3F3PC

Crystal structure of the nucleoporin pair nup85-seh1, space group p21212
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
509
structure length
480
Chain Sequence
KRDPVSGAILVPMTVNDQPIEKNGDKMPLKFKLGPLSYQNMAFITAKDKYKLYPVRIPRLDTSKEFSAYVSGLFEIYRDLGDDRVFNNSNFAKEHNATVNLAMEAILNELEVFIGRVKDQDGRVNRFYELEESLTVLNCLRTMYFILDGQDVEENRSEFIESLLNWINRSDGEPDEEYIEQVFSVKVFETQYFWKLLNQLVLRGLLSQAIGCIERSDLLPYLSDTCAVSFDAVSDSIELLKQYPKDSSSTFREWKNLVLKLSQAFGSSATDISGELRDYIEDFLLVIGGNQRKILQYSRTWYESFCGFLLYYIPSLELSAEYLQMSLEANVVDITNDWEQPCVDIISGKIHSILPVMESLDSCTAAFTAMICEAKGLIENIFELEDLFSYRNGMASYMLNSFAFELCSLGDKELWPVAIGLIALSATGTRSAKKMVIAELLPHYPFVTNDDIEWMLSICVEWRLPEIAKEIYTTLGNQML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Nucleoporin SEH1
publication title A fence-like coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 145
structure length 480
sequence length 509
chains with identical sequence D, G, H, K, L
ec nomenclature
pdb deposition date 2008-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.500 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3f3pC01
3F3FC 3F3PC
chains in the Genus database with same CATH superfamily
2YADA 1Z02A 1ZB9A 4MH4A 1I6HI 3CC41 4NBEA 1QVGY 2NAPA 3Q87A 2DE6A 5IP7I 2BJOA 1KC82 4EWCA 1KD12 1Y1VI 2W03A 1VQ8Z 3NDJA 3CCSZ 1P9NA 3GTKI 4DGLA 2O53A 4E2ZA 1WJ2A 3NH8A 1YJN1 3S1NI 2B63I 4RVHA 2OZKA 3CCE1 3GTJI 2PK7A 4MRIA 3S2DI 2NVXI 2F4MA 1S7MA 2IZ3A 2IV2X 1VQMZ 3GTMS 3CCJ1 3GTOI 3FQMA 3CC71 1RO0A 1KRLA 3G6E1 4NBDA 1QF8A 1S721 5AN9F 1AA6A 5C4JI 3GTQI 3I56Z 4A3BI 1YUKA 3J81b 1YI21 3VTNA 4CL1A 2JIMA 2G2KA 2E7ZA 2E2JI 3CMEZ 1YHQ1 1NUIA 3D2LA 1K731 2YU9I 1RO2A 3S16I 4A3DI 4NB9A 2JR6A 2P3YA 3ESWA 1VQPZ 1TWCI 1NJI1 2R7ZI 3CCU1 2WB1A 3T4NB 2Q51A 2V3VA 5D1OB 3MZKB 1X3WA 2QREB 1N8R1 1RO4A 5A2Qf 3CCM1 1K732 4MONA 4XX2A 4QTTA 3J80b 3IX0A 1VQ41 3I4NI 2W04A 2VUGA 1NJI2 3KIHA 4HH4A 4HGYA 1YJ91 2VPZA 3EEDA 2QEXZ 4Y52I 1N8R2 3G71Z 3MZLB 3JAMb 2RIQA 1KQSZ 1TWFI 3BG0B 3TDHB 