3F3PC

Crystal structure of the nucleoporin pair nup85-seh1, space group p21212
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
509
structure length
480
Chain Sequence
KRDPVSGAILVPMTVNDQPIEKNGDKMPLKFKLGPLSYQNMAFITAKDKYKLYPVRIPRLDTSKEFSAYVSGLFEIYRDLGDDRVFNNSNFAKEHNATVNLAMEAILNELEVFIGRVKDQDGRVNRFYELEESLTVLNCLRTMYFILDGQDVEENRSEFIESLLNWINRSDGEPDEEYIEQVFSVKVFETQYFWKLLNQLVLRGLLSQAIGCIERSDLLPYLSDTCAVSFDAVSDSIELLKQYPKDSSSTFREWKNLVLKLSQAFGSSATDISGELRDYIEDFLLVIGGNQRKILQYSRTWYESFCGFLLYYIPSLELSAEYLQMSLEANVVDITNDWEQPCVDIISGKIHSILPVMESLDSCTAAFTAMICEAKGLIENIFELEDLFSYRNGMASYMLNSFAFELCSLGDKELWPVAIGLIALSATGTRSAKKMVIAELLPHYPFVTNDDIEWMLSICVEWRLPEIAKEIYTTLGNQML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoporin SEH1
publication title A fence-like coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 145
structure length 480
sequence length 509
chains with identical sequence D, G, H, K, L
ec nomenclature
pdb deposition date 2008-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.500 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3f3pC01
3F3FC 3F3PC
chains in the Genus database with same CATH superfamily
2QRCB 4CL1A 2JS4A 2JUBA 1YITZ 3JAMf 2V8JA 3G4S1 3S1MI 1VQLZ 1USPA 3M4OI 2IZ4A 1KC82 2JA8I 2GTIA 3GTKI 4A3BI 3RZDI 3HOUI 1M1K1 1Z02A 3NH5A 3ESWA 3FKII 5IT9b 2ZAEB 2JA6I 3I55Z 2E2II 1WJ2A 2V8KA 1K731 2E9HA 4RVFA 1ML8A 4E2ZA 4NBFA 2IZ3A 2Q51A 3J81b 1K9M2 1VQ6Z 2JIPA 1NJI1 3GTMS 1PFTA 3EEDA 2NAPA 5IP9I 2P28A 4NBDA 5A2Qf 2HU9A 1YUAA 1P9NA 3NDIA 1K83I 1RO4A 3CCU1 4A3JI 3G4SZ 3F3PC 1SIWA 2VPWA 3J7A4 4NBHA 2DE6A 1USPB 2PMZA 4HGYA 1TFIA 4A3LI 4Y52I 3GTPI 1WCMI 4XX2A 4QTTA 4MONA 5LL6f 1Q7Y1 4NBEA 4BY7I 2JIOA 1VQN1 2IV2X 1L1OC 2W03A 2RPRA 3H0GI 5CM2M 3CC21 3CPWY 2R6MA 5D1PA 3S1NI 3CCUZ 1K8A1 2GTHA 3CCS1 1VQK1 3G6E1 2JR6A 1TWAI 4NH1C 3G711 3JAMb 2R93I 3S2HI 1FDIA 3U50C 4NOZA 3GTOI 5D1OA 3IFUA 1YUKA 2LFUA 5FLXf 3J80f 1VQNZ 3I561 2QEX1 4MD9A 1N8R2 3VTNA 3OW2Z 5T6BA 3CC2Z 2JIRA 