2OOYB

Crystal structure of the adenylate sensor from amp-activated protein kinase complexed with atp
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
92
structure length
92
Chain Sequence
EQYSTEIPAFLTSNTLQELKLPKPPSLPPHLEKCILNSNTAYKEDQSVLPNPNHVLLNHLAAANTQLGVLALSATTRYHRKYVTTAMFKNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SNF1-like protein kinase ssp2
publication title Crystal structures of the adenylate sensor from fission yeast AMP-activated protein kinase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 3
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ooyB01
2QRDB 2QLVB 2QR1B 2QREB 3T4NB 3TE5B 2OOXB 3TDHB 2OOYB 2QRCB
chains in the Genus database with same CATH superfamily
2VPYA 2VUMI 2JR6A 1W2BY 3J80f 3GTLI 4E32A 1VQN1 1FDOA 4RS4A 2OTJ1 1WZNA 1KC81 2OTLZ 3VMGA 3GTMI 4A3CI 2ZAEB 1M1K2 4S1TA 3S16I 1RLYA 5D1PA 4DGLA 2HU9A 1LQLA 1YJ91 3K7AI 1TWGI 1KQSZ 1X3WA 3GTQI 1JWHC 3CD61 1VQ61 3GTJI 3S2DI 4NOZA 4E2XA 1Z02A 3J81f 1I6HI 2DE5A 1M902 4E31A 4HGZA 2BJOA 1YJWZ 1USPA 1QVGY 1VQ41 2JA6I 1QVFY 5T6BA 1WIIA 3NDJA 1X3ZA 2JIOA 4RV9A 1K9M1 1K8A1 2PM9A 1N8R2 2VF1A 2QA4Z 3S1NI 2RHBA 2JIQA 1KD12 3KIFA 3U50C 2QEXZ 3JAMb 4NBCA 3D9XA 2OOXB 1KQSY 1YJNZ 3IX0A 1ZB8A 1VQL1 2R7ZI 3CC41 2R6MA 2K5RA 1VQ5Z 4RVFA 1RNIA 1RO2A 2KI7B 5CM2M 4QTTA 3CCSZ 3OW2Z 3CCM1 3IF8A 4BY7I 2P3YA 4MD7A 2JIMA 3JAMf 4NB9A 1PFTA 4AYBA 4HGYA 3CCR1 4BBSI 2JIPA 1YIT1 2QR1B 4NFRA 3CMAZ 1W2BZ 1VQK1 2B63I 3Q87A 1N2FA 2HF1A 1VQM1 4NH1C 4X6AI 1X0TA 4TNUA 3IFUA 2IZ4A 3S1QI 4BXXI 2VPXA 3LUSA 2JA5I 3MZKB 4A3KI 1S72Z 3GTGI 3M3YI 3CC2Z 4A3DI 1SFOI 2OTL1 4A3MI 2JUBA 2V3VA 3H0GI 2QLVB 3GCFA 1VQOZ 3GTMS 2JS4A 1KC82 1QVGZ 3RZOI 3J81b 1QVFZ 1RQFA 1YI2Z 3HOZI 3ESWA 3NH8A 4DK1A 1VQ71 2R92I 5FLMI 1YJW1 4MXUA 3S15I 3J7A4 2V8JA 1NUIA 3S2HI 3G6EZ 3CCL1 3GTKI 2RPRA 2LIYA 3MZLB 1Q811 2YU9I 3KIHA 1ZB9A 4NBAA 1Q7Y1 3D6WA 2QA41 1WW9A 3H3VJ 1DL6A 1VQ8Z 2QEX1 1K9M2 1K8A2 3CCVZ 1I3QI 