1WIIA

Solution structure of rsgi ruh-025, a duf701 domain from mouse cdna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
85
structure length
85
Chain Sequence
GSSGSSGRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical UPF0222 protein MGC4549
publication title Solution structure of RSGI RUH-025, a DUF701 domain from mouse cDNA
rcsb
source organism Mus musculus
total genus 9
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.190 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1wiiA01
1WIIA
chains in the Genus database with same CATH superfamily
2W03A 5CM2M 3F3FC 1VQMZ 2OTJZ 3I4NI 2NVYI 3S2HI 1I3QI 2QRCB 4AYBA 2JA7I 3J81f 4Y7NI 3EERA 2JIPA 1YJNZ 5T6BA 2QA41 1WW9A 4MONA 3GCFA 2RBLA 2NVTI 3ESWA 1WCMI 3BG1B 1KQSY 3HOZI 3CCM1 2AKLA 1QVGZ 2GU2A 1USPA 2K5RA 4E2XA 1VQM1 2JA6I 2OTJ1 1Y8CA 4MH4A 1M1K1 3S1RI 3EEDA 3IF8A 1YJN1 5IT9f 3VMIA 3CCQZ 5FLXb 2HU9A 1YJ9Z 1VQ81 2GTIA 2G2KA 3G4SZ 4A3EI 3H0GI 3HOYI 3QWUA 1P9NA 1VQ71 4MXUA 5T64A 2W04A 3RZOI 2KI7B 1WJ2A 3OW2Y 3D9XA 1Z01A 1YI2Z 3CCQ1 2LIYA 1YJ91 1TWHI 3J80f 1KD12 3CCLZ 5LL6f 3G4S1 4A93I 3I56Z 1Q811 3CC4Z 3CPWY 5A2Qb 2LFUA 3CC71 1K83I 3CMAZ 3VMGA 4QTUA 3FKII 3U50C 3Q87A 1TWAI 1FDIA 4DQYB 1YI21 2DE7A 1KC81 3GTQI 4XX2A 1RO0A 1Q862 1Q822 3G71Z 3CCL1 2DE5A 4E33A 3I561 1TFIA 1KQSZ 3CC41 3P5JB 4S1TA 2Q51A 3CD6Z 3CMA1 3IX0A 1S72Z 1ZB9A 3GTPI 4MRIA 3HOWI 2R93I 2LEXA 3CCEZ 1N8R2 4A3GI 2WAQA 4A3MI 4BBRI 3G711 1VQOZ 1L1OC 1FDOA 3CQZI 4A3DI 1YIJZ 2JNYA 2F4OA 3CD61 3S1QI 3S2DI 2IV2X 4A3II 2JA5I 4RVGA 4NH1C 3NH4A 3CCE1 2P3YA 5D1PA 2J6AA 3HKZA 2B63I 1VQO1 3KIHA 1Q7Y1 2JMOA 1YIJ1 1M902 4NBFA 4BXXI 2PK7A 4RVFA 4BY7I 4EWCA 1SFOI 3VMHA 4NBDA 2E7ZA 2Y0SA 2QEXZ 4NBBA 1DL6A 1QVFZ 1VQLZ 1X3ZA 1W2BY 1PFTA 1Z03A 3MZKB 3CXCZ 3CCU1 1JJ2Z 1YUKA 1K9M1 1YITZ 5FLXf 1X0TA 2V8IA 4Y52I 3D2LA 1M1K2 2NVXI 4RS4A 1K8A1 1VQL1 3TDHB 1NP6A 4DK1A 1WIIA 2JS4A 3JAMf 3I4MI 3FQMA 1WZNA 