4BBSI 3OW2Z 3M4OI 1VQO1 1YITZ 5T64A 1VQ91 5T6BA 2QR1B 2JIRA 1USPB 3CCLZ 3HOZI 2OTJ1 4NBBA 2JNYA 3NH5A 5C4XI 1Q811 3GTGI 4A3FI 3CCV1 5FLXf 3CCMZ 1JJ2Y 1QVFZ 1RQFA 3S1MI 4TNUA 2RBLA 3IF8A 3D6WA 3F3PC 3D9XA 4DQYB 1YJWZ 1YIJZ 2WAQA 1R9TI 2DE7A 3CXCZ 2OOYB 3G4S1 4A93I 1RLYA 3P5JB 1VQ61 3GKQA 3K7AI 1VQK1 3CPWY 1W2BY 1TWHI 1K9M1 2VPXA 1PFTA 4E2WA 2LIYA 2E9HA 1JWHC 2K3RA 1VQ71 5IP9I 4E31A 3CC4Z 2VPWA 1L1OC 4NBGA 2R93I 3VMGA 1M1K1 1Q16A 2KI7B 1K9M2 1VQN1 4S1TA 2IZ4A 1DL6A 2QRDB 1QVGZ 2ZAEB 2AYDA 3H0GI 1Z01A 5CM2M 2JA5I 2EGTA 4DK1A 1VLAA 1M1K2 2H85A 1YJNZ 3I4MI 4E33A 3CC21 1VQL1 2RT9A 2GU2A 3F3FC 3I551 2JA8I 1Y8CA 1I3QI 1VQ51 3CCEZ 4BXXI 1VQKZ 2JIOA 3KIFA 3IFUA 2OTL1 5A2Qb 1WW9A 3CMA1 4NBHA 2KPIA 3CCJZ 2GTIA 3CCQ1 2JA7I 5LL6f 3H3VJ 3CCR1 3CC7Z 2E2HI 1USPA 3HOXI 1K8A1 1FDOA 4NB8A 3CQZI 3G6EZ 2JUBA 1S72Z 2LFUA 2QA41 4A3MI 2QLVB 2R6MA 3CD61 2JA6I 1ZH1A 1YUAA 2VF1A 1YI2Z 1Y1VS 4NBAA 2P28A 2RHBA 1K8A2 5IT9f 5C3EI 2V45A 3HOYI 1YHQZ 4E2XA 2HF1A 2M6NA 4RVGA 1VQ81 3HOWI 3CCS1 3M3YI 3PO2I 3TE5B 3NDIA 3CCUZ 4NH1C 3GTPI 3HOUI 3RZDI 3S1QI 3HOVI 3GTLI 2E2II 5FLXb 3FQQA 1VQ4Z 1SFOI 2HU9A 2NVYI 3FKII 1YJ9Z 1X0TA 1M901 4NBFA 1Y1WI 1Q812 5C44I 1N2FA 4MD7A 4RVFA 5FLMI 1NP6A 2Q4ZA 4BY7I 1TWAI 2AKLA 3VMHA 4BY1I 4NFRA 3I07A 3S2HI 3I561 1M902 1VQOZ 2O4HA 2QRCB 1VQ9Z 3HKZA 1SIWA 3S14I 1I50I 4E30A 2OOXB 3CME1 2OTJZ 2VPYA 4MD9A 4RS4A 2NVTI 3PO3I 1RNIA 3CCVZ 2Y0SA 2JIQA 4NBCA 4HGZA 4Y7NI 1VQP1 5D1OA 2JIPA 2PM9A 2V8IA 1ZB8A 4E2YA 1JJ2Z 3IR7A 1K83I 3GCFA 5T67A 3QWUA 4AYBA 2K5RA 4BBRI 3G4SZ 1KQSY 2QEX1 3VMIA 3G711 3RZOI 3OW2Y 1VQ6Z 3J81f 4NOZA 1Q861 1Q821 3U50C 3EERA 4A3II 3J7A4 1TFIA 1YIT1 4A3JI 2M48A 2PMZA 3BG1B 1WIIA 1Z03A 4MXUA 3CPWZ 1VQ7Z 3GTMI 3LUSA 4A3KI 3CCL1 1W2BZ 3VB9A 3MONA 1Q862 1Q822 1QVFY 2VUMI 1VQNZ 1WCMI 3J80f 2JS4A 1Q7Y1 4QTUA 3S15I 1QXFA 2V8KA 4A3GI 5IT9b 2DE5A 3CXCY 1YJW1 4A3LI 1YIJ1 4RV9A 5D1PA 4A3EI 4X6AI 2GTHA 1WZNA 2I3CA 3CC2Z 1VQLZ 2LEXA 1ML8A 3I55Z 1LQLA 1Q7Y2 3JAMf 2QKDA 4MD8A 1VQ5Z 3NFZA 2JMOA 2NVQI 4A3CI 2J6AA 2OTLZ 3CMAZ 4E32A 3CCQZ 3S1RI 2F4OA 3CCRZ 1FDIA 3NH4A 1X3ZA 4RVDA 1QYPA 1KC81 1TWGI 3PO3S 1KD11 1VQM1 2R92I 2V8JA 2QA4Z 3S17I 2RPRA 3CD6Z
