1WIIA

Solution structure of rsgi ruh-025, a duf701 domain from mouse cdna
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
85
structure length
85
Chain Sequence
b'GSSGSSGRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0222 protein MGC4549
publication title Solution structure of RSGI RUH-025, a DUF701 domain from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 9
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.190 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1wiiA01
1WIIA
chains in the Genus database with same CATH superfamily
2HU9A 3CCVZ 2M6NA 2QREB 1L1OC 4A3CI 5IT9b 3JAMb 1ML8A 3FQMA 3J80b 3MZKB 3I07A 4NB8A 3CC21 3I4NI 5IP9I 1YUAA 2JA8I 2K3RA 4XX2A 4E2YA 2W03A 2QRCB 3GTJI 1NP6A 4RVGA 1AA6A 2AKLA 3PO3S 4A3MI 3CC4Z 2JNYA 3H0GI 1KD11 3CCEZ 3BG0B 2JIRA 2Q4ZA 1Q822 2GU2A 1VQ51 4DQYB 1VQ61 3VTNA 4MH4A 2LEXA 1P9NA 1KC82 3HOUI 2AYDA 4MD8A 3T4NB 2IV2X 4E32A 1QVFZ 1YUKA 2VPZA 1W2BZ 3VB9A 1Y8CA 3P5JB 1Q861 1W2BY 4RVHA 1YHQ1 4BBRI 1DL6A 1Z02A 1VQ7Z 1VQOZ 1VQNZ 1K731 3G71Z 3NH4A 3J7A4 5D1OA 5A2Qb 1YJNZ 2QEXZ 1NUIA 1USPA 2G2KA 3KIHA 4CL1A 3CCR1 4A3GI 2O53A 1K8A1 2NVQI 3HOYI 3S2HI 2K5RA 5FLXf 4A93I 2PK7A 4QTUA 3VMHA 3CD6Z 1S721 3CMA1 4MRIA 1Y1VI 3TDHB 1VQ91 4E31A 3EEDA 4NBFA 2OTL1 4Y52I 2Y0SA 2KPIA 4A3KI 3VMGA 3CCQZ 2OZKA 2WB1A 3HOZI 5LL6f 1JWHC 5C44I 1NJI2 3NDIA 3CXCZ 1QXFA 3BG1B 1VQMZ 2GTIA 2DE7A 2V8KA 2OOXB 3CC7Z 1VQ4Z 3M3YI 4A3EI 2P28A 1RO0A 3NH5A 3KIFA 3CPWY 2VPWA 2VPYA 3GTMS 2I3CA 1YITZ 4A3FI 1Q812 5IT9f 3JAMf 3I551 1JJ2Y 2E2JI 3J80f 2QLVB 1PFTA 2DE6A 1K9M1 1YIJZ 2NAPA 2RBLA 3CCV1 1Q7Y1 3NDJA 2IZ3A 2OTJZ 1Q16A 4E2XA 1X3ZA 1RO2A 2IZ4A 3RZOI 3J81b 2VUMI 3CCS1 3CCUZ 3S16I 1M901 2E2II 1ZH1A 1VQPZ 4A3II 4MD9A 4MONA 4A3BI 5T64A 3CCE1 2HF1A 2V3VA 4MXUA 3S1RI 3HOWI 2QA41 2JIMA 2JR6A 3GTLI 1I3QI 1KD12 3VMIA 2PMZA 3TE5B 3GCFA 3I4MI 4NBHA 5A2Qf 4NBDA 4RS4A 