1WIIA

Solution structure of rsgi ruh-025, a duf701 domain from mouse cdna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
85
structure length
85
Chain Sequence
GSSGSSGRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0222 protein MGC4549
publication title Solution structure of RSGI RUH-025, a DUF701 domain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 9
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.190 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1wiiA01
1WIIA
chains in the Genus database with same CATH superfamily
2LFUA 3CCRZ 4A93I 1Q811 3I4MI 4RS4A 4BBRI 1JJ2Y 1Q7Y1 3CC41 2E2HI 1VQ51 3S2HI 1M902 1N2FA 2VF1A 1X3ZA 1X3WA 3NH5A 2DE5A 2JS4A 4E2ZA 3CCQ1 3IFUA 1NUIA 3I56Z 1TWHI 1VQ7Z 3GKQA 2RHBA 2J6AA 2RPRA 2QR1B 4NB8A 1KRLA 2ZAEB 2NAPA 3IX0A 3MONA 3G4S1 5T6BA 1Z02A 3J80b 1YHQ1 2P28A 2W03A 3GTGI 3CCSZ 2VPWA 3VMGA 1KQSZ 1VQM1 1M1K1 3CCLZ 1KC81 4Y52I 3CMAZ 2VPZA 1KD12 1YJ91 1KQSY 3CCVZ 3CME1 2NVTI 1YJNZ 2R6MA 3GCFA 2NVYI 3S17I 3G6EZ 2IZ4A 2OTJ1 1S72Z 4NBAA 1NJI2 4EWCA 3VMHA 5AN9F 4NB9A 3S1RI 4QTUA 3CCU1 3I07A 3HOYI 5C4XI 1VQ6Z 3GTOI 2G2KA 1QVFY 1USPB 2V3VA 1Q861 2P3YA 2JIRA 3I55Z 1K9M1 2AKLA 1DL6A 4A3II 1Q812 1JWHC 3VMIA 4RVHA 1VQLZ 3HOUI 1VQNZ 4E30A 3GTKI 1Q7Y2 4A3MI 2QEXZ 4DQYB 2Y0SA 1YITZ 3G71Z 1USPA 4NBHA 2GU2A 3GTMS 1S7MA 4RVGA 2K3RA 4A3EI 2QKDA 4E33A 1TWGI 2JIOA 2PM9A 2RBLA 4A3CI 2EGTA 3M3YI 3CD6Z 1ZH1A 5T64A 2QREB 3CXCZ 5IT9f 3TDHB 1QXFA 2I3CA 3QWUA 3S14I 2VUGA 3CCE1 4BY7I 1VQ5Z 3NDIA 3D6WA 1Q821 1QVGZ 2YADA 3CCQZ 3CC2Z 2Q4ZA 4AYBA 1W2BZ 4E2WA 4NBCA 3EEDA 2JIMA 2VPYA 1K83I 3H0GI 4DGLA 1KC82 1M1K2 2QA41 1QVGY 1P9NA 3NDJA 3CC71 1W2BY 3FQQA 2OOXB 4Y7NI 3GTPI 3HOWI 4A3BI 3CCR1 3JAMf 4BY1I 4NOZA 2KI7B 1L1OC 1VQ8Z 2JA8I 4A3FI 3GTMI 1ZB8A 5FLMI 3FKII 5A2Qf 4RV9A 4HGYA 1VQMZ 1N8R1 1VQPZ 2NVXI 1QYPA 1VQOZ 1Q862 1I50I 2IV2X 3MZLB 3F3PC 4NBBA 1YJW1 5FLXf 3I561 4E31A 2OTJZ 