3HOWI 4RV9A 3CCSZ 1VQKZ 3G6EZ 4BBSI 5T64A 2NVXI 3VMHA 1JJ2Z 3G71Z 2JMOA 2OOXB 1Q821 1QVGZ 2QRDB 3I4NI 3CCM1 5C4JI 3CC41 2RIQA 4RS4A 2JA7I 4NB9A 5D1OB 4DK1A 4E2WA 2LIYA 3I56Z 2H85A 2QEXZ 2OTJ1 3FQMA 3PO3I 4RVHA 1X0TA 1NJI2 3D9XA 2O4HA 2EGTA 3QWUA 1ZB8A 1WZNA 1VQM1 1VQ91 1YI21 1TWCI 2QKDA 1VQP1 1ZH1A 4E2XA 1SFOI 2AKLA 1YJW1 3HKZA 4QTUA 3CCMZ 2V45A 1Y8CA 3CC4Z 2Q4ZA 2QR1B 3CC71 1KD12 4A3II 1QXFA 3VB9A 3NH4A 2VF1A 2YADA 1Y1WI 2OTJZ 2K5RA 2F4OA 1KC81 2GU2A 2M6NA 1Y1VS 1QYPA 3I4MI 3GKQA 2R7ZI 3Q87A 3GCFA 1VQMZ 1VQ9Z 1K8A2 1YI2Z 4E33A 1VQPZ 3S17I 3GTJI 1WW9A 3GTQI 1YJWZ 1K9M1 3PO3S 2BJOA 2KPIA 3LUSA 1KQSY 3CC7Z 3CPWZ 2V8IA 5C4XI 4TNUA 1Q862 4E2YA 4E30A 2VPZA 2OZKA 2V3VA 2O53A 3BG0B 2HF1A 3VMIA 5T67A 1W2BY 3CCV1 2PK7A 3CCE1 5IT9f 3CCR1 2K3RA 5FLMI 5C44I 2QA41 3CCJ1 1VQ71 3S15I 2VUGA 2JA5I 3J81f 1Q811 1TWHI 5C3EI 3IR7A 4A3DI 1YIJ1 4S1TA 3CCQ1 2PM9A 1QVFY 1I50I 2M48A 2WAQA 5A2Qb 4DGLA 4A3GI 2E2JI 2Y0SA 1Y1VI 3T4NB 4HGZA 3CCVZ 1RO0A 4A3CI 2OOYB 3CCEZ 1AA6A 3CCRZ 3CXCY 3HOVI 1KRLA 1M1K2 1S721 2QA4Z 3CCJZ 4E31A 1M901 1VQ7Z 1I6HI 2VPYA 1N2FA 1K732 1YHQ1 1YIJZ 4BBRI 1N8R1 3K7AI 3CCQZ 2I3CA 3NFZA 2NVYI 3H3VJ 1RO2A 2QREB 3KIHA 3D2LA 3VMGA 2JIMA 1FDOA 1X3WA 4MXUA 2LEXA 3PO2I 1S72Z 1S7MA 4BXXI 1JWHC 2DE7A 1TWGI 4A93I 3KIFA 3S1RI 1YHQZ 4MRIA 4X6AI 3HOZI 4MH4A 1Q7Y2 1ZB9A 4A3KI 5FLXb 2VUMI 2VPXA 3J80b 3D6WA 2YU9I 3NH8A 2E7ZA 3CD61 3GTGI 3EERA 2RHBA 1QF8A 1NP6A 4A3EI 2G2KA 4HH4A 3CME1 2WB1A 2DE5A 2OTL1 2QLVB 3S2DI 4NB8A 1KQSZ 3CCL1 4A3FI 2NVQI 3I07A 3MZLB 3RZOI 1X3ZA 1KD11 3CQZI 3GTLI 3HOXI 1RQFA 3S14I 1TWFI 2R92I 1Z01A 1Q812 2J6AA 4NBBA 1LQLA 4EWCA 3P5JB 2P3YA 4DQYB 1W2BZ 2NVTI 3CD6Z 1YJ91 4MD7A 1VQ81 1VLAA 4NBAA 2E2HI 3M3YI 3CMA1 1VQ51 1RNIA 4E32A 4A3MI 2B63I 3TE5B 1VQO1 3F3FC 3NDJA 2AYDA 4NFRA 3CMEZ 1Q822 2OTLZ 1I3QI 1YJN1 2KI7B 3HOYI 3CCLZ 2JIQA 1R9TI 4NBCA 1NUIA 1Z03A 2RT9A 4MD8A 3IX0A 3TDHB 1VQ41 1QVFZ 1M902 3S1QI 1Q861 1DL6A 1Q16A 4BY1I 4Y7NI 1YIT1 4AYBA 1VQL1 1RLYA 2W04A 1WIIA 3OW2Y 3GTMI 3MONA 1YJ9Z 5AN9F 1VQ8Z 3CXCZ 2JNYA 3CMAZ 1VQ5Z 3I551 1VQOZ 1JJ2Y 3FQQA 2F4MA 1QVGY 3IF8A 1YJNZ 4NBGA 2RBLA 1VQ61 4RVDA 3BG1B 4RVGA 3MZKB 5IP7I 1VQ4Z 3S16I