3IX0A 3I56Z 3S1QI 1Z01A 1VQLZ 1QVFY 5FLMI 1VQ71 3GTGI 1VQO1 2VUGA 3EERA 1VQN1 1Z03A 5AN9F 4E2WA 1K83I 3F3PC 1YJN1 1Q862 1WIIA 3GTPI 2JIPA 1VQ6Z 4E30A 1M1K1 1YJWZ 3S2DI 1TWCI 3HOXI 2E7ZA 3FKII 3CD61 4BBSI 5D1PA 4MD7A 2JA5I 1YI2Z 1ZB8A 2LIYA 3G6EZ 5C3EI 1RNIA 4RVFA 2DE5A 3G4S1 3GTMI 1YJ91 1TFIA 3S14I 2NVYI 2WAQA 3GKQA 4E2ZA 4A3LI 2LFUA 2JUBA 1VQM1 1VQ8Z 2R6MA 3CXCY 1QF8A 1S72Z 3CC71 2QR1B 4NBGA 1X0TA 2PM9A 3PO2I 4BY7I 2R93I 3CCL1 3GTOI 5C4XI 1N8R1 3CCMZ 3IFUA 5T6BA 1YIT1 2H85A 1VQK1 3CCJ1 2RIQA 4HH4A 5IP7I 1YIJ1 1I50I 3PO3I 3J81f 3GTQI 2B63I 3QWUA 2BJOA 2R92I 3D2LA 2OTJ1 2V45A 2E2HI 1VLAA 1Q7Y2 1RO4A 1TWFI 2J6AA 3OW2Z 1USPB 4AYBA 3K7AI 3CCU1 3OW2Y 2ZAEB 4E33A 4RV9A 1KQSZ 1VQP1 2YU9I 1N2FA 3F3FC 2W04A 1WW9A 1M902 4NOZA 2O4HA 3CMEZ 3CC41 3S1MI 2YADA 5C4JI 1WCMI 1FDOA 3CC2Z 4A3DI 3CCSZ 2EGTA 1SIWA 3HOVI 4RVDA 2JS4A 3ESWA 1WZNA 3RZDI 3I561 1VQL1 1Q821 2E9HA 2P3YA 1Y1WI 2NVTI 3G711 1LQLA 3D9XA 1QYPA 2F4MA 2QA4Z 1KC81 2QEX1 1R9TI 4S1TA 1VQ5Z 1YJW1 1K732 3D6WA 4NBCA 2JA7I 5CM2M 5T67A 3NH8A 4NB9A 1M1K2 4NBAA 1KRLA 1YI21 1K8A2 4A3JI 2M48A 3FQQA 3U50C 1YHQZ 3G6E1 2V8IA 2F4OA 2QKDA 2RPRA 4X6AI 3CCQ1 1FDIA 1I6HI 4HGYA 3CCRZ 2RT9A 1S7MA 2R7ZI 3NFZA 1VQ81 2KI7B 3H3VJ 2OOYB 2JA6I 2GTHA 1TWHI 4Y7NI 1TWGI 4EWCA 3CMAZ 1VQ41 1X3WA 4NBEA 3Q87A 1WJ2A 3HKZA 1VQ9Z 4QTTA 5FLXb 3CCM1 4TNUA 2OTLZ 3MONA 3G4SZ 1RQFA 1NJI1 1YJ9Z 2NVXI 1TWAI 2JMOA 3IR7A 4BY1I 1N8R2 4DK1A 3IF8A 4BXXI 1QVGZ 3LUSA 1QVGY 1RLYA 3M4OI 3S15I 2JIOA 2VF1A 1K9M2 4HGZA 3MZLB 3GTKI 1Y1VS 3CQZI 2V8JA 4NH1C 3CPWZ 4DGLA 5D1OB 2RHBA 3S17I 3CCLZ 1Q811 3S1NI 2JIQA 1SFOI 1JJ2Z 1ZB9A 1VQKZ 2QRDB 4NBBA 3CCJZ 2Q51A 4NFRA 1KQSY 3I55Z 2VPXA 3CME1
chains in the Genus database with same CATH topology