4NB8A 3PO3I 2ZAEB 4HGZA 4E2ZA 1RNIA 2V45A 1VQ4Z 2AYDA 1RLYA 1VQPZ 2JIQA 3HOXI 3VB9A 3J7A4 2KPIA 2QKDA 4RVDA 1Q812 1Y1VS 3FQQA 1VQ41 3S1NI 5AN9F 3I07A 1Q16A 5IT9b 5T67A 1KC82 1QYPA 1W2BZ 4TNUA 4A3KI 1QVFY 1AA6A 3NDJA 4NBCA 5C44I 4A3CI 1VLAA 3CXCY 1JJ2Y 2H85A 2JA8I 2P28A 4X6AI 3GTGI 3S15I 3TE5B 3CCRZ 1YJWZ 2QRDB 4A3FI 4NFRA 3MZLB 2PMZA 3GTOI 3KIFA 2VPZA 4HGYA 3HOVI 2I3CA 3GTMI 2JUBA 2JIMA 2K3RA 4BY1I 1RQFA 1S721 4NB9A 3CCR1 2VPWA 1YJW1 4E2YA 1Z02A 2JIRA 2PM9A 1VQKZ 2OTLZ 4HH4A 1SIWA 3NDIA 1Q7Y2 1JWHC 2O53A 1K731 5IP9I 5C4JI 4NBHA 1VQ5Z 2R7ZI 2O4HA 4BBSI 1ZB8A 4A3BI 2VPXA 4MD7A 1VQK1 3T4NB 4E31A 3GTLI 1QXFA 2RHBA 3GTKI 1K9M2 2VUMI 2V8KA 4NBAA 2M6NA 2IZ3A 5D1OA 3S1MI 1NJI1 2OOYB 4NBGA 1K8A2 2QEX1 1QF8A 5C4XI 1TWCI 2E2HI 2GTHA 1ZH1A 1I6HI 4RV9A 1LQLA 3BG0B 1N2FA 4NOZA 2BJOA 1VQ8Z 3H3VJ 1S7MA 1YIT1 1VQ6Z 2OZKA 3I55Z 2F4MA 3J81b 1VQ7Z 2QLVB 5A2Qf 2RPRA 2IZ4A 4DGLA 3RZDI 1VQ9Z 2JR6A 2EGTA 4MD8A 3D6WA 3PO3S 4RVHA 3G6EZ 1VQNZ 1ML8A 1VQ61 3I551 1RO2A 2NAPA 4E32A 2R6MA 1Y1VI 3CC7Z 3S14I 3PO2I 1VQP1 3S16I 3JAMb 3GKQA 2V8JA 1VQ91 4A3LI 2NVQI 3CMEZ 2RT9A 1TWGI 3G6E1 4E30A 3CC2Z 1VQN1 1R9TI 1KD11 2QREB 4E2WA 2VF1A 2VUGA 3J80b 3CCJZ 2E2JI 2YADA 3M4OI 2QR1B 3GTJI 3CME1 2HF1A 2V3VA 3CC21 2M48A 4QTTA 4NBEA 1Q861 1Q821 3F3PC 3K7AI 3MONA 2RIQA 1QVGY 1YUAA 5D1OB 3M3YI 3CCJ1 2Q4ZA 2OOXB 3NH8A 1K732 1RO4A 5FLMI 4A3JI 3GTMS 1N8R1 3LUSA 3HOUI 1I50I 2R92I 5IP7I 2E2II 1YHQZ 4MD9A 1Y1WI 1X3WA 3CCSZ 3CCVZ 2OTL1 3IR7A 3OW2Z 2E9HA 2VPYA 3VTNA 3S17I 1USPB 4CL1A 1TWFI 1KRLA 1VQ51 2WB1A 2QA4Z 5C3EI 3NH5A 3CCUZ 2YU9I 3IFUA 2DE6A 1NJI2 3CPWZ 1NUIA 1YHQ1 3CCS1 3CCV1 1M901 3NFZA 2JIOA 3CCMZ
chains in the Genus database with same CATH topology