chains in the Genus database with same CATH topology
2YADA 1Z02A 1ZB9A 4MH4A 1I6HI 3CC41 4NBEA 1QVGY 3Q87A 2DE6A 5IP7I 2BJOA 1KC82 4EWCA 1KD12 1Y1VI 2W03A 1VQ8Z 3NDJA 3CCSZ 1P9NA 3GTKI 4DGLA 2O53A 4E2ZA 3NH8A 1YJN1 3S1NI 2B63I 4RVHA 2OZKA 3CCE1 3GTJI 2PK7A 4MRIA 3S2DI 2NVXI 2F4MA 1S7MA 2IZ3A 1VQMZ 3GTMS 3CCJ1 3GTOI 3FQMA 3CC71 1RO0A 1KRLA 3G6E1 4NBDA 1QF8A 1S721 5AN9F 5C4JI 3GTQI 3I56Z 4A3BI 1YUKA 3J81b 1YI21 3VTNA 4CL1A 2G2KA 2E2JI 3CMEZ 1YHQ1 1NUIA 1K731 2YU9I 1RO2A 3S16I 4A3DI 4NB9A 2JR6A 2P3YA 3ESWA 1VQPZ 1TWCI 1NJI1 2R7ZI 3CCU1 2WB1A 3T4NB 2Q51A 5D1OB 3MZKB 1X3WA 2QREB 1N8R1 1RO4A 5A2Qf 3CCM1 1K732 4MONA 4XX2A 4QTTA 3J80b 3IX0A 1VQ41 3I4NI 2W04A 2VUGA 1NJI2 3KIHA 4HH4A 4HGYA 1YJ91 3EEDA 2QEXZ 4Y52I 1N8R2 3G71Z 3MZLB 3JAMb 2RIQA 1KQSZ 1TWFI 3BG0B 3TDHB 4BBSI 3OW2Z 3M4OI 1VQO1 1YITZ 5T64A 1VQ91 5T6BA 2QR1B 1USPB 3CCLZ 3HOZI 2OTJ1 4NBBA 2JNYA 3NH5A 5C4XI 1Q811 3GTGI 4A3FI 3CCV1 5FLXf 3CCMZ 1JJ2Y 1QVFZ 1RQFA 3S1MI 4TNUA 2RBLA 3IF8A 3D6WA 3F3PC 3D9XA 4DQYB 1YJWZ 1YIJZ 2WAQA 1R9TI 2DE7A 3CXCZ 2OOYB 3G4S1 4A93I 1RLYA 3P5JB 1VQ61 3GKQA 3K7AI 1VQK1 3CPWY 1W2BY 1TWHI 1K9M1 1PFTA 4E2WA 2LIYA 2E9HA 1JWHC 2K3RA 1VQ71 5IP9I 4E31A 3CC4Z 1L1OC 4NBGA 2R93I 3VMGA 1M1K1 2KI7B 1K9M2 1VQN1 4S1TA 2IZ4A 1DL6A 2QRDB 1QVGZ 2ZAEB 3H0GI 1Z01A 5CM2M 2JA5I 2EGTA 4DK1A 1VLAA 1M1K2 2H85A 1YJNZ 3I4MI 4E33A 3CC21 1VQL1 2RT9A 2GU2A 3F3FC 3I551 2JA8I 1I3QI 1VQ51 3CCEZ 4BXXI 1VQKZ 3KIFA 3IFUA 2OTL1 5A2Qb 1WW9A 3CMA1 4NBHA 2KPIA 3CCJZ 2GTIA 3CCQ1 2JA7I 5LL6f 3H3VJ 3CCR1 3CC7Z 2E2HI 1USPA 3HOXI 1K8A1 4NB8A 3CQZI 3G6EZ 2JUBA 1S72Z 2LFUA 2QA41 4A3MI 2QLVB 2R6MA 3CD61 2JA6I 1ZH1A 1YUAA 2VF1A 1YI2Z 1Y1VS 4NBAA 2P28A 2RHBA 1K8A2 5IT9f 5C3EI 3HOYI 1YHQZ 4E2XA 2HF1A 2M6NA 4RVGA 1VQ81 3HOWI 3CCS1 3M3YI 3PO2I 3TE5B 3NDIA 3CCUZ 4NH1C 3GTPI 3HOUI 