1Q16A 3VB9A 4A93I 2M48A 3FQQA 1USPB 1K83I 2LFUA 2Y0SA 3M4OI 2QREB 4QTUA 4HH4A 1YHQZ 2PMZA 3CCQZ 4MH4A 3CCEZ 1VQNZ 3I55Z 3CCS1 2OTJZ 3EERA 3F3FC 1Y1VI 5C3EI 2Q51A 1Z01A 5T64A 2GU2A 1Q861 3CQZI 3FKII 2JA7I 1I50I 3CCJ1 1R9TI 3CXCY 1VQ6Z 1TWHI 3CMA1 3I56Z 4NBFA 2WB1A 2V45A 4NBHA 5C44I 4A3LI 5IP9I 1TWAI 3P5JB 3S1MI 2E9HA 4E2ZA 4NB8A 1K731 1Z03A 3G711 4BY1I 1Y1WI 3GKQA 1S721 4NBEA 1KRLA 3CC21 3CCUZ 3VMIA 4E33A 3VMHA 4NBDA 4A3II 4E2WA 2RIQA 2OOYB 3S14I 2IZ3A 3HOVI 3G4SZ 4E2YA 5C4JI 1VQO1 3I4NI 3NH5A 1NJI1 3D2LA 1AA6A 1VQPZ 4MRIA 4RVGA 1QXFA 1NP6A 2K3RA 2DE6A 1YI21 3CC7Z 3EEDA 4XX2A 2IV2X 5AN9F 1WJ2A 5A2Qf 3CMEZ 1Q821 5IT9b 2H85A 1YUAA 3NDIA 3GTPI 1WCMI 3PO3I 2PK7A 1Y8CA 4MD8A 3G6E1 2P28A 2QKDA 5D1OA 2RT9A 2DE7A 1ZH1A 3F3PC 4EWCA 3T4NB 3FQMA 2VPWA 1JJ2Y 5T67A 1VQ81 1Q812 1QYPA 2Q4ZA 1VLAA 3CCV1 3NH4A 2AKLA 5IT9f 2E2II 2R93I 2O4HA 4A3GI 1YIJZ 4CL1A 4A3JI 1L1OC 1TFIA 4DQYB 1FDIA 1YHQ1 4A3FI 3S1RI 3CCQ1 1YUKA 3CCE1 3CXCZ 2NVXI 3I551 4MD9A 2W04A 2RBLA 1TWFI 4NBGA 1YJN1 1Y1VS 2VUGA 3CPWY 1VQ9Z 1Q862 1VQ51 3I561 3HOXI 1M1K1 2VPZA 1VQ7Z 4NBBA 2WAQA 2NVTI 2YADA 3GTOI 2LEXA 2E2JI 1RO4A 1ML8A 3CCLZ 1M901 3TE5B 1YJ9Z 2I3CA 2E2HI 2NVYI 2QRCB 3CD6Z 3I4MI 3BG1B 3MONA 2E7ZA 3TDHB 3CCU1 5IP7I 1K732 4E30A 3G4S1 2JNYA 1SIWA 1N8R1 4A3BI 1RO0A 1VQ4Z 4A3EI 1KD11 1VQP1 5A2Qb 2QRDB 2M6NA 3CC71 3RZDI 3CME1 1NJI2 3BG0B 4BBRI 3HKZA 1S7MA 3S17I 1P9NA 5FLXb 1JJ2Z 3PO2I 4RVHA 2OZKA 3QWUA 1Q822 2V8IA 4RVDA 1VQLZ 3CCJZ 3PO3S 3CC4Z 2GTIA 2KPIA 2F4OA 2F4MA 3IR7A 4Y7NI 3CCMZ 3NFZA 1YIJ1 5FLXf 3J80b 2JIRA 4Y52I 3CCRZ 2J6AA 2W03A 3VTNA 2GTHA 5D1OB 3G71Z 2NVQI 3CPWZ 3I07A 1YITZ 2NAPA 3HOYI 1TWCI 1VQKZ 5LL6f 3OW2Y 2O53A 2JA8I 1VQMZ 3HOUI 1Q7Y2 3HOWI 2AYDA 2G2KA 1QF8A 4MONA 5C4XI 2V8KA 2EGTA 2JMOA 1VQ91
chains in the Genus database with same CATH topology
