1WIIA

Solution structure of rsgi ruh-025, a duf701 domain from mouse cdna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
85
structure length
85
Chain Sequence
GSSGSSGRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-025, a DUF701 domain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical UPF0222 protein MGC4549
total genus 9
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.190 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1wiiA01
1WIIA
chains in the Genus database with same CATH superfamily
1VQKZ 3GTGI 3HOXI 2E2JI 2JNYA 2JIOA 2QREB 2E7ZA 3PO3I 1K9M1 1VQ51 3HOZI 5FLXb 1TFIA 2QEXZ 3CCMZ 2JA8I 1VQ41 3CD61 1USPB 2YADA 1YIJ1 4HGYA 4MONA 3VMIA 1QVGY 1KC82 1M1K2 2NVTI 3G71Z 1VQ71 1Q822 1VQN1 3CMA1 3D6WA 4HGZA 1VQ8Z 5IP9I 3GTOI 3CCS1 2VPZA 1Q821 3GTMS 2G2KA 4QTTA 4E30A 3I561 1W2BY 2QKDA 4A3KI 3GTQI 1NP6A 3S1RI 2JIQA 1VQO1 1K9M2 4NBDA 4NB9A 2H85A 4E2ZA 4NBBA 3J80b 2V8IA 3VTNA 3CCJZ 1QYPA 4CL1A 3OW2Y 1QVGZ 4NBAA 3JAMf 2Q51A 5A2Qb 3TE5B 3CCU1 2OTJZ 3CC71 1TWHI 1YJN1 2NAPA 3I4NI 1VLAA 4NBFA 1FDIA 1RQFA 1USPA 3NDIA 5T67A 1K8A1 1X3WA 3P5JB 3Q87A 2YU9I 2QRCB 1VQM1 1YJWZ 1NJI1 3IFUA 1N8R2 3CQZI 3D9XA 2E9HA 1X0TA 3CME1 3IX0A 2Q4ZA 1Q7Y2 4A3GI 1WZNA 3NDJA 3S16I 4S1TA 2LEXA 1KD11 4E31A 3IF8A 4NBEA 1Q7Y1 1WJ2A 4A3II 4TNUA 3PO3S 3CCQ1 5T6BA 1Z01A 3CCVZ 2JA5I 1KQSY 1TWGI 2M48A 2QA4Z 2LIYA 3HOUI 2R7ZI 1NJI2 2IZ4A 1AA6A 3GTJI 2DE7A 4NBGA 3I55Z 2R93I 1YJW1 3GTMI 1PFTA 3CCEZ 2K3RA 3S1MI 2O53A 4BY7I 3F3FC 2QR1B 3G4S1 2GTHA 2RBLA 1Y8CA 3G6EZ 4BBRI 3GTPI 1YJNZ 3GKQA 4NBHA 3KIFA 2IV2X 2W03A 1RO2A 1YITZ 4E2YA 1Q861 3OW2Z 2OTL1 2QA41 3EEDA 2AKLA 1ZB9A 3CCV1 4XX2A 3FQMA 2JMOA 5C4XI 1VQOZ 3CCQZ 3MZLB 4BXXI 3VMHA 3RZDI 3HOYI 3I07A 3J7A4 1KQSZ 3G6E1 3D2LA 3FQQA 1I6HI 3M3YI 3CMAZ 3G4SZ 1VQNZ 4AYBA 1JJ2Z 1QVFZ 4E32A 1L1OC 2HU9A 1YI21 1RO0A 3BG1B 1S7MA 3CD6Z 2V3VA 2QEX1 3I551 1JJ2Y 3RZOI 4DK1A 1YI2Z 