1WIIA

Solution structure of rsgi ruh-025, a duf701 domain from mouse cdna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
85
structure length
85
Chain Sequence
GSSGSSGRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0222 protein MGC4549
publication title Solution structure of RSGI RUH-025, a DUF701 domain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 9
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.190 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1wiiA01
1WIIA
chains in the Genus database with same CATH superfamily
1KRLA 3CCS1 1I50I 3CCM1 4MD8A 3OW2Z 3HOVI 1YJ91 2Q4ZA 1RQFA 3CCEZ 4A3JI 3K7AI 1M1K2 3I07A 1TWAI 2IV2X 1RO0A 3HOWI 2R6MA 3GTJI 2RBLA 2H85A 4MONA 3CC7Z 5C44I 1VQK1 5D1OB 2AYDA 3I55Z 3GTLI 1Q861 2NVXI 3BG0B 1Q812 2Y0SA 3PO3I 3CCRZ 2YU9I 1I6HI 1USPA 2JR6A 5A2Qb 2QA4Z 3OW2Y 1NUIA 3CCQZ 2R92I 1ZB9A 1VQ4Z 1Q862 5T64A 2OTLZ 1QVGZ 4XX2A 1Q7Y1 1VQN1 3CCUZ 2JUBA 4HGZA 4E33A 2IZ3A 2P3YA 5LL6f 3FQMA 3S2DI 2KPIA 5FLXf 1VQO1 2OTJ1 1VQLZ 2V3VA 3TE5B 2HF1A 3PO3S 3H3VJ 2M6NA 1K731 3P5JB 4NOZA 2NVTI 3H0GI 2W03A 4NH1C 4CL1A 3G6EZ 1QVGY 4BBRI 1SIWA 1M902 4NBFA 1AA6A 1I3QI 2JNYA 3BG1B 3CC41 2JA8I 3M3YI 3CQZI 4RS4A 3LUSA 2E7ZA 3VB9A 1K732 2GTIA 1YJWZ 3EEDA 4E2XA 3G71Z 2DE5A 1K9M2 3JAMf 4E32A 3CCJ1 1KD11 1YIJZ 3HKZA 1Y1VI 2PM9A 1W2BZ 3NH8A 2E2HI 3S1NI 3IX0A 3S1MI 1ZH1A 1N2FA 4MRIA 2O4HA 1YHQZ 1VQPZ 3G4SZ 2IZ4A 1ZB8A 2PMZA 1WCMI 1KD12 2JIQA 5FLXb 1VQ5Z 2V45A 5IP9I 1S721 3FQQA 1LQLA 2J6AA 3CCVZ 5AN9F 3CXCZ 4E2YA 4NB8A 3CME1 1Y8CA 4DK1A 5T67A 3J7A4 3GTQI 4MD9A 1RO4A 1Q811 1YJN1 4A3LI 4E2ZA 1P9NA 1W2BY 1L1OC 1K8A1 3QWUA 2VPXA 1Y1VS 1KQSZ 2QLVB 3CMAZ 4RVHA 3F3FC 3S1RI 2QEXZ 2RPRA 3RZDI 1Z01A 2R93I 3G6E1 1YI2Z 4RVFA 2ZAEB 2HU9A 4NBBA 3JAMb 4A3BI 1VQMZ 4NBAA 2VPWA 4NBDA 1K8A2 3CXCY 3NH5A 1YITZ 3GTKI 1TFIA 3CPWZ 1RNIA 1YJW1 4TNUA 2EGTA 2QR1B 2LIYA 2QKDA 3CCL1 3CD61 4A93I 3CC2Z 1VQ7Z 