2OOYB

Crystal structure of the adenylate sensor from amp-activated protein kinase complexed with atp
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
92
structure length
92
Chain Sequence
EQYSTEIPAFLTSNTLQELKLPKPPSLPPHLEKCILNSNTAYKEDQSVLPNPNHVLLNHLAAANTQLGVLALSATTRYHRKYVTTAMFKNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords SNF1-like protein kinase ssp2
publication title Crystal structures of the adenylate sensor from fission yeast AMP-activated protein kinase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 3
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ooyB01
2OOYB 2QRDB 2QREB 2QRCB 2QLVB 3T4NB 3TDHB 3TE5B 2OOXB 2QR1B
chains in the Genus database with same CATH superfamily
2JUBA 2H85A 2QRDB 1YITZ 2VUGA 1QF8A 3CXCZ 1QXFA 3S1NI 3CC4Z 3CC2Z 3FQMA 3CPWZ 3PO3S 1ZH1A 1VQM1 2OTJZ 2R92I 3CCVZ 1VQKZ 2VPYA 3M4OI 3T4NB 1TFIA 4Y52I 2I3CA 3GTMI 3HOZI 2PM9A 5IP7I 3CCSZ 1DL6A 1W2BZ 2QRCB 3RZOI 2IZ4A 2R7ZI 1KC81 1VQ5Z 1KRLA 1VQ7Z 3G4SZ 1Q812 4EWCA 4NB9A 3CCL1 4X6AI 1KD12 1Q7Y1 3CCM1 3GCFA 4E2ZA 1VQL1 1WIIA 1S721 1ZB8A 2NVXI 1K732 4CL1A 2BJOA 2RPRA 2YU9I 3JAMf 2V8JA 3CCJZ 1R9TI 2OOXB 2GTIA 4MONA 4A3EI 1JWHC 3CD61 3BG1B 3J81f 3RZDI 1YUKA 3CMA1 1JJ2Y 2OTLZ 3S2HI 2F4OA 5C4XI 2KPIA 2E2HI 3I4MI 4QTUA 3GKQA 2PK7A 1VQOZ 5CM2M 2RIQA 1VLAA 3Q87A 3VMIA 1ZB9A 2P28A 4BY7I 4MD9A 1PFTA 3PO2I 2HU9A 1K8A1 3CMEZ 3H0GI 4RS4A 3GTGI 3FKII 2GTHA 3NDIA 2QA41 5FLXf 1I3QI 4AYBA 5A2Qf 3MZLB 4RVGA 3CCUZ 2NVYI 4E32A 2VPWA 5IT9f 3GTPI 4A3CI 2JIMA 1YJN1 3NH4A 2EGTA 4TNUA 1WW9A 2JA5I 2JA8I 4RV9A 3F3PC 1Q811 2JMOA 1YJ91 3H3VJ 5C4JI 1VQ8Z 3J7A4 4A3DI 1AA6A 1KD11 1USPA 1Q822 3F3FC 3S1QI 1KQSY 1Z01A 2E2II 2M48A 3IFUA 5T64A 3CCE1 1QVGY 3P5JB 4NBCA 3U50C 4A93I 2V8KA 3HOUI 4QTTA 2OZKA 2VPZA 1WCMI 2P3YA 1SIWA 4E31A 1Y1WI 3I55Z 2JIQA 1M1K2 3NFZA 1TWCI 2YADA 1RQFA 3PO3I 3FQQA 1WZNA 1JJ2Z 1YJWZ 3I4NI 2PMZA 2NVQI 3I07A 4DK1A 1QYPA 5C44I 2R6MA 4BBSI 2V8IA 