2WAQA 1Z02A 3HOWI 3GTLI 2JR6A 2VPXA 2GU2A 1Z03A 1WCMI 2VPYA 1RNIA 2OTJ1 2JS4A 1N2FA 3GTKI 2PMZA 3FKII 4HH4A 3CCJ1 3CMEZ 2BJOA 4NB8A 1R9TI 1ML8A 4QTUA 3MONA 1K83I 2OTLZ 3CC2Z 4RVGA 2OZKA 2K5RA 4MD7A 1YIT1 5CM2M 1RLYA 2WB1A 1M901 3I56Z 2E2II 3NH5A 2VUMI 2O4HA 2JIPA 5AN9F 3G711 3S17I 1SIWA 4A93I 3EERA 3HKZA 3CCE1 1VQ4Z 4MH4A 5FLMI 3CC7Z 1KRLA 4NOZA 1VQL1 2VPWA 2V45A 1M902 4A3BI 4NBCA 2QRDB 3MZKB 5LL6f 4BBSI 3HOVI 3CPWY 1Y1VS 3J81f 3NFZA 1VQ61 1S721 4DGLA 2M6NA 2JA6I 4X6AI 2KI7B 5IT9f 1YHQZ 5C4JI 2IZ3A 1QVFY 3TDHB 2JUBA 1M1K1 1VQ81 1DL6A 3CCRZ 1VQ7Z 3U50C 3CC4Z 2PM9A 1SFOI 5D1PA 1YJ91 1ZB8A 3CCM1 3CCL1 4A3FI 2V8JA 1I50I 2HF1A 5C3EI 4Y7NI 2PK7A 3S15I 4BY1I 1VQMZ 3S1QI 2QLVB 2W04A 2P3YA 2R6MA 1Y1WI 3H0GI 1WIIA 3J81b 3LUSA 3J80f 4A3MI 4EWCA 3PO2I 3M4OI 1VQ9Z 4MD9A 3QWUA 3I4MI 3JAMb 3CCUZ 2ZAEB 2DE6A 2EGTA 3CPWZ 1VQ91 1JWHC 2JA7I 2NVYI 1FDOA 2Y0SA 3NH4A 3VB9A 5T64A 4A3JI 1Q862 3K7AI 1Y1VI 2JIRA 3NH8A 3CCSZ 1LQLA 1NUIA 1YJ9Z 2RHBA 1TWFI 1RO4A 1ZH1A 2RT9A 4A3EI 2GTIA 2KPIA 1K731 3S14I 1QXFA 3IR7A 3CCR1 1VQP1 2B63I 2VUGA 1K8A2 3BG0B 2NVQI 3T4NB 5FLXf 1YIJZ 4E2WA 2F4MA 1KC81 1VQ5Z 5IP7I 1TWCI 4RVHA 1S72Z 3H3VJ 1VQ6Z 1YUAA 4E33A 4MD8A 4Y52I 5D1OA 1WW9A 4A3DI 3CXCZ 2I3CA 1VQK1 3GCFA 1W2BZ 2V8KA 1VQLZ 4A3LI 2NVXI 1QF8A 5A2Qf 2OOXB 3CXCY 4DQYB 4A3CI 3F3PC 2F4OA 1K732 2R92I 1Q811 1Q16A 2P28A 4RVDA 4RV9A 1KD12 2VF1A 1I3QI 1VQPZ 1P9NA 4E2XA 2E2HI 4MXUA 1YUKA 3S1NI 2LFUA 4RS4A 1N8R1 5C44I 2RPRA 4RVFA 5IT9b 3S2DI 3CCLZ 3CC21 2J6AA 1TWAI 3CC41 2AYDA 4NH1C 3S2HI 4NFRA 1YHQ1 4MRIA 2RIQA 2OOYB 3KIHA 1Q812 5D1OB 2JIMA 3ESWA 2DE5A 3VMGA 1X3ZA
chains in the Genus database with same CATH topology