3NFZA 3J81b 4QTTA 2G2KA 3TDHB 3I56Z 2GTHA 2V8IA 2NAPA 5T6BA 1KQSY 1N8R2 1VQ8Z 4A3KI 4A3MI 1VQ6Z 4DQYB 1VQP1 4RVGA 1M901 4BY7I 2PK7A 2GU2A 3CCSZ 5D1PA 1VQ51 3GTPI 3CCMZ 1DL6A 2KI7B 3CPWY 2YADA 2VUGA 4S1TA 3VMGA 1YJ9Z 1WIIA 3CCE1 1K9M1 5C4XI 3VTNA 3HOUI 3I4NI 4A3FI 1VQKZ 3CC71 5IT9b 3S15I 4X6AI 3I551 2LFUA 3S17I 2O53A 3CMA1 3MZKB 2V8JA 1KC82 3M4OI 3CCR1 5IP7I 2NVQI 3GTOI 4BY1I 1TWHI 2QA41 1NJI1 4E31A 3GTMI 3CCQ1 4HH4A 4NBHA 4Y52I 2VPZA 2JA6I 1VQ41 2OTL1 4NBGA 1VQNZ 3J81f 5FLMI 3GCFA 3CCU1 2JMOA 2R7ZI 2WAQA 1VQ9Z 1X0TA 2JIRA 1NJI2 1WZNA 3I561 1JJ2Z 1VQ61 4A3GI 3RZOI 2OTJZ 1TWCI 1VQL1 2JA5I 2B63I 1WW9A 2OZKA 2JIMA 2I3CA 3VMHA 3GTMS 3PO2I 4A3CI 1QXFA 1QYPA 2E2JI 4MD7A 1RLYA 2BJOA 3CC4Z 5IT9f 4BXXI 3MONA 2OOYB 3KIHA 1Q821 1PFTA 3MZLB 2RHBA 3S14I 1N8R1 2VPYA 2LEXA 3J80b 2QRCB 1JJ2Y 2E9HA 1JWHC 3CCJZ 4A3II 3G711 4NFRA 3NDJA 2WB1A 4EWCA 1VLAA 2M48A 3IFUA 1YIJ1 2V8KA 1FDIA 5C4JI 2F4MA 2QRDB 4NBEA 1Q822 2RT9A 2JIOA 3GTGI 2NVYI 1FDOA 4MH4A 3EERA 3T4NB 1TWFI 2P28A 1YHQ1 2VF1A 3G4S1 1NP6A 3NH4A 1RO2A 2F4OA 4A3DI 1X3WA 4E2WA 1S72Z 4RVDA 3VMIA 1K83I 1TWGI 3D9XA 3CCV1 1VQ91 3CMEZ 4E30A 2K5RA 3Q87A 5D1OA 3S2HI 4BBSI 2RIQA 1YJNZ 1KC81 1Z02A 4Y7NI 4NB9A 1Q7Y2 3IR7A 4RV9A 1R9TI 1Y1WI 3U50C 1QVFZ 1YUKA 1X3ZA 5CM2M 5C3EI 2AKLA 3HOYI 3KIFA 1Z03A 2QEX1 2E2II 3HOXI 1SFOI 1YI21 4DGLA 4NBCA 3I4MI 1VQM1 4HGYA 4QTUA 3IF8A 4MXUA 1ML8A 1WJ2A 2OOXB 3J80f 1YIT1 3F3PC 2JA7I 4AYBA 3S1QI 3ESWA 3CCLZ 3CD6Z 1YUAA 5A2Qf 3NDIA 2W04A 3CC21 2K3RA 2JS4A 3FKII 1VQ71 3HOZI 3D2LA 1QVFY 1S7MA 1QF8A 2DE6A 2Q51A 3GKQA 1VQ81 1Q16A 4A3EI 3D6WA 1M1K1 1VQOZ 2JIPA 1USPB 2DE7A 3S16I 2QREB 2VUMI
chains in the Genus database with same CATH topology