5AN9F 1Y1VS 4DQYB 2E2JI 1QVFY 3S17I 3CC71 4A3JI 2IV2X 2RHBA 3J80b 3EERA 1TWAI 4NFRA 3I561 3GTKI 1X0TA 3IR7A 1SFOI 1FDIA 2OOYB 2Q51A 4MD8A 2G2KA 2DE5A 4Y7NI 5D1OB 1NJI2 2Q4ZA 3K7AI 2GU2A 1RO2A 2E7ZA 3M3YI 1VQN1 3GTOI 1USPB 1VQPZ 3S16I 3G71Z 2DE7A 2KI7B 2QEX1 1VQ6Z 3HOVI 4E2WA 4NH1C 1YIT1 4NBHA 4NBDA 4A3BI 2O53A 1NUIA 1KQSZ 3G6E1 2QREB 2V3VA 3HKZA 3NH8A 1VQ91 4NBFA 2JIPA 1VQMZ 1YI21 3CCR1 1RO0A 2QLVB 2NAPA 3TE5B 1RLYA 3GTLI 1K83I 2AYDA 3CCV1 4MRIA 5D1PA 1VQK1 5T67A 3S2DI 1L1OC 5D1OA 2K5RA 4NB8A 4HGZA 3CCS1 1N8R2 1YUAA 4A3MI 1X3WA 3EEDA 4A3FI 1VQ71 3G4S1 4S1TA 3CCLZ 3JAMb 2WAQA 1FDOA 4RVFA 3CCMZ 1VQLZ 2V45A 1S72Z 1K731 2JA6I 3J81b 2RT9A 3KIFA 4HGYA 1Q862 1P9NA 3D6WA 1M902 3CCJ1 2M6NA 4XX2A 3ESWA 4NBEA 3CD6Z 4E30A 1TWHI 4MH4A 3CMAZ 1NJI1 3IF8A 2AKLA 2OTL1 1QVFZ 2J6AA 2F4MA 4A3LI 2W04A 3NH5A 3CQZI 3IX0A 1VQO1 1Q16A 4NBGA 2LFUA 4NOZA 4MXUA 5FLXb 5A2Qb 1K8A2 3S15I 2ZAEB 2B63I 2LEXA 3G6EZ 4A3II 2QA4Z 1YHQ1 3CME1 4BBRI 5IT9b 1VQ9Z 1YI2Z 3CCRZ 2RBLA 1VQ41 3S14I 3GTMS 4E2XA 1N2FA 3HOYI 2NVTI 3CCU1 4NBBA 1YIJ1 1YJNZ 1Y1VI 1N8R1 3OW2Y 2K3RA 1ML8A 1YJ9Z 3MZKB 4MD7A 3NDJA 4A3GI 1VQ81 2JIRA 1Q821 1I6HI 3D2LA 3TDHB 2JIOA 5T6BA 1K9M2 1X3ZA 3CXCY 1Q861 5LL6f 3CCQ1 2LIYA 2WB1A 2E9HA 3CPWY 1M901 3CCEZ 1I50I 2QKDA 2QR1B 2JR6A 4A3KI 4RVHA 2Y0SA 1NP6A 3CC41 5IP9I 3CC21 3HOWI 1W2BY 1M1K1 1RNIA 3I551 1QVGZ 2VUMI 4E33A 5FLMI 2OTJ1 4RVDA 3VB9A 1TWFI 1Y8CA 3HOXI 3VTNA 4NBAA 4BY1I 1YHQZ 1YJW1 2JS4A 2O4HA 1KC82 1RO4A 1VQ51 4DGLA 1VQ4Z 2JA7I 3LUSA 2VPXA 2W03A 2DE6A 3QWUA 3VMHA 3MONA 1YIJZ 2VF1A 1Q7Y2 2JNYA 3CC7Z 2R93I 3BG0B 3S1MI 3I56Z 4BXXI 1WJ2A 1TWGI 3KIHA 3D9XA 3VMGA 1K9M1 4HH4A 3GTJI 3J80f 2HF1A 1Z02A 3CCQZ 4E2YA 3GTQI 3OW2Z 1S7MA 5C3EI 2IZ3A 1VQNZ 1LQLA 2QEXZ 3S1RI 1VQP1 3G711 1Z03A 1VQ61
chains in the Genus database with same CATH topology