2HU9A 3CCVZ 2M6NA 2QREB 1L1OC 4A3CI 5IT9b 3JAMb 1ML8A 3FQMA 3J80b 3MZKB 3I07A 4NB8A 3CC21 3I4NI 5IP9I 1YUAA 2JA8I 2K3RA 4XX2A 4E2YA 2W03A 2QRCB 1NP6A 4RVGA 3GTJI 2AKLA 3PO3S 4A3MI 3CC4Z 2JNYA 3H0GI 1KD11 3CCEZ 3BG0B 2Q4ZA 1Q822 2GU2A 1VQ51 4DQYB 1VQ61 3VTNA 4MH4A 1P9NA 1KC82 3HOUI 4MD8A 3T4NB 4E32A 1QVFZ 1YUKA 1W2BZ 3VB9A 3P5JB 1Q861 1W2BY 4RVHA 1YHQ1 4BBRI 1DL6A 1Z02A 1VQ7Z 1VQOZ 1VQNZ 1K731 3G71Z 3NH4A 3J7A4 5D1OA 5A2Qb 1YJNZ 2QEXZ 1NUIA 1USPA 2G2KA 3KIHA 4CL1A 3CCR1 4A3GI 2O53A 1K8A1 2NVQI 3HOYI 3S2HI 2K5RA 5FLXf 4A93I 2PK7A 4QTUA 3VMHA 3CD6Z 1S721 3CMA1 4MRIA 1Y1VI 3TDHB 1VQ91 4E31A 3EEDA 4NBFA 2OTL1 4Y52I 2Y0SA 2KPIA 4A3KI 3VMGA 3CCQZ 2OZKA 2WB1A 3HOZI 5LL6f 1JWHC 5C44I 1NJI2 3NDIA 3CXCZ 3BG1B 1VQMZ 2GTIA 2DE7A 2V8KA 2OOXB 3CC7Z 1VQ4Z 3M3YI 4A3EI 2P28A 1RO0A 3NH5A 3KIFA 3CPWY 3GTMS 2I3CA 1YITZ 4A3FI 1Q812 5IT9f 3JAMf 3I551 1JJ2Y 2E2JI 3J80f 2QLVB 1PFTA 2DE6A 1K9M1 1YIJZ 2RBLA 3CCV1 1Q7Y1 3NDJA 2IZ3A 2OTJZ 4E2XA 1X3ZA 1RO2A 2IZ4A 3RZOI 3J81b 2VUMI 3CCS1 3CCUZ 3S16I 1M901 2E2II 1ZH1A 1VQPZ 4A3II 4MD9A 4MONA 4A3BI 5T64A 3CCE1 2HF1A 4MXUA 3S1RI 3HOWI 2QA41 2JR6A 3GTLI 1I3QI 1KD12 3VMIA 2PMZA 3TE5B 3GCFA 3I4MI 4NBHA 5A2Qf 4NBDA 4RS4A 3IX0A 3I56Z 3S1QI 1Z01A 1VQLZ 1QVFY 5FLMI 1VQ71 3GTGI 1VQO1 2VUGA 3EERA 1VQN1 1Z03A 5AN9F 4E2WA 1K83I 3F3PC 1YJN1 1Q862 1WIIA 3GTPI 1VQ6Z 4E30A 1M1K1 1YJWZ 3S2DI 1TWCI 3HOXI 3FKII 3CD61 4BBSI 5D1PA 4MD7A 2JA5I 1YI2Z 1ZB8A 2LIYA 3G6EZ 5C3EI 1RNIA 4RVFA 2DE5A 3G4S1 3GTMI 1YJ91 1TFIA 3S14I 2NVYI 2WAQA 3GKQA 4E2ZA 4A3LI 2LFUA 2JUBA 1VQM1 1VQ8Z 2R6MA 3CXCY 1QF8A 1S72Z 3CC71 2QR1B 4NBGA 1X0TA 2PM9A 3PO2I 4BY7I 2R93I 3CCL1 3GTOI 5C4XI 1N8R1 3CCMZ 3IFUA 5T6BA 1YIT1 2H85A 1VQK1 3CCJ1 2RIQA 4HH4A 5IP7I 1YIJ1 1I50I 3PO3I 3J81f 3GTQI 2B63I 3QWUA 2BJOA 2R92I 2OTJ1 2E2HI 1VLAA 1Q7Y2 1RO4A 1TWFI 2J6AA 3OW2Z 1USPB 4AYBA 3K7AI 3CCU1 3OW2Y 2ZAEB 4E33A 4RV9A 1KQSZ 1VQP1 2YU9I 1N2FA 3F3FC 2W04A 1WW9A 1M902 4NOZA 2O4HA 3CMEZ 3CC41 3S1MI 2YADA 5C4JI 1WCMI 3CC2Z 4A3DI 3CCSZ 2EGTA 3HOVI 4RVDA 2JS4A 3ESWA 3RZDI 