1KRLA 3CCS1 1I50I 3CCM1 4MD8A 3OW2Z 3HOVI 1YJ91 2Q4ZA 1RQFA 3CCEZ 4A3JI 3K7AI 1M1K2 3I07A 1TWAI 1RO0A 3HOWI 2R6MA 3GTJI 2RBLA 2H85A 4MONA 3CC7Z 5C44I 1VQK1 5D1OB 3I55Z 3GTLI 1Q861 2NVXI 3BG0B 1Q812 2Y0SA 3PO3I 3CCRZ 2YU9I 1I6HI 1USPA 2JR6A 5A2Qb 2QA4Z 3OW2Y 1NUIA 3CCQZ 2R92I 1ZB9A 1VQ4Z 1Q862 5T64A 2OTLZ 1QVGZ 4XX2A 1Q7Y1 1VQN1 3CCUZ 2JUBA 4HGZA 4E33A 2IZ3A 2P3YA 5LL6f 3FQMA 3S2DI 2KPIA 5FLXf 1VQO1 2OTJ1 1VQLZ 3TE5B 2HF1A 3PO3S 3H3VJ 2M6NA 1K731 3P5JB 4NOZA 2NVTI 3H0GI 2W03A 4NH1C 4CL1A 3G6EZ 1QVGY 4BBRI 1M902 4NBFA 1I3QI 2JNYA 3BG1B 3CC41 2JA8I 3M3YI 3CQZI 4RS4A 3LUSA 3VB9A 1K732 2GTIA 1YJWZ 3EEDA 4E2XA 3G71Z 2DE5A 1K9M2 3JAMf 4E32A 3CCJ1 1KD11 1YIJZ 3HKZA 1Y1VI 2PM9A 1W2BZ 3NH8A 2E2HI 3S1NI 3IX0A 3S1MI 1ZH1A 1N2FA 4MRIA 2O4HA 1YHQZ 1VQPZ 3G4SZ 2IZ4A 1ZB8A 2PMZA 1WCMI 1KD12 5FLXb 1VQ5Z 5IP9I 1S721 3FQQA 1LQLA 2J6AA 3CCVZ 5AN9F 3CXCZ 4E2YA 4NB8A 3CME1 4DK1A 5T67A 3J7A4 3GTQI 4MD9A 1RO4A 1Q811 1YJN1 4A3LI 4E2ZA 1P9NA 1W2BY 1L1OC 1K8A1 3QWUA 1Y1VS 1KQSZ 2QLVB 3CMAZ 4RVHA 3F3FC 3S1RI 2QEXZ 2RPRA 3RZDI 1Z01A 2R93I 3G6E1 1YI2Z 4RVFA 2ZAEB 2HU9A 4NBBA 3JAMb 4A3BI 1VQMZ 4NBAA 4NBDA 1K8A2 3CXCY 3NH5A 1YITZ 3GTKI 1TFIA 3CPWZ 1RNIA 1YJW1 4TNUA 2EGTA 2QR1B 2LIYA 2QKDA 3CCL1 3CD61 4A93I 3CC2Z 1VQ7Z 3NFZA 3J81b 4QTTA 2G2KA 3TDHB 3I56Z 2GTHA 2V8IA 5T6BA 1KQSY 1N8R2 1VQ8Z 4A3KI 4A3MI 1VQ6Z 4DQYB 1VQP1 4RVGA 1M901 4BY7I 2PK7A 2GU2A 3CCSZ 1VQ51 5D1PA 3GTPI 3CCMZ 1DL6A 2KI7B 3CPWY 2YADA 2VUGA 4S1TA 3VMGA 1YJ9Z 1WIIA 3CCE1 1K9M1 5C4XI 3VTNA 3HOUI 3I4NI 4A3FI 1VQKZ 3CC71 5IT9b 3S15I 4X6AI 3I551 2LFUA 3S17I 2O53A 3CMA1 3MZKB 2V8JA 1KC82 3M4OI 3CCR1 5IP7I 2NVQI 3GTOI 4BY1I 1TWHI 2QA41 1NJI1 4E31A 3GTMI 3CCQ1 4HH4A 4NBHA 4Y52I 2JA6I 1VQ41 2OTL1 4NBGA 1VQNZ 3J81f 5FLMI 3GCFA 3CCU1 2JMOA 2R7ZI 2WAQA 1VQ9Z 1X0TA 1NJI2 3I561 1JJ2Z 1VQ61 4A3GI 3RZOI 2OTJZ 1TWCI 1VQL1 2JA5I 2B63I 1WW9A 2OZKA 2I3CA 3VMHA 3GTMS 3PO2I 4A3CI 1QYPA 2E2JI 4MD7A 1RLYA 2BJOA 3CC4Z 5IT9f 4BXXI 3MONA 2OOYB 3KIHA 1Q821 1PFTA 3MZLB 2RHBA 3S14I 1N8R1 3J80b 2QRCB 1JJ2Y 2E9HA 1JWHC 3CCJZ 4A3II 3G711 4NFRA 3NDJA 2WB1A 4EWCA 1VLAA 2M48A 3IFUA 1YIJ1 2V8KA 5C4JI 