4NBDA 1VQ71 2JA5I 4A3LI 5IT9b 1Q16A 3S1MI 1Y1VI 2W04A 1YI21 1R9TI 1WW9A 1K8A1 3BG1B 3CCUZ 2AYDA 5IP7I 1K732 3CCJ1 2F4MA 3CCS1 3KIHA 2DE6A 3CCMZ 2H85A 2E9HA 3F3FC 3P5JB 1VQ9Z 2JA6I 3CCL1 5CM2M 5D1OB 4MD7A 3CMA1 3RZOI 3S1QI 2NVQI 3CPWZ 3I4NI 3NH8A 1RNIA 3CCV1 4TNUA 3JAMb 2RIQA 1YIJZ 1YJN1 1RO2A 3TE5B 3G6E1 3CPWY 1RLYA 4NBFA 1VQKZ 1S721 3ESWA 2DE7A 2HU9A 5C44I 2E2II 3PO3I 1VQ41 4E2XA 1QF8A 5A2Qb 5D1OA 3VB9A 2JA7I 1VQ61 2OTLZ 5LL6f 4MXUA 4NH1C 2R92I 1RQFA 3I551 3HKZA 2K5RA 1WZNA 3CCEZ 1NP6A 5D1PA 4S1TA 1VQL1 2JUBA 1VQN1 2JIPA 2M6NA 3CC4Z 4NBEA 2V8KA 3S2DI 2VUMI 3VTNA 1Y1VS 1Y1WI 2QEX1 1YIT1 2QRCB 4HGZA 4NFRA 2JR6A 3CXCY 3G711 3K7AI 1LQLA 3S1NI 2V8JA 2V45A 2LIYA 2O4HA 1WIIA 1TFIA 4A3GI 2VPXA 4E32A 3GTLI 3CD61 1TWAI 2M48A 3J7A4 3HOZI 4A3KI 2BJOA 4HH4A 2E2JI 1K8A2 1VLAA 3U50C 3BG0B 3PO2I 3G4SZ 3LUSA 1YUAA 2OOYB 2PMZA 2GTHA 1YHQZ 3EERA 4A3DI 1YUKA 2JIQA 3M4OI 2YU9I 4XX2A 1Z03A 2PK7A 3D2LA 1TWFI 3CC21 1Y8CA 2JNYA 3CQZI 3RZDI 1AA6A 3GTJI 3PO3S 4A3JI 1YJWZ 1FDIA 1K9M2 1YJ9Z 4QTTA 3CMEZ 1PFTA 3D9XA 1YI2Z 2V8IA 5IP9I 3S15I 2R7ZI 1WCMI 2HF1A 3CCJZ 1VQ81 5T67A 2Q51A 4RVFA 1ZB9A 2KPIA 1M901 1VQP1 3H3VJ 3IF8A 3Q87A 1VQO1 1Z01A 3J81f 2E7ZA 3GTQI 4DK1A 1X0TA 2WB1A 3S16I 2OZKA 1RO0A 1ML8A 4NBGA 4CL1A 1VQ4Z 1QVFZ 4MRIA 4MD9A 1SFOI 1Q822 4MONA 3HOXI 2LEXA 2O53A 1RO4A 2QLVB 3IR7A 1FDOA 1SIWA 4BBSI 3CCM1 3HOVI 1VQ91 2QRDB 4X6AI 3OW2Z 2RT9A 1I3QI 1WJ2A 1KD11 4RVDA 5FLXb 2GTIA 3OW2Y 3MZKB 3NH4A 5C3EI 1YIJ1 3J80f 4MH4A 1VQK1 2R93I 2F4OA 1NJI1 3KIFA 4E2YA 1K731 3NFZA 1N8R2 2WAQA 4MD8A 2QA4Z 3FQMA 2JMOA 1I6HI 2OTL1 1TWCI 3CC7Z 5C4JI 2IZ3A 3J81b 2B63I 4BXXI 3T4NB 1JJ2Z
chains in the Genus database with same CATH topology