3I561 1VQL1 1Q821 2E9HA 2P3YA 1Y1WI 2NVTI 3G711 1LQLA 3D9XA 1QYPA 2F4MA 2QA4Z 1KC81 2QEX1 1R9TI 4S1TA 1VQ5Z 1YJW1 1K732 3D6WA 4NBCA 2JA7I 5CM2M 5T67A 3NH8A 4NB9A 1M1K2 4NBAA 1KRLA 1YI21 1K8A2 4A3JI 2M48A 3FQQA 3U50C 1YHQZ 3G6E1 2V8IA 2F4OA 2QKDA 2RPRA 4X6AI 3CCQ1 1I6HI 4HGYA 3CCRZ 2RT9A 1S7MA 2R7ZI 3NFZA 1VQ81 2KI7B 3H3VJ 2OOYB 2JA6I 2GTHA 1TWHI 4Y7NI 1TWGI 4EWCA 3CMAZ 1VQ41 1X3WA 4NBEA 3Q87A 3HKZA 1VQ9Z 4QTTA 5FLXb 3CCM1 4TNUA 2OTLZ 3MONA 3G4SZ 1RQFA 1NJI1 1YJ9Z 2NVXI 1TWAI 2JMOA 4BY1I 1N8R2 4DK1A 3IF8A 4BXXI 1QVGZ 3LUSA 1QVGY 1RLYA 3M4OI 3S15I 2VF1A 1K9M2 4HGZA 3MZLB 3GTKI 1Y1VS 3CQZI 2V8JA 4NH1C 3CPWZ 4DGLA 5D1OB 2RHBA 3S17I 3CCLZ 1Q811 3S1NI 1SFOI 1JJ2Z 1ZB9A 1VQKZ 2QRDB 4NBBA 3CCJZ 2Q51A 4NFRA 1KQSY 3I55Z 3CME1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WII A; 
#chains in the Genus database with same CATH topology
 2HU9 A;  3CCV Z;  2M6N A;  2QRE B;  1L1O C;  4A3C I;  5IT9 b;  3JAM b;  1ML8 A;  3FQM A;  3J80 b;  3MZK B;  3I07 A;  4NB8 A;  3CC2 1;  3I4N I;  5IP9 I;  1YUA A;  2JA8 I;  2K3R A;  4XX2 A;  4E2Y A;  2W03 A;  2QRC B;  3GTJ I;  1NP6 A;  4RVG A;  1AA6 A;  2AKL A;  3PO3 S;  4A3M I;  3CC4 Z;  2JNY A;  3H0G I;  1KD1 1;  3CCE Z;  3BG0 B;  2JIR A;  2Q4Z A;  1Q82 2;  2GU2 A;  1VQ5 1;  4DQY B;  1VQ6 1;  3VTN A;  4MH4 A;  2LEX A;  1P9N A;  1KC8 2;  3HOU I;  2AYD A;  4MD8 A;  3T4N B;  2IV2 X;  4E32 A;  1QVF Z;  1YUK A;  2VPZ A;  1W2B Z;  3VB9 A;  1Y8C A;  3P5J B;  1Q86 1;  1W2B Y;  4RVH A;  1YHQ 1;  4BBR I;  1DL6 A;  1Z02 A;  1VQ7 Z;  1VQO Z;  1VQN Z;  1K73 1;  3G71 Z;  3NH4 A;  3J7A 4;  5D1O A;  5A2Q b;  1YJN Z;  2QEX Z;  1NUI A;  1USP A;  2G2K A;  3KIH A;  4CL1 A;  3CCR 1;  4A3G I;  2O53 A;  1K8A 1;  2NVQ I;  3HOY I;  3S2H I;  2K5R A;  5FLX f;  4A93 I;  2PK7 A;  4QTU A;  3VMH A;  3CD6 Z;  1S72 1;  3CMA 1;  4MRI A;  1Y1V I;  3TDH B;  1VQ9 1;  4E31 A;  3EED