2F4MA 2QRDB 4NBEA 1Q822 2RT9A 3GTGI 2NVYI 4MH4A 3EERA 3T4NB 1TWFI 2P28A 1YHQ1 2VF1A 3G4S1 1NP6A 3NH4A 1RO2A 2F4OA 4A3DI 1X3WA 4E2WA 1S72Z 4RVDA 3VMIA 1K83I 1TWGI 3D9XA 3CCV1 1VQ91 3CMEZ 4E30A 2K5RA 3Q87A 5D1OA 3S2HI 4BBSI 2RIQA 1YJNZ 1KC81 1Z02A 4Y7NI 4NB9A 1Q7Y2 4RV9A 1R9TI 1Y1WI 3U50C 1QVFZ 1YUKA 1X3ZA 5CM2M 5C3EI 2AKLA 3HOYI 3KIFA 1Z03A 2QEX1 2E2II 3HOXI 1SFOI 1YI21 4DGLA 4NBCA 3I4MI 1VQM1 4HGYA 4QTUA 3IF8A 4MXUA 1ML8A 2OOXB 3J80f 1YIT1 3F3PC 2JA7I 4AYBA 3S1QI 3ESWA 3CCLZ 3CD6Z 1YUAA 5A2Qf 3NDIA 2W04A 3CC21 2K3RA 2JS4A 3FKII 1VQ71 3HOZI 1QVFY 1S7MA 1QF8A 2DE6A 2Q51A 3GKQA 1VQ81 4A3EI 3D6WA 1M1K1 1VQOZ 1USPB 2DE7A 3S16I 2QREB 2VUMI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WII A; 
#chains in the Genus database with same CATH topology
 1KRL A;  3CCS 1;  1I50 I;  3CCM 1;  4MD8 A;  3OW2 Z;  3HOV I;  1YJ9 1;  2Q4Z A;  1RQF A;  3CCE Z;  4A3J I;  3K7A I;  1M1K 2;  3I07 A;  1TWA I;  2IV2 X;  1RO0 A;  3HOW I;  2R6M A;  3GTJ I;  2RBL A;  2H85 A;  4MON A;  3CC7 Z;  5C44 I;  1VQK 1;  5D1O B;  2AYD A;  3I55 Z;  3GTL I;  1Q86 1;  2NVX I;  3BG0 B;  1Q81 2;  2Y0S A;  3PO3 I;  3CCR Z;  2YU9 I;  1I6H I;  1USP A;  2JR6 A;  5A2Q b;  2QA4 Z;  3OW2 Y;  1NUI A;  3CCQ Z;  2R92 I;  1ZB9 A;  1VQ4 Z;  1Q86 2;  5T64 A;  2OTL Z;  1QVG Z;  4XX2 A;  1Q7Y 1;  1VQN 1;  3CCU Z;  2JUB A;  4HGZ A;  4E33 A;  2IZ3 A;  2P3Y A;  5LL6 f;  3FQM A;  3S2D I;  2KPI A;  5FLX f;  1VQO 1;  2OTJ 1;  1VQL Z;  2V3V A;  3TE5 B;  2HF1 A;  3PO3 S;  3H3V J;  2M6N A;  1K73 1;  3P5J B;  4NOZ A;  2NVT I;  3H0G I;  2W03 A;  4NH1 C;  4CL1 A;  3G6E Z;  1QVG Y;  4BBR I;  1SIW A;  1M90 2;  4NBF A;  1AA6 A;  1I3Q I;  2JNY A;  3BG1 B;  3CC4 1;  2JA8 I;  3M3Y I;  3CQZ I;  4RS4 A;  3LUS A;  2E7Z A;  3VB9 A;  1K73 2;  2GTI A;  1YJW Z;  3EED A;  4E2X A;  3G71 Z;  2DE5 A;  1K9M 2;  3JAM f;  4E32 A;  3CCJ 1;  1KD1 1;  1YIJ Z;  3HKZ A;  1Y1V I;  2PM9 A;  