chains in the Genus database with same CATH topology
2QRCB 4CL1A 2JS4A 2JUBA 1YITZ 3JAMf 2V8JA 3G4S1 3S1MI 1VQLZ 1USPA 3M4OI 2IZ4A 1KC82 2JA8I 2GTIA 3GTKI 4A3BI 3RZDI 3HOUI 1M1K1 1Z02A 3NH5A 3ESWA 3FKII 5IT9b 2ZAEB 2JA6I 3I55Z 2E2II 2V8KA 1K731 2E9HA 4RVFA 1ML8A 4E2ZA 4NBFA 2IZ3A 2Q51A 3J81b 1K9M2 1VQ6Z 1NJI1 3GTMS 1PFTA 3EEDA 5IP9I 2P28A 4NBDA 5A2Qf 2HU9A 1YUAA 1P9NA 3NDIA 1K83I 1RO4A 3CCU1 4A3JI 3G4SZ 3F3PC 3J7A4 4NBHA 2DE6A 1USPB 2PMZA 4HGYA 1TFIA 4A3LI 4Y52I 3GTPI 1WCMI 4XX2A 4QTTA 4MONA 5LL6f 1Q7Y1 4NBEA 4BY7I 1VQN1 1L1OC 2W03A 2RPRA 3H0GI 5CM2M 3CC21 3CPWY 2R6MA 5D1PA 3S1NI 3CCUZ 1K8A1 2GTHA 3CCS1 1VQK1 3G6E1 2JR6A 1TWAI 4NH1C 3G711 3JAMb 2R93I 3S2HI 3U50C 4NOZA 3GTOI 5D1OA 3IFUA 1YUKA 2LFUA 5FLXf 3J80f 1VQNZ 3I561 2QEX1 4MD9A 1N8R2 3VTNA 3OW2Z 5T6BA 3CC2Z 3HOWI 4RV9A 3CCSZ 1VQKZ 3G6EZ 4BBSI 5T64A 2NVXI 3VMHA 1JJ2Z 3G71Z 2JMOA 2OOXB 1Q821 1QVGZ 2QRDB 3I4NI 3CCM1 5C4JI 3CC41 2RIQA 4RS4A 2JA7I 4NB9A 5D1OB 4DK1A 4E2WA 2LIYA 3I56Z 2H85A 2QEXZ 2OTJ1 3FQMA 3PO3I 4RVHA 1X0TA 1NJI2 3D9XA 2O4HA 2EGTA 3QWUA 1ZB8A 1VQ91 1VQM1 1YI21 1TWCI 2QKDA 1VQP1 1ZH1A 4E2XA 1SFOI 2AKLA 1YJW1 3HKZA 4QTUA 3CCMZ 3CC4Z 2Q4ZA 2QR1B 3CC71 1KD12 4A3II 3VB9A 3NH4A 2VF1A 2YADA 1Y1WI 2OTJZ 2K5RA 2F4OA 1KC81 2GU2A 2M6NA 1Y1VS 1QYPA 3I4MI 3GKQA 2R7ZI 3Q87A 3GCFA 1VQMZ 1VQ9Z 1K8A2 1YI2Z 4E33A 1VQPZ 3S17I 3GTJI 1WW9A 3GTQI 1YJWZ 1K9M1 3PO3S 2BJOA 2KPIA 3LUSA 1KQSY 3CC7Z 3CPWZ 2V8IA 5C4XI 4TNUA 1Q862 4E2YA 4E30A 2OZKA 2O53A 3BG0B 2HF1A 3VMIA 5T67A 1W2BY 3CCV1 2PK7A 3CCE1 5IT9f 3CCR1 2K3RA 5FLMI 5C44I 2QA41 3CCJ1 1VQ71 3S15I 2VUGA 2JA5I 3J81f 1Q811 1TWHI 5C3EI 4A3DI 1YIJ1 4S1TA 3CCQ1 2PM9A 1QVFY 1I50I 2M48A 2WAQA 5A2Qb 4DGLA 4A3GI 2E2JI 2Y0SA 1Y1VI 3T4NB 4HGZA 3CCVZ 1RO0A 4A3CI 2OOYB 3CCEZ 3CCRZ 3CXCY 3HOVI 1KRLA 1M1K2 1S721 2QA4Z 3CCJZ 