2OOYB

Crystal structure of the adenylate sensor from amp-activated protein kinase complexed with atp
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
92
structure length
92
Chain Sequence
EQYSTEIPAFLTSNTLQELKLPKPPSLPPHLEKCILNSNTAYKEDQSVLPNPNHVLLNHLAAANTQLGVLALSATTRYHRKYVTTAMFKNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SNF1-like protein kinase ssp2
publication title Crystal structures of the adenylate sensor from fission yeast AMP-activated protein kinase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 3
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ooyB01
2QREB 2OOXB 3TDHB 3TE5B 2OOYB 2QRDB 3T4NB 2QR1B 2QLVB 2QRCB
chains in the Genus database with same CATH superfamily
3CCSZ 1NUIA 3BG0B 5IT9f 1ML8A 2JR6A 1TWFI 1VQ71 3CMA1 1X3WA 2W03A 1FDOA 1M901 3CCV1 4EWCA 1Q811 4BY1I 3PO3I 1Y1VS 4BY7I 2NVTI 1QVGZ 2J6AA 1JJ2Y 3CPWY 2EGTA 1VLAA 1YJNZ 2YU9I 5C4XI 1K8A1 3GTKI 2DE5A 2JIRA 4HGYA 1YJ91 4NBDA 4E31A 3J81f 3CCLZ 1Y8CA 3GCFA 2NVYI 5CM2M 3CQZI 5FLMI 1YHQZ 1YITZ 1I3QI 4MRIA 2O53A 3CXCZ 5LL6f 4MD9A 3TDHB 1Q822 4NH1C 2IV2X 2GU2A 1VQP1 1YIJZ 2OTL1 1VQ61 3VMHA 2PK7A 2Q4ZA 3HOVI 1Q16A 3IR7A 3S1QI 2Q51A 1RQFA 3CCMZ 1FDIA 4XX2A 3F3FC 2I3CA 3CC21 3VMGA 3HOYI 1R9TI 3M3YI 4E2YA 4E2WA 1VQ91 3I551 1JWHC 1RO2A 1Z01A 3I4NI 1QYPA 2M48A 3HOUI 2NVQI 3S2DI 1M1K1 4BBSI 3J80f 1Q821 3S1RI 1PFTA 3GTLI 1DL6A 3CCJZ 3CCUZ 2P3YA 4A3CI 1X3ZA 4NBAA 1KC81 1ZH1A 1YI21 4A3MI 3CCRZ 2W04A 1K732 2DE7A 3KIFA 3VB9A 4CL1A 1KD12 2LFUA 4MH4A 4A3FI 3J81b 1S72Z 2JIMA 2E7ZA 3T4NB 1YJN1 1KQSZ 4MONA 1RNIA 2E2HI 4E2XA 2JUBA 4QTUA 2JNYA 3CCL1 1N8R2 5C3EI 1K9M1 2P28A 3P5JB 2JMOA 3S15I 3RZDI 3MZLB 5D1OB 1YHQ1 2WB1A 3NH8A 2G2KA 4DK1A 4NBEA 3D6WA 3NDIA 2OOYB 4RVGA 2QA4Z 2JA5I 3GTQI 2H85A 4AYBA 3TE5B 1WW9A 3BG1B 4RVFA 2B63I 4E33A 1VQK1 2JS4A 4NBGA 1VQ8Z 3GTJI 1WJ2A 3D9XA 2PM9A 2VF1A 4E2ZA 3CCM1 3CC7Z 3J80b 4E32A 4NBFA 3CC4Z 2V8KA 1VQMZ 2OTJ1 1RO4A 1Q861 2E2JI 