1W2B Z;  3NH8 A;  2E2H I;  3S1N I;  3IX0 A;  3S1M I;  1ZH1 A;  1N2F A;  4MRI A;  2O4H A;  1YHQ Z;  1VQP Z;  3G4S Z;  2IZ4 A;  1ZB8 A;  2PMZ A;  1WCM I;  1KD1 2;  2JIQ A;  5FLX b;  1VQ5 Z;  2V45 A;  5IP9 I;  1S72 1;  3FQQ A;  1LQL A;  2J6A A;  3CCV Z;  5AN9 F;  3CXC Z;  4E2Y A;  4NB8 A;  3CME 1;  1Y8C A;  4DK1 A;  5T67 A;  3J7A 4;  3GTQ I;  4MD9 A;  1RO4 A;  1Q81 1;  1YJN 1;  4A3L I;  4E2Z A;  1P9N A;  1W2B Y;  1L1O C;  1K8A 1;  3QWU A;  2VPX A;  1Y1V S;  1KQS Z;  2QLV B;  3CMA Z;  4RVH A;  3F3F C;  3S1R I;  2QEX Z;  2RPR A;  3RZD I;  1Z01 A;  2R93 I;  3G6E 1;  1YI2 Z;  4RVF A;  2ZAE B;  2HU9 A;  4NBB A;  3JAM b;  4A3B I;  1VQM Z;  4NBA A;  2VPW A;  4NBD A;  1K8A 2;  3CXC Y;  3NH5 A;  1YIT Z;  3GTK I;  1TFI A;  3CPW Z;  1RNI A;  1YJW 1;  4TNU A;  2EGT A;  2QR1 B;  2LIY A;  2QKD A;  3CCL 1;  3CD6 1;  4A93 I;  3CC2 Z;  1VQ7 Z;  3NFZ A;  3J81 b;  4QTT A;  2G2K A;  3TDH B;  3I56 Z;  2GTH A;  2V8I A;  2NAP A;  5T6B A;  1KQS Y;  1N8R 2;  1VQ8 Z;  4A3K I;  4A3M I;  1VQ6 Z;  4DQY B;  1VQP 1;  4RVG A;  1M90 1;  4BY7 I;  2PK7 A;  2GU2 A;  3CCS Z;  5D1P A;  1VQ5 1;  3GTP I;  3CCM Z;  1DL6 A;  2KI7 B;  3CPW Y;  2YAD A;  2VUG A;  4S1T A;  3VMG A;  1YJ9 Z;  1WII A;  3CCE 1;  1K9M 1;  5C4X I;  3VTN A;  3HOU I;  3I4N I;  4A3F I;  1VQK Z;  3CC7 1;  5IT9 b;  3S15 I;  4X6A I;  3I55 1;  2LFU A;  3S17 I;  2O53 A;  3CMA 1;  3MZK B;  2V8J A;  1KC8 2;  3M4O I;  3CCR 1;  5IP7 I;  2NVQ I;  3GTO I;  4BY1 I;  1TWH I;  2QA4 1;  1NJI 1;  4E31 A;  3GTM I;  3CCQ 1;  4HH4 A;  4NBH A;  4Y52 I;  2VPZ A;  2JA6 I;  1VQ4 1;  2OTL 1;  4NBG A;  1VQN Z;  3J81 f;  5FLM I;  3GCF A;  3CCU 1;  2JMO A;  2R7Z I;  2WAQ A;  1VQ9 Z;  1X0T A;  2JIR A;  1NJI 2;  1WZN A;  3I56 1;  1JJ2 Z;  1VQ6 1;  4A3G I;  3RZO I;  2OTJ Z;  1TWC I;  1VQL 1;  2JA5 I;  2B63 I;  1WW9 A;  2OZK A;  2JIM A;  2I3C A;  3VMH A;  3GTM S;  3PO2 I;  4A3C I;  1QXF A;  1QYP A;  