4E31A 1M901 1VQ7Z 1I6HI 1N2FA 1K732 1YHQ1 1YIJZ 4BBRI 1N8R1 3K7AI 3CCQZ 2I3CA 3NFZA 2NVYI 3H3VJ 1RO2A 2QREB 3KIHA 3VMGA 1X3WA 4MXUA 3PO2I 1S72Z 1S7MA 4BXXI 1JWHC 2DE7A 1TWGI 4A93I 3KIFA 3S1RI 1YHQZ 4MRIA 4X6AI 3HOZI 4MH4A 1Q7Y2 1ZB9A 4A3KI 5FLXb 2VUMI 3J80b 3D6WA 2YU9I 3NH8A 3CD61 3GTGI 3EERA 2RHBA 1QF8A 1NP6A 4A3EI 2G2KA 4HH4A 3CME1 2WB1A 2DE5A 2OTL1 2QLVB 3S2DI 4NB8A 1KQSZ 3CCL1 4A3FI 2NVQI 3I07A 3MZLB 3RZOI 1X3ZA 1KD11 3CQZI 3GTLI 3HOXI 1RQFA 3S14I 1TWFI 2R92I 1Z01A 1Q812 2J6AA 4NBBA 1LQLA 4EWCA 3P5JB 2P3YA 4DQYB 1W2BZ 2NVTI 3CD6Z 1YJ91 4MD7A 1VQ81 1VLAA 4NBAA 2E2HI 3M3YI 3CMA1 1VQ51 1RNIA 4E32A 4A3MI 2B63I 3TE5B 1VQO1 3F3FC 3NDJA 4NFRA 3CMEZ 1Q822 2OTLZ 1I3QI 1YJN1 2KI7B 3HOYI 3CCLZ 1R9TI 4NBCA 1NUIA 1Z03A 2RT9A 4MD8A 3IX0A 3TDHB 1VQ41 1QVFZ 1M902 3S1QI 1Q861 1DL6A 4BY1I 4Y7NI 1YIT1 4AYBA 1VQL1 1RLYA 2W04A 1WIIA 3OW2Y 3GTMI 3MONA 1YJ9Z 5AN9F 1VQ8Z 3CXCZ 2JNYA 3CMAZ 1VQ5Z 3I551 1VQOZ 1JJ2Y 3FQQA 2F4MA 1QVGY 3IF8A 1YJNZ 4NBGA 2RBLA 1VQ61 4RVDA 3BG1B 4RVGA 3MZKB 5IP7I 1VQ4Z 3S16I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F3F C;  3F3P C; 
#chains in the Genus database with same CATH topology
 2QRC B;  4CL1 A;  2JS4 A;  2JUB A;  1YIT Z;  3JAM f;  2V8J A;  3G4S 1;  3S1M I;  1VQL Z;  1USP A;  3M4O I;  2IZ4 A;  1KC8 2;  2JA8 I;  2GTI A;  3GTK I;  4A3B I;  3RZD I;  3HOU I;  1M1K 1;  1Z02 A;  3NH5 A;  3ESW A;  3FKI I;  5IT9 b;  2ZAE B;  2JA6 I;  3I55 Z;  2E2I I;  1WJ2 A;  2V8K A;  1K73 1;  2E9H A;  4RVF A;  1ML8 A;  4E2Z A;  4NBF A;  2IZ3 A;  2Q51 A;  3J81 b;  1K9M 2;  1VQ6 Z;  2JIP A;  1NJI 1;  3GTM S;  1PFT A;  3EED A;  2NAP A;  5IP9 I;  2P28 A;  4NBD A;  5A2Q f;  2HU9 A;  1YUA A;  1P9N A;  3NDI A;  1K83 I;  1RO4 A;  3CCU 1;  4A3J I;  3G4S Z;  3F3P C;  1SIW A;  2VPW A;  3J7A 4;  4NBH A;  2DE6 A;  1USP B;  2PMZ A;  4HGY A;  1TFI A;  4A3L I;  4Y52 I;  3GTP I;  1WCM I;  4XX2 A;  4QTT A;  4MON A;  5LL6 f;  1Q7Y 1;  4NBE A;  4BY7 I;  2JIO A;  1VQN 1;  2IV2 X;  1L1O C;  