1VQKZ 3GTGI 3HOXI 2E2JI 2JNYA 2QREB 3PO3I 1K9M1 1VQ51 3HOZI 5FLXb 1TFIA 2QEXZ 3CCMZ 2JA8I 1VQ41 3CD61 1USPB 2YADA 1YIJ1 4HGYA 4MONA 3VMIA 1QVGY 1KC82 1M1K2 2NVTI 3G71Z 1VQ71 1Q822 1VQN1 3CMA1 3D6WA 4HGZA 1VQ8Z 5IP9I 3GTOI 3CCS1 1Q821 3GTMS 2G2KA 4QTTA 4E30A 3I561 2QKDA 4A3KI 3GTQI 1NP6A 3S1RI 1VQO1 1K9M2 4NBDA 4NB9A 2H85A 4E2ZA 4NBBA 3J80b 2V8IA 3VTNA 3CCJZ 1QYPA 4CL1A 3OW2Y 1QVGZ 4NBAA 3JAMf 2Q51A 5A2Qb 3TE5B 3CCU1 2OTJZ 3CC71 1TWHI 1YJN1 3I4NI 1VLAA 4NBFA 1USPA 1RQFA 3NDIA 5T67A 1K8A1 1X3WA 3P5JB 3Q87A 2YU9I 2QRCB 1VQM1 1YJWZ 1NJI1 3IFUA 1N8R2 3CQZI 3D9XA 2E9HA 1X0TA 3CME1 3IX0A 2Q4ZA 1Q7Y2 4A3GI 3NDJA 3S16I 4S1TA 1KD11 4E31A 3IF8A 4NBEA 1Q7Y1 4A3II 4TNUA 3PO3S 3CCQ1 5T6BA 1Z01A 3CCVZ 2JA5I 1KQSY 1TWGI 2M48A 2QA4Z 2LIYA 3HOUI 2R7ZI 1NJI2 2IZ4A 3GTJI 2DE7A 4NBGA 3I55Z 2R93I 1YJW1 3GTMI 1PFTA 3CCEZ 2K3RA 3S1MI 2O53A 4BY7I 3F3FC 2QR1B 3G4S1 2GTHA 2RBLA 3G6EZ 4BBRI 3GTPI 1YJNZ 3GKQA 4NBHA 3KIFA 2W03A 1RO2A 1YITZ 4E2YA 1Q861 3OW2Z 2OTL1 2QA41 3EEDA 2AKLA 1ZB9A 3CCV1 4XX2A 3FQMA 2JMOA 5C4XI 1VQOZ 3CCQZ 3MZLB 4BXXI 3VMHA 3RZDI 3HOYI 3I07A 3J7A4 1KQSZ 1X3ZA 3G6E1 3FQQA 1I6HI 3M3YI 3CMAZ 3G4SZ 1VQNZ 4AYBA 1JJ2Z 1QVFZ 4E32A 1L1OC 2HU9A 1YI21 1RO0A 3BG1B 1S7MA 3CD6Z 2QEX1 3I551 1JJ2Y 3RZOI 4DK1A 1YI2Z 2WAQA 1Z02A 3HOWI 3GTLI 2JR6A 2GU2A 1Z03A 1WCMI 1RNIA 2OTJ1 2JS4A 1N2FA 3GTKI 2PMZA 3FKII 4HH4A 3CCJ1 3CMEZ 2BJOA 4NB8A 1R9TI 1ML8A 4QTUA 3MONA 1K83I 2OTLZ 3CC2Z 4RVGA 2OZKA 2K5RA 4MD7A 1YIT1 5CM2M 1RLYA 2WB1A 1M901 3I56Z 2E2II 3NH5A 2VUMI 2O4HA 5AN9F 3G711 3S17I 4A93I 3EERA 3HKZA 3CCE1 1VQ4Z 4MH4A 5FLMI 3CC7Z 1KRLA 4NOZA 1VQL1 1M902 4A3BI 4NBCA 2QRDB 3MZKB 5LL6f 4BBSI 3HOVI 3CPWY 1Y1VS 3J81f 3NFZA 1VQ61 1S721 4DGLA 2M6NA 2JA6I 4X6AI 2KI7B 5IT9f 1YHQZ 5C4JI 2IZ3A 1QVFY 3TDHB 2JUBA 1M1K1 1VQ81 1DL6A 3CCRZ 1VQ7Z 3U50C 3CC4Z 2PM9A 1SFOI 5D1PA 1YJ91 1ZB8A 3CCM1 3CCL1 4A3FI 2V8JA 1I50I 2HF1A 5C3EI 4Y7NI 2PK7A 3S15I 4BY1I 1VQMZ 3S1QI 2QLVB 2W04A 2P3YA 2R6MA 1Y1WI 3H0GI 1WIIA 3J81b 3LUSA 3J80f 4A3MI 4EWCA 3PO2I 3M4OI 1VQ9Z 4MD9A 3QWUA 3I4MI 3JAMb 3CCUZ 2ZAEB 2DE6A 2EGTA 3CPWZ 1VQ91 1JWHC 2JA7I 2NVYI 2Y0SA 3NH4A 3VB9A 5T64A 4A3JI 1Q862 