3RZDI 3S1QI 3HOVI 3GTLI 2E2II 5FLXb 3FQQA 1VQ4Z 1SFOI 2HU9A 2NVYI 3FKII 1YJ9Z 1X0TA 1M901 4NBFA 1Y1WI 1Q812 5C44I 1N2FA 4MD7A 4RVFA 5FLMI 1NP6A 2Q4ZA 4BY7I 1TWAI 2AKLA 3VMHA 4BY1I 4NFRA 3I07A 3S2HI 3I561 1M902 1VQOZ 2O4HA 2QRCB 1VQ9Z 3HKZA 3S14I 1I50I 4E30A 2OOXB 3CME1 2OTJZ 4MD9A 4RS4A 2NVTI 3PO3I 1RNIA 3CCVZ 2Y0SA 4NBCA 4HGZA 4Y7NI 1VQP1 5D1OA 2PM9A 2V8IA 1ZB8A 4E2YA 1JJ2Z 1K83I 3GCFA 5T67A 3QWUA 4AYBA 2K5RA 4BBRI 3G4SZ 1KQSY 2QEX1 3VMIA 3G711 3RZOI 3OW2Y 1VQ6Z 3J81f 4NOZA 1Q861 1Q821 3U50C 3EERA 4A3II 3J7A4 1TFIA 1YIT1 4A3JI 2M48A 2PMZA 3BG1B 1WIIA 1Z03A 4MXUA 3CPWZ 1VQ7Z 3GTMI 3LUSA 4A3KI 3CCL1 1W2BZ 3VB9A 3MONA 1Q862 1Q822 1QVFY 2VUMI 1VQNZ 1WCMI 3J80f 2JS4A 1Q7Y1 4QTUA 3S15I 2V8KA 4A3GI 5IT9b 2DE5A 3CXCY 1YJW1 4A3LI 1YIJ1 4RV9A 5D1PA 4A3EI 4X6AI 2GTHA 2I3CA 3CC2Z 1VQLZ 1ML8A 3I55Z 1LQLA 1Q7Y2 3JAMf 2QKDA 4MD8A 1VQ5Z 3NFZA 2JMOA 2NVQI 4A3CI 2J6AA 2OTLZ 3CMAZ 4E32A 3CCQZ 3S1RI 2F4OA 3CCRZ 3NH4A 1X3ZA 4RVDA 1QYPA 1KC81 1TWGI 3PO3S 1KD11 1VQM1 2R92I 2V8JA 2QA4Z 3S17I 2RPRA 3CD6Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F3F C;  3F3P C; 
#chains in the Genus database with same CATH topology
 2YAD A;  1Z02 A;  1ZB9 A;  4MH4 A;  1I6H I;  3CC4 1;  4NBE A;  1QVG Y;  2NAP A;  3Q87 A;  2DE6 A;  5IP7 I;  2BJO A;  1KC8 2;  4EWC A;  1KD1 2;  1Y1V I;  2W03 A;  1VQ8 Z;  3NDJ A;  3CCS Z;  1P9N A;  3GTK I;  4DGL A;  2O53 A;  4E2Z A;  1WJ2 A;  3NH8 A;  1YJN 1;  3S1N I;  2B63 I;  4RVH A;  2OZK A;  3CCE 1;  3GTJ I;  2PK7 A;  4MRI A;  3S2D I;  2NVX I;  2F4M A;  1S7M A;  2IZ3 A;  2IV2 X;  1VQM Z;  3GTM S;  3CCJ 1;  3GTO I;  3FQM A;  3CC7 1;  1RO0 A;  1KRL A;  3G6E 1;  4NBD A;  1QF8 A;  1S72 1;  5AN9 F;  1AA6 A;  5C4J I;  3GTQ I;  3I56 Z;  4A3B I;  1YUK A;  3J81 b;  1YI2 1;  3VTN A;  4CL1 A;  2JIM A;  2G2K A;  2E7Z A;  2E2J I;  3CME Z;  1YHQ 1;  1NUI A;  3D2L A;  1K73 1;  2YU9 I;  1RO2 A;  3S16 I;  4A3D I;  4NB9 A;  2JR6 A;  2P3Y A;  3ESW A;  1VQP Z;  1TWC I;  1NJI 1;  2R7Z