2W03A 5CM2M 3F3FC 1VQMZ 2OTJZ 3I4NI 2NVYI 3S2HI 1I3QI 2QRCB 4AYBA 2JA7I 3J81f 4Y7NI 3EERA 1YJNZ 5T6BA 2QA41 1WW9A 4MONA 3GCFA 2RBLA 2NVTI 3ESWA 1WCMI 3BG1B 1KQSY 3HOZI 3CCM1 2AKLA 1QVGZ 2GU2A 1USPA 2K5RA 4E2XA 1VQM1 2JA6I 2OTJ1 4MH4A 1M1K1 3S1RI 3EEDA 3IF8A 1YJN1 5IT9f 3VMIA 3CCQZ 5FLXb 2HU9A 1YJ9Z 1VQ81 2GTIA 2G2KA 3G4SZ 4A3EI 3H0GI 3HOYI 3QWUA 1P9NA 1VQ71 4MXUA 5T64A 2W04A 3RZOI 2KI7B 3OW2Y 3D9XA 1Z01A 1YI2Z 3CCQ1 2LIYA 1YJ91 1TWHI 3J80f 1KD12 3CCLZ 5LL6f 3G4S1 4A93I 3I56Z 1Q811 3CC4Z 3CPWY 3CC71 5A2Qb 2LFUA 1K83I 3CMAZ 3VMGA 4QTUA 3FKII 3U50C 3Q87A 1TWAI 4DQYB 1YI21 2DE7A 1KC81 3GTQI 4XX2A 1RO0A 1Q862 1Q822 3G71Z 3CCL1 2DE5A 4E33A 3I561 1TFIA 1KQSZ 3CC41 3P5JB 4S1TA 2Q51A 3CD6Z 3CMA1 3IX0A 1S72Z 1ZB9A 3GTPI 4MRIA 3HOWI 2R93I 3CCEZ 1N8R2 4A3GI 2WAQA 4A3MI 4BBRI 3G711 1VQOZ 1L1OC 3CQZI 4A3DI 1YIJZ 2JNYA 2F4OA 3CD61 3S1QI 3S2DI 4A3II 2JA5I 4RVGA 4NH1C 3NH4A 3CCE1 2P3YA 5D1PA 2J6AA 3HKZA 2B63I 1VQO1 3KIHA 1Q7Y1 2JMOA 1YIJ1 1M902 4NBFA 4BXXI 2PK7A 4RVFA 4BY7I 4EWCA 1SFOI 3VMHA 4NBDA 2Y0SA 2QEXZ 4NBBA 1DL6A 1QVFZ 1VQLZ 1X3ZA 1W2BY 1PFTA 1Z03A 3MZKB 3CXCZ 3CCU1 1JJ2Z 1YUKA 1K9M1 1YITZ 5FLXf 1X0TA 2V8IA 4Y52I 1M1K2 2NVXI 4RS4A 1K8A1 1VQL1 3TDHB 1NP6A 4DK1A 1WIIA 2JS4A 3JAMf 3I4MI 3FQMA 4NB8A 3PO3I 2ZAEB 4HGZA 4E2ZA 1RNIA 1VQ4Z 1RLYA 1VQPZ 3HOXI 3VB9A 3J7A4 2KPIA 2QKDA 4RVDA 1Q812 1Y1VS 3FQQA 1VQ41 3S1NI 5AN9F 3I07A 5IT9b 5T67A 1KC82 1QYPA 1W2BZ 4TNUA 4A3KI 1QVFY 3NDJA 4NBCA 5C44I 4A3CI 1VLAA 3CXCY 1JJ2Y 2H85A 2JA8I 2P28A 4X6AI 3GTGI 3S15I 3TE5B 3CCRZ 1YJWZ 2QRDB 4A3FI 4NFRA 3MZLB 2PMZA 3GTOI 3KIFA 4HGYA 3HOVI 2I3CA 3GTMI 2JUBA 2K3RA 4BY1I 1RQFA 1S721 4NB9A 3CCR1 1YJW1 4E2YA 1Z02A 2PM9A 1VQKZ 2OTLZ 4HH4A 3NDIA 1Q7Y2 1JWHC 2O53A 1K731 5IP9I 5C4JI 4NBHA 1VQ5Z 2R7ZI 2O4HA 4BBSI 1ZB8A 4A3BI 4MD7A 1VQK1 3T4NB 4E31A 3GTLI 2RHBA 3GTKI 1K9M2 2VUMI 2V8KA 4NBAA 2M6NA 2IZ3A 5D1OA 3S1MI 1NJI1 2OOYB 4NBGA 1K8A2 2QEX1 1QF8A 5C4XI 1TWCI 2E2HI 2GTHA 1ZH1A 1I6HI 4RV9A 1LQLA 3BG0B 1N2FA 4NOZA 2BJOA 1VQ8Z 3H3VJ 1S7MA 1YIT1 1VQ6Z 2OZKA 3I55Z 2F4MA 3J81b 1VQ7Z 2QLVB 5A2Qf 2RPRA 2IZ4A 4DGLA 3RZDI 1VQ9Z 2JR6A 2EGTA 