2VUMI 2JR6A 1W2BY 3J80f 3GTLI 4E32A 1VQN1 4RS4A 2OTJ1 1KC81 2OTLZ 3GTMI 3VMGA 4A3CI 2ZAEB 1M1K2 4S1TA 3S16I 1RLYA 5D1PA 4DGLA 2HU9A 1LQLA 1YJ91 3K7AI 1TWGI 1KQSZ 1X3WA 3GTQI 1JWHC 3CD61 1VQ61 3GTJI 3S2DI 4NOZA 4E2XA 1Z02A 3J81f 1I6HI 2DE5A 1M902 4E31A 4HGZA 2BJOA 1YJWZ 1USPA 1QVGY 1VQ41 2JA6I 1QVFY 5T6BA 1WIIA 3NDJA 1X3ZA 4RV9A 1K9M1 1K8A1 2PM9A 1N8R2 2VF1A 2QA4Z 3S1NI 2RHBA 1KD12 3KIFA 3U50C 2QEXZ 3JAMb 4NBCA 3D9XA 2OOXB 1KQSY 1YJNZ 3IX0A 1ZB8A 1VQL1 2R7ZI 3CC41 2R6MA 2K5RA 1VQ5Z 4RVFA 1RNIA 1RO2A 2KI7B 5CM2M 4QTTA 3CCSZ 3OW2Z 3CCM1 3IF8A 4BY7I 2P3YA 4MD7A 3JAMf 4NB9A 1PFTA 4AYBA 4HGYA 3CCR1 4BBSI 1YIT1 2QR1B 4NFRA 3CMAZ 1W2BZ 1VQK1 2B63I 3Q87A 1N2FA 2HF1A 1VQM1 4NH1C 4X6AI 1X0TA 4TNUA 3IFUA 2IZ4A 3S1QI 4BXXI 3LUSA 2JA5I 3MZKB 4A3KI 1S72Z 3GTGI 3M3YI 3CC2Z 4A3DI 1SFOI 2OTL1 4A3MI 2JUBA 3H0GI 2QLVB 3GCFA 1VQOZ 3GTMS 2JS4A 1KC82 1QVGZ 3RZOI 3J81b 1QVFZ 1RQFA 1YI2Z 3HOZI 3ESWA 3NH8A 4DK1A 1VQ71 2R92I 5FLMI 1YJW1 4MXUA 3S15I 3J7A4 2V8JA 1NUIA 3S2HI 3G6EZ 3CCL1 3GTKI 2RPRA 2LIYA 3MZLB 1Q811 2YU9I 3KIHA 1ZB9A 4NBAA 1Q7Y1 3D6WA 2QA41 1WW9A 3H3VJ 1DL6A 1VQ8Z 2QEX1 1K9M2 1K8A2 3CCVZ 1I3QI 3VB9A 4A93I 2M48A 3FQQA 1USPB 1K83I 2LFUA 2Y0SA 3M4OI 2QREB 4QTUA 4HH4A 1YHQZ 2PMZA 3CCQZ 4MH4A 3CCEZ 1VQNZ 3I55Z 3CCS1 2OTJZ 3EERA 3F3FC 1Y1VI 5C3EI 2Q51A 1Z01A 5T64A 2GU2A 1Q861 3CQZI 3FKII 2JA7I 1I50I 3CCJ1 1R9TI 3CXCY 1VQ6Z 1TWHI 3CMA1 3I56Z 4NBFA 2WB1A 4NBHA 5C44I 4A3LI 5IP9I 1TWAI 3P5JB 3S1MI 2E9HA 4E2ZA 4NB8A 1K731 1Z03A 3G711 4BY1I 1Y1WI 3GKQA 1S721 4NBEA 1KRLA 3CC21 3CCUZ 3VMIA 4E33A 3VMHA 4NBDA 4A3II 4E2WA 2RIQA 2OOYB 3S14I 2IZ3A 3HOVI 3G4SZ 4E2YA 5C4JI 1VQO1 3I4NI 3NH5A 1NJI1 1VQPZ 4MRIA 4RVGA 1NP6A 2K3RA 2DE6A 1YI21 3CC7Z 3EEDA 4XX2A 5AN9F 5A2Qf 3CMEZ 1Q821 5IT9b 2H85A 1YUAA 3NDIA 3GTPI 1WCMI 3PO3I 2PK7A 4MD8A 3G6E1 2P28A 2QKDA 5D1OA 2RT9A 2DE7A 1ZH1A 3F3PC 4EWCA 3T4NB 3FQMA 1JJ2Y 5T67A 1VQ81 1Q812 1QYPA 2Q4ZA 1VLAA 3CCV1 3NH4A 2AKLA 5IT9f 2E2II 2R93I 2O4HA 4A3GI 1YIJZ 4CL1A 4A3JI 1L1OC 1TFIA 4DQYB 1YHQ1 4A3FI 3S1RI 3CCQ1 1YUKA 3CCE1 3CXCZ 2NVXI 