2E2J I;  4MD7 A;  1RLY A;  2BJO A;  3CC4 Z;  5IT9 f;  4BXX I;  3MON A;  2OOY B;  3KIH A;  1Q82 1;  1PFT A;  3MZL B;  2RHB A;  3S14 I;  1N8R 1;  2VPY A;  2LEX A;  3J80 b;  2QRC B;  1JJ2 Y;  2E9H A;  1JWH C;  3CCJ Z;  4A3I I;  3G71 1;  4NFR A;  3NDJ A;  2WB1 A;  4EWC A;  1VLA A;  2M48 A;  3IFU A;  1YIJ 1;  2V8K A;  1FDI A;  5C4J I;  2F4M A;  2QRD B;  4NBE A;  1Q82 2;  2RT9 A;  2JIO A;  3GTG I;  2NVY I;  1FDO A;  4MH4 A;  3EER A;  3T4N B;  1TWF I;  2P28 A;  1YHQ 1;  2VF1 A;  3G4S 1;  1NP6 A;  3NH4 A;  1RO2 A;  2F4O A;  4A3D I;  1X3W A;  4E2W A;  1S72 Z;  4RVD A;  3VMI A;  1K83 I;  1TWG I;  3D9X A;  3CCV 1;  1VQ9 1;  3CME Z;  4E30 A;  2K5R A;  3Q87 A;  5D1O A;  3S2H I;  4BBS I;  2RIQ A;  1YJN Z;  1KC8 1;  1Z02 A;  4Y7N I;  4NB9 A;  1Q7Y 2;  3IR7 A;  4RV9 A;  1R9T I;  1Y1W I;  3U50 C;  1QVF Z;  1YUK A;  1X3Z A;  5CM2 M;  5C3E I;  2AKL A;  3HOY I;  3KIF A;  1Z03 A;  2QEX 1;  2E2I I;  3HOX I;  1SFO I;  1YI2 1;  4DGL A;  4NBC A;  3I4M I;  1VQM 1;  4HGY A;  4QTU A;  3IF8 A;  4MXU A;  1ML8 A;  1WJ2 A;  2OOX B;  3J80 f;  1YIT 1;  3F3P C;  2JA7 I;  4AYB A;  3S1Q I;  3ESW A;  3CCL Z;  3CD6 Z;  1YUA A;  5A2Q f;  3NDI A;  2W04 A;  3CC2 1;  2K3R A;  2JS4 A;  3FKI I;  1VQ7 1;  3HOZ I;  3D2L A;  1QVF Y;  1S7M A;  1QF8 A;  2DE6 A;  2Q51 A;  3GKQ A;  1VQ8 1;  1Q16 A;  4A3E I;  3D6W A;  1M1K 1;  1VQO Z;  2JIP A;  1USP B;  2DE7 A;  3S16 I;  2QRE B;  2VUM I; 
#chains in the Genus database with same CATH homology
 1KRL A;  3CCS 1;  1I50 I;  3CCM 1;  4MD8 A;  3OW2 Z;  3HOV I;  1YJ9 1;  2Q4Z A;  1RQF A;  3CCE Z;  4A3J I;  3K7A I;  1M1K 2;  3I07 A;  1TWA I;  1RO0 A;  3HOW I;  2R6M A;  3GTJ I;  2RBL A;  2H85 A;  4MON A;  3CC7 Z;  5C44 I;  1VQK 1;  5D1O B;  3I55 Z;  3GTL I;  1Q86 1;  2NVX I;  3BG0 B;  1Q81 2;  2Y0S A;  3PO3 I;  3CCR Z;  2YU9 I;  1I6H I;  1USP A;  2JR6 A;  5A2Q b;  2QA4 Z;  3OW2 Y;  1NUI A;  3CCQ Z;  2R92 I;  