2NVXI 1YJW1 3OW2Y 2QKDA 3PO2I 3CCJ1 2RHBA 1P9NA 2Y0SA 4RV9A 3CCEZ 1I6HI 3M4OI 3ESWA 4RS4A 2ZAEB 3CCR1 1VQNZ 4DGLA 1Z02A 3HKZA 3G6EZ 5AN9F 3G71Z 3IX0A 3NDJA 1S721 1TWCI 4BBRI 2V45A 3G4SZ 5A2Qf 2O4HA 3CMEZ 3CCQ1 3CD6Z 1ZB9A 3GTPI 1SIWA 1L1OC 3CPWZ 1JJ2Z 2F4OA 2QRDB 4NOZA 2JA8I 3S2HI 4HGZA 1S7MA 1VQO1 2KI7B 1Q7Y2 3U50C 2QREB 2VUMI 2E9HA 3I07A 2K5RA 4NBCA 3K7AI 1X0TA 1YUAA 3I56Z 1VQ41 3FQMA 3GTOI 3CCS1 2NAPA 1VQ7Z 3CMAZ 2QRCB 2R7ZI 2VUGA 3CCVZ 2BJOA 3S14I 2M6NA 2LIYA 1W2BY 1AA6A 2VPXA 3NH4A 2V3VA 2GTIA 4MD7A 2GTHA 3NH5A 2DE6A 3S1NI 2QEXZ 3GKQA 3CCE1 2F4MA 1ZB8A 3FQQA 2RIQA 3JAMb 1I50I 2JIPA 4A3II 3FKII 4X6AI 1VQN1 2VPYA 4Y52I 1K731 5A2Qb 1QF8A 1YIT1 1KD11 3GTMS 1QVFY 1KRLA 1TWGI 1WIIA 4NBBA 2OTLZ 3MZKB 1RLYA 1YIJ1 3CME1 1VQ6Z 1M902 1QVGY 1N8R1 2JA7I 1Q812 3CC2Z 2V8IA 2JIOA 4RVHA 1YUKA 3I55Z 3IFUA 2VPZA 3Q87A 4MXUA 3RZOI 2IZ4A 1K8A2 3CCU1 2YADA 2RBLA 2R6MA 3QWUA 3CXCY 1QVFZ 4A3EI 1YI2Z 2RPRA 4NB8A 3H0GI 3HOZI 1WZNA 3GTMI 2IZ3A 3S16I 3JAMf 1WCMI 2E2II 1LQLA 4MD8A 2HU9A 2JA6I 5D1PA 2QEX1 1NP6A 4NB9A 3HOXI 3OW2Z 1SFOI 3VTNA 3J7A4 4BXXI 1VQ5Z 4A3JI 4S1TA 2R93I 2V8JA 5IP7I 2LEXA 1M1K2 4TNUA 3NFZA 1VQLZ 3EEDA 1Z03A 2QA41 1TWHI 2R92I 5FLXf 2QR1B 3IF8A 1KC82 2QLVB 1VQKZ 4QTTA 1VQ81 1USPA 1Y1VI 3CC71 4NFRA 1KQSY 2RT9A 3I4MI 3CC41 4A3LI 2OTJZ 1VQM1 5IT9b 1QXFA 1YJWZ 5C44I 2K3RA 1Q7Y1 4E30A 5C4JI 4A3DI 2VPWA 2OZKA 3F3PC 2WAQA 4Y7NI 3H3VJ 1YJ9Z 1K9M2 5D1OA 3VMIA 4DQYB 1K83I 5T67A 3GTGI 1TWAI 4NBHA 5T6BA 3G6E1 3G711 1USPB 2HF1A 3MONA 1N2FA 3PO3S 3HOWI 3D2LA 1NJI2 4A3BI 1RO0A 1W2BZ 3LUSA 2KPIA 4RVDA 3G4S1 1VQPZ 2OOXB 3CCQZ 2AYDA 5IP9I 3CD61 5T64A 4A3GI 4A93I 4HH4A 3EERA 3S17I 1Y1WI 2AKLA 2JIQA 1VQOZ 1Q862 1TFIA 3S1MI 1VQ51 5FLXb 1VQ9Z 1VQL1 1NJI1 2PMZA 3KIHA 1VQ4Z 4A3KI 3I561
chains in the Genus database with same CATH topology