2JUBA 2H85A 2QRDB 1YITZ 2VUGA 1QF8A 3CXCZ 3S1NI 3CC4Z 3CC2Z 3FQMA 3CPWZ 3PO3S 1ZH1A 1VQM1 2OTJZ 2R92I 3CCVZ 1VQKZ 3M4OI 3T4NB 1TFIA 4Y52I 2I3CA 3GTMI 3HOZI 2PM9A 5IP7I 3CCSZ 1DL6A 1W2BZ 2QRCB 3RZOI 2IZ4A 2R7ZI 1KC81 1VQ5Z 1KRLA 1VQ7Z 3G4SZ 1Q812 4EWCA 4NB9A 3CCL1 4X6AI 1KD12 1Q7Y1 3CCM1 3GCFA 4E2ZA 1VQL1 1WIIA 1S721 1ZB8A 2NVXI 1K732 4CL1A 2BJOA 2RPRA 2YU9I 3JAMf 2V8JA 3CCJZ 1R9TI 2OOXB 2GTIA 4MONA 4A3EI 1JWHC 3CD61 3BG1B 3J81f 3RZDI 1YUKA 3CMA1 1JJ2Y 2OTLZ 3S2HI 2F4OA 5C4XI 2KPIA 2E2HI 3I4MI 4QTUA 3GKQA 2PK7A 1VQOZ 5CM2M 2RIQA 1VLAA 3Q87A 3VMIA 1ZB9A 2P28A 4BY7I 4MD9A 1PFTA 3PO2I 2HU9A 1K8A1 3CMEZ 3H0GI 4RS4A 3GTGI 3FKII 2GTHA 3NDIA 2QA41 5FLXf 1I3QI 4AYBA 5A2Qf 3MZLB 4RVGA 3CCUZ 2NVYI 4E32A 5IT9f 3GTPI 4A3CI 1YJN1 3NH4A 2EGTA 4TNUA 1WW9A 2JA5I 2JA8I 4RV9A 3F3PC 1Q811 2JMOA 1YJ91 3H3VJ 5C4JI 1VQ8Z 3J7A4 4A3DI 1KD11 1USPA 1Q822 3F3FC 3S1QI 1KQSY 1Z01A 2E2II 2M48A 3IFUA 5T64A 3CCE1 1QVGY 3P5JB 4NBCA 3U50C 4A93I 2V8KA 3HOUI 4QTTA 2OZKA 1WCMI 2P3YA 4E31A 1Y1WI 3I55Z 1M1K2 3NFZA 1TWCI 2YADA 1RQFA 3PO3I 3FQQA 1JJ2Z 1YJWZ 3I4NI 2PMZA 2NVQI 3I07A 4DK1A 1QYPA 5C44I 2R6MA 4BBSI 2V8IA 5AN9F 1Y1VS 4DQYB 2E2JI 1QVFY 3S17I 3CC71 4A3JI 2RHBA 3J80b 3EERA 1TWAI 4NFRA 3I561 3GTKI 1X0TA 1SFOI 2OOYB 2Q51A 4MD8A 2G2KA 2DE5A 4Y7NI 5D1OB 1NJI2 2Q4ZA 3K7AI 2GU2A 1RO2A 3M3YI 1VQN1 3GTOI 1USPB 1VQPZ 3S16I 3G71Z 2DE7A 2KI7B 2QEX1 1VQ6Z 3HOVI 4E2WA 4NH1C 1YIT1 4NBHA 4NBDA 4A3BI 2O53A 1NUIA 1KQSZ 3G6E1 2QREB 3HKZA 3NH8A 1VQ91 4NBFA 1VQMZ 1YI21 3CCR1 1RO0A 2QLVB 3TE5B 1RLYA 3GTLI 1K83I 3CCV1 4MRIA 5D1PA 1VQK1 5T67A 3S2DI 1L1OC 5D1OA 2K5RA 4NB8A 4HGZA 3CCS1 1N8R2 1YUAA 4A3MI 1X3WA 3EEDA 4A3FI 1VQ71 3G4S1 4S1TA 3CCLZ 3JAMb 2WAQA 4RVFA 3CCMZ 1VQLZ 1S72Z 1K731 2JA6I 3J81b 2RT9A 3KIFA 4HGYA 1Q862 1P9NA 3D6WA 1M902 3CCJ1 2M6NA 4XX2A 3ESWA 4NBEA 3CD6Z 4E30A 1TWHI 4MH4A 3CMAZ 1NJI1 3IF8A 2AKLA 2OTL1 1QVFZ 2J6AA 2F4MA 4A3LI 2W04A 3NH5A 3CQZI 3IX0A 1VQO1 4NBGA 2LFUA 4NOZA 4MXUA 5FLXb 5A2Qb 1K8A2 3S15I 2ZAEB 2B63I 3G6EZ 4A3II 2QA4Z 1YHQ1 3CME1 4BBRI 5IT9b 1VQ9Z 1YI2Z 3CCRZ 