4MD8A 3D6WA 3PO3S 4RVHA 3G6EZ 1VQNZ 1ML8A 1VQ61 3I551 1RO2A 4E32A 2R6MA 1Y1VI 3CC7Z 3S14I 3PO2I 1VQP1 3S16I 3JAMb 3GKQA 2V8JA 1VQ91 4A3LI 2NVQI 3CMEZ 2RT9A 1TWGI 4E30A 3G6E1 3CC2Z 1VQN1 1R9TI 1KD11 2QREB 4E2WA 2VF1A 2VUGA 3J80b 3CCJZ 2E2JI 2YADA 3M4OI 2QR1B 3GTJI 3CME1 2HF1A 3CC21 2M48A 4QTTA 4NBEA 1Q861 1Q821 3F3PC 3K7AI 3MONA 2RIQA 1QVGY 1YUAA 5D1OB 3M3YI 3CCJ1 2Q4ZA 2OOXB 3NH8A 1K732 1RO4A 5FLMI 4A3JI 3GTMS 1N8R1 3LUSA 3HOUI 1I50I 2R92I 5IP7I 2E2II 1YHQZ 4MD9A 1Y1WI 1X3WA 3CCSZ 3CCVZ 2OTL1 3OW2Z 2E9HA 3VTNA 3S17I 1USPB 4CL1A 1TWFI 1KRLA 1VQ51 2WB1A 2QA4Z 5C3EI 3NH5A 3CCUZ 2YU9I 3IFUA 2DE6A 1NJI2 3CPWZ 1NUIA 1YHQ1 3CCS1 3CCV1 1M901 3NFZA 3CCMZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WII A; 
#chains in the Genus database with same CATH topology
 2W03 A;  5CM2 M;  3F3F C;  1VQM Z;  2OTJ Z;  3I4N I;  2NVY I;  3S2H I;  1I3Q I;  2QRC B;  4AYB A;  2JA7 I;  3J81 f;  4Y7N I;  3EER A;  2JIP A;  1YJN Z;  5T6B A;  2QA4 1;  1WW9 A;  4MON A;  3GCF A;  2RBL A;  2NVT I;  3ESW A;  1WCM I;  3BG1 B;  1KQS Y;  3HOZ I;  3CCM 1;  2AKL A;  1QVG Z;  2GU2 A;  1USP A;  2K5R A;  4E2X A;  1VQM 1;  2JA6 I;  2OTJ 1;  1Y8C A;  4MH4 A;  1M1K 1;  3S1R I;  3EED A;  3IF8 A;  1YJN 1;  5IT9 f;  3VMI A;  3CCQ Z;  5FLX b;  2HU9 A;  1YJ9 Z;  1VQ8 1;  2GTI A;  2G2K A;  3G4S Z;  4A3E I;  3H0G I;  3HOY I;  3QWU A;  1P9N A;  1VQ7 1;  4MXU A;  5T64 A;  2W04 A;  3RZO I;  2KI7 B;  1WJ2 A;  3OW2 Y;  3D9X A;  1Z01 A;  1YI2 Z;  3CCQ 1;  2LIY A;  1YJ9 1;  1TWH I;  3J80 f;  1KD1 2;  3CCL Z;  5LL6 f;  3G4S 1;  4A93 I;  3I56 Z;  1Q81 1;  3CC4 Z;  3CPW Y;  5A2Q b;  2LFU A;  3CC7 1;  1K83 I;  3CMA Z;  3VMG A;  4QTU A;  3FKI I;  3U50 C;  3Q87 A;  1TWA I;  1FDI A;  4DQY B;  1YI2 1;  2DE7 A;  1KC8 1;  3GTQ I;  4XX2 A;  1RO0 A;  1Q86 2;  1Q82 2;  3G71 Z;  3CCL 1;  2DE5 A;  4E33 A;  3I56 1;  1TFI A;  1KQS Z;  3CC4 1;  3P5J B;  4S1T A;  2Q51 A;  