3I551 4MD9A 2W04A 2RBLA 1TWFI 4NBGA 1YJN1 1Y1VS 2VUGA 3CPWY 1VQ9Z 1Q862 1VQ51 3I561 3HOXI 1M1K1 1VQ7Z 4NBBA 2WAQA 2NVTI 2YADA 3GTOI 2E2JI 1RO4A 1ML8A 3CCLZ 1M901 3TE5B 1YJ9Z 2I3CA 2E2HI 2NVYI 2QRCB 3CD6Z 3I4MI 3BG1B 3MONA 3TDHB 3CCU1 5IP7I 1K732 4E30A 3G4S1 2JNYA 1N8R1 4A3BI 1RO0A 1VQ4Z 4A3EI 1KD11 1VQP1 5A2Qb 2QRDB 2M6NA 3CC71 3RZDI 3CME1 1NJI2 3BG0B 4BBRI 3HKZA 1S7MA 3S17I 1P9NA 5FLXb 1JJ2Z 3PO2I 4RVHA 2OZKA 3QWUA 1Q822 2V8IA 4RVDA 1VQLZ 3CCJZ 3PO3S 3CC4Z 2GTIA 2KPIA 2F4OA 2F4MA 4Y7NI 3CCMZ 3NFZA 1YIJ1 5FLXf 3J80b 4Y52I 3CCRZ 2J6AA 2W03A 3VTNA 2GTHA 5D1OB 3G71Z 2NVQI 3CPWZ 3I07A 1YITZ 3HOYI 1TWCI 1VQKZ 5LL6f 3OW2Y 2O53A 2JA8I 1VQMZ 3HOUI 1Q7Y2 3HOWI 2G2KA 1QF8A 4MONA 5C4XI 2V8KA 2EGTA 2JMOA 1VQ91
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QRD B;  2QLV B;  2QR1 B;  2QRE B;  3T4N B;  3TE5 B;  2OOX B;  3TDH B;  2OOY B;  2QRC B; 
#chains in the Genus database with same CATH topology
 2VPY A;  2VUM I;  2JR6 A;  1W2B Y;  3J80 f;  3GTL I;  4E32 A;  1VQN 1;  1FDO A;  4RS4 A;  2OTJ 1;  1WZN A;  1KC8 1;  2OTL Z;  3VMG A;  3GTM I;  4A3C I;  2ZAE B;  1M1K 2;  4S1T A;  3S16 I;  1RLY A;  5D1P A;  4DGL A;  2HU9 A;  1LQL A;  1YJ9 1;  3K7A I;  1TWG I;  1KQS Z;  1X3W A;  3GTQ I;  1JWH C;  3CD6 1;  1VQ6 1;  3GTJ I;  3S2D I;  4NOZ A;  4E2X A;  1Z02 A;  3J81 f;  1I6H I;  2DE5 A;  1M90 2;  4E31 A;  4HGZ A;  2BJO A;  1YJW Z;  1USP A;  1QVG Y;  1VQ4 1;  2JA6 I;  1QVF Y;  5T6B A;  1WII A;  3NDJ A;  1X3Z A;  2JIO A;  4RV9 A;  1K9M 1;  1K8A 1;  2PM9 A;  1N8R 2;  2VF1 A;  2QA4 Z;  3S1N I;  2RHB A;  2JIQ A;  1KD1 2;  3KIF A;  3U50 C;  2QEX Z;  3JAM b;  4NBC A;  3D9X A;  2OOX B;  1KQS Y;  1YJN Z;  3IX0 A;  1ZB8 A;  1VQL 1;  2R7Z I;  3CC4 1;  2R6M A;  2K5R A;  1VQ5 Z;  4RVF A;  1RNI A;  1RO2 A;  2KI7 B;  5CM2 M;  4QTT A;  3CCS Z;  3OW2 Z;  3CCM 1;  3IF8 A;  4BY7 I;  2P3Y A;  4MD7 A;  2JIM A;  3JAM f;  4NB9 A;  1PFT A;  4AYB A;  4HGY A;  3CCR 1;  