I;  3CCU 1;  2WB1 A;  3T4N B;  2Q51 A;  2V3V A;  5D1O B;  3MZK B;  1X3W A;  2QRE B;  1N8R 1;  1RO4 A;  5A2Q f;  3CCM 1;  1K73 2;  4MON A;  4XX2 A;  4QTT A;  3J80 b;  3IX0 A;  1VQ4 1;  3I4N I;  2W04 A;  2VUG A;  1NJI 2;  3KIH A;  4HH4 A;  4HGY A;  1YJ9 1;  2VPZ A;  3EED A;  2QEX Z;  4Y52 I;  1N8R 2;  3G71 Z;  3MZL B;  3JAM b;  2RIQ A;  1KQS Z;  1TWF I;  3BG0 B;  3TDH B;  4BBS I;  3OW2 Z;  3M4O I;  1VQO 1;  1YIT Z;  5T64 A;  1VQ9 1;  5T6B A;  2QR1 B;  2JIR A;  1USP B;  3CCL Z;  3HOZ I;  2OTJ 1;  4NBB A;  2JNY A;  3NH5 A;  5C4X I;  1Q81 1;  3GTG I;  4A3F I;  3CCV 1;  5FLX f;  3CCM Z;  1JJ2 Y;  1QVF Z;  1RQF A;  3S1M I;  4TNU A;  2RBL A;  3IF8 A;  3D6W A;  3F3P C;  3D9X A;  4DQY B;  1YJW Z;  1YIJ Z;  2WAQ A;  1R9T I;  2DE7 A;  3CXC Z;  2OOY B;  3G4S 1;  4A93 I;  1RLY A;  3P5J B;  1VQ6 1;  3GKQ A;  3K7A I;  1VQK 1;  3CPW Y;  1W2B Y;  1TWH I;  1K9M 1;  2VPX A;  1PFT A;  4E2W A;  2LIY A;  2E9H A;  1JWH C;  2K3R A;  1VQ7 1;  5IP9 I;  4E31 A;  3CC4 Z;  2VPW A;  1L1O C;  4NBG A;  2R93 I;  3VMG A;  1M1K 1;  1Q16 A;  2KI7 B;  1K9M 2;  1VQN 1;  4S1T A;  2IZ4 A;  1DL6 A;  2QRD B;  1QVG Z;  2ZAE B;  2AYD A;  3H0G I;  1Z01 A;  5CM2 M;  2JA5 I;  2EGT A;  4DK1 A;  1VLA A;  1M1K 2;  2H85 A;  1YJN Z;  3I4M I;  4E33 A;  3CC2 1;  1VQL 1;  2RT9 A;  2GU2 A;  3F3F C;  3I55 1;  2JA8 I;  1Y8C A;  1I3Q I;  1VQ5 1;  3CCE Z;  4BXX I;  1VQK Z;  2JIO A;  3KIF A;  3IFU A;  2OTL 1;  5A2Q b;  1WW9 A;  3CMA 1;  4NBH A;  2KPI A;  3CCJ Z;  2GTI A;  3CCQ 1;  2JA7 I;  5LL6 f;  3H3V J;  3CCR 1;  3CC7 Z;  2E2H I;  1USP A;  3HOX I;  1K8A 1;  1FDO A;  4NB8 A;  3CQZ I;  3G6E Z;  2JUB A;  1S72 Z;  2LFU A;  2QA4 1;  4A3M I;  2QLV B;  2R6M A;  3CD6 1;  2JA6 I;  1ZH1 A;  1YUA A;  2VF1 A;  1YI2 Z;  1Y1V S;  4NBA A;  2P28 A;  2RHB A;  1K8A 2;  5IT9 f;  5C3E I;  2V45 A;  3HOY I;  1YHQ Z;  4E2X A;  2HF1 A;  2M6N A;  4RVG A;  1VQ8 1;  3HOW I;  3CCS 1;  3M3Y I;  3PO2 I;  3TE5 B;  3NDI A;  3CCU Z;  4NH1 C;  3GTP I;  3HOU