2W03 A;  2RPR A;  3H0G I;  5CM2 M;  3CC2 1;  3CPW Y;  2R6M A;  5D1P A;  3S1N I;  3CCU Z;  1K8A 1;  2GTH A;  3CCS 1;  1VQK 1;  3G6E 1;  2JR6 A;  1TWA I;  4NH1 C;  3G71 1;  3JAM b;  2R93 I;  3S2H I;  1FDI A;  3U50 C;  4NOZ A;  3GTO I;  5D1O A;  3IFU A;  1YUK A;  2LFU A;  5FLX f;  3J80 f;  1VQN Z;  3I56 1;  2QEX 1;  4MD9 A;  1N8R 2;  3VTN A;  3OW2 Z;  5T6B A;  3CC2 Z;  2JIR A;  3HOW I;  4RV9 A;  3CCS Z;  1VQK Z;  3G6E Z;  4BBS I;  5T64 A;  2NVX I;  3VMH A;  1JJ2 Z;  3G71 Z;  2JMO A;  2OOX B;  1Q82 1;  1QVG Z;  2QRD B;  3I4N I;  3CCM 1;  5C4J I;  3CC4 1;  2RIQ A;  4RS4 A;  2JA7 I;  4NB9 A;  5D1O B;  4DK1 A;  4E2W A;  2LIY A;  3I56 Z;  2H85 A;  2QEX Z;  2OTJ 1;  3FQM A;  3PO3 I;  4RVH A;  1X0T A;  1NJI 2;  3D9X A;  2O4H A;  2EGT A;  3QWU A;  1ZB8 A;  1WZN A;  1VQM 1;  1VQ9 1;  1YI2 1;  1TWC I;  2QKD A;  1VQP 1;  1ZH1 A;  4E2X A;  1SFO I;  2AKL A;  1YJW 1;  3HKZ A;  4QTU A;  3CCM Z;  2V45 A;  1Y8C A;  3CC4 Z;  2Q4Z A;  2QR1 B;  3CC7 1;  1KD1 2;  4A3I I;  1QXF A;  3VB9 A;  3NH4 A;  2VF1 A;  2YAD A;  1Y1W I;  2OTJ Z;  2K5R A;  2F4O A;  1KC8 1;  2GU2 A;  2M6N A;  1Y1V S;  1QYP A;  3I4M I;  3GKQ A;  2R7Z I;  3Q87 A;  3GCF A;  1VQM Z;  1VQ9 Z;  1K8A 2;  1YI2 Z;  4E33 A;  1VQP Z;  3S17 I;  3GTJ I;  1WW9 A;  3GTQ I;  1YJW Z;  1K9M 1;  3PO3 S;  2BJO A;  2KPI A;  3LUS A;  1KQS Y;  3CC7 Z;  3CPW Z;  2V8I A;  5C4X I;  4TNU A;  1Q86 2;  4E2Y A;  4E30 A;  2VPZ A;  2OZK A;  2V3V A;  2O53 A;  3BG0 B;  2HF1 A;  3VMI A;  5T67 A;  1W2B Y;  3CCV 1;  2PK7 A;  3CCE 1;  5IT9 f;  3CCR 1;  2K3R A;  5FLM I;  5C44 I;  2QA4 1;  3CCJ 1;  1VQ7 1;  3S15 I;  2VUG A;  2JA5 I;  3J81 f;  1Q81 1;  1TWH I;  5C3E I;  3IR7 A;  4A3D I;  1YIJ 1;  4S1T A;  3CCQ 1;  2PM9 A;  1QVF Y;  1I50 I;  2M48 A;  2WAQ A;  5A2Q b;  4DGL A;  4A3G I;  2E2J I;  2Y0S A;  1Y1V I;  3T4N B;  4HGZ A;  3CCV Z;  1RO0 A;  4A3C I;  2OOY B;  3CCE Z;  1AA6 A;  3CCR Z;  3CXC Y;  3HOV I;  1KRL A;  1M1K 2;  1S72 1;  2QA4 Z;  3CCJ Z;  4E31 A;  