2LFUA 3CCRZ 4A93I 1Q811 3I4MI 4RS4A 4BBRI 1JJ2Y 1Q7Y1 3CC41 2E2HI 1VQ51 3S2HI 1M902 1N2FA 2VF1A 1X3ZA 1X3WA 3NH5A 2DE5A 2JS4A 4E2ZA 3CCQ1 3IFUA 1NUIA 3I56Z 1TWHI 1VQ7Z 3GKQA 2RHBA 2J6AA 2RPRA 2QR1B 4NB8A 1KRLA 2ZAEB 3IX0A 3MONA 3G4S1 5T6BA 1Z02A 3J80b 1YHQ1 2P28A 2W03A 3GTGI 3CCSZ 3VMGA 1KQSZ 1VQM1 1M1K1 3CCLZ 1KC81 4Y52I 3CMAZ 1KD12 1YJ91 1KQSY 3CCVZ 3CME1 2NVTI 1YJNZ 2R6MA 3GCFA 2NVYI 3S17I 3G6EZ 2IZ4A 2OTJ1 1S72Z 4NBAA 1NJI2 4EWCA 3VMHA 5AN9F 4NB9A 3S1RI 4QTUA 3CCU1 3I07A 3HOYI 5C4XI 1VQ6Z 3GTOI 2G2KA 1QVFY 1USPB 1Q861 2P3YA 3I55Z 1K9M1 2AKLA 1DL6A 4A3II 1Q812 1JWHC 3VMIA 4RVHA 1VQLZ 3HOUI 1VQNZ 4E30A 3GTKI 1Q7Y2 4A3MI 2QEXZ 4DQYB 2Y0SA 1YITZ 3G71Z 1USPA 4NBHA 2GU2A 3GTMS 1S7MA 4RVGA 2K3RA 4A3EI 2QKDA 4E33A 1TWGI 2PM9A 2RBLA 4A3CI 2EGTA 3M3YI 3CD6Z 1ZH1A 5T64A 2QREB 3CXCZ 5IT9f 3TDHB 2I3CA 3QWUA 3S14I 2VUGA 3CCE1 4BY7I 1VQ5Z 3NDIA 3D6WA 1Q821 1QVGZ 2YADA 3CCQZ 3CC2Z 2Q4ZA 4AYBA 1W2BZ 4E2WA 4NBCA 3EEDA 1M1K2 1K83I 3H0GI 4DGLA 1KC82 2QA41 1QVGY 1P9NA 3NDJA 3CC71 1W2BY 3FQQA 2OOXB 4Y7NI 3GTPI 3HOWI 4A3BI 3CCR1 3JAMf 4BY1I 4NOZA 2KI7B 1L1OC 1VQ8Z 2JA8I 4A3FI 3GTMI 1ZB8A 5FLMI 3FKII 5A2Qf 4RV9A 4HGYA 1VQMZ 1N8R1 1VQPZ 2NVXI 1QYPA 1VQOZ 1Q862 1I50I 3MZLB 3F3PC 4NBBA 1YJW1 5FLXf 3I561 4E31A 2OTJZ 4NBDA 1VQ71 2JA5I 4A3LI 5IT9b 3S1MI 1Y1VI 2W04A 1YI21 1R9TI 1WW9A 1K8A1 3BG1B 3CCUZ 5IP7I 1K732 3CCJ1 2F4MA 3CCS1 3KIHA 2DE6A 3CCMZ 2H85A 2E9HA 3F3FC 3P5JB 1VQ9Z 2JA6I 3CCL1 5CM2M 5D1OB 4MD7A 3CMA1 3RZOI 3S1QI 2NVQI 3CPWZ 3I4NI 3NH8A 1RNIA 3CCV1 4TNUA 3JAMb 2RIQA 1YIJZ 1YJN1 1RO2A 3TE5B 3G6E1 3CPWY 1RLYA 4NBFA 1VQKZ 1S721 3ESWA 2DE7A 2HU9A 5C44I 2E2II 3PO3I 1VQ41 4E2XA 1QF8A 5A2Qb 5D1OA 3VB9A 2JA7I 1VQ61 2OTLZ 5LL6f 4MXUA 4NH1C 2R92I 1RQFA 3I551 3HKZA 2K5RA 3CCEZ 1NP6A 5D1PA 4S1TA 1VQL1 2JUBA 1VQN1 3CC4Z 2M6NA 4NBEA 2V8KA 3S2DI 2VUMI 3VTNA 1Y1VS 1Y1WI 2QEX1 1YIT1 2QRCB 4HGZA 4NFRA 2JR6A 3CXCY 3G711 3K7AI 1LQLA 3S1NI 2V8JA 2LIYA 2O4HA 1WIIA 1TFIA 4A3GI 4E32A 3GTLI 3CD61 1TWAI 2M48A 3J7A4 3HOZI 4A3KI 2BJOA 4HH4A 2E2JI 1K8A2 1VLAA 3U50C 3BG0B 3PO2I 3G4SZ 3LUSA 1YUAA 2OOYB 2PMZA 2GTHA 1YHQZ 3EERA 4A3DI 1YUKA 3M4OI 