3CCSZ 1NUIA 3BG0B 5IT9f 1ML8A 2JR6A 1TWFI 1VQ71 3CMA1 1X3WA 2W03A 1M901 3CCV1 4EWCA 1Q811 4BY1I 3PO3I 1Y1VS 4BY7I 2NVTI 1QVGZ 2J6AA 1JJ2Y 3CPWY 2EGTA 1VLAA 1YJNZ 2YU9I 5C4XI 1K8A1 3GTKI 2DE5A 4HGYA 1YJ91 4NBDA 4E31A 3J81f 3CCLZ 3GCFA 2NVYI 5CM2M 3CQZI 5FLMI 1YHQZ 1YITZ 1I3QI 4MRIA 2O53A 3CXCZ 5LL6f 4MD9A 3TDHB 1Q822 4NH1C 2GU2A 1VQP1 1YIJZ 2OTL1 1VQ61 3VMHA 2PK7A 2Q4ZA 3HOVI 3S1QI 2Q51A 1RQFA 3CCMZ 4XX2A 3F3FC 2I3CA 3CC21 3VMGA 3HOYI 1R9TI 3M3YI 4E2YA 4E2WA 1VQ91 3I551 1RO2A 1JWHC 1Z01A 3I4NI 1QYPA 2M48A 3HOUI 2NVQI 3S2DI 1M1K1 4BBSI 3J80f 1Q821 3S1RI 1PFTA 3GTLI 1DL6A 3CCJZ 3CCUZ 2P3YA 4A3CI 1X3ZA 4NBAA 1KC81 1ZH1A 1YI21 4A3MI 3CCRZ 2W04A 1K732 2DE7A 3KIFA 3VB9A 4CL1A 1KD12 2LFUA 4MH4A 4A3FI 3J81b 1S72Z 3T4NB 1YJN1 1KQSZ 4MONA 1RNIA 2E2HI 4E2XA 2JUBA 4QTUA 2JNYA 3CCL1 1N8R2 5C3EI 1K9M1 2P28A 3P5JB 2JMOA 3S15I 3RZDI 3MZLB 5D1OB 1YHQ1 2WB1A 3NH8A 2G2KA 4DK1A 4NBEA 3D6WA 3NDIA 2OOYB 4RVGA 2QA4Z 2JA5I 3GTQI 2H85A 4AYBA 3TE5B 1WW9A 3BG1B 4RVFA 2B63I 4E33A 1VQK1 2JS4A 4NBGA 1VQ8Z 3GTJI 3D9XA 2PM9A 2VF1A 4E2ZA 3CCM1 3CC7Z 3J80b 4E32A 4NBFA 3CC4Z 2V8KA 1VQMZ 2OTJ1 1RO4A 1Q861 2E2JI 2NVXI 1YJW1 3OW2Y 2QKDA 3PO2I 3CCJ1 2RHBA 1P9NA 2Y0SA 4RV9A 3CCEZ 1I6HI 3M4OI 3ESWA 4RS4A 2ZAEB 3CCR1 1VQNZ 4DGLA 1Z02A 3HKZA 3G6EZ 5AN9F 3G71Z 3IX0A 3NDJA 1S721 1TWCI 4BBRI 3G4SZ 5A2Qf 2O4HA 3CMEZ 3CCQ1 3CD6Z 1ZB9A 3GTPI 1L1OC 3CPWZ 1JJ2Z 2F4OA 2QRDB 4NOZA 2JA8I 3S2HI 4HGZA 1S7MA 1VQO1 2KI7B 1Q7Y2 3U50C 2QREB 2VUMI 2E9HA 3I07A 2K5RA 4NBCA 3K7AI 1X0TA 1YUAA 3I56Z 1VQ41 3FQMA 3GTOI 3CCS1 1VQ7Z 3CMAZ 2QRCB 2R7ZI 2VUGA 3CCVZ 2BJOA 3S14I 2M6NA 2LIYA 1W2BY 3NH4A 2GTIA 4MD7A 2GTHA 3NH5A 2DE6A 3S1NI 2QEXZ 3GKQA 3CCE1 2F4MA 1ZB8A 3FQQA 2RIQA 3JAMb 1I50I 4A3II 3FKII 4X6AI 1VQN1 4Y52I 1K731 5A2Qb 1QF8A 1YIT1 1KD11 3GTMS 1QVFY 1KRLA 1TWGI 1WIIA 4NBBA 2OTLZ 3MZKB 1RLYA 1YIJ1 3CME1 1VQ6Z 1M902 1QVGY 1N8R1 2JA7I 1Q812 3CC2Z 2V8IA 4RVHA 1YUKA 3I55Z 3IFUA 3Q87A 4MXUA 3RZOI 2IZ4A 1K8A2 3CCU1 2YADA 2RBLA 2R6MA 3QWUA 3CXCY 1QVFZ 4A3EI 1YI2Z 2RPRA 4NB8A 3H0GI 3HOZI 3GTMI 2IZ3A 3S16I 