1ZB9 A;  1VQ4 Z;  1Q86 2;  5T64 A;  2OTL Z;  1QVG Z;  4XX2 A;  1Q7Y 1;  1VQN 1;  3CCU Z;  2JUB A;  4HGZ A;  4E33 A;  2IZ3 A;  2P3Y A;  5LL6 f;  3FQM A;  3S2D I;  2KPI A;  5FLX f;  1VQO 1;  2OTJ 1;  1VQL Z;  3TE5 B;  2HF1 A;  3PO3 S;  3H3V J;  2M6N A;  1K73 1;  3P5J B;  4NOZ A;  2NVT I;  3H0G I;  2W03 A;  4NH1 C;  4CL1 A;  3G6E Z;  1QVG Y;  4BBR I;  1M90 2;  4NBF A;  1I3Q I;  2JNY A;  3BG1 B;  3CC4 1;  2JA8 I;  3M3Y I;  3CQZ I;  4RS4 A;  3LUS A;  3VB9 A;  1K73 2;  2GTI A;  1YJW Z;  3EED A;  4E2X A;  3G71 Z;  2DE5 A;  1K9M 2;  3JAM f;  4E32 A;  3CCJ 1;  1KD1 1;  1YIJ Z;  3HKZ A;  1Y1V I;  2PM9 A;  1W2B Z;  3NH8 A;  2E2H I;  3S1N I;  3IX0 A;  3S1M I;  1ZH1 A;  1N2F A;  4MRI A;  2O4H A;  1YHQ Z;  1VQP Z;  3G4S Z;  2IZ4 A;  1ZB8 A;  2PMZ A;  1WCM I;  1KD1 2;  5FLX b;  1VQ5 Z;  5IP9 I;  1S72 1;  3FQQ A;  1LQL A;  2J6A A;  3CCV Z;  5AN9 F;  3CXC Z;  4E2Y A;  4NB8 A;  3CME 1;  4DK1 A;  5T67 A;  3J7A 4;  3GTQ I;  4MD9 A;  1RO4 A;  1Q81 1;  1YJN 1;  4A3L I;  4E2Z A;  1P9N A;  1W2B Y;  1L1O C;  1K8A 1;  3QWU A;  1Y1V S;  1KQS Z;  2QLV B;  3CMA Z;  4RVH A;  3F3F C;  3S1R I;  2QEX Z;  2RPR A;  3RZD I;  1Z01 A;  2R93 I;  3G6E 1;  1YI2 Z;  4RVF A;  2ZAE B;  2HU9 A;  4NBB A;  3JAM b;  4A3B I;  1VQM Z;  4NBA A;  4NBD A;  1K8A 2;  3CXC Y;  3NH5 A;  1YIT Z;  3GTK I;  1TFI A;  3CPW Z;  1RNI A;  1YJW 1;  4TNU A;  2EGT A;  2QR1 B;  2LIY A;  2QKD A;  3CCL 1;  3CD6 1;  4A93 I;  3CC2 Z;  1VQ7 Z;  3NFZ A;  3J81 b;  4QTT A;  2G2K A;  3TDH B;  3I56 Z;  2GTH A;  2V8I A;  5T6B A;  1KQS Y;  1N8R 2;  1VQ8 Z;  4A3K I;  4A3M I;  1VQ6 Z;  4DQY B;  1VQP 1;  4RVG A;  1M90 1;  4BY7 I;  2PK7 A;  2GU2 A;  3CCS Z;  1VQ5 1;  5D1P A;  3GTP I;  3CCM Z;  1DL6 A;  2KI7 B;  3CPW Y;  2YAD A;  2VUG A;  4S1T A;  3VMG A;  1YJ9 Z;  1WII A;  3CCE 1;  1K9M 1;  5C4X I;  3VTN A;  3HOU I;  3I4N I;  4A3F I;  1VQK Z;  3CC7 1;  5IT9 b;  3S15 I;  4X6A I;  