2RBLA 1VQ41 3S14I 3GTMS 4E2XA 1N2FA 3HOYI 2NVTI 3CCU1 4NBBA 1YIJ1 1YJNZ 1Y1VI 1N8R1 3OW2Y 2K3RA 1ML8A 1YJ9Z 3MZKB 4MD7A 3NDJA 4A3GI 1VQ81 1Q821 1I6HI 3TDHB 5T6BA 1K9M2 1X3ZA 3CXCY 1Q861 5LL6f 3CCQ1 2LIYA 2WB1A 2E9HA 3CPWY 1M901 3CCEZ 1I50I 2QKDA 2QR1B 2JR6A 4A3KI 4RVHA 2Y0SA 1NP6A 3CC41 5IP9I 3CC21 3HOWI 1W2BY 1M1K1 1RNIA 3I551 1QVGZ 2VUMI 4E33A 5FLMI 2OTJ1 4RVDA 3VB9A 1TWFI 3HOXI 3VTNA 4NBAA 4BY1I 1YHQZ 1YJW1 2JS4A 2O4HA 1KC82 1RO4A 1VQ51 4DGLA 1VQ4Z 2JA7I 3LUSA 2W03A 2DE6A 3QWUA 3VMHA 3MONA 1YIJZ 2VF1A 1Q7Y2 2JNYA 3CC7Z 2R93I 3BG0B 3S1MI 3I56Z 4BXXI 1TWGI 3KIHA 3D9XA 3VMGA 1K9M1 4HH4A 3GTJI 3J80f 2HF1A 1Z02A 3CCQZ 4E2YA 3GTQI 3OW2Z 1S7MA 5C3EI 2IZ3A 1VQNZ 1LQLA 2QEXZ 3S1RI 1VQP1 3G711 1Z03A 1VQ61
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOY B;  2QRD B;  2QRE B;  2QRC B;  2QLV B;  3T4N B;  3TDH B;  3TE5 B;  2OOX B;  2QR1 B; 
#chains in the Genus database with same CATH topology
 2JUB A;  2H85 A;  2QRD B;  1YIT Z;  2VUG A;  1QF8 A;  3CXC Z;  1QXF A;  3S1N I;  3CC4 Z;  3CC2 Z;  3FQM A;  3CPW Z;  3PO3 S;  1ZH1 A;  1VQM 1;  2OTJ Z;  2R92 I;  3CCV Z;  1VQK Z;  2VPY A;  3M4O I;  3T4N B;  1TFI A;  4Y52 I;  2I3C A;  3GTM I;  3HOZ I;  2PM9 A;  5IP7 I;  3CCS Z;  1DL6 A;  1W2B Z;  2QRC B;  3RZO I;  2IZ4 A;  2R7Z I;  1KC8 1;  1VQ5 Z;  1KRL A;  1VQ7 Z;  3G4S Z;  1Q81 2;  4EWC A;  4NB9 A;  3CCL 1;  4X6A I;  1KD1 2;  1Q7Y 1;  3CCM 1;  3GCF A;  4E2Z A;  1VQL 1;  1WII A;  1S72 1;  1ZB8 A;  2NVX I;  1K73 2;  4CL1 A;  2BJO A;  2RPR A;  2YU9 I;  3JAM f;  2V8J A;  3CCJ Z;  1R9T I;  2OOX B;  2GTI A;  4MON A;  4A3E I;  1JWH C;  3CD6 1;  3BG1 B;  3J81 f;  3RZD I;  1YUK A;  3CMA 1;  1JJ2 Y;  2OTL Z;  3S2H I;  2F4O A;  5C4X I;  2KPI A;  2E2H I;  3I4M I;  4QTU A;  3GKQ A;  2PK7 A;  1VQO Z;  5CM2 M;  2RIQ A;  1VLA A;  3Q87 A;  3VMI A;  1ZB9 A;  2P28 A;  4BY7 I;  4MD9 A;  1PFT A;  3PO2 I;  2HU9 A;  1K8A 1;  3CME Z;  3H0G I;  4RS4 A;  3GTG