I;  3RZD I;  3S1Q I;  3HOV I;  3GTL I;  2E2I I;  5FLX b;  3FQQ A;  1VQ4 Z;  1SFO I;  2HU9 A;  2NVY I;  3FKI I;  1YJ9 Z;  1X0T A;  1M90 1;  4NBF A;  1Y1W I;  1Q81 2;  5C44 I;  1N2F A;  4MD7 A;  4RVF A;  5FLM I;  1NP6 A;  2Q4Z A;  4BY7 I;  1TWA I;  2AKL A;  3VMH A;  4BY1 I;  4NFR A;  3I07 A;  3S2H I;  3I56 1;  1M90 2;  1VQO Z;  2O4H A;  2QRC B;  1VQ9 Z;  3HKZ A;  1SIW A;  3S14 I;  1I50 I;  4E30 A;  2OOX B;  3CME 1;  2OTJ Z;  2VPY A;  4MD9 A;  4RS4 A;  2NVT I;  3PO3 I;  1RNI A;  3CCV Z;  2Y0S A;  2JIQ A;  4NBC A;  4HGZ A;  4Y7N I;  1VQP 1;  5D1O A;  2JIP A;  2PM9 A;  2V8I A;  1ZB8 A;  4E2Y A;  1JJ2 Z;  3IR7 A;  1K83 I;  3GCF A;  5T67 A;  3QWU A;  4AYB A;  2K5R A;  4BBR I;  3G4S Z;  1KQS Y;  2QEX 1;  3VMI A;  3G71 1;  3RZO I;  3OW2 Y;  1VQ6 Z;  3J81 f;  4NOZ A;  1Q86 1;  1Q82 1;  3U50 C;  3EER A;  4A3I I;  3J7A 4;  1TFI A;  1YIT 1;  4A3J I;  2M48 A;  2PMZ A;  3BG1 B;  1WII A;  1Z03 A;  4MXU A;  3CPW Z;  1VQ7 Z;  3GTM I;  3LUS A;  4A3K I;  3CCL 1;  1W2B Z;  3VB9 A;  3MON A;  1Q86 2;  1Q82 2;  1QVF Y;  2VUM I;  1VQN Z;  1WCM I;  3J80 f;  2JS4 A;  1Q7Y 1;  4QTU A;  3S15 I;  1QXF A;  2V8K A;  4A3G I;  5IT9 b;  2DE5 A;  3CXC Y;  1YJW 1;  4A3L I;  1YIJ 1;  4RV9 A;  5D1P A;  4A3E I;  4X6A I;  2GTH A;  1WZN A;  2I3C A;  3CC2 Z;  1VQL Z;  2LEX A;  1ML8 A;  3I55 Z;  1LQL A;  1Q7Y 2;  3JAM f;  2QKD A;  4MD8 A;  1VQ5 Z;  3NFZ A;  2JMO A;  2NVQ I;  4A3C I;  2J6A A;  2OTL Z;  3CMA Z;  4E32 A;  3CCQ Z;  3S1R I;  2F4O A;  3CCR Z;  1FDI A;  3NH4 A;  1X3Z A;  4RVD A;  1QYP A;  1KC8 1;  1TWG I;  3PO3 S;  1KD1 1;  1VQM 1;  2R92 I;  2V8J A;  2QA4 Z;  3S17 I;  2RPR A;  3CD6 Z; 
#chains in the Genus database with same CATH homology