4BBS I;  2JIP A;  1YIT 1;  2QR1 B;  4NFR A;  3CMA Z;  1W2B Z;  1VQK 1;  2B63 I;  3Q87 A;  1N2F A;  2HF1 A;  1VQM 1;  4NH1 C;  4X6A I;  1X0T A;  4TNU A;  3IFU A;  2IZ4 A;  3S1Q I;  4BXX I;  2VPX A;  3LUS A;  2JA5 I;  3MZK B;  4A3K I;  1S72 Z;  3GTG I;  3M3Y I;  3CC2 Z;  4A3D I;  1SFO I;  2OTL 1;  4A3M I;  2JUB A;  2V3V A;  3H0G I;  2QLV B;  3GCF A;  1VQO Z;  3GTM S;  2JS4 A;  1KC8 2;  1QVG Z;  3RZO I;  3J81 b;  1QVF Z;  1RQF A;  1YI2 Z;  3HOZ I;  3ESW A;  3NH8 A;  4DK1 A;  1VQ7 1;  2R92 I;  5FLM I;  1YJW 1;  4MXU A;  3S15 I;  3J7A 4;  2V8J A;  1NUI A;  3S2H I;  3G6E Z;  3CCL 1;  3GTK I;  2RPR A;  2LIY A;  3MZL B;  1Q81 1;  2YU9 I;  3KIH A;  1ZB9 A;  4NBA A;  1Q7Y 1;  3D6W A;  2QA4 1;  1WW9 A;  3H3V J;  1DL6 A;  1VQ8 Z;  2QEX 1;  1K9M 2;  1K8A 2;  3CCV Z;  1I3Q I;  1Q16 A;  3VB9 A;  4A93 I;  2M48 A;  3FQQ A;  1USP B;  1K83 I;  2LFU A;  2Y0S A;  3M4O I;  2QRE B;  4QTU A;  4HH4 A;  1YHQ Z;  2PMZ A;  3CCQ Z;  4MH4 A;  3CCE Z;  1VQN Z;  3I55 Z;  3CCS 1;  2OTJ Z;  3EER A;  3F3F C;  1Y1V I;  5C3E I;  2Q51 A;  1Z01 A;  5T64 A;  2GU2 A;  1Q86 1;  3CQZ I;  3FKI I;  2JA7 I;  1I50 I;  3CCJ 1;  1R9T I;  3CXC Y;  1VQ6 Z;  1TWH I;  3CMA 1;  3I56 Z;  4NBF A;  2WB1 A;  2V45 A;  4NBH A;  5C44 I;  4A3L I;  5IP9 I;  1TWA I;  3P5J B;  3S1M I;  2E9H A;  4E2Z A;  4NB8 A;  1K73 1;  1Z03 A;  3G71 1;  4BY1 I;  1Y1W I;  3GKQ A;  1S72 1;  4NBE A;  1KRL A;  3CC2 1;  3CCU Z;  3VMI A;  4E33 A;  3VMH A;  4NBD A;  4A3I I;  4E2W A;  2RIQ A;  2OOY B;  3S14 I;  2IZ3 A;  3HOV I;  3G4S Z;  4E2Y A;  5C4J I;  1VQO 1;  3I4N I;  3NH5 A;  1NJI 1;  3D2L A;  1AA6 A;  1VQP Z;  4MRI A;  4RVG A;  1QXF A;  1NP6 A;  2K3R A;  2DE6 A;  1YI2 1;  3CC7 Z;  3EED A;  4XX2 A;  2IV2 X;  5AN9 F;  1WJ2 A;  5A2Q f;  3CME Z;  1Q82 1;  5IT9 b;  2H85 A;  1YUA A;  3NDI A;  3GTP I;  1WCM I;  3PO3 I;  2PK7 A;  1Y8C A;  4MD8 A;  3G6E 1;  2P28 A;  2QKD A;  5D1O A;  2RT9 A;  2DE7 A;  1ZH1 A;  