3CD6 Z;  3CMA 1;  3IX0 A;  1S72 Z;  1ZB9 A;  3GTP I;  4MRI A;  3HOW I;  2R93 I;  2LEX A;  3CCE Z;  1N8R 2;  4A3G I;  2WAQ A;  4A3M I;  4BBR I;  3G71 1;  1VQO Z;  1L1O C;  1FDO A;  3CQZ I;  4A3D I;  1YIJ Z;  2JNY A;  2F4O A;  3CD6 1;  3S1Q I;  3S2D I;  2IV2 X;  4A3I I;  2JA5 I;  4RVG A;  4NH1 C;  3NH4 A;  3CCE 1;  2P3Y A;  5D1P A;  2J6A A;  3HKZ A;  2B63 I;  1VQO 1;  3KIH A;  1Q7Y 1;  2JMO A;  1YIJ 1;  1M90 2;  4NBF A;  4BXX I;  2PK7 A;  4RVF A;  4BY7 I;  4EWC A;  1SFO I;  3VMH A;  4NBD A;  2E7Z A;  2Y0S A;  2QEX Z;  4NBB A;  1DL6 A;  1QVF Z;  1VQL Z;  1X3Z A;  1W2B Y;  1PFT A;  1Z03 A;  3MZK B;  3CXC Z;  3CCU 1;  1JJ2 Z;  1YUK A;  1K9M 1;  1YIT Z;  5FLX f;  1X0T A;  2V8I A;  4Y52 I;  3D2L A;  1M1K 2;  2NVX I;  4RS4 A;  1K8A 1;  1VQL 1;  3TDH B;  1NP6 A;  4DK1 A;  1WII A;  2JS4 A;  3JAM f;  3I4M I;  3FQM A;  1WZN A;  4NB8 A;  3PO3 I;  2ZAE B;  4HGZ A;  4E2Z A;  1RNI A;  2V45 A;  1VQ4 Z;  2AYD A;  1RLY A;  1VQP Z;  2JIQ A;  3HOX I;  3VB9 A;  3J7A 4;  2KPI A;  2QKD A;  4RVD A;  1Q81 2;  1Y1V S;  3FQQ A;  1VQ4 1;  3S1N I;  5AN9 F;  3I07 A;  1Q16 A;  5IT9 b;  5T67 A;  1KC8 2;  1QYP A;  1W2B Z;  4TNU A;  4A3K I;  1QVF Y;  1AA6 A;  3NDJ A;  4NBC A;  5C44 I;  4A3C I;  1VLA A;  3CXC Y;  1JJ2 Y;  2H85 A;  2JA8 I;  2P28 A;  4X6A I;  3GTG I;  3S15 I;  3TE5 B;  3CCR Z;  1YJW Z;  2QRD B;  4A3F I;  4NFR A;  3MZL B;  2PMZ A;  3GTO I;  3KIF A;  2VPZ A;  4HGY A;  3HOV I;  2I3C A;  3GTM I;  2JUB A;  2JIM A;  2K3R A;  4BY1 I;  1RQF A;  1S72 1;  4NB9 A;  3CCR 1;  2VPW A;  1YJW 1;  4E2Y A;  1Z02 A;  2JIR A;  2PM9 A;  1VQK Z;  2OTL Z;  4HH4 A;  1SIW A;  3NDI A;  1Q7Y 2;  1JWH C;  2O53 A;  1K73 1;  5IP9 I;  5C4J I;  4NBH A;  1VQ5 Z;  2R7Z I;  2O4H A;  4BBS I;  1ZB8 A;  4A3B I;  2VPX A;  4MD7 A;  1VQK 1;  3T4N B;  4E31 A;  3GTL I;  1QXF A;  2RHB A;  3GTK I;  1K9M 2;  2VUM I;  2V8K A;  4NBA A;  2M6N A;  2IZ3 A;  5D1O A;  