3K7AI 1Y1VI 3NH8A 3CCSZ 1LQLA 1NUIA 1YJ9Z 2RHBA 1TWFI 1RO4A 1ZH1A 2RT9A 4A3EI 2GTIA 2KPIA 1K731 3S14I 1VQP1 3CCR1 2B63I 2VUGA 1K8A2 3BG0B 2NVQI 3T4NB 5FLXf 1YIJZ 4E2WA 2F4MA 1KC81 1VQ5Z 5IP7I 1TWCI 4RVHA 1S72Z 3H3VJ 1VQ6Z 1YUAA 4E33A 4MD8A 4Y52I 5D1OA 1WW9A 4A3DI 3CXCZ 2I3CA 1VQK1 3GCFA 1W2BZ 2V8KA 1VQLZ 4A3LI 2NVXI 1QF8A 5A2Qf 2OOXB 3CXCY 4DQYB 4A3CI 3F3PC 2F4OA 1K732 2R92I 1Q811 2P28A 4RVDA 4RV9A 1KD12 2VF1A 1I3QI 1VQPZ 1P9NA 4E2XA 2E2HI 4MXUA 1YUKA 3S1NI 2LFUA 4RS4A 1N8R1 5C44I 2RPRA 4RVFA 5IT9b 3S2DI 3CCLZ 3CC21 2J6AA 1TWAI 3CC41 4NH1C 3S2HI 4NFRA 1YHQ1 4MRIA 2RIQA 2OOYB 3KIHA 1Q812 5D1OB 3ESWA 2DE5A 3VMGA 1W2BY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WII A; 
#chains in the Genus database with same CATH topology
 1VQK Z;  3GTG I;  3HOX I;  2E2J I;  2JNY A;  2JIO A;  2QRE B;  2E7Z A;  3PO3 I;  1K9M 1;  1VQ5 1;  3HOZ I;  5FLX b;  1TFI A;  2QEX Z;  3CCM Z;  2JA8 I;  1VQ4 1;  3CD6 1;  1USP B;  2YAD A;  1YIJ 1;  4HGY A;  4MON A;  3VMI A;  1QVG Y;  1KC8 2;  1M1K 2;  2NVT I;  3G71 Z;  1VQ7 1;  1Q82 2;  1VQN 1;  3CMA 1;  3D6W A;  4HGZ A;  1VQ8 Z;  5IP9 I;  3GTO I;  3CCS 1;  2VPZ A;  1Q82 1;  3GTM S;  2G2K A;  4QTT A;  4E30 A;  3I56 1;  1W2B Y;  2QKD A;  4A3K I;  3GTQ I;  1NP6 A;  3S1R I;  2JIQ A;  1VQO 1;  1K9M 2;  4NBD A;  4NB9 A;  2H85 A;  4E2Z A;  4NBB A;  3J80 b;  2V8I A;  3VTN A;  3CCJ Z;  1QYP A;  4CL1 A;  3OW2 Y;  1QVG Z;  4NBA A;  3JAM f;  2Q51 A;  5A2Q b;  3TE5 B;  3CCU 1;  2OTJ Z;  3CC7 1;  1TWH I;  1YJN 1;  2NAP A;  3I4N I;  1VLA A;  4NBF A;  1FDI A;  1RQF A;  1USP A;  3NDI A;  5T67 A;  1K8A 1;  1X3W A;  3P5J B;  3Q87 A;  2YU9 I;  2QRC B;  1VQM 1;  1YJW Z;  1NJI 1;  3IFU A;  1N8R 2;  3CQZ I;  3D9X A;  2E9H A;  1X0T A;  3CME 1;  3IX0 A;  2Q4Z A;  1Q7Y 2;  4A3G I;  1WZN A;  3NDJ A;  3S16 I;  4S1T A;  2LEX A;  1KD1 1;  4E31 A;  3IF8 A;  4NBE A;  1Q7Y 1;  1WJ2 A;  4A3I I;  4TNU