3JAMf 1WCMI 2E2II 1LQLA 4MD8A 2HU9A 2JA6I 5D1PA 2QEX1 1NP6A 4NB9A 3HOXI 3OW2Z 1SFOI 3VTNA 3J7A4 4BXXI 1VQ5Z 4A3JI 4S1TA 2R93I 2V8JA 5IP7I 1M1K2 4TNUA 3NFZA 1VQLZ 3EEDA 1Z03A 2QA41 1TWHI 2R92I 5FLXf 2QR1B 3IF8A 1KC82 2QLVB 1VQKZ 4QTTA 1VQ81 1USPA 1Y1VI 3CC71 4NFRA 1KQSY 2RT9A 3I4MI 3CC41 4A3LI 2OTJZ 1VQM1 5IT9b 1YJWZ 5C44I 2K3RA 1Q7Y1 4E30A 5C4JI 4A3DI 2OZKA 3F3PC 2WAQA 4Y7NI 3H3VJ 1YJ9Z 1K9M2 5D1OA 3VMIA 4DQYB 1K83I 5T67A 3GTGI 1TWAI 4NBHA 5T6BA 3G6E1 3G711 1USPB 2HF1A 3MONA 1N2FA 3PO3S 3HOWI 4A3BI 1NJI2 1RO0A 1W2BZ 3LUSA 2KPIA 4RVDA 3G4S1 1VQPZ 2OOXB 3CCQZ 5IP9I 3CD61 5T64A 4A3GI 4A93I 4HH4A 3EERA 3S17I 1Y1WI 2AKLA 1VQOZ 1Q862 1TFIA 3S1MI 1VQ51 5FLXb 1VQ9Z 1VQL1 1NJI1 2PMZA 3KIHA 1VQ4Z 4A3KI 3I561
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QRE B;  2OOX B;  3TDH B;  3TE5 B;  2OOY B;  2QRD B;  3T4N B;  2QR1 B;  2QLV B;  2QRC B; 
#chains in the Genus database with same CATH topology
 3CCS Z;  1NUI A;  3BG0 B;  5IT9 f;  1ML8 A;  2JR6 A;  1TWF I;  1VQ7 1;  3CMA 1;  1X3W A;  2W03 A;  1FDO A;  1M90 1;  3CCV 1;  4EWC A;  1Q81 1;  4BY1 I;  3PO3 I;  1Y1V S;  4BY7 I;  2NVT I;  1QVG Z;  2J6A A;  1JJ2 Y;  3CPW Y;  2EGT A;  1VLA A;  1YJN Z;  2YU9 I;  5C4X I;  1K8A 1;  3GTK I;  2DE5 A;  2JIR A;  4HGY A;  1YJ9 1;  4NBD A;  4E31 A;  3J81 f;  3CCL Z;  1Y8C A;  3GCF A;  2NVY I;  5CM2 M;  3CQZ I;  5FLM I;  1YHQ Z;  1YIT Z;  1I3Q I;  4MRI A;  2O53 A;  3CXC Z;  5LL6 f;  4MD9 A;  3TDH B;  1Q82 2;  4NH1 C;  2IV2 X;  2GU2 A;  1VQP 1;  1YIJ Z;  2OTL 1;  1VQ6 1;  3VMH A;  2PK7 A;  2Q4Z A;  3HOV I;  1Q16 A;  3IR7 A;  3S1Q I;  2Q51 A;  1RQF A;  3CCM Z;  1FDI A;  4XX2 A;  3F3F C;  2I3C A;  3CC2 1;  3VMG A;  3HOY I;  1R9T I;  3M3Y I;  4E2Y A;  4E2W A;  1VQ9 1;  3I55 1;  1JWH C;  1RO2 A;  1Z01 A;  3I4N I;  1QYP A;  2M48 A;  3HOU I;  2NVQ I;  3S2D I;  1M1K 1;  4BBS I;  3J80 f;  1Q82 1;  3S1R I;  1PFT A;  3GTL I;  1DL6 A;  3CCJ Z;  3CCU Z;  2P3Y A;  