3S1M I;  1NJI 1;  2OOY B;  4NBG A;  1K8A 2;  2QEX 1;  1QF8 A;  5C4X I;  1TWC I;  2E2H I;  2GTH A;  1ZH1 A;  1I6H I;  4RV9 A;  1LQL A;  3BG0 B;  1N2F A;  4NOZ A;  2BJO A;  1VQ8 Z;  3H3V J;  1S7M A;  1YIT 1;  1VQ6 Z;  2OZK A;  3I55 Z;  2F4M A;  3J81 b;  1VQ7 Z;  2QLV B;  5A2Q f;  2RPR A;  2IZ4 A;  4DGL A;  3RZD I;  1VQ9 Z;  2JR6 A;  2EGT A;  4MD8 A;  3D6W A;  3PO3 S;  4RVH A;  3G6E Z;  1VQN Z;  1ML8 A;  1VQ6 1;  3I55 1;  1RO2 A;  2NAP A;  4E32 A;  2R6M A;  1Y1V I;  3CC7 Z;  3S14 I;  3PO2 I;  1VQP 1;  3S16 I;  3JAM b;  3GKQ A;  2V8J A;  1VQ9 1;  4A3L I;  2NVQ I;  3CME Z;  2RT9 A;  1TWG I;  3G6E 1;  4E30 A;  3CC2 Z;  1VQN 1;  1R9T I;  1KD1 1;  2QRE B;  4E2W A;  2VF1 A;  2VUG A;  3J80 b;  3CCJ Z;  2E2J I;  2YAD A;  3M4O I;  2QR1 B;  3GTJ I;  3CME 1;  2HF1 A;  2V3V A;  3CC2 1;  2M48 A;  4QTT A;  4NBE A;  1Q86 1;  1Q82 1;  3F3P C;  3K7A I;  3MON A;  2RIQ A;  1QVG Y;  1YUA A;  5D1O B;  3M3Y I;  3CCJ 1;  2Q4Z A;  2OOX B;  3NH8 A;  1K73 2;  1RO4 A;  5FLM I;  4A3J I;  3GTM S;  1N8R 1;  3LUS A;  3HOU I;  1I50 I;  2R92 I;  5IP7 I;  2E2I I;  1YHQ Z;  4MD9 A;  1Y1W I;  1X3W A;  3CCS Z;  3CCV Z;  2OTL 1;  3IR7 A;  3OW2 Z;  2E9H A;  2VPY A;  3VTN A;  3S17 I;  1USP B;  4CL1 A;  1TWF I;  1KRL A;  1VQ5 1;  2WB1 A;  2QA4 Z;  5C3E I;  3NH5 A;  3CCU Z;  2YU9 I;  3IFU A;  2DE6 A;  1NJI 2;  3CPW Z;  1NUI A;  1YHQ 1;  3CCS 1;  3CCV 1;  1M90 1;  3NFZ A;  2JIO A;  3CCM Z; 
#chains in the Genus database with same CATH homology
 2W03 A;  5CM2 M;  3F3F C;  1VQM Z;  2OTJ Z;  3I4N I;  2NVY I;  3S2H I;  1I3Q I;  2QRC B;  4AYB A;  2JA7 I;  3J81 f;  4Y7N I;  3EER A;  1YJN Z;  5T6B A;  2QA4 1;  1WW9 A;  4MON A;  3GCF A;  2RBL A;  2NVT I;  3ESW A;  1WCM I;  3BG1 B;  1KQS Y;  3HOZ I;  3CCM 1;  2AKL A;  1QVG Z;  2GU2 A;  1USP A;  2K5R A;  4E2X A;  1VQM 1;  2JA6 I;  2OTJ 1;  4MH4 A;  1M1K 1;  3S1R I;  3EED A;  3IF8 A;  1YJN 1;  5IT9 f;  