2YU9I 4XX2A 1Z03A 2PK7A 1TWFI 3CC21 2JNYA 3CQZI 3RZDI 3GTJI 3PO3S 4A3JI 1YJWZ 1K9M2 1YJ9Z 4QTTA 3CMEZ 1PFTA 3D9XA 1YI2Z 2V8IA 5IP9I 3S15I 2R7ZI 1WCMI 2HF1A 3CCJZ 1VQ81 5T67A 2Q51A 4RVFA 1ZB9A 2KPIA 1M901 1VQP1 3H3VJ 3IF8A 3Q87A 1VQO1 1Z01A 3J81f 3GTQI 4DK1A 1X0TA 2WB1A 3S16I 2OZKA 1RO0A 1ML8A 4NBGA 4CL1A 1VQ4Z 1QVFZ 4MRIA 4MD9A 1SFOI 1Q822 4MONA 3HOXI 2O53A 1RO4A 2QLVB 4BBSI 3CCM1 3HOVI 1VQ91 2QRDB 4X6AI 3OW2Z 2RT9A 1I3QI 1KD11 4RVDA 5FLXb 2GTIA 3OW2Y 3MZKB 3NH4A 5C3EI 1YIJ1 3J80f 4MH4A 1VQK1 2R93I 2F4OA 1NJI1 3KIFA 4E2YA 1K731 3NFZA 1N8R2 2WAQA 4MD8A 2QA4Z 3FQMA 2JMOA 1I6HI 2OTL1 1TWCI 3CC7Z 5C4JI 2IZ3A 3J81b 2B63I 4BXXI 3T4NB 1JJ2Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WII A; 
#chains in the Genus database with same CATH topology
 2LFU A;  3CCR Z;  4A93 I;  1Q81 1;  3I4M I;  4RS4 A;  4BBR I;  1JJ2 Y;  1Q7Y 1;  3CC4 1;  2E2H I;  1VQ5 1;  3S2H I;  1M90 2;  1N2F A;  2VF1 A;  1X3Z A;  1X3W A;  3NH5 A;  2DE5 A;  2JS4 A;  4E2Z A;  3CCQ 1;  3IFU A;  1NUI A;  3I56 Z;  1TWH I;  1VQ7 Z;  3GKQ A;  2RHB A;  2J6A A;  2RPR A;  2QR1 B;  4NB8 A;  1KRL A;  2ZAE B;  2NAP A;  3IX0 A;  3MON A;  3G4S 1;  5T6B A;  1Z02 A;  3J80 b;  1YHQ 1;  2P28 A;  2W03 A;  3GTG I;  3CCS Z;  2VPW A;  3VMG A;  1KQS Z;  1VQM 1;  1M1K 1;  3CCL Z;  1KC8 1;  4Y52 I;  3CMA Z;  2VPZ A;  1KD1 2;  1YJ9 1;  1KQS Y;  3CCV Z;  3CME 1;  2NVT I;  1YJN Z;  2R6M A;  3GCF A;  2NVY I;  3S17 I;  3G6E Z;  2IZ4 A;  2OTJ 1;  1S72 Z;  4NBA A;  1NJI 2;  4EWC A;  3VMH A;  5AN9 F;  4NB9 A;  3S1R I;  4QTU A;  3CCU 1;  3I07 A;  3HOY I;  5C4X I;  1VQ6 Z;  3GTO I;  2G2K A;  1QVF Y;  1USP B;  2V3V A;  1Q86 1;  2P3Y A;  2JIR A;  3I55 Z;  1K9M 1;  2AKL A;  1DL6 A;  4A3I I;  1Q81 2;  1JWH C;  3VMI A;  4RVH A;  1VQL Z;  3HOU I;  1VQN Z;  4E30 A;  3GTK I;  1Q7Y 2;  4A3M I;  2QEX Z;  4DQY B;  2Y0S A;  1YIT Z;  3G71 Z;  1USP A;  4NBH A;  2GU2 A;  3GTM S;  