4A3C I;  1X3Z A;  4NBA A;  1KC8 1;  1ZH1 A;  1YI2 1;  4A3M I;  3CCR Z;  2W04 A;  1K73 2;  2DE7 A;  3KIF A;  3VB9 A;  4CL1 A;  1KD1 2;  2LFU A;  4MH4 A;  4A3F I;  3J81 b;  1S72 Z;  2JIM A;  2E7Z A;  3T4N B;  1YJN 1;  1KQS Z;  4MON A;  1RNI A;  2E2H I;  4E2X A;  2JUB A;  4QTU A;  2JNY A;  3CCL 1;  1N8R 2;  5C3E I;  1K9M 1;  2P28 A;  3P5J B;  2JMO A;  3S15 I;  3RZD I;  3MZL B;  5D1O B;  1YHQ 1;  2WB1 A;  3NH8 A;  2G2K A;  4DK1 A;  4NBE A;  3D6W A;  3NDI A;  2OOY B;  4RVG A;  2QA4 Z;  2JA5 I;  3GTQ I;  2H85 A;  4AYB A;  3TE5 B;  1WW9 A;  3BG1 B;  4RVF A;  2B63 I;  4E33 A;  1VQK 1;  2JS4 A;  4NBG A;  1VQ8 Z;  3GTJ I;  1WJ2 A;  3D9X A;  2PM9 A;  2VF1 A;  4E2Z A;  3CCM 1;  3CC7 Z;  3J80 b;  4E32 A;  4NBF A;  3CC4 Z;  2V8K A;  1VQM Z;  2OTJ 1;  1RO4 A;  1Q86 1;  2E2J I;  2NVX I;  1YJW 1;  3OW2 Y;  2QKD A;  3PO2 I;  3CCJ 1;  2RHB A;  1P9N A;  2Y0S A;  4RV9 A;  3CCE Z;  1I6H I;  3M4O I;  3ESW A;  4RS4 A;  2ZAE B;  3CCR 1;  1VQN Z;  4DGL A;  1Z02 A;  3HKZ A;  3G6E Z;  5AN9 F;  3G71 Z;  3IX0 A;  3NDJ A;  1S72 1;  1TWC I;  4BBR I;  2V45 A;  3G4S Z;  5A2Q f;  2O4H A;  3CME Z;  3CCQ 1;  3CD6 Z;  1ZB9 A;  3GTP I;  1SIW A;  1L1O C;  3CPW Z;  1JJ2 Z;  2F4O A;  2QRD B;  4NOZ A;  2JA8 I;  3S2H I;  4HGZ A;  1S7M A;  1VQO 1;  2KI7 B;  1Q7Y 2;  3U50 C;  2QRE B;  2VUM I;  2E9H A;  3I07 A;  2K5R A;  4NBC A;  3K7A I;  1X0T A;  1YUA A;  3I56 Z;  1VQ4 1;  3FQM A;  3GTO I;  3CCS 1;  2NAP A;  1VQ7 Z;  3CMA Z;  2QRC B;  2R7Z I;  2VUG A;  3CCV Z;  2BJO A;  3S14 I;  2M6N A;  2LIY A;  1W2B Y;  1AA6 A;  2VPX A;  3NH4 A;  2V3V A;  2GTI A;  4MD7 A;  2GTH A;  3NH5 A;  2DE6 A;  3S1N I;  2QEX Z;  3GKQ A;  3CCE 1;  2F4M A;  1ZB8 A;  3FQQ A;  2RIQ A;  3JAM b;  1I50 I;  2JIP A;  4A3I I;  3FKI I;  4X6A I;  1VQN 1;  2VPY A;  4Y52 I;  1K73 1;  5A2Q b;  1QF8 A;  1YIT 1;  1KD1 1;  3GTM S;  1QVF Y;  1KRL A;  1TWG I;  1WII A;  4NBB A;  2OTL Z;  3MZK B;  1RLY A;  1YIJ 1;  