I;  3FKI I;  2GTH A;  3NDI A;  2QA4 1;  5FLX f;  1I3Q I;  4AYB A;  5A2Q f;  3MZL B;  4RVG A;  3CCU Z;  2NVY I;  4E32 A;  2VPW A;  5IT9 f;  3GTP I;  4A3C I;  2JIM A;  1YJN 1;  3NH4 A;  2EGT A;  4TNU A;  1WW9 A;  2JA5 I;  2JA8 I;  4RV9 A;  3F3P C;  1Q81 1;  2JMO A;  1YJ9 1;  3H3V J;  5C4J I;  1VQ8 Z;  3J7A 4;  4A3D I;  1AA6 A;  1KD1 1;  1USP A;  1Q82 2;  3F3F C;  3S1Q I;  1KQS Y;  1Z01 A;  2E2I I;  2M48 A;  3IFU A;  5T64 A;  3CCE 1;  1QVG Y;  3P5J B;  4NBC A;  3U50 C;  4A93 I;  2V8K A;  3HOU I;  4QTT A;  2OZK A;  2VPZ A;  1WCM I;  2P3Y A;  1SIW A;  4E31 A;  1Y1W I;  3I55 Z;  2JIQ A;  1M1K 2;  3NFZ A;  1TWC I;  2YAD A;  1RQF A;  3PO3 I;  3FQQ A;  1WZN A;  1JJ2 Z;  1YJW Z;  3I4N I;  2PMZ A;  2NVQ I;  3I07 A;  4DK1 A;  1QYP A;  5C44 I;  2R6M A;  4BBS I;  2V8I A;  5AN9 F;  1Y1V S;  4DQY B;  2E2J I;  1QVF Y;  3S17 I;  3CC7 1;  4A3J I;  2IV2 X;  2RHB A;  3J80 b;  3EER A;  1TWA I;  4NFR A;  3I56 1;  3GTK I;  1X0T A;  3IR7 A;  1SFO I;  1FDI A;  2OOY B;  2Q51 A;  4MD8 A;  2G2K A;  2DE5 A;  4Y7N I;  5D1O B;  1NJI 2;  2Q4Z A;  3K7A I;  2GU2 A;  1RO2 A;  2E7Z A;  3M3Y I;  1VQN 1;  3GTO I;  1USP B;  1VQP Z;  3S16 I;  3G71 Z;  2DE7 A;  2KI7 B;  2QEX 1;  1VQ6 Z;  3HOV I;  4E2W A;  4NH1 C;  1YIT 1;  4NBH A;  4NBD A;  4A3B I;  2O53 A;  1NUI A;  1KQS Z;  3G6E 1;  2QRE B;  2V3V A;  3HKZ A;  3NH8 A;  1VQ9 1;  4NBF A;  2JIP A;  1VQM Z;  1YI2 1;  3CCR 1;  1RO0 A;  2QLV B;  2NAP A;  3TE5 B;  1RLY A;  3GTL I;  1K83 I;  2AYD A;  3CCV 1;  4MRI A;  5D1P A;  1VQK 1;  5T67 A;  3S2D I;  1L1O C;  5D1O A;  2K5R A;  4NB8 A;  4HGZ A;  3CCS 1;  1N8R 2;  1YUA A;  4A3M I;  1X3W A;  3EED A;  4A3F I;  1VQ7 1;  3G4S 1;  4S1T A;  3CCL Z;  3JAM b;  2WAQ A;  1FDO A;  4RVF A;  3CCM Z;  1VQL Z;  2V45 A;  1S72 Z;  1K73 1;  2JA6 I;  3J81 b;  2RT9 A;  3KIF A;  4HGY A;  1Q86 2;  1P9N A;  3D6W A;  1M90 2;  3CCJ 1;  2M6N A;  4XX2 A;  3ESW A;  4NBE A;  3CD6 Z;  4E30 A;  1TWH I;  