3F3P C;  4EWC A;  3T4N B;  3FQM A;  2VPW A;  1JJ2 Y;  5T67 A;  1VQ8 1;  1Q81 2;  1QYP A;  2Q4Z A;  1VLA A;  3CCV 1;  3NH4 A;  2AKL A;  5IT9 f;  2E2I I;  2R93 I;  2O4H A;  4A3G I;  1YIJ Z;  4CL1 A;  4A3J I;  1L1O C;  1TFI A;  4DQY B;  1FDI A;  1YHQ 1;  4A3F I;  3S1R I;  3CCQ 1;  1YUK A;  3CCE 1;  3CXC Z;  2NVX I;  3I55 1;  4MD9 A;  2W04 A;  2RBL A;  1TWF I;  4NBG A;  1YJN 1;  1Y1V S;  2VUG A;  3CPW Y;  1VQ9 Z;  1Q86 2;  1VQ5 1;  3I56 1;  3HOX I;  1M1K 1;  2VPZ A;  1VQ7 Z;  4NBB A;  2WAQ A;  2NVT I;  2YAD A;  3GTO I;  2LEX A;  2E2J I;  1RO4 A;  1ML8 A;  3CCL Z;  1M90 1;  3TE5 B;  1YJ9 Z;  2I3C A;  2E2H I;  2NVY I;  2QRC B;  3CD6 Z;  3I4M I;  3BG1 B;  3MON A;  2E7Z A;  3TDH B;  3CCU 1;  5IP7 I;  1K73 2;  4E30 A;  3G4S 1;  2JNY A;  1SIW A;  1N8R 1;  4A3B I;  1RO0 A;  1VQ4 Z;  4A3E I;  1KD1 1;  1VQP 1;  5A2Q b;  2QRD B;  2M6N A;  3CC7 1;  3RZD I;  3CME 1;  1NJI 2;  3BG0 B;  4BBR I;  3HKZ A;  1S7M A;  3S17 I;  1P9N A;  5FLX b;  1JJ2 Z;  3PO2 I;  4RVH A;  2OZK A;  3QWU A;  1Q82 2;  2V8I A;  4RVD A;  1VQL Z;  3CCJ Z;  3PO3 S;  3CC4 Z;  2GTI A;  2KPI A;  2F4O A;  2F4M A;  3IR7 A;  4Y7N I;  3CCM Z;  3NFZ A;  1YIJ 1;  5FLX f;  3J80 b;  2JIR A;  4Y52 I;  3CCR Z;  2J6A A;  2W03 A;  3VTN A;  2GTH A;  5D1O B;  3G71 Z;  2NVQ I;  3CPW Z;  3I07 A;  1YIT Z;  2NAP A;  3HOY I;  1TWC I;  1VQK Z;  5LL6 f;  3OW2 Y;  2O53 A;  2JA8 I;  1VQM Z;  3HOU I;  1Q7Y 2;  3HOW I;  2AYD A;  2G2K A;  1QF8 A;  4MON A;  5C4X I;  2V8K A;  2EGT A;  2JMO A;  1VQ9 1; 
#chains in the Genus database with same CATH homology
 2VUM I;  2JR6 A;  1W2B Y;  3J80 f;  3GTL I;  4E32 A;  1VQN 1;  4RS4 A;  2OTJ 1;  1KC8 1;  2OTL Z;  3GTM I;  3VMG A;  4A3C I;  2ZAE B;  1M1K 2;  4S1T A;  3S16 I;  1RLY A;  5D1P A;  4DGL A;  2HU9 A;  1LQL A;  1YJ9 1;  3K7A I;  1TWG I;  1KQS Z;  1X3W A;  3GTQ I;  1JWH C;  3CD6 1;  1VQ6 1;  3GTJ I;  3S2D I;  4NOZ A;  4E2X A;  1Z02 A;  3J81 f;  1I6H I;  2DE5 