3CME 1;  1VQ6 Z;  1M90 2;  1QVG Y;  1N8R 1;  2JA7 I;  1Q81 2;  3CC2 Z;  2V8I A;  2JIO A;  4RVH A;  1YUK A;  3I55 Z;  3IFU A;  2VPZ A;  3Q87 A;  4MXU A;  3RZO I;  2IZ4 A;  1K8A 2;  3CCU 1;  2YAD A;  2RBL A;  2R6M A;  3QWU A;  3CXC Y;  1QVF Z;  4A3E I;  1YI2 Z;  2RPR A;  4NB8 A;  3H0G I;  3HOZ I;  1WZN A;  3GTM I;  2IZ3 A;  3S16 I;  3JAM f;  1WCM I;  2E2I I;  1LQL A;  4MD8 A;  2HU9 A;  2JA6 I;  5D1P A;  2QEX 1;  1NP6 A;  4NB9 A;  3HOX I;  3OW2 Z;  1SFO I;  3VTN A;  3J7A 4;  4BXX I;  1VQ5 Z;  4A3J I;  4S1T A;  2R93 I;  2V8J A;  5IP7 I;  2LEX A;  1M1K 2;  4TNU A;  3NFZ A;  1VQL Z;  3EED A;  1Z03 A;  2QA4 1;  1TWH I;  2R92 I;  5FLX f;  2QR1 B;  3IF8 A;  1KC8 2;  2QLV B;  1VQK Z;  4QTT A;  1VQ8 1;  1USP A;  1Y1V I;  3CC7 1;  4NFR A;  1KQS Y;  2RT9 A;  3I4M I;  3CC4 1;  4A3L I;  2OTJ Z;  1VQM 1;  5IT9 b;  1QXF A;  1YJW Z;  5C44 I;  2K3R A;  1Q7Y 1;  4E30 A;  5C4J I;  4A3D I;  2VPW A;  2OZK A;  3F3P C;  2WAQ A;  4Y7N I;  3H3V J;  1YJ9 Z;  1K9M 2;  5D1O A;  3VMI A;  4DQY B;  1K83 I;  5T67 A;  3GTG I;  1TWA I;  4NBH A;  5T6B A;  3G6E 1;  3G71 1;  1USP B;  2HF1 A;  3MON A;  1N2F A;  3PO3 S;  3HOW I;  3D2L A;  1NJI 2;  4A3B I;  1RO0 A;  1W2B Z;  3LUS A;  2KPI A;  4RVD A;  3G4S 1;  1VQP Z;  2OOX B;  3CCQ Z;  2AYD A;  5IP9 I;  3CD6 1;  5T64 A;  4A3G I;  4A93 I;  4HH4 A;  3EER A;  3S17 I;  1Y1W I;  2AKL A;  2JIQ A;  1VQO Z;  1Q86 2;  1TFI A;  3S1M I;  1VQ5 1;  5FLX b;  1VQ9 Z;  1VQL 1;  1NJI 1;  2PMZ A;  3KIH A;  1VQ4 Z;  4A3K I;  3I56 1; 
#chains in the Genus database with same CATH homology
 3CCS Z;  1NUI A;  3BG0 B;  5IT9 f;  1ML8 A;  2JR6 A;  1TWF I;  1VQ7 1;  3CMA 1;  1X3W A;  2W03 A;  1M90 1;  3CCV 1;  4EWC A;  1Q81 1;  4BY1 I;  3PO3 I;  1Y1V S;  4BY7 I;  2NVT I;  1QVG Z;  2J6A A;  1JJ2 Y;  3CPW Y;  2EGT A;  1VLA A;  1YJN Z;  2YU9 I;  5C4X I;  1K8A 1;  3GTK I;  2DE5 A;  4HGY A;  1YJ9 1;  4NBD A;  4E31 A;  3J81 f;  3CCL Z;  3GCF A;  2NVY