A;  3PO3 S;  3CCQ 1;  5T6B A;  1Z01 A;  3CCV Z;  2JA5 I;  1KQS Y;  1TWG I;  2M48 A;  2QA4 Z;  2LIY A;  3HOU I;  2R7Z I;  1NJI 2;  2IZ4 A;  1AA6 A;  3GTJ I;  2DE7 A;  4NBG A;  3I55 Z;  2R93 I;  1YJW 1;  3GTM I;  1PFT A;  3CCE Z;  2K3R A;  3S1M I;  2O53 A;  4BY7 I;  3F3F C;  2QR1 B;  3G4S 1;  2GTH A;  2RBL A;  1Y8C A;  3G6E Z;  4BBR I;  3GTP I;  1YJN Z;  3GKQ A;  4NBH A;  3KIF A;  2IV2 X;  2W03 A;  1RO2 A;  1YIT Z;  4E2Y A;  1Q86 1;  3OW2 Z;  2OTL 1;  2QA4 1;  3EED A;  2AKL A;  1ZB9 A;  3CCV 1;  4XX2 A;  3FQM A;  2JMO A;  5C4X I;  1VQO Z;  3CCQ Z;  3MZL B;  4BXX I;  3VMH A;  3RZD I;  3HOY I;  3I07 A;  3J7A 4;  1KQS Z;  3G6E 1;  3D2L A;  3FQQ A;  1I6H I;  3M3Y I;  3CMA Z;  3G4S Z;  1VQN Z;  4AYB A;  1JJ2 Z;  1QVF Z;  4E32 A;  1L1O C;  2HU9 A;  1YI2 1;  1RO0 A;  3BG1 B;  1S7M A;  3CD6 Z;  2V3V A;  2QEX 1;  3I55 1;  1JJ2 Y;  3RZO I;  4DK1 A;  1YI2 Z;  2WAQ A;  1Z02 A;  3HOW I;  3GTL I;  2JR6 A;  2VPX A;  2GU2 A;  1Z03 A;  1WCM I;  2VPY A;  1RNI A;  2OTJ 1;  2JS4 A;  1N2F A;  3GTK I;  2PMZ A;  3FKI I;  4HH4 A;  3CCJ 1;  3CME Z;  2BJO A;  4NB8 A;  1R9T I;  1ML8 A;  4QTU A;  3MON A;  1K83 I;  2OTL Z;  3CC2 Z;  4RVG A;  2OZK A;  2K5R A;  4MD7 A;  1YIT 1;  5CM2 M;  1RLY A;  2WB1 A;  1M90 1;  3I56 Z;  2E2I I;  3NH5 A;  2VUM I;  2O4H A;  2JIP A;  5AN9 F;  3G71 1;  3S17 I;  1SIW A;  4A93 I;  3EER A;  3HKZ A;  3CCE 1;  1VQ4 Z;  4MH4 A;  5FLM I;  3CC7 Z;  1KRL A;  4NOZ A;  1VQL 1;  2VPW A;  2V45 A;  1M90 2;  4A3B I;  4NBC A;  2QRD B;  3MZK B;  5LL6 f;  4BBS I;  3HOV I;  3CPW Y;  1Y1V S;  3J81 f;  3NFZ A;  1VQ6 1;  1S72 1;  4DGL A;  2M6N A;  2JA6 I;  4X6A I;  2KI7 B;  5IT9 f;  1YHQ Z;  5C4J I;  2IZ3 A;  1QVF Y;  3TDH B;  2JUB A;  1M1K 1;  1VQ8 1;  1DL6 A;  3CCR Z;  1VQ7 Z;  3U50 C;  3CC4 Z;  2PM9 A;  1SFO I;  5D1P A;  1YJ9 1;  1ZB8 A;  3CCM 1;  3CCL 1;  4A3F I;  2V8J A;  1I50 I;  2HF1 A;  5C3E I;  4Y7N I;  