A;  1M90 2;  4E31 A;  4HGZ A;  2BJO A;  1YJW Z;  1USP A;  1QVG Y;  1VQ4 1;  2JA6 I;  1QVF Y;  5T6B A;  1WII A;  3NDJ A;  1X3Z A;  4RV9 A;  1K9M 1;  1K8A 1;  2PM9 A;  1N8R 2;  2VF1 A;  2QA4 Z;  3S1N I;  2RHB A;  1KD1 2;  3KIF A;  3U50 C;  2QEX Z;  3JAM b;  4NBC A;  3D9X A;  2OOX B;  1KQS Y;  1YJN Z;  3IX0 A;  1ZB8 A;  1VQL 1;  2R7Z I;  3CC4 1;  2R6M A;  2K5R A;  1VQ5 Z;  4RVF A;  1RNI A;  1RO2 A;  2KI7 B;  5CM2 M;  4QTT A;  3CCS Z;  3OW2 Z;  3CCM 1;  3IF8 A;  4BY7 I;  2P3Y A;  4MD7 A;  3JAM f;  4NB9 A;  1PFT A;  4AYB A;  4HGY A;  3CCR 1;  4BBS I;  1YIT 1;  2QR1 B;  4NFR A;  3CMA Z;  1W2B Z;  1VQK 1;  2B63 I;  3Q87 A;  1N2F A;  2HF1 A;  1VQM 1;  4NH1 C;  4X6A I;  1X0T A;  4TNU A;  3IFU A;  2IZ4 A;  3S1Q I;  4BXX I;  3LUS A;  2JA5 I;  3MZK B;  4A3K I;  1S72 Z;  3GTG I;  3M3Y I;  3CC2 Z;  4A3D I;  1SFO I;  2OTL 1;  4A3M I;  2JUB A;  3H0G I;  2QLV B;  3GCF A;  1VQO Z;  3GTM S;  2JS4 A;  1KC8 2;  1QVG Z;  3RZO I;  3J81 b;  1QVF Z;  1RQF A;  1YI2 Z;  3HOZ I;  3ESW A;  3NH8 A;  4DK1 A;  1VQ7 1;  2R92 I;  5FLM I;  1YJW 1;  4MXU A;  3S15 I;  3J7A 4;  2V8J A;  1NUI A;  3S2H I;  3G6E Z;  3CCL 1;  3GTK I;  2RPR A;  2LIY A;  3MZL B;  1Q81 1;  2YU9 I;  3KIH A;  1ZB9 A;  4NBA A;  1Q7Y 1;  3D6W A;  2QA4 1;  1WW9 A;  3H3V J;  1DL6 A;  1VQ8 Z;  2QEX 1;  1K9M 2;  1K8A 2;  3CCV Z;  1I3Q I;  3VB9 A;  4A93 I;  2M48 A;  3FQQ A;  1USP B;  1K83 I;  2LFU A;  2Y0S A;  3M4O I;  2QRE B;  4QTU A;  4HH4 A;  1YHQ Z;  2PMZ A;  3CCQ Z;  4MH4 A;  3CCE Z;  1VQN Z;  3I55 Z;  3CCS 1;  2OTJ Z;  3EER A;  3F3F C;  1Y1V I;  5C3E I;  2Q51 A;  1Z01 A;  5T64 A;  2GU2 A;  1Q86 1;  3CQZ I;  3FKI I;  2JA7 I;  1I50 I;  3CCJ 1;  1R9T I;  3CXC Y;  1VQ6 Z;  1TWH I;  3CMA 1;  3I56 Z;  4NBF A;  2WB1 A;  4NBH A;  5C44 I;  4A3L I;  5IP9 I;  1TWA I;  3P5J B;  3S1M I;  2E9H A;  4E2Z A;  4NB8 A;  1K73 1;  1Z03 A;  3G71 1;  4BY1 I;  1Y1W I;  3GKQ A;  1S72 1;  4NBE A;  1KRL A;  3CC2 