I;  5CM2 M;  3CQZ I;  5FLM I;  1YHQ Z;  1YIT Z;  1I3Q I;  4MRI A;  2O53 A;  3CXC Z;  5LL6 f;  4MD9 A;  3TDH B;  1Q82 2;  4NH1 C;  2GU2 A;  1VQP 1;  1YIJ Z;  2OTL 1;  1VQ6 1;  3VMH A;  2PK7 A;  2Q4Z A;  3HOV I;  3S1Q I;  2Q51 A;  1RQF A;  3CCM Z;  4XX2 A;  3F3F C;  2I3C A;  3CC2 1;  3VMG A;  3HOY I;  1R9T I;  3M3Y I;  4E2Y A;  4E2W A;  1VQ9 1;  3I55 1;  1RO2 A;  1JWH C;  1Z01 A;  3I4N I;  1QYP A;  2M48 A;  3HOU I;  2NVQ I;  3S2D I;  1M1K 1;  4BBS I;  3J80 f;  1Q82 1;  3S1R I;  1PFT A;  3GTL I;  1DL6 A;  3CCJ Z;  3CCU Z;  2P3Y A;  4A3C I;  1X3Z A;  4NBA A;  1KC8 1;  1ZH1 A;  1YI2 1;  4A3M I;  3CCR Z;  2W04 A;  1K73 2;  2DE7 A;  3KIF A;  3VB9 A;  4CL1 A;  1KD1 2;  2LFU A;  4MH4 A;  4A3F I;  3J81 b;  1S72 Z;  3T4N B;  1YJN 1;  1KQS Z;  4MON A;  1RNI A;  2E2H I;  4E2X A;  2JUB A;  4QTU A;  2JNY A;  3CCL 1;  1N8R 2;  5C3E I;  1K9M 1;  2P28 A;  3P5J B;  2JMO A;  3S15 I;  3RZD I;  3MZL B;  5D1O B;  1YHQ 1;  2WB1 A;  3NH8 A;  2G2K A;  4DK1 A;  4NBE A;  3D6W A;  3NDI A;  2OOY B;  4RVG A;  2QA4 Z;  2JA5 I;  3GTQ I;  2H85 A;  4AYB A;  3TE5 B;  1WW9 A;  3BG1 B;  4RVF A;  2B63 I;  4E33 A;  1VQK 1;  2JS4 A;  4NBG A;  1VQ8 Z;  3GTJ I;  3D9X A;  2PM9 A;  2VF1 A;  4E2Z A;  3CCM 1;  3CC7 Z;  3J80 b;  4E32 A;  4NBF A;  3CC4 Z;  2V8K A;  1VQM Z;  2OTJ 1;  1RO4 A;  1Q86 1;  2E2J I;  2NVX I;  1YJW 1;  3OW2 Y;  2QKD A;  3PO2 I;  3CCJ 1;  2RHB A;  1P9N A;  2Y0S A;  4RV9 A;  3CCE Z;  1I6H I;  3M4O I;  3ESW A;  4RS4 A;  2ZAE B;  3CCR 1;  1VQN Z;  4DGL A;  1Z02 A;  3HKZ A;  3G6E Z;  5AN9 F;  3G71 Z;  3IX0 A;  3NDJ A;  1S72 1;  1TWC I;  4BBR I;  3G4S Z;  5A2Q f;  2O4H A;  3CME Z;  3CCQ 1;  3CD6 Z;  1ZB9 A;  3GTP I;  1L1O C;  3CPW Z;  1JJ2 Z;  2F4O A;  2QRD B;  4NOZ A;  2JA8 I;  3S2H I;  4HGZ A;  1S7M A;  1VQO 1;  2KI7 B;  1Q7Y 2;  3U50 C;  2QRE B;  2VUM I;  2E9H A;  3I07 A;  2K5R A;  4NBC A;  3K7A I;  1X0T A;  1YUA A;  3I56 Z;  1VQ4 1;  3FQM A;  3GTO