4MH4 A;  3CMA Z;  1NJI 1;  3IF8 A;  2AKL A;  2OTL 1;  1QVF Z;  2J6A A;  2F4M A;  4A3L I;  2W04 A;  3NH5 A;  3CQZ I;  3IX0 A;  1VQO 1;  1Q16 A;  4NBG A;  2LFU A;  4NOZ A;  4MXU A;  5FLX b;  5A2Q b;  1K8A 2;  3S15 I;  2ZAE B;  2B63 I;  2LEX A;  3G6E Z;  4A3I I;  2QA4 Z;  1YHQ 1;  3CME 1;  4BBR I;  5IT9 b;  1VQ9 Z;  1YI2 Z;  3CCR Z;  2RBL A;  1VQ4 1;  3S14 I;  3GTM S;  4E2X A;  1N2F A;  3HOY I;  2NVT I;  3CCU 1;  4NBB A;  1YIJ 1;  1YJN Z;  1Y1V I;  1N8R 1;  3OW2 Y;  2K3R A;  1ML8 A;  1YJ9 Z;  3MZK B;  4MD7 A;  3NDJ A;  4A3G I;  1VQ8 1;  2JIR A;  1Q82 1;  1I6H I;  3D2L A;  3TDH B;  2JIO A;  5T6B A;  1K9M 2;  1X3Z A;  3CXC Y;  1Q86 1;  5LL6 f;  3CCQ 1;  2LIY A;  2WB1 A;  2E9H A;  3CPW Y;  1M90 1;  3CCE Z;  1I50 I;  2QKD A;  2QR1 B;  2JR6 A;  4A3K I;  4RVH A;  2Y0S A;  1NP6 A;  3CC4 1;  5IP9 I;  3CC2 1;  3HOW I;  1W2B Y;  1M1K 1;  1RNI A;  3I55 1;  1QVG Z;  2VUM I;  4E33 A;  5FLM I;  2OTJ 1;  4RVD A;  3VB9 A;  1TWF I;  1Y8C A;  3HOX I;  3VTN A;  4NBA A;  4BY1 I;  1YHQ Z;  1YJW 1;  2JS4 A;  2O4H A;  1KC8 2;  1RO4 A;  1VQ5 1;  4DGL A;  1VQ4 Z;  2JA7 I;  3LUS A;  2VPX A;  2W03 A;  2DE6 A;  3QWU A;  3VMH A;  3MON A;  1YIJ Z;  2VF1 A;  1Q7Y 2;  2JNY A;  3CC7 Z;  2R93 I;  3BG0 B;  3S1M I;  3I56 Z;  4BXX I;  1WJ2 A;  1TWG I;  3KIH A;  3D9X A;  3VMG A;  1K9M 1;  4HH4 A;  3GTJ I;  3J80 f;  2HF1 A;  1Z02 A;  3CCQ Z;  4E2Y A;  3GTQ I;  3OW2 Z;  1S7M A;  5C3E I;  2IZ3 A;  1VQN Z;  1LQL A;  2QEX Z;  3S1R I;  1VQP 1;  3G71 1;  1Z03 A;  1VQ6 1; 
#chains in the Genus database with same CATH homology
 2JUB A;  2H85 A;  2QRD B;  1YIT Z;  2VUG A;  1QF8 A;  3CXC Z;  3S1N I;  3CC4 Z;  3CC2 Z;  3FQM A;  3CPW Z;  3PO3 S;  1ZH1 A;  1VQM 1;  2OTJ Z;  2R92 I;  3CCV Z;  1VQK Z;  3M4O I;  3T4N B;  1TFI A;  4Y52 I;  2I3C A;  3GTM I;  3HOZ I;  2PM9 A;  5IP7 I;  3CCS Z;  1DL6 A;  1W2B Z;  2QRC B;  3RZO I;  2IZ4 A;  2R7Z I;  1KC8 1;  1VQ5 Z;  1KRL A;  1VQ7 Z;  