1S7M A;  4RVG A;  2K3R A;  4A3E I;  2QKD A;  4E33 A;  1TWG I;  2JIO A;  2PM9 A;  2RBL A;  4A3C I;  2EGT A;  3M3Y I;  3CD6 Z;  1ZH1 A;  5T64 A;  2QRE B;  3CXC Z;  5IT9 f;  3TDH B;  1QXF A;  2I3C A;  3QWU A;  3S14 I;  2VUG A;  3CCE 1;  4BY7 I;  1VQ5 Z;  3NDI A;  3D6W A;  1Q82 1;  1QVG Z;  2YAD A;  3CCQ Z;  3CC2 Z;  2Q4Z A;  4AYB A;  1W2B Z;  4E2W A;  4NBC A;  3EED A;  2JIM A;  2VPY A;  1K83 I;  3H0G I;  4DGL A;  1KC8 2;  1M1K 2;  2QA4 1;  1QVG Y;  1P9N A;  3NDJ A;  3CC7 1;  1W2B Y;  3FQQ A;  2OOX B;  4Y7N I;  3GTP I;  3HOW I;  4A3B I;  3CCR 1;  3JAM f;  4BY1 I;  4NOZ A;  2KI7 B;  1L1O C;  1VQ8 Z;  2JA8 I;  4A3F I;  3GTM I;  1ZB8 A;  5FLM I;  3FKI I;  5A2Q f;  4RV9 A;  4HGY A;  1VQM Z;  1N8R 1;  1VQP Z;  2NVX I;  1QYP A;  1VQO Z;  1Q86 2;  1I50 I;  2IV2 X;  3MZL B;  3F3P C;  4NBB A;  1YJW 1;  5FLX f;  3I56 1;  4E31 A;  2OTJ Z;  4NBD A;  1VQ7 1;  2JA5 I;  4A3L I;  5IT9 b;  1Q16 A;  3S1M I;  1Y1V I;  2W04 A;  1YI2 1;  1R9T I;  1WW9 A;  1K8A 1;  3BG1 B;  3CCU Z;  2AYD A;  5IP7 I;  1K73 2;  3CCJ 1;  2F4M A;  3CCS 1;  3KIH A;  2DE6 A;  3CCM Z;  2H85 A;  2E9H A;  3F3F C;  3P5J B;  1VQ9 Z;  2JA6 I;  3CCL 1;  5CM2 M;  5D1O B;  4MD7 A;  3CMA 1;  3RZO I;  3S1Q I;  2NVQ I;  3CPW Z;  3I4N I;  3NH8 A;  1RNI A;  3CCV 1;  4TNU A;  3JAM b;  2RIQ A;  1YIJ Z;  1YJN 1;  1RO2 A;  3TE5 B;  3G6E 1;  3CPW Y;  1RLY A;  4NBF A;  1VQK Z;  1S72 1;  3ESW A;  2DE7 A;  2HU9 A;  5C44 I;  2E2I I;  3PO3 I;  1VQ4 1;  4E2X A;  1QF8 A;  5A2Q b;  5D1O A;  3VB9 A;  2JA7 I;  1VQ6 1;  2OTL Z;  5LL6 f;  4MXU A;  4NH1 C;  2R92 I;  1RQF A;  3I55 1;  3HKZ A;  2K5R A;  1WZN A;  3CCE Z;  1NP6 A;  5D1P A;  4S1T A;  1VQL 1;  2JUB A;  1VQN 1;  2JIP A;  2M6N A;  3CC4 Z;  4NBE A;  2V8K A;  3S2D I;  2VUM I;  3VTN A;  1Y1V S;  1Y1W I;  2QEX 1;  1YIT 1;  2QRC B;  4HGZ A;  4NFR A;  2JR6 A;  3CXC Y;  3G71 1;  3K7A I;  1LQL A;  3S1N I;  2V8J A;  2V45 A;  