2PK7 A;  3S15 I;  4BY1 I;  1VQM Z;  3S1Q I;  2QLV B;  2W04 A;  2P3Y A;  2R6M A;  1Y1W I;  3H0G I;  1WII A;  3J81 b;  3LUS A;  3J80 f;  4A3M I;  4EWC A;  3PO2 I;  3M4O I;  1VQ9 Z;  4MD9 A;  3QWU A;  3I4M I;  3JAM b;  3CCU Z;  2ZAE B;  2DE6 A;  2EGT A;  3CPW Z;  1VQ9 1;  1JWH C;  2JA7 I;  2NVY I;  1FDO A;  2Y0S A;  3NH4 A;  3VB9 A;  5T64 A;  4A3J I;  1Q86 2;  3K7A I;  1Y1V I;  2JIR A;  3NH8 A;  3CCS Z;  1LQL A;  1NUI A;  1YJ9 Z;  2RHB A;  1TWF I;  1RO4 A;  1ZH1 A;  2RT9 A;  4A3E I;  2GTI A;  2KPI A;  1K73 1;  3S14 I;  1QXF A;  3IR7 A;  3CCR 1;  1VQP 1;  2B63 I;  2VUG A;  1K8A 2;  3BG0 B;  2NVQ I;  3T4N B;  5FLX f;  1YIJ Z;  4E2W A;  2F4M A;  1KC8 1;  1VQ5 Z;  5IP7 I;  1TWC I;  4RVH A;  1S72 Z;  3H3V J;  1VQ6 Z;  1YUA A;  4E33 A;  4MD8 A;  4Y52 I;  5D1O A;  1WW9 A;  4A3D I;  3CXC Z;  2I3C A;  1VQK 1;  3GCF A;  1W2B Z;  2V8K A;  1VQL Z;  4A3L I;  2NVX I;  1QF8 A;  5A2Q f;  2OOX B;  3CXC Y;  4DQY B;  4A3C I;  3F3P C;  2F4O A;  1K73 2;  2R92 I;  1Q81 1;  1Q16 A;  2P28 A;  4RVD A;  4RV9 A;  1KD1 2;  2VF1 A;  1I3Q I;  1VQP Z;  1P9N A;  4E2X A;  2E2H I;  4MXU A;  1YUK A;  3S1N I;  2LFU A;  4RS4 A;  1N8R 1;  5C44 I;  2RPR A;  4RVF A;  5IT9 b;  3S2D I;  3CCL Z;  3CC2 1;  2J6A A;  1TWA I;  3CC4 1;  2AYD A;  4NH1 C;  3S2H I;  4NFR A;  1YHQ 1;  4MRI A;  2RIQ A;  2OOY B;  3KIH A;  1Q81 2;  5D1O B;  2JIM A;  3ESW A;  2DE5 A;  3VMG A;  1X3Z A; 
#chains in the Genus database with same CATH homology
 1VQK Z;  3GTG I;  3HOX I;  2E2J I;  2JNY A;  2QRE B;  3PO3 I;  1K9M 1;  1VQ5 1;  3HOZ I;  5FLX b;  1TFI A;  2QEX Z;  3CCM Z;  2JA8 I;  1VQ4 1;  3CD6 1;  1USP B;  2YAD A;  1YIJ 1;  4HGY A;  4MON A;  3VMI A;  1QVG Y;  1KC8 2;  1M1K 2;  2NVT I;  3G71 Z;  1VQ7 1;  1Q82 2;  1VQN 1;  3CMA 1;  3D6W A;  4HGZ A;  1VQ8 Z;  5IP9 I;  3GTO I;  3CCS 1;  1Q82 1;  3GTM S;  2G2K A;  4QTT A;  4E30 A;  3I56 1;  2QKD A;  4A3K I;  3GTQ I;  1NP6 A;  3S1R I;  1VQO 1;  1K9M 2;  4NBD A;  4NB9 A;  2H85 A;  4E2Z A;  4NBB A;  3J80 b;  2V8I A;  3VTN A;  3CCJ Z;  1QYP A;  4CL1 A;  3OW2 Y;  1QVG Z;  4NBA A;  3JAM f;  2Q51 A;  5A2Q b;  3TE5 B;  3CCU 1;  2OTJ Z;  3CC7 1;  1TWH I;  1YJN 1;  3I4N I;  1VLA A;  4NBF A;  1USP A;  1RQF A;  3NDI A;  5T67 A;  1K8A 1;  1X3W A;  3P5J B;  3Q87 A;  2YU9 I;  2QRC B;  1VQM 1;  1YJW Z;  1NJI 1;  3IFU A;  1N8R 2;  3CQZ I;  3D9X A;  2E9H A;  1X0T A;  3CME 1;  3IX0 A;  2Q4Z A;  1Q7Y 2;  4A3G I;  3NDJ A;  3S16 I;  4S1T A;  1KD1 1;  4E31 A;  3IF8 A;  4NBE A;  1Q7Y 1;  4A3I I;  4TNU A;  3PO3 S;  3CCQ 1;  5T6B A;  1Z01 A;  3CCV Z;  2JA5 I;  1KQS Y;  1TWG I;  2M48 A;  2QA4 Z;  2LIY A;  3HOU I;  2R7Z I;  1NJI 2;  2IZ4 A;  3GTJ I;  2DE7 A;  4NBG A;  3I55 Z;  2R93 I;  1YJW 1;  3GTM I;  1PFT A;  3CCE Z;  2K3R A;  3S1M I;  2O53 A;  4BY7 I;  3F3F C;  2QR1 B;  3G4S 1;  2GTH A;  2RBL A;  3G6E Z;  4BBR I;  3GTP I;  1YJN Z;  3GKQ A;  4NBH A;  3KIF A;  2W03 A;  1RO2 A;  1YIT Z;  4E2Y A;  1Q86 1;  3OW2 Z;  2OTL 1;  2QA4 1;  3EED A;  2AKL A;  1ZB9 A;  3CCV 1;  4XX2 A;  3FQM A;  2JMO A;  5C4X I;  1VQO Z;  3CCQ Z;  3MZL B;  4BXX I;  3VMH A;  3RZD I;  3HOY I;  3I07 A;  3J7A 4;  1KQS Z;  1X3Z A;  3G6E 1;  3FQQ A;  1I6H I;  3M3Y I;  3CMA Z;  3G4S Z;  1VQN Z;  4AYB A;  1JJ2 Z;  1QVF Z;  4E32 A;  1L1O C;  2HU9 A;  1YI2 1;  1RO0 A;  3BG1 B;  1S7M A;  3CD6 Z;  2QEX 1;  3I55 1;  1JJ2 Y;  3RZO I;  4DK1 A;  1YI2 Z;  2WAQ A;  1Z02 A;  3HOW I;  3GTL I;  2JR6 A;  2GU2 A;  1Z03 A;  1WCM I;  1RNI A;  2OTJ 1;  2JS4 A;  1N2F A;  3GTK I;  2PMZ A;  3FKI I;  4HH4 A;  3CCJ 1;  3CME Z;  2BJO A;  4NB8 A;  1R9T I;  1ML8 A;  4QTU A;  3MON A;  1K83 I;  2OTL Z;  3CC2 Z;  4RVG A;  2OZK A;  2K5R A;  4MD7 A;  1YIT 1;  5CM2 M;  1RLY A;  2WB1 A;  1M90 1;  3I56 Z;  2E2I I;  3NH5 A;  2VUM I;  2O4H A;  5AN9 F;  3G71 1;  3S17 I;  4A93 I;  3EER A;  3HKZ A;  