;  2RHB A;  3ESW A;  2AKL A;  2HU9 A;  3I55 1;  1S72 1;  3S2H I;  1NUI A;  2VF1 A;  4NOZ A;  2QEX 1;  1Y1V S;  4NBB A;  3CCV Z;  3CC7 1;  2E2H I;  3GTO I;  2QA4 1;  5LL6 f;  1Y1V I;  3CC4 Z;  1VQ8 Z;  4MD7 A;  3G71 Z;  3S1N I;  3CD6 Z;  1QYP A;  2NVQ I;  2W04 A;  3NDI A;  2OOY B;  2V45 A;  2DE7 A;  2WB1 A;  3OW2 Y;  5IP9 I;  1VQO Z;  1TWC I;  1VQ9 1;  3HOV I;  3CCR 1;  3JAM f;  2YAD A;  4A3B I;  5A2Q f;  5T64 A;  2M6N A;  3CME 1;  1K8A 2;  3U50 C;  1Q16 A;  2JR6 A;  1TWG I;  1Q7Y 2;  4BY7 I;  1AA6 A;  2LFU A;  1Z03 A;  3OW2 Z;  1YUA A;  1ZB8 A;  4HH4 A;  4NFR A;  4A3I I;  3BG1 B;  4A93 I;  1YIT Z;  4CL1 A;  4RVH A;  3S14 I;  1VQN Z;  1TWH I;  2NVY I;  3H0G I;  1Q82 1;  1VQP Z;  1FDO A;  3EED A;  3GTL I;  1QXF A;  1N8R 2;  3MZK B;  1Y1W I;  1M1K 1;  1P9N A;  3VB9 A;  2PM9 A;  2KPI A;  1Y8C A;  3CC4 1;  3CPW Y;  5FLX b;  4TNU A;  1VQ8 1;  2AYD A;  4QTU A;  4E33 A;  2DE5 A;  3G71 1;  1M90 1;  3CD6 1;  4Y7N I;  2ZAE B;  4E2Y A;  5C44 I;  3S1M I;  3CCM Z;  2K3R A;  1VQL Z;  1YJN Z;  3MON A;  5D1O B;  2BJO A;  1VQO 1;  4A3G I;  3CPW Z;  1W2B Y;  3BG0 B;  4A3K I;  1YUK A;  1ZB9 A;  3PO2 I;  3S1Q I;  4BXX I;  3GTG I;  1DL6 A;  1KRL A;  2JIQ A;  2VPY A;  4RVD A;  1JJ2 Y;  3I4N I;  3GTM S;  4NBF A;  4RVG A;  1QF8 A;  3KIF A;  2O4H A;  2E7Z A;  3KIH A;  1YIT 1;  1W2B Z;  3HOY I;  1Z02 A;  3Q87 A;  2R7Z I;  1VLA A;  1VQN 1;  1QVG Y;  1YJW 1;  4BBS I;  1KQS Y;  1VQP 1;  1R9T I;  1VQ7 1;  2JNY A;  1L1O C;  1QVG Z;  1KQS Z;  5C4X I;  4MON A;  3CME Z;  3CCM 1;  2GTI A;  1VQL 1;  3F3F C;  4MD9 A;  1YJN 1;  5FLX f;  2JIO A;  3VMI A;  2QLV B;  1K8A 1;  5T6B A;  2VPX A;  1Q7Y 1;  2LIY A;  1NJI 2;  2JA8 I;  2JMO A;  3D9X A;  3FKI I;  1Z01 A;  1WW9 A;  2HF1 A;  4A3E I;  2OZK A;  3IF8 A;  4NB9 A;  2V8J A;  1RO4 A;  3HOW I;  1N2F A;  1N8R 1;  3P5J B;  2E2J I;  3GCF A;  3G6E 1;  3T4N B;  3CCJ Z;  1Q81 2;  4MXU A;  3J80 b;  2OTJ Z;  3LUS A;  1VQ5 Z;  1VQ4 Z;  3PO3 I;  1KC8 2;  1VQK Z;  2OTL Z;  4RV9 A;  3CC2 Z;  2JA5 I;  4NH1 C;  3MZL B;  3CQZ I;  3D2L A;  4HGY A;  1YI2 Z;  2DE6 A;  2E9H A;  4E2W A;  3CMA Z;  2RBL A;  3NDJ A;  1RNI