 2YAD A;  1Z02 A;  1ZB9 A;  4MH4 A;  1I6H I;  3CC4 1;  4NBE A;  1QVG Y;  3Q87 A;  2DE6 A;  5IP7 I;  2BJO A;  1KC8 2;  4EWC A;  1KD1 2;  1Y1V I;  2W03 A;  1VQ8 Z;  3NDJ A;  3CCS Z;  1P9N A;  3GTK I;  4DGL A;  2O53 A;  4E2Z A;  3NH8 A;  1YJN 1;  3S1N I;  2B63 I;  4RVH A;  2OZK A;  3CCE 1;  3GTJ I;  2PK7 A;  4MRI A;  3S2D I;  2NVX I;  2F4M A;  1S7M A;  2IZ3 A;  1VQM Z;  3GTM S;  3CCJ 1;  3GTO I;  3FQM A;  3CC7 1;  1RO0 A;  1KRL A;  3G6E 1;  4NBD A;  1QF8 A;  1S72 1;  5AN9 F;  5C4J I;  3GTQ I;  3I56 Z;  4A3B I;  1YUK A;  3J81 b;  1YI2 1;  3VTN A;  4CL1 A;  2G2K A;  2E2J I;  3CME Z;  1YHQ 1;  1NUI A;  1K73 1;  2YU9 I;  1RO2 A;  3S16 I;  4A3D I;  4NB9 A;  2JR6 A;  2P3Y A;  3ESW A;  1VQP Z;  1TWC I;  1NJI 1;  2R7Z I;  3CCU 1;  2WB1 A;  3T4N B;  2Q51 A;  5D1O B;  3MZK B;  1X3W A;  2QRE B;  1N8R 1;  1RO4 A;  5A2Q f;  3CCM 1;  1K73 2;  4MON A;  4XX2 A;  4QTT A;  3J80 b;  3IX0 A;  1VQ4 1;  3I4N I;  2W04 A;  2VUG A;  1NJI 2;  3KIH A;  4HH4 A;  4HGY A;  1YJ9 1;  3EED A;  2QEX Z;  4Y52 I;  1N8R 2;  3G71 Z;  3MZL B;  3JAM b;  2RIQ A;  1KQS Z;  1TWF I;  3BG0 B;  3TDH B;  4BBS I;  3OW2 Z;  3M4O I;  1VQO 1;  1YIT Z;  5T64 A;  1VQ9 1;  5T6B A;  2QR1 B;  1USP B;  3CCL Z;  3HOZ I;  2OTJ 1;  4NBB A;  2JNY A;  3NH5 A;  5C4X I;  1Q81 1;  3GTG I;  4A3F I;  3CCV 1;  5FLX f;  3CCM Z;  1JJ2 Y;  1QVF Z;  1RQF A;  3S1M I;  4TNU A;  2RBL A;  3IF8 A;  3D6W A;  3F3P C;  3D9X A;  4DQY B;  1YJW Z;  1YIJ Z;  2WAQ A;  1R9T I;  2DE7 A;  3CXC Z;  2OOY B;  3G4S 1;  4A93 I;  1RLY A;  3P5J B;  1VQ6 1;  3GKQ A;  3K7A I;  1VQK 1;  3CPW Y;  1W2B Y;  1TWH I;  1K9M 1;  1PFT A;  4E2W A;  2LIY A;  2E9H A;  1JWH C;  2K3R A;  1VQ7 1;  5IP9 I;  4E31 A;  3CC4 Z;  1L1O C;  4NBG A;  2R93 I;  3VMG A;  1M1K 1;  2KI7 B;  1K9M 2;  1VQN 1;  4S1T A;  2IZ4 A;  1DL6 A;  2QRD B;  1QVG Z;  2ZAE B;  3H0G I;  1Z01 A;  5CM2 M;  2JA5 I;  2EGT A;  4DK1 A;  1VLA A;  1M1K 2;  2H85 A;  1YJN Z;  3I4M I;  4E33 A;  3CC2 1;  1VQL 1;  2RT9 A;  2GU2 A;  3F3F C;  3I55 1;  2JA8 I;  1I3Q I;  1VQ5 1;  3CCE Z;  4BXX I;  1VQK Z;  3KIF A;  3IFU A;  2OTL 1;  5A2Q b;  1WW9 A;  3CMA 1;  4NBH A;  2KPI A;  3CCJ Z;  2GTI A;  3CCQ 1;  2JA7 I;  5LL6 f;  3H3V J;  3CCR 1;  3CC7 Z;  2E2H I;  1USP A;  3HOX I;  1K8A 1;  4NB8 