3G4S Z;  1Q81 2;  4EWC A;  4NB9 A;  3CCL 1;  4X6A I;  1KD1 2;  1Q7Y 1;  3CCM 1;  3GCF A;  4E2Z A;  1VQL 1;  1WII A;  1S72 1;  1ZB8 A;  2NVX I;  1K73 2;  4CL1 A;  2BJO A;  2RPR A;  2YU9 I;  3JAM f;  2V8J A;  3CCJ Z;  1R9T I;  2OOX B;  2GTI A;  4MON A;  4A3E I;  1JWH C;  3CD6 1;  3BG1 B;  3J81 f;  3RZD I;  1YUK A;  3CMA 1;  1JJ2 Y;  2OTL Z;  3S2H I;  2F4O A;  5C4X I;  2KPI A;  2E2H I;  3I4M I;  4QTU A;  3GKQ A;  2PK7 A;  1VQO Z;  5CM2 M;  2RIQ A;  1VLA A;  3Q87 A;  3VMI A;  1ZB9 A;  2P28 A;  4BY7 I;  4MD9 A;  1PFT A;  3PO2 I;  2HU9 A;  1K8A 1;  3CME Z;  3H0G I;  4RS4 A;  3GTG I;  3FKI I;  2GTH A;  3NDI A;  2QA4 1;  5FLX f;  1I3Q I;  4AYB A;  5A2Q f;  3MZL B;  4RVG A;  3CCU Z;  2NVY I;  4E32 A;  5IT9 f;  3GTP I;  4A3C I;  1YJN 1;  3NH4 A;  2EGT A;  4TNU A;  1WW9 A;  2JA5 I;  2JA8 I;  4RV9 A;  3F3P C;  1Q81 1;  2JMO A;  1YJ9 1;  3H3V J;  5C4J I;  1VQ8 Z;  3J7A 4;  4A3D I;  1KD1 1;  1USP A;  1Q82 2;  3F3F C;  3S1Q I;  1KQS Y;  1Z01 A;  2E2I I;  2M48 A;  3IFU A;  5T64 A;  3CCE 1;  1QVG Y;  3P5J B;  4NBC A;  3U50 C;  4A93 I;  2V8K A;  3HOU I;  4QTT A;  2OZK A;  1WCM I;  2P3Y A;  4E31 A;  1Y1W I;  3I55 Z;  1M1K 2;  3NFZ A;  1TWC I;  2YAD A;  1RQF A;  3PO3 I;  3FQQ A;  1JJ2 Z;  1YJW Z;  3I4N I;  2PMZ A;  2NVQ I;  3I07 A;  4DK1 A;  1QYP A;  5C44 I;  2R6M A;  4BBS I;  2V8I A;  5AN9 F;  1Y1V S;  4DQY B;  2E2J I;  1QVF Y;  3S17 I;  3CC7 1;  4A3J I;  2RHB A;  3J80 b;  3EER A;  1TWA I;  4NFR A;  3I56 1;  3GTK I;  1X0T A;  1SFO I;  2OOY B;  2Q51 A;  4MD8 A;  2G2K A;  2DE5 A;  4Y7N I;  5D1O B;  1NJI 2;  2Q4Z A;  3K7A I;  2GU2 A;  1RO2 A;  3M3Y I;  1VQN 1;  3GTO I;  1USP B;  1VQP Z;  3S16 I;  3G71 Z;  2DE7 A;  2KI7 B;  2QEX 1;  1VQ6 Z;  3HOV I;  4E2W A;  4NH1 C;  1YIT 1;  4NBH A;  4NBD A;  4A3B I;  2O53 A;  1NUI A;  1KQS Z;  3G6E 1;  2QRE B;  3HKZ A;  3NH8 A;  1VQ9 1;  4NBF A;  1VQM Z;  1YI2 1;  3CCR 1;  1RO0 A;  2QLV B;  3TE5 B;  1RLY A;  3GTL