1M90 1;  1VQ7 Z;  1I6H I;  2VPY A;  1N2F A;  1K73 2;  1YHQ 1;  1YIJ Z;  4BBR I;  1N8R 1;  3K7A I;  3CCQ Z;  2I3C A;  3NFZ A;  2NVY I;  3H3V J;  1RO2 A;  2QRE B;  3KIH A;  3D2L A;  3VMG A;  2JIM A;  1FDO A;  1X3W A;  4MXU A;  2LEX A;  3PO2 I;  1S72 Z;  1S7M A;  4BXX I;  1JWH C;  2DE7 A;  1TWG I;  4A93 I;  3KIF A;  3S1R I;  1YHQ Z;  4MRI A;  4X6A I;  3HOZ I;  4MH4 A;  1Q7Y 2;  1ZB9 A;  4A3K I;  5FLX b;  2VUM I;  2VPX A;  3J80 b;  3D6W A;  2YU9 I;  3NH8 A;  2E7Z A;  3CD6 1;  3GTG I;  3EER A;  2RHB A;  1QF8 A;  1NP6 A;  4A3E I;  2G2K A;  4HH4 A;  3CME 1;  2WB1 A;  2DE5 A;  2OTL 1;  2QLV B;  3S2D I;  4NB8 A;  1KQS Z;  3CCL 1;  4A3F I;  2NVQ I;  3I07 A;  3MZL B;  3RZO I;  1X3Z A;  1KD1 1;  3CQZ I;  3GTL I;  3HOX I;  1RQF A;  3S14 I;  1TWF I;  2R92 I;  1Z01 A;  1Q81 2;  2J6A A;  4NBB A;  1LQL A;  4EWC A;  3P5J B;  2P3Y A;  4DQY B;  1W2B Z;  2NVT I;  3CD6 Z;  1YJ9 1;  4MD7 A;  1VQ8 1;  1VLA A;  4NBA A;  2E2H I;  3M3Y I;  3CMA 1;  1VQ5 1;  1RNI A;  4E32 A;  4A3M I;  2B63 I;  3TE5 B;  1VQO 1;  3F3F C;  3NDJ A;  2AYD A;  4NFR A;  3CME Z;  1Q82 2;  2OTL Z;  1I3Q I;  1YJN 1;  2KI7 B;  3HOY I;  3CCL Z;  2JIQ A;  1R9T I;  4NBC A;  1NUI A;  1Z03 A;  2RT9 A;  4MD8 A;  3IX0 A;  3TDH B;  1VQ4 1;  1QVF Z;  1M90 2;  3S1Q I;  1Q86 1;  1DL6 A;  1Q16 A;  4BY1 I;  4Y7N I;  1YIT 1;  4AYB A;  1VQL 1;  1RLY A;  2W04 A;  1WII A;  3OW2 Y;  3GTM I;  3MON A;  1YJ9 Z;  5AN9 F;  1VQ8 Z;  3CXC Z;  2JNY A;  3CMA Z;  1VQ5 Z;  3I55 1;  1VQO Z;  1JJ2 Y;  3FQQ A;  2F4M A;  1QVG Y;  3IF8 A;  1YJN Z;  4NBG A;  2RBL A;  1VQ6 1;  4RVD A;  3BG1 B;  4RVG A;  3MZK B;  5IP7 I;  1VQ4 Z;  3S16 I; 
#chains in the Genus database with same CATH homology