A;  3J81 f;  1YHQ Z;  3I56 Z;  1USP B;  3TDH B;  1RLY A;  4QTT A;  3G4S Z;  1RO2 A;  1JWH C;  5T67 A;  4E30 A;  1YJW Z;  1K83 I;  2NAP A;  1K9M 2;  4MH4 A;  2WAQ A;  2LEX A;  2RIQ A;  2I3C A;  1VQ7 Z;  1WII A;  1PFT A;  3QWU A;  2JUB A;  1KD1 1;  3CCJ 1;  1FDI A;  1ZH1 A;  4Y52 I;  1K73 2;  3FQQ A;  2OTJ 1;  1VQ5 1;  1VQ4 1;  4NBH A;  2RPR A;  3VMG A;  4NBG A;  3IR7 A;  1VQK 1;  2OTL 1;  4A3D I;  3J80 f;  2VPW A;  3CC2 1;  2K5R A;  1X3W A;  1LQL A;  2NVT I;  3HOX I;  2B63 I;  1YI2 1;  2M48 A;  3CMA 1;  2VUG A;  2JA7 I;  1NJI 1;  1YHQ 1;  4E2Z A;  5C3E I;  3I56 1;  2V8K A;  5D1O A;  3G4S 1;  3CCU Z;  4A3M I;  3CCE Z;  3NFZ A;  2IV2 X;  2Y0S A;  2V3V A;  3G6E Z;  4A3F I;  1I6H I;  1JJ2 Z;  2Q51 A;  3IX0 A;  2EGT A;  2JIM A;  3TE5 B;  2NVX I;  1Q81 1;  1YIJ Z;  4A3L I;  1VQ6 Z;  2H85 A;  4DQY B;  1KC8 1;  3J7A 4;  4NBE A;  3JAM b;  3RZO I;  5IT9 b;  5A2Q b;  4HGZ A;  5D1P A;  1VQM Z;  1WJ2 A;  2RT9 A;  3CCL 1;  2Q4Z A;  3GKQ A;  3RZD I;  2F4O A;  4MRI A;  2OOX B;  4E31 A;  3GTQ I;  2JIR A;  2IZ3 A;  3GTK I;  1YJ9 1;  2V8I A;  2QKD A;  4A3C I;  3PO3 S;  4MD8 A;  3CCU 1;  3NH8 A;  3CCE 1;  1I50 I;  2J6A A;  2PMZ A;  4RS4 A;  1Q86 2;  1K9M 1;  3GTP I;  5AN9 F;  2JS4 A;  2VUM I;  1X0T A;  4E2X A;  4AYB A;  2IZ4 A;  2GU2 A;  1RO0 A;  2QRE B;  4E32 A;  1YIJ 1;  1K73 1;  2R6M A;  3EER A;  1ML8 A;  1VQ6 1;  1SIW A;  4NB8 A;  3GTJ I;  3I07 A;  1WZN A;  1I3Q I;  3S2D I;  1WCM I;  3CCS 1;  1SFO I;  2QRC B;  4S1T A;  1VQM 1;  2QRD B;  3NH5 A;  3M4O I;  3S15 I;  2R93 I;  3VTN A;  3M3Y I;  5IT9 f;  3H3V J;  1TWF I;  3I4M I;  1QVF Y;  1TWA I;  3CCQ Z;  2E2I I;  1USP A;  3F3P C;  2JA6 I;  4X6A I;  1S7M A;  1NP6 A;  3IFU A;  4RVF A;  3S16 I;  4DK1 A;  3CCV 1;  2KI7 B;  4BY1 I;  4NBC A;  1QVF Z;  1RQF A;  4NBA A;  3CCL Z;  1TFI A;  3HOZ I;  3D6W A;  3HKZ A;  3NH4 A;  5FLM I;  2PK7 A;  4NBD A;  5CM2 M;  5C4J I;  3FQM A;  1YJ9 Z;  3I55 Z;  1S72 Z;  4BBR I;  2G2K A;  3VMH A;  2P28 A;  2QEX Z;  2P3Y A;  2W03 A;  3S1R I;  3CC7 Z;  1Q86 1;  3CCQ 1;  2QA4 Z;  3S17 I;  4XX2 A;  2VPZ A;  1Q82 2; 
#chains in the Genus database with same CATH homology