2LIY A;  2O4H A;  1WII A;  1TFI A;  4A3G I;  2VPX A;  4E32 A;  3GTL I;  3CD6 1;  1TWA I;  2M48 A;  3J7A 4;  3HOZ I;  4A3K I;  2BJO A;  4HH4 A;  2E2J I;  1K8A 2;  1VLA A;  3U50 C;  3BG0 B;  3PO2 I;  3G4S Z;  3LUS A;  1YUA A;  2OOY B;  2PMZ A;  2GTH A;  1YHQ Z;  3EER A;  4A3D I;  1YUK A;  2JIQ A;  3M4O I;  2YU9 I;  4XX2 A;  1Z03 A;  2PK7 A;  3D2L A;  1TWF I;  3CC2 1;  1Y8C A;  2JNY A;  3CQZ I;  3RZD I;  1AA6 A;  3GTJ I;  3PO3 S;  4A3J I;  1YJW Z;  1FDI A;  1K9M 2;  1YJ9 Z;  4QTT A;  3CME Z;  1PFT A;  3D9X A;  1YI2 Z;  2V8I A;  5IP9 I;  3S15 I;  2R7Z I;  1WCM I;  2HF1 A;  3CCJ Z;  1VQ8 1;  5T67 A;  2Q51 A;  4RVF A;  1ZB9 A;  2KPI A;  1M90 1;  1VQP 1;  3H3V J;  3IF8 A;  3Q87 A;  1VQO 1;  1Z01 A;  3J81 f;  2E7Z A;  3GTQ I;  4DK1 A;  1X0T A;  2WB1 A;  3S16 I;  2OZK A;  1RO0 A;  1ML8 A;  4NBG A;  4CL1 A;  1VQ4 Z;  1QVF Z;  4MRI A;  4MD9 A;  1SFO I;  1Q82 2;  4MON A;  3HOX I;  2LEX A;  2O53 A;  1RO4 A;  2QLV B;  3IR7 A;  1FDO A;  1SIW A;  4BBS I;  3CCM 1;  3HOV I;  1VQ9 1;  2QRD B;  4X6A I;  3OW2 Z;  2RT9 A;  1I3Q I;  1WJ2 A;  1KD1 1;  4RVD A;  5FLX b;  2GTI A;  3OW2 Y;  3MZK B;  3NH4 A;  5C3E I;  1YIJ 1;  3J80 f;  4MH4 A;  1VQK 1;  2R93 I;  2F4O A;  1NJI 1;  3KIF A;  4E2Y A;  1K73 1;  3NFZ A;  1N8R 2;  2WAQ A;  4MD8 A;  2QA4 Z;  3FQM A;  2JMO A;  1I6H I;  2OTL 1;  1TWC I;  3CC7 Z;  5C4J I;  2IZ3 A;  3J81 b;  2B63 I;  4BXX I;  3T4N B;  1JJ2 Z; 
#chains in the Genus database with same CATH homology
 2LFU A;  3CCR Z;  4A93 I;  1Q81 1;  3I4M I;  4RS4 A;  4BBR I;  1JJ2 Y;  1Q7Y 1;  3CC4 1;  2E2H I;  1VQ5 1;  3S2H I;  1M90 2;  1N2F A;  2VF1 A;  1X3Z A;  1X3W A;  3NH5 A;  2DE5 A;  2JS4 A;  4E2Z A;  3CCQ 1;  3IFU A;  1NUI A;  3I56 Z;  1TWH I;  1VQ7 Z;  3GKQ A;  2RHB A;  2J6A A;  2RPR A;  2QR1 B;  4NB8 A;  1KRL A;  2ZAE B;  3IX0 A;  3MON A;  3G4S 1;  5T6B A;  1Z02 A;  3J80 b;  1YHQ 1;  2P28 A;  2W03 A;  3GTG I;  