 2QRC B;  4CL1 A;  2JS4 A;  2JUB A;  1YIT Z;  3JAM f;  2V8J A;  3G4S 1;  3S1M I;  1VQL Z;  1USP A;  3M4O I;  2IZ4 A;  1KC8 2;  2JA8 I;  2GTI A;  3GTK I;  4A3B I;  3RZD I;  3HOU I;  1M1K 1;  1Z02 A;  3NH5 A;  3ESW A;  3FKI I;  5IT9 b;  2ZAE B;  2JA6 I;  3I55 Z;  2E2I I;  2V8K A;  1K73 1;  2E9H A;  4RVF A;  1ML8 A;  4E2Z A;  4NBF A;  2IZ3 A;  2Q51 A;  3J81 b;  1K9M 2;  1VQ6 Z;  1NJI 1;  3GTM S;  1PFT A;  3EED A;  5IP9 I;  2P28 A;  4NBD A;  5A2Q f;  2HU9 A;  1YUA A;  1P9N A;  3NDI A;  1K83 I;  1RO4 A;  3CCU 1;  4A3J I;  3G4S Z;  3F3P C;  3J7A 4;  4NBH A;  2DE6 A;  1USP B;  2PMZ A;  4HGY A;  1TFI A;  4A3L I;  4Y52 I;  3GTP I;  1WCM I;  4XX2 A;  4QTT A;  4MON A;  5LL6 f;  1Q7Y 1;  4NBE A;  4BY7 I;  1VQN 1;  1L1O C;  2W03 A;  2RPR A;  3H0G I;  5CM2 M;  3CC2 1;  3CPW Y;  2R6M A;  5D1P A;  3S1N I;  3CCU Z;  1K8A 1;  2GTH A;  3CCS 1;  1VQK 1;  3G6E 1;  2JR6 A;  1TWA I;  4NH1 C;  3G71 1;  3JAM b;  2R93 I;  3S2H I;  3U50 C;  4NOZ A;  3GTO I;  5D1O A;  3IFU A;  1YUK A;  2LFU A;  5FLX f;  3J80 f;  1VQN Z;  3I56 1;  2QEX 1;  4MD9 A;  1N8R 2;  3VTN A;  3OW2 Z;  5T6B A;  3CC2 Z;  3HOW I;  4RV9 A;  3CCS Z;  1VQK Z;  3G6E Z;  4BBS I;  5T64 A;  2NVX I;  3VMH A;  1JJ2 Z;  3G71 Z;  2JMO A;  2OOX B;  1Q82 1;  1QVG Z;  2QRD B;  3I4N I;  3CCM 1;  5C4J I;  3CC4 1;  2RIQ A;  4RS4 A;  2JA7 I;  4NB9 A;  5D1O B;  4DK1 A;  4E2W A;  2LIY A;  3I56 Z;  2H85 A;  2QEX Z;  2OTJ 1;  3FQM A;  3PO3 I;  4RVH A;  1X0T A;  1NJI 2;  3D9X A;  2O4H A;  2EGT A;  3QWU A;  1ZB8 A;  1VQ9 1;  1VQM 1;  1YI2 1;  1TWC I;  2QKD A;  1VQP 1;  1ZH1 A;  4E2X A;  1SFO I;  2AKL A;  1YJW 1;  3HKZ A;  4QTU A;  3CCM Z;  3CC4 Z;  2Q4Z A;  2QR1 B;  3CC7 1;  1KD1 2;  4A3I I;  3VB9 A;  3NH4 A;  2VF1 A;  2YAD A;  1Y1W I;  2OTJ Z;  2K5R A;  2F4O A;  1KC8 1;  2GU2 A;  2M6N A;  1Y1V S;  1QYP A;  3I4M I;  3GKQ A;  2R7Z I;  3Q87 A;  3GCF A;  1VQM Z;  1VQ9 Z;  1K8A 2;  1YI2 Z;  4E33 A;  1VQP Z;  3S17 I;  3GTJ I;  1WW9 A;  3GTQ I;  1YJW Z;  1K9M 1;  3PO3 S;  2BJO A;  2KPI A;  3LUS A;  1KQS Y;  3CC7 Z;  3CPW Z;  2V8I A;  5C4X I;  4TNU A;  1Q86 2;  4E2Y A;  4E30 A;  2OZK A;  2O53 A;  3BG0 B;  2HF1 A;  3VMI A;  5T67 A;  1W2B Y;  3CCV 1;  2PK7 A;  3CCE 1;  5IT9 f;  3CCR 1;  2K3R A;  5FLM I;  5C44 I;  2QA4 