I;  1K83 I;  3CCV 1;  4MRI A;  5D1P A;  1VQK 1;  5T67 A;  3S2D I;  1L1O C;  5D1O A;  2K5R A;  4NB8 A;  4HGZ A;  3CCS 1;  1N8R 2;  1YUA A;  4A3M I;  1X3W A;  3EED A;  4A3F I;  1VQ7 1;  3G4S 1;  4S1T A;  3CCL Z;  3JAM b;  2WAQ A;  4RVF A;  3CCM Z;  1VQL Z;  1S72 Z;  1K73 1;  2JA6 I;  3J81 b;  2RT9 A;  3KIF A;  4HGY A;  1Q86 2;  1P9N A;  3D6W A;  1M90 2;  3CCJ 1;  2M6N A;  4XX2 A;  3ESW A;  4NBE A;  3CD6 Z;  4E30 A;  1TWH I;  4MH4 A;  3CMA Z;  1NJI 1;  3IF8 A;  2AKL A;  2OTL 1;  1QVF Z;  2J6A A;  2F4M A;  4A3L I;  2W04 A;  3NH5 A;  3CQZ I;  3IX0 A;  1VQO 1;  4NBG A;  2LFU A;  4NOZ A;  4MXU A;  5FLX b;  5A2Q b;  1K8A 2;  3S15 I;  2ZAE B;  2B63 I;  3G6E Z;  4A3I I;  2QA4 Z;  1YHQ 1;  3CME 1;  4BBR I;  5IT9 b;  1VQ9 Z;  1YI2 Z;  3CCR Z;  2RBL A;  1VQ4 1;  3S14 I;  3GTM S;  4E2X A;  1N2F A;  3HOY I;  2NVT I;  3CCU 1;  4NBB A;  1YIJ 1;  1YJN Z;  1Y1V I;  1N8R 1;  3OW2 Y;  2K3R A;  1ML8 A;  1YJ9 Z;  3MZK B;  4MD7 A;  3NDJ A;  4A3G I;  1VQ8 1;  1Q82 1;  1I6H I;  3TDH B;  5T6B A;  1K9M 2;  1X3Z A;  3CXC Y;  1Q86 1;  5LL6 f;  3CCQ 1;  2LIY A;  2WB1 A;  2E9H A;  3CPW Y;  1M90 1;  3CCE Z;  1I50 I;  2QKD A;  2QR1 B;  2JR6 A;  4A3K I;  4RVH A;  2Y0S A;  1NP6 A;  3CC4 1;  5IP9 I;  3CC2 1;  3HOW I;  1W2B Y;  1M1K 1;  1RNI A;  3I55 1;  1QVG Z;  2VUM I;  4E33 A;  5FLM I;  2OTJ 1;  4RVD A;  3VB9 A;  1TWF I;  3HOX I;  3VTN A;  4NBA A;  4BY1 I;  1YHQ Z;  1YJW 1;  2JS4 A;  2O4H A;  1KC8 2;  1RO4 A;  1VQ5 1;  4DGL A;  1VQ4 Z;  2JA7 I;  3LUS A;  2W03 A;  2DE6 A;  3QWU A;  3VMH A;  3MON A;  1YIJ Z;  2VF1 A;  1Q7Y 2;  2JNY A;  3CC7 Z;  2R93 I;  3BG0 B;  3S1M I;  3I56 Z;  4BXX I;  1TWG I;  3KIH A;  3D9X A;  3VMG A;  1K9M 1;  4HH4 A;  3GTJ I;  3J80 f;  2HF1 A;  1Z02 A;  3CCQ Z;  4E2Y A;  3GTQ I;  3OW2 Z;  1S7M A;  5C3E I;  2IZ3 A;  1VQN Z;  1LQL A;  2QEX Z;  3S1R I;  1VQP 1;  3G71 1;  1Z03 A;  1VQ6 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...