3VMI A;  3CCQ Z;  5FLX b;  2HU9 A;  1YJ9 Z;  1VQ8 1;  2GTI A;  2G2K A;  3G4S Z;  4A3E I;  3H0G I;  3HOY I;  3QWU A;  1P9N A;  1VQ7 1;  4MXU A;  5T64 A;  2W04 A;  3RZO I;  2KI7 B;  3OW2 Y;  3D9X A;  1Z01 A;  1YI2 Z;  3CCQ 1;  2LIY A;  1YJ9 1;  1TWH I;  3J80 f;  1KD1 2;  3CCL Z;  5LL6 f;  3G4S 1;  4A93 I;  3I56 Z;  1Q81 1;  3CC4 Z;  3CPW Y;  3CC7 1;  5A2Q b;  2LFU A;  1K83 I;  3CMA Z;  3VMG A;  4QTU A;  3FKI I;  3U50 C;  3Q87 A;  1TWA I;  4DQY B;  1YI2 1;  2DE7 A;  1KC8 1;  3GTQ I;  4XX2 A;  1RO0 A;  1Q86 2;  1Q82 2;  3G71 Z;  3CCL 1;  2DE5 A;  4E33 A;  3I56 1;  1TFI A;  1KQS Z;  3CC4 1;  3P5J B;  4S1T A;  2Q51 A;  3CD6 Z;  3CMA 1;  3IX0 A;  1S72 Z;  1ZB9 A;  3GTP I;  4MRI A;  3HOW I;  2R93 I;  3CCE Z;  1N8R 2;  4A3G I;  2WAQ A;  4A3M I;  4BBR I;  3G71 1;  1VQO Z;  1L1O C;  3CQZ I;  4A3D I;  1YIJ Z;  2JNY A;  2F4O A;  3CD6 1;  3S1Q I;  3S2D I;  4A3I I;  2JA5 I;  4RVG A;  4NH1 C;  3NH4 A;  3CCE 1;  2P3Y A;  5D1P A;  2J6A A;  3HKZ A;  2B63 I;  1VQO 1;  3KIH A;  1Q7Y 1;  2JMO A;  1YIJ 1;  1M90 2;  4NBF A;  4BXX I;  2PK7 A;  4RVF A;  4BY7 I;  4EWC A;  1SFO I;  3VMH A;  4NBD A;  2Y0S A;  2QEX Z;  4NBB A;  1DL6 A;  1QVF Z;  1VQL Z;  1X3Z A;  1W2B Y;  1PFT A;  1Z03 A;  3MZK B;  3CXC Z;  3CCU 1;  1JJ2 Z;  1YUK A;  1K9M 1;  1YIT Z;  5FLX f;  1X0T A;  2V8I A;  4Y52 I;  1M1K 2;  2NVX I;  4RS4 A;  1K8A 1;  1VQL 1;  3TDH B;  1NP6 A;  4DK1 A;  1WII A;  2JS4 A;  3JAM f;  3I4M I;  3FQM A;  4NB8 A;  3PO3 I;  2ZAE B;  4HGZ A;  4E2Z A;  1RNI A;  1VQ4 Z;  1RLY A;  1VQP Z;  3HOX I;  3VB9 A;  3J7A 4;  2KPI A;  2QKD A;  4RVD A;  1Q81 2;  1Y1V S;  3FQQ A;  1VQ4 1;  3S1N I;  5AN9 F;  3I07 A;  5IT9 b;  5T67 A;  1KC8 2;  1QYP A;  1W2B Z;  4TNU A;  4A3K I;  1QVF Y;  3NDJ A;  4NBC A;  5C44 I;  4A3C I;  1VLA A;  3CXC Y;  1JJ2 Y;  2H85 A;  2JA8 I;  2P28 A;  4X6A I;  3GTG I;  3S15 I;  3TE5 B;  3CCR Z;  1YJW Z;  2QRD B;  4A3F I;  4NFR