1;  3CCJ 1;  1VQ7 1;  3S15 I;  2VUG A;  2JA5 I;  3J81 f;  1Q81 1;  1TWH I;  5C3E I;  4A3D I;  1YIJ 1;  4S1T A;  3CCQ 1;  2PM9 A;  1QVF Y;  1I50 I;  2M48 A;  2WAQ A;  5A2Q b;  4DGL A;  4A3G I;  2E2J I;  2Y0S A;  1Y1V I;  3T4N B;  4HGZ A;  3CCV Z;  1RO0 A;  4A3C I;  2OOY B;  3CCE Z;  3CCR Z;  3CXC Y;  3HOV I;  1KRL A;  1M1K 2;  1S72 1;  2QA4 Z;  3CCJ Z;  4E31 A;  1M90 1;  1VQ7 Z;  1I6H I;  1N2F A;  1K73 2;  1YHQ 1;  1YIJ Z;  4BBR I;  1N8R 1;  3K7A I;  3CCQ Z;  2I3C A;  3NFZ A;  2NVY I;  3H3V J;  1RO2 A;  2QRE B;  3KIH A;  3VMG A;  1X3W A;  4MXU A;  3PO2 I;  1S72 Z;  1S7M A;  4BXX I;  1JWH C;  2DE7 A;  1TWG I;  4A93 I;  3KIF A;  3S1R I;  1YHQ Z;  4MRI A;  4X6A I;  3HOZ I;  4MH4 A;  1Q7Y 2;  1ZB9 A;  4A3K I;  5FLX b;  2VUM I;  3J80 b;  3D6W A;  2YU9 I;  3NH8 A;  3CD6 1;  3GTG I;  3EER A;  2RHB A;  1QF8 A;  1NP6 A;  4A3E I;  2G2K A;  4HH4 A;  3CME 1;  2WB1 A;  2DE5 A;  2OTL 1;  2QLV B;  3S2D I;  4NB8 A;  1KQS Z;  3CCL 1;  4A3F I;  2NVQ I;  3I07 A;  3MZL B;  3RZO I;  1X3Z A;  1KD1 1;  3CQZ I;  3GTL I;  3HOX I;  1RQF A;  3S14 I;  1TWF I;  2R92 I;  1Z01 A;  1Q81 2;  2J6A A;  4NBB A;  1LQL A;  4EWC A;  3P5J B;  2P3Y A;  4DQY B;  1W2B Z;  2NVT I;  3CD6 Z;  1YJ9 1;  4MD7 A;  1VQ8 1;  1VLA A;  4NBA A;  2E2H I;  3M3Y I;  3CMA 1;  1VQ5 1;  1RNI A;  4E32 A;  4A3M I;  2B63 I;  3TE5 B;  1VQO 1;  3F3F C;  3NDJ A;  4NFR A;  3CME Z;  1Q82 2;  2OTL Z;  1I3Q I;  1YJN 1;  2KI7 B;  3HOY I;  3CCL Z;  1R9T I;  4NBC A;  1NUI A;  1Z03 A;  2RT9 A;  4MD8 A;  3IX0 A;  3TDH B;  1VQ4 1;  1QVF Z;  1M90 2;  3S1Q I;  1Q86 1;  1DL6 A;  4BY1 I;  4Y7N I;  1YIT 1;  4AYB A;  1VQL 1;  1RLY A;  2W04 A;  1WII A;  3OW2 Y;  3GTM I;  3MON A;  1YJ9 Z;  5AN9 F;  1VQ8 Z;  3CXC Z;  2JNY A;  3CMA Z;  1VQ5 Z;  3I55 1;  1VQO Z;  1JJ2 Y;  3FQQ A;  2F4M A;  1QVG Y;  3IF8 A;  1YJN Z;  4NBG A;  2RBL A;  1VQ6 1;  4RVD A;  3BG1 B;  4RVG A;  3MZK B;  5IP7 I;  1VQ4 Z;  3S16 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...