1;  3CCU Z;  3VMI A;  4E33 A;  3VMH A;  4NBD A;  4A3I I;  4E2W A;  2RIQ A;  2OOY B;  3S14 I;  2IZ3 A;  3HOV I;  3G4S Z;  4E2Y A;  5C4J I;  1VQO 1;  3I4N I;  3NH5 A;  1NJI 1;  1VQP Z;  4MRI A;  4RVG A;  1NP6 A;  2K3R A;  2DE6 A;  1YI2 1;  3CC7 Z;  3EED A;  4XX2 A;  5AN9 F;  5A2Q f;  3CME Z;  1Q82 1;  5IT9 b;  2H85 A;  1YUA A;  3NDI A;  3GTP I;  1WCM I;  3PO3 I;  2PK7 A;  4MD8 A;  3G6E 1;  2P28 A;  2QKD A;  5D1O A;  2RT9 A;  2DE7 A;  1ZH1 A;  3F3P C;  4EWC A;  3T4N B;  3FQM A;  1JJ2 Y;  5T67 A;  1VQ8 1;  1Q81 2;  1QYP A;  2Q4Z A;  1VLA A;  3CCV 1;  3NH4 A;  2AKL A;  5IT9 f;  2E2I I;  2R93 I;  2O4H A;  4A3G I;  1YIJ Z;  4CL1 A;  4A3J I;  1L1O C;  1TFI A;  4DQY B;  1YHQ 1;  4A3F I;  3S1R I;  3CCQ 1;  1YUK A;  3CCE 1;  3CXC Z;  2NVX I;  3I55 1;  4MD9 A;  2W04 A;  2RBL A;  1TWF I;  4NBG A;  1YJN 1;  1Y1V S;  2VUG A;  3CPW Y;  1VQ9 Z;  1Q86 2;  1VQ5 1;  3I56 1;  3HOX I;  1M1K 1;  1VQ7 Z;  4NBB A;  2WAQ A;  2NVT I;  2YAD A;  3GTO I;  2E2J I;  1RO4 A;  1ML8 A;  3CCL Z;  1M90 1;  3TE5 B;  1YJ9 Z;  2I3C A;  2E2H I;  2NVY I;  2QRC B;  3CD6 Z;  3I4M I;  3BG1 B;  3MON A;  3TDH B;  3CCU 1;  5IP7 I;  1K73 2;  4E30 A;  3G4S 1;  2JNY A;  1N8R 1;  4A3B I;  1RO0 A;  1VQ4 Z;  4A3E I;  1KD1 1;  1VQP 1;  5A2Q b;  2QRD B;  2M6N A;  3CC7 1;  3RZD I;  3CME 1;  1NJI 2;  3BG0 B;  4BBR I;  3HKZ A;  1S7M A;  3S17 I;  1P9N A;  5FLX b;  1JJ2 Z;  3PO2 I;  4RVH A;  2OZK A;  3QWU A;  1Q82 2;  2V8I A;  4RVD A;  1VQL Z;  3CCJ Z;  3PO3 S;  3CC4 Z;  2GTI A;  2KPI A;  2F4O A;  2F4M A;  4Y7N I;  3CCM Z;  3NFZ A;  1YIJ 1;  5FLX f;  3J80 b;  4Y52 I;  3CCR Z;  2J6A A;  2W03 A;  3VTN A;  2GTH A;  5D1O B;  3G71 Z;  2NVQ I;  3CPW Z;  3I07 A;  1YIT Z;  3HOY I;  1TWC I;  1VQK Z;  5LL6 f;  3OW2 Y;  2O53 A;  2JA8 I;  1VQM Z;  3HOU I;  1Q7Y 2;  3HOW I;  2G2K A;  1QF8 A;  4MON A;  5C4X I;  2V8K A;  2EGT A;  2JMO A;  1VQ9 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...