I;  3CCS 1;  1VQ7 Z;  3CMA Z;  2QRC B;  2R7Z I;  2VUG A;  3CCV Z;  2BJO A;  3S14 I;  2M6N A;  2LIY A;  1W2B Y;  3NH4 A;  2GTI A;  4MD7 A;  2GTH A;  3NH5 A;  2DE6 A;  3S1N I;  2QEX Z;  3GKQ A;  3CCE 1;  2F4M A;  1ZB8 A;  3FQQ A;  2RIQ A;  3JAM b;  1I50 I;  4A3I I;  3FKI I;  4X6A I;  1VQN 1;  4Y52 I;  1K73 1;  5A2Q b;  1QF8 A;  1YIT 1;  1KD1 1;  3GTM S;  1QVF Y;  1KRL A;  1TWG I;  1WII A;  4NBB A;  2OTL Z;  3MZK B;  1RLY A;  1YIJ 1;  3CME 1;  1VQ6 Z;  1M90 2;  1QVG Y;  1N8R 1;  2JA7 I;  1Q81 2;  3CC2 Z;  2V8I A;  4RVH A;  1YUK A;  3I55 Z;  3IFU A;  3Q87 A;  4MXU A;  3RZO I;  2IZ4 A;  1K8A 2;  3CCU 1;  2YAD A;  2RBL A;  2R6M A;  3QWU A;  3CXC Y;  1QVF Z;  4A3E I;  1YI2 Z;  2RPR A;  4NB8 A;  3H0G I;  3HOZ I;  3GTM I;  2IZ3 A;  3S16 I;  3JAM f;  1WCM I;  2E2I I;  1LQL A;  4MD8 A;  2HU9 A;  2JA6 I;  5D1P A;  2QEX 1;  1NP6 A;  4NB9 A;  3HOX I;  3OW2 Z;  1SFO I;  3VTN A;  3J7A 4;  4BXX I;  1VQ5 Z;  4A3J I;  4S1T A;  2R93 I;  2V8J A;  5IP7 I;  1M1K 2;  4TNU A;  3NFZ A;  1VQL Z;  3EED A;  1Z03 A;  2QA4 1;  1TWH I;  2R92 I;  5FLX f;  2QR1 B;  3IF8 A;  1KC8 2;  2QLV B;  1VQK Z;  4QTT A;  1VQ8 1;  1USP A;  1Y1V I;  3CC7 1;  4NFR A;  1KQS Y;  2RT9 A;  3I4M I;  3CC4 1;  4A3L I;  2OTJ Z;  1VQM 1;  5IT9 b;  1YJW Z;  5C44 I;  2K3R A;  1Q7Y 1;  4E30 A;  5C4J I;  4A3D I;  2OZK A;  3F3P C;  2WAQ A;  4Y7N I;  3H3V J;  1YJ9 Z;  1K9M 2;  5D1O A;  3VMI A;  4DQY B;  1K83 I;  5T67 A;  3GTG I;  1TWA I;  4NBH A;  5T6B A;  3G6E 1;  3G71 1;  1USP B;  2HF1 A;  3MON A;  1N2F A;  3PO3 S;  3HOW I;  4A3B I;  1NJI 2;  1RO0 A;  1W2B Z;  3LUS A;  2KPI A;  4RVD A;  3G4S 1;  1VQP Z;  2OOX B;  3CCQ Z;  5IP9 I;  3CD6 1;  5T64 A;  4A3G I;  4A93 I;  4HH4 A;  3EER A;  3S17 I;  1Y1W I;  2AKL A;  1VQO Z;  1Q86 2;  1TFI A;  3S1M I;  1VQ5 1;  5FLX b;  1VQ9 Z;  1VQL 1;  1NJI 1;  2PMZ A;  3KIH A;  1VQ4 Z;  4A3K I;  3I56 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...