 3CXC Y;  2GTH A;  1M1K 2;  4EWC A;  4A3J I;  3CCS Z;  3GTM I;  2O53 A;  2F4M A;  5IP7 I;  1KD1 2;  1X3Z A;  2QR1 B;  1M90 2;  2YU9 I;  3HOU I;  2R92 I;  4DGL A;  3CXC Z;  1VQ9 Z;  3K7A I;  3J81 b;  3CCR Z;  2RHB A;  3ESW A;  2AKL A;  2HU9 A;  3I55 1;  1S72 1;  3S2H I;  1NUI A;  2VF1 A;  4NOZ A;  2QEX 1;  1Y1V S;  4NBB A;  3CCV Z;  3CC7 1;  2E2H I;  3GTO I;  2QA4 1;  5LL6 f;  1Y1V I;  3CC4 Z;  1VQ8 Z;  4MD7 A;  3G71 Z;  3S1N I;  3CD6 Z;  1QYP A;  2NVQ I;  2W04 A;  3NDI A;  2OOY B;  2DE7 A;  2WB1 A;  3OW2 Y;  5IP9 I;  1VQO Z;  1TWC I;  1VQ9 1;  3HOV I;  3CCR 1;  3JAM f;  2YAD A;  4A3B I;  5A2Q f;  5T64 A;  2M6N A;  3CME 1;  1K8A 2;  3U50 C;  2JR6 A;  1TWG I;  1Q7Y 2;  4BY7 I;  2LFU A;  1Z03 A;  3OW2 Z;  1YUA A;  1ZB8 A;  4HH4 A;  4NFR A;  4A3I I;  3BG1 B;  4A93 I;  1YIT Z;  4CL1 A;  4RVH A;  3S14 I;  1VQN Z;  1TWH I;  2NVY I;  3H0G I;  1Q82 1;  1VQP Z;  3EED A;  3GTL I;  1N8R 2;  3MZK B;  1Y1W I;  1M1K 1;  1P9N A;  3VB9 A;  2PM9 A;  2KPI A;  3CC4 1;  3CPW Y;  5FLX b;  4TNU A;  1VQ8 1;  4QTU A;  4E33 A;  2DE5 A;  3G71 1;  1M90 1;  3CD6 1;  4Y7N I;  2ZAE B;  4E2Y A;  5C44 I;  3S1M I;  3CCM Z;  2K3R A;  1VQL Z;  1YJN Z;  3MON A;  5D1O B;  2BJO A;  1VQO 1;  4A3G I;  3CPW Z;  1W2B Y;  3BG0 B;  4A3K I;  1YUK A;  1ZB9 A;  3PO2 I;  3S1Q I;  4BXX I;  3GTG I;  1DL6 A;  1KRL A;  4RVD A;  1JJ2 Y;  3I4N I;  3GTM S;  4NBF A;  4RVG A;  1QF8 A;  3KIF A;  2O4H A;  3KIH A;  1YIT 1;  1W2B Z;  3HOY I;  1Z02 A;  3Q87 A;  2R7Z I;  1VLA A;  1VQN 1;  1QVG Y;  1YJW 1;  4BBS I;  1KQS Y;  1VQP 1;  1R9T I;  1VQ7 1;  2JNY A;  1L1O C;  1QVG Z;  1KQS Z;  5C4X I;  4MON A;  3CME Z;  3CCM 1;  2GTI A;  1VQL 1;  3F3F C;  4MD9 A;  1YJN 1;  5FLX f;  3VMI A;  2QLV B;  1K8A 1;  5T6B A;  1Q7Y 1;  2LIY A;  1NJI 2;  2JA8 I;  2JMO A;  3D9X A;  3FKI I;  1Z01 A;  1WW9 A;  2HF1 A;  4A3E I;  2OZK A;  3IF8 A;  4NB9 A;  2V8J A;  1RO4 A;  3HOW I;  1N2F A;  1N8R 1;  3P5J B;  2E2J I;  3GCF A;  3G6E 1;  3T4N B;  3CCJ Z;  1Q81 2;  4MXU A;  3J80 b;  2OTJ Z;  3LUS A;  1VQ5 Z;  1VQ4 Z;  3PO3 I;  1KC8 2;  1VQK Z;  2OTL Z;  4RV9 A;  3CC2 Z;  2JA5 I;  