3CCS Z;  3VMG A;  1KQS Z;  1VQM 1;  1M1K 1;  3CCL Z;  1KC8 1;  4Y52 I;  3CMA Z;  1KD1 2;  1YJ9 1;  1KQS Y;  3CCV Z;  3CME 1;  2NVT I;  1YJN Z;  2R6M A;  3GCF A;  2NVY I;  3S17 I;  3G6E Z;  2IZ4 A;  2OTJ 1;  1S72 Z;  4NBA A;  1NJI 2;  4EWC A;  3VMH A;  5AN9 F;  4NB9 A;  3S1R I;  4QTU A;  3CCU 1;  3I07 A;  3HOY I;  5C4X I;  1VQ6 Z;  3GTO I;  2G2K A;  1QVF Y;  1USP B;  1Q86 1;  2P3Y A;  3I55 Z;  1K9M 1;  2AKL A;  1DL6 A;  4A3I I;  1Q81 2;  1JWH C;  3VMI A;  4RVH A;  1VQL Z;  3HOU I;  1VQN Z;  4E30 A;  3GTK I;  1Q7Y 2;  4A3M I;  2QEX Z;  4DQY B;  2Y0S A;  1YIT Z;  3G71 Z;  1USP A;  4NBH A;  2GU2 A;  3GTM S;  1S7M A;  4RVG A;  2K3R A;  4A3E I;  2QKD A;  4E33 A;  1TWG I;  2PM9 A;  2RBL A;  4A3C I;  2EGT A;  3M3Y I;  3CD6 Z;  1ZH1 A;  5T64 A;  2QRE B;  3CXC Z;  5IT9 f;  3TDH B;  2I3C A;  3QWU A;  3S14 I;  2VUG A;  3CCE 1;  4BY7 I;  1VQ5 Z;  3NDI A;  3D6W A;  1Q82 1;  1QVG Z;  2YAD A;  3CCQ Z;  3CC2 Z;  2Q4Z A;  4AYB A;  1W2B Z;  4E2W A;  4NBC A;  3EED A;  1M1K 2;  1K83 I;  3H0G I;  4DGL A;  1KC8 2;  2QA4 1;  1QVG Y;  1P9N A;  3NDJ A;  3CC7 1;  1W2B Y;  3FQQ A;  2OOX B;  4Y7N I;  3GTP I;  3HOW I;  4A3B I;  3CCR 1;  3JAM f;  4BY1 I;  4NOZ A;  2KI7 B;  1L1O C;  1VQ8 Z;  2JA8 I;  4A3F I;  3GTM I;  1ZB8 A;  5FLM I;  3FKI I;  5A2Q f;  4RV9 A;  4HGY A;  1VQM Z;  1N8R 1;  1VQP Z;  2NVX I;  1QYP A;  1VQO Z;  1Q86 2;  1I50 I;  3MZL B;  3F3P C;  4NBB A;  1YJW 1;  5FLX f;  3I56 1;  4E31 A;  2OTJ Z;  4NBD A;  1VQ7 1;  2JA5 I;  4A3L I;  5IT9 b;  3S1M I;  1Y1V I;  2W04 A;  1YI2 1;  1R9T I;  1WW9 A;  1K8A 1;  3BG1 B;  3CCU Z;  5IP7 I;  1K73 2;  3CCJ 1;  2F4M A;  3CCS 1;  3KIH A;  2DE6 A;  3CCM Z;  2H85 A;  2E9H A;  3F3F C;  3P5J B;  1VQ9 Z;  2JA6 I;  3CCL 1;  5CM2 M;  5D1O B;  4MD7 A;  3CMA 1;  3RZO I;  3S1Q I;  2NVQ I;  3CPW Z;  3I4N I;  3NH8 A;  1RNI A;  3CCV 1;  4TNU A;  3JAM b;  2RIQ A;  1YIJ Z;  1YJN 1;  1RO2 A;  