A;  3MZL B;  2PMZ A;  3GTO I;  3KIF A;  4HGY A;  3HOV I;  2I3C A;  3GTM I;  2JUB A;  2K3R A;  4BY1 I;  1RQF A;  1S72 1;  4NB9 A;  3CCR 1;  1YJW 1;  4E2Y A;  1Z02 A;  2PM9 A;  1VQK Z;  2OTL Z;  4HH4 A;  3NDI A;  1Q7Y 2;  1JWH C;  2O53 A;  1K73 1;  5IP9 I;  5C4J I;  4NBH A;  1VQ5 Z;  2R7Z I;  2O4H A;  4BBS I;  1ZB8 A;  4A3B I;  4MD7 A;  1VQK 1;  3T4N B;  4E31 A;  3GTL I;  2RHB A;  3GTK I;  1K9M 2;  2VUM I;  2V8K A;  4NBA A;  2M6N A;  2IZ3 A;  5D1O A;  3S1M I;  1NJI 1;  2OOY B;  4NBG A;  1K8A 2;  2QEX 1;  1QF8 A;  5C4X I;  1TWC I;  2E2H I;  2GTH A;  1ZH1 A;  1I6H I;  4RV9 A;  1LQL A;  3BG0 B;  1N2F A;  4NOZ A;  2BJO A;  1VQ8 Z;  3H3V J;  1S7M A;  1YIT 1;  1VQ6 Z;  2OZK A;  3I55 Z;  2F4M A;  3J81 b;  1VQ7 Z;  2QLV B;  5A2Q f;  2RPR A;  2IZ4 A;  4DGL A;  3RZD I;  1VQ9 Z;  2JR6 A;  2EGT A;  4MD8 A;  3D6W A;  3PO3 S;  4RVH A;  3G6E Z;  1VQN Z;  1ML8 A;  1VQ6 1;  3I55 1;  1RO2 A;  4E32 A;  2R6M A;  1Y1V I;  3CC7 Z;  3S14 I;  3PO2 I;  1VQP 1;  3S16 I;  3JAM b;  3GKQ A;  2V8J A;  1VQ9 1;  4A3L I;  2NVQ I;  3CME Z;  2RT9 A;  1TWG I;  4E30 A;  3G6E 1;  3CC2 Z;  1VQN 1;  1R9T I;  1KD1 1;  2QRE B;  4E2W A;  2VF1 A;  2VUG A;  3J80 b;  3CCJ Z;  2E2J I;  2YAD A;  3M4O I;  2QR1 B;  3GTJ I;  3CME 1;  2HF1 A;  3CC2 1;  2M48 A;  4QTT A;  4NBE A;  1Q86 1;  1Q82 1;  3F3P C;  3K7A I;  3MON A;  2RIQ A;  1QVG Y;  1YUA A;  5D1O B;  3M3Y I;  3CCJ 1;  2Q4Z A;  2OOX B;  3NH8 A;  1K73 2;  1RO4 A;  5FLM I;  4A3J I;  3GTM S;  1N8R 1;  3LUS A;  3HOU I;  1I50 I;  2R92 I;  5IP7 I;  2E2I I;  1YHQ Z;  4MD9 A;  1Y1W I;  1X3W A;  3CCS Z;  3CCV Z;  2OTL 1;  3OW2 Z;  2E9H A;  3VTN A;  3S17 I;  1USP B;  4CL1 A;  1TWF I;  1KRL A;  1VQ5 1;  2WB1 A;  2QA4 Z;  5C3E I;  3NH5 A;  3CCU Z;  2YU9 I;  3IFU A;  2DE6 A;  1NJI 2;  3CPW Z;  1NUI A;  1YHQ 1;  3CCS 1;  3CCV 1;  1M90 1;  3NFZ A;  3CCM Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...