3CCE 1;  1VQ4 Z;  4MH4 A;  5FLM I;  3CC7 Z;  1KRL A;  4NOZ A;  1VQL 1;  1M90 2;  4A3B I;  4NBC A;  2QRD B;  3MZK B;  5LL6 f;  4BBS I;  3HOV I;  3CPW Y;  1Y1V S;  3J81 f;  3NFZ A;  1VQ6 1;  1S72 1;  4DGL A;  2M6N A;  2JA6 I;  4X6A I;  2KI7 B;  5IT9 f;  1YHQ Z;  5C4J I;  2IZ3 A;  1QVF Y;  3TDH B;  2JUB A;  1M1K 1;  1VQ8 1;  1DL6 A;  3CCR Z;  1VQ7 Z;  3U50 C;  3CC4 Z;  2PM9 A;  1SFO I;  5D1P A;  1YJ9 1;  1ZB8 A;  3CCM 1;  3CCL 1;  4A3F I;  2V8J A;  1I50 I;  2HF1 A;  5C3E I;  4Y7N I;  2PK7 A;  3S15 I;  4BY1 I;  1VQM Z;  3S1Q I;  2QLV B;  2W04 A;  2P3Y A;  2R6M A;  1Y1W I;  3H0G I;  1WII A;  3J81 b;  3LUS A;  3J80 f;  4A3M I;  4EWC A;  3PO2 I;  3M4O I;  1VQ9 Z;  4MD9 A;  3QWU A;  3I4M I;  3JAM b;  3CCU Z;  2ZAE B;  2DE6 A;  2EGT A;  3CPW Z;  1VQ9 1;  1JWH C;  2JA7 I;  2NVY I;  2Y0S A;  3NH4 A;  3VB9 A;  5T64 A;  4A3J I;  1Q86 2;  3K7A I;  1Y1V I;  3NH8 A;  3CCS Z;  1LQL A;  1NUI A;  1YJ9 Z;  2RHB A;  1TWF I;  1RO4 A;  1ZH1 A;  2RT9 A;  4A3E I;  2GTI A;  2KPI A;  1K73 1;  3S14 I;  1VQP 1;  3CCR 1;  2B63 I;  2VUG A;  1K8A 2;  3BG0 B;  2NVQ I;  3T4N B;  5FLX f;  1YIJ Z;  4E2W A;  2F4M A;  1KC8 1;  1VQ5 Z;  5IP7 I;  1TWC I;  4RVH A;  1S72 Z;  3H3V J;  1VQ6 Z;  1YUA A;  4E33 A;  4MD8 A;  4Y52 I;  5D1O A;  1WW9 A;  4A3D I;  3CXC Z;  2I3C A;  1VQK 1;  3GCF A;  1W2B Z;  2V8K A;  1VQL Z;  4A3L I;  2NVX I;  1QF8 A;  5A2Q f;  2OOX B;  3CXC Y;  4DQY B;  4A3C I;  3F3P C;  2F4O A;  1K73 2;  2R92 I;  1Q81 1;  2P28 A;  4RVD A;  4RV9 A;  1KD1 2;  2VF1 A;  1I3Q I;  1VQP Z;  1P9N A;  4E2X A;  2E2H I;  4MXU A;  1YUK A;  3S1N I;  2LFU A;  4RS4 A;  1N8R 1;  5C44 I;  2RPR A;  4RVF A;  5IT9 b;  3S2D I;  3CCL Z;  3CC2 1;  2J6A A;  1TWA I;  3CC4 1;  4NH1 C;  3S2H I;  4NFR A;  1YHQ 1;  4MRI A;  2RIQ A;  2OOY B;  3KIH A;  1Q81 2;  5D1O B;  3ESW A;  2DE5 A;  3VMG A;  1W2B Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...