A;  3CQZ I;  3G6E Z;  2JUB A;  1S72 Z;  2LFU A;  2QA4 1;  4A3M I;  2QLV B;  2R6M A;  3CD6 1;  2JA6 I;  1ZH1 A;  1YUA A;  2VF1 A;  1YI2 Z;  1Y1V S;  4NBA A;  2P28 A;  2RHB A;  1K8A 2;  5IT9 f;  5C3E I;  3HOY I;  1YHQ Z;  4E2X A;  2HF1 A;  2M6N A;  4RVG A;  1VQ8 1;  3HOW I;  3CCS 1;  3M3Y I;  3PO2 I;  3TE5 B;  3NDI A;  3CCU Z;  4NH1 C;  3GTP I;  3HOU I;  3RZD I;  3S1Q I;  3HOV I;  3GTL I;  2E2I I;  5FLX b;  3FQQ A;  1VQ4 Z;  1SFO I;  2HU9 A;  2NVY I;  3FKI I;  1YJ9 Z;  1X0T A;  1M90 1;  4NBF A;  1Y1W I;  1Q81 2;  5C44 I;  1N2F A;  4MD7 A;  4RVF A;  5FLM I;  1NP6 A;  2Q4Z A;  4BY7 I;  1TWA I;  2AKL A;  3VMH A;  4BY1 I;  4NFR A;  3I07 A;  3S2H I;  3I56 1;  1M90 2;  1VQO Z;  2O4H A;  2QRC B;  1VQ9 Z;  3HKZ A;  3S14 I;  1I50 I;  4E30 A;  2OOX B;  3CME 1;  2OTJ Z;  4MD9 A;  4RS4 A;  2NVT I;  3PO3 I;  1RNI A;  3CCV Z;  2Y0S A;  4NBC A;  4HGZ A;  4Y7N I;  1VQP 1;  5D1O A;  2PM9 A;  2V8I A;  1ZB8 A;  4E2Y A;  1JJ2 Z;  1K83 I;  3GCF A;  5T67 A;  3QWU A;  4AYB A;  2K5R A;  4BBR I;  3G4S Z;  1KQS Y;  2QEX 1;  3VMI A;  3G71 1;  3RZO I;  3OW2 Y;  1VQ6 Z;  3J81 f;  4NOZ A;  1Q86 1;  1Q82 1;  3U50 C;  3EER A;  4A3I I;  3J7A 4;  1TFI A;  1YIT 1;  4A3J I;  2M48 A;  2PMZ A;  3BG1 B;  1WII A;  1Z03 A;  4MXU A;  3CPW Z;  1VQ7 Z;  3GTM I;  3LUS A;  4A3K I;  3CCL 1;  1W2B Z;  3VB9 A;  3MON A;  1Q86 2;  1Q82 2;  1QVF Y;  2VUM I;  1VQN Z;  1WCM I;  3J80 f;  2JS4 A;  1Q7Y 1;  4QTU A;  3S15 I;  2V8K A;  4A3G I;  5IT9 b;  2DE5 A;  3CXC Y;  1YJW 1;  4A3L I;  1YIJ 1;  4RV9 A;  5D1P A;  4A3E I;  4X6A I;  2GTH A;  2I3C A;  3CC2 Z;  1VQL Z;  1ML8 A;  3I55 Z;  1LQL A;  1Q7Y 2;  3JAM f;  2QKD A;  4MD8 A;  1VQ5 Z;  3NFZ A;  2JMO A;  2NVQ I;  4A3C I;  2J6A A;  2OTL Z;  3CMA Z;  4E32 A;  3CCQ Z;  3S1R I;  2F4O A;  3CCR Z;  3NH4 A;  1X3Z A;  4RVD A;  1QYP A;  1KC8 1;  1TWG I;  3PO3 S;  1KD1 1;  1VQM 1;  2R92 I;  2V8J A;  2QA4 Z;  3S17 I;  2RPR A;  3CD6 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...