3I55 1;  2LFU A;  3S17 I;  2O53 A;  3CMA 1;  3MZK B;  2V8J A;  1KC8 2;  3M4O I;  3CCR 1;  5IP7 I;  2NVQ I;  3GTO I;  4BY1 I;  1TWH I;  2QA4 1;  1NJI 1;  4E31 A;  3GTM I;  3CCQ 1;  4HH4 A;  4NBH A;  4Y52 I;  2JA6 I;  1VQ4 1;  2OTL 1;  4NBG A;  1VQN Z;  3J81 f;  5FLM I;  3GCF A;  3CCU 1;  2JMO A;  2R7Z I;  2WAQ A;  1VQ9 Z;  1X0T A;  1NJI 2;  3I56 1;  1JJ2 Z;  1VQ6 1;  4A3G I;  3RZO I;  2OTJ Z;  1TWC I;  1VQL 1;  2JA5 I;  2B63 I;  1WW9 A;  2OZK A;  2I3C A;  3VMH A;  3GTM S;  3PO2 I;  4A3C I;  1QYP A;  2E2J I;  4MD7 A;  1RLY A;  2BJO A;  3CC4 Z;  5IT9 f;  4BXX I;  3MON A;  2OOY B;  3KIH A;  1Q82 1;  1PFT A;  3MZL B;  2RHB A;  3S14 I;  1N8R 1;  3J80 b;  2QRC B;  1JJ2 Y;  2E9H A;  1JWH C;  3CCJ Z;  4A3I I;  3G71 1;  4NFR A;  3NDJ A;  2WB1 A;  4EWC A;  1VLA A;  2M48 A;  3IFU A;  1YIJ 1;  2V8K A;  5C4J I;  2F4M A;  2QRD B;  4NBE A;  1Q82 2;  2RT9 A;  3GTG I;  2NVY I;  4MH4 A;  3EER A;  3T4N B;  1TWF I;  2P28 A;  1YHQ 1;  2VF1 A;  3G4S 1;  1NP6 A;  3NH4 A;  1RO2 A;  2F4O A;  4A3D I;  1X3W A;  4E2W A;  1S72 Z;  4RVD A;  3VMI A;  1K83 I;  1TWG I;  3D9X A;  3CCV 1;  1VQ9 1;  3CME Z;  4E30 A;  2K5R A;  3Q87 A;  5D1O A;  3S2H I;  4BBS I;  2RIQ A;  1YJN Z;  1KC8 1;  1Z02 A;  4Y7N I;  4NB9 A;  1Q7Y 2;  4RV9 A;  1R9T I;  1Y1W I;  3U50 C;  1QVF Z;  1YUK A;  1X3Z A;  5CM2 M;  5C3E I;  2AKL A;  3HOY I;  3KIF A;  1Z03 A;  2QEX 1;  2E2I I;  3HOX I;  1SFO I;  1YI2 1;  4DGL A;  4NBC A;  3I4M I;  1VQM 1;  4HGY A;  4QTU A;  3IF8 A;  4MXU A;  1ML8 A;  2OOX B;  3J80 f;  1YIT 1;  3F3P C;  2JA7 I;  4AYB A;  3S1Q I;  3ESW A;  3CCL Z;  3CD6 Z;  1YUA A;  5A2Q f;  3NDI A;  2W04 A;  3CC2 1;  2K3R A;  2JS4 A;  3FKI I;  1VQ7 1;  3HOZ I;  1QVF Y;  1S7M A;  1QF8 A;  2DE6 A;  2Q51 A;  3GKQ A;  1VQ8 1;  4A3E I;  3D6W A;  1M1K 1;  1VQO Z;  1USP B;  2DE7 A;  3S16 I;  2QRE B;  2VUM I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...