3TE5 B;  3G6E 1;  3CPW Y;  1RLY A;  4NBF A;  1VQK Z;  1S72 1;  3ESW A;  2DE7 A;  2HU9 A;  5C44 I;  2E2I I;  3PO3 I;  1VQ4 1;  4E2X A;  1QF8 A;  5A2Q b;  5D1O A;  3VB9 A;  2JA7 I;  1VQ6 1;  2OTL Z;  5LL6 f;  4MXU A;  4NH1 C;  2R92 I;  1RQF A;  3I55 1;  3HKZ A;  2K5R A;  3CCE Z;  1NP6 A;  5D1P A;  4S1T A;  1VQL 1;  2JUB A;  1VQN 1;  3CC4 Z;  2M6N A;  4NBE A;  2V8K A;  3S2D I;  2VUM I;  3VTN A;  1Y1V S;  1Y1W I;  2QEX 1;  1YIT 1;  2QRC B;  4HGZ A;  4NFR A;  2JR6 A;  3CXC Y;  3G71 1;  3K7A I;  1LQL A;  3S1N I;  2V8J A;  2LIY A;  2O4H A;  1WII A;  1TFI A;  4A3G I;  4E32 A;  3GTL I;  3CD6 1;  1TWA I;  2M48 A;  3J7A 4;  3HOZ I;  4A3K I;  2BJO A;  4HH4 A;  2E2J I;  1K8A 2;  1VLA A;  3U50 C;  3BG0 B;  3PO2 I;  3G4S Z;  3LUS A;  1YUA A;  2OOY B;  2PMZ A;  2GTH A;  1YHQ Z;  3EER A;  4A3D I;  1YUK A;  3M4O I;  2YU9 I;  4XX2 A;  1Z03 A;  2PK7 A;  1TWF I;  3CC2 1;  2JNY A;  3CQZ I;  3RZD I;  3GTJ I;  3PO3 S;  4A3J I;  1YJW Z;  1K9M 2;  1YJ9 Z;  4QTT A;  3CME Z;  1PFT A;  3D9X A;  1YI2 Z;  2V8I A;  5IP9 I;  3S15 I;  2R7Z I;  1WCM I;  2HF1 A;  3CCJ Z;  1VQ8 1;  5T67 A;  2Q51 A;  4RVF A;  1ZB9 A;  2KPI A;  1M90 1;  1VQP 1;  3H3V J;  3IF8 A;  3Q87 A;  1VQO 1;  1Z01 A;  3J81 f;  3GTQ I;  4DK1 A;  1X0T A;  2WB1 A;  3S16 I;  2OZK A;  1RO0 A;  1ML8 A;  4NBG A;  4CL1 A;  1VQ4 Z;  1QVF Z;  4MRI A;  4MD9 A;  1SFO I;  1Q82 2;  4MON A;  3HOX I;  2O53 A;  1RO4 A;  2QLV B;  4BBS I;  3CCM 1;  3HOV I;  1VQ9 1;  2QRD B;  4X6A I;  3OW2 Z;  2RT9 A;  1I3Q I;  1KD1 1;  4RVD A;  5FLX b;  2GTI A;  3OW2 Y;  3MZK B;  3NH4 A;  5C3E I;  1YIJ 1;  3J80 f;  4MH4 A;  1VQK 1;  2R93 I;  2F4O A;  1NJI 1;  3KIF A;  4E2Y A;  1K73 1;  3NFZ A;  1N8R 2;  2WAQ A;  4MD8 A;  2QA4 Z;  3FQM A;  2JMO A;  1I6H I;  2OTL 1;  1TWC I;  3CC7 Z;  5C4J I;  2IZ3 A;  3J81 b;  2B63 I;  4BXX I;  3T4N B;  1JJ2 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...