4NH1 C;  3MZL B;  3CQZ I;  4HGY A;  1YI2 Z;  2DE6 A;  2E9H A;  4E2W A;  3CMA Z;  2RBL A;  3NDJ A;  1RNI A;  3J81 f;  1YHQ Z;  3I56 Z;  1USP B;  3TDH B;  1RLY A;  4QTT A;  3G4S Z;  1RO2 A;  1JWH C;  5T67 A;  4E30 A;  1YJW Z;  1K83 I;  1K9M 2;  4MH4 A;  2WAQ A;  2RIQ A;  2I3C A;  1VQ7 Z;  1WII A;  1PFT A;  3QWU A;  2JUB A;  1KD1 1;  3CCJ 1;  1ZH1 A;  4Y52 I;  1K73 2;  3FQQ A;  2OTJ 1;  1VQ5 1;  1VQ4 1;  4NBH A;  2RPR A;  3VMG A;  4NBG A;  1VQK 1;  2OTL 1;  4A3D I;  3J80 f;  3CC2 1;  2K5R A;  1X3W A;  1LQL A;  2NVT I;  3HOX I;  2B63 I;  1YI2 1;  2M48 A;  3CMA 1;  2VUG A;  2JA7 I;  1NJI 1;  1YHQ 1;  4E2Z A;  5C3E I;  3I56 1;  2V8K A;  5D1O A;  3G4S 1;  3CCU Z;  4A3M I;  3CCE Z;  3NFZ A;  2Y0S A;  3G6E Z;  4A3F I;  1I6H I;  1JJ2 Z;  2Q51 A;  3IX0 A;  2EGT A;  3TE5 B;  2NVX I;  1Q81 1;  1YIJ Z;  4A3L I;  1VQ6 Z;  2H85 A;  4DQY B;  1KC8 1;  3J7A 4;  4NBE A;  3JAM b;  3RZO I;  5IT9 b;  5A2Q b;  4HGZ A;  5D1P A;  1VQM Z;  2RT9 A;  3CCL 1;  2Q4Z A;  3GKQ A;  3RZD I;  2F4O A;  4MRI A;  2OOX B;  4E31 A;  3GTQ I;  2IZ3 A;  3GTK I;  1YJ9 1;  2V8I A;  2QKD A;  4A3C I;  3PO3 S;  4MD8 A;  3CCU 1;  3NH8 A;  3CCE 1;  1I50 I;  2J6A A;  2PMZ A;  4RS4 A;  1Q86 2;  1K9M 1;  3GTP I;  5AN9 F;  2JS4 A;  2VUM I;  1X0T A;  4E2X A;  4AYB A;  2IZ4 A;  2GU2 A;  1RO0 A;  2QRE B;  4E32 A;  1YIJ 1;  1K73 1;  2R6M A;  3EER A;  1ML8 A;  1VQ6 1;  4NB8 A;  3GTJ I;  3I07 A;  1I3Q I;  3S2D I;  1WCM I;  3CCS 1;  1SFO I;  2QRC B;  4S1T A;  1VQM 1;  2QRD B;  3NH5 A;  3M4O I;  3S15 I;  2R93 I;  3VTN A;  3M3Y I;  5IT9 f;  3H3V J;  1TWF I;  3I4M I;  1QVF Y;  1TWA I;  3CCQ Z;  2E2I I;  1USP A;  3F3P C;  2JA6 I;  4X6A I;  1S7M A;  1NP6 A;  3IFU A;  4RVF A;  3S16 I;  4DK1 A;  3CCV 1;  2KI7 B;  4BY1 I;  4NBC A;  1QVF Z;  1RQF A;  4NBA A;  3CCL Z;  1TFI A;  3HOZ I;  3D6W A;  3HKZ A;  3NH4 A;  5FLM I;  2PK7 A;  4NBD A;  5CM2 M;  5C4J I;  3FQM A;  1YJ9 Z;  3I55 Z;  1S72 Z;  4BBR I;  2G2K A;  3VMH A;  2P28 A;  2QEX Z;  2P3Y A;  2W03 A;  3S1R I;  3CC7 Z;  1Q86 1;  3CCQ 1;  2QA4 Z;  3S17 I;  4XX2 A;  1Q82 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...