A;  4NBF A;  2OTL 1;  4Y52 I;  2Y0S A;  2KPI A;  4A3K I;  3VMG A;  3CCQ Z;  2OZK A;  2WB1 A;  3HOZ I;  5LL6 f;  1JWH C;  5C44 I;  1NJI 2;  3NDI A;  3CXC Z;  1QXF A;  3BG1 B;  1VQM Z;  2GTI A;  2DE7 A;  2V8K A;  2OOX B;  3CC7 Z;  1VQ4 Z;  3M3Y I;  4A3E I;  2P28 A;  1RO0 A;  3NH5 A;  3KIF A;  3CPW Y;  2VPW A;  2VPY A;  3GTM S;  2I3C A;  1YIT Z;  4A3F I;  1Q81 2;  5IT9 f;  3JAM f;  3I55 1;  1JJ2 Y;  2E2J I;  3J80 f;  2QLV B;  1PFT A;  2DE6 A;  1K9M 1;  1YIJ Z;  2NAP A;  2RBL A;  3CCV 1;  1Q7Y 1;  3NDJ A;  2IZ3 A;  2OTJ Z;  1Q16 A;  4E2X A;  1X3Z A;  1RO2 A;  2IZ4 A;  3RZO I;  3J81 b;  2VUM I;  3CCS 1;  3CCU Z;  3S16 I;  1M90 1;  2E2I I;  1ZH1 A;  1VQP Z;  4A3I I;  4MD9 A;  4MON A;  4A3B I;  5T64 A;  3CCE 1;  2HF1 A;  2V3V A;  4MXU A;  3S1R I;  3HOW I;  2QA4 1;  2JIM A;  2JR6 A;  3GTL I;  1I3Q I;  1KD1 2;  3VMI A;  2PMZ A;  3TE5 B;  3GCF A;  3I4M I;  4NBH A;  5A2Q f;  4NBD A;  4RS4 A;  3IX0 A;  3I56 Z;  3S1Q I;  1Z01 A;  1VQL Z;  1QVF Y;  5FLM I;  1VQ7 1;  3GTG I;  1VQO 1;  2VUG A;  3EER A;  1VQN 1;  1Z03 A;  5AN9 F;  4E2W A;  1K83 I;  3F3P C;  1YJN 1;  1Q86 2;  1WII A;  3GTP I;  2JIP A;  1VQ6 Z;  4E30 A;  1M1K 1;  1YJW Z;  3S2D I;  1TWC I;  3HOX I;  2E7Z A;  3FKI I;  3CD6 1;  4BBS I;  5D1P A;  4MD7 A;  2JA5 I;  1YI2 Z;  1ZB8 A;  2LIY A;  3G6E Z;  5C3E I;  1RNI A;  4RVF A;  2DE5 A;  3G4S 1;  3GTM I;  1YJ9 1;  1TFI A;  3S14 I;  2NVY I;  2WAQ A;  3GKQ A;  4E2Z A;  4A3L I;  2LFU A;  2JUB A;  1VQM 1;  1VQ8 Z;  2R6M A;  3CXC Y;  1QF8 A;  1S72 Z;  3CC7 1;  2QR1 B;  4NBG A;  1X0T A;  2PM9 A;  3PO2 I;  4BY7 I;  2R93 I;  3CCL 1;  3GTO I;  5C4X I;  1N8R 1;  3CCM Z;  3IFU A;  5T6B A;  1YIT 1;  2H85 A;  1VQK 1;  3CCJ 1;  2RIQ A;  4HH4 A;  5IP7 I;  1YIJ 1;  1I50 I;  3PO3 I;  3J81 f;  3GTQ I;  2B63 I;  3QWU A;  2BJO A;  2R92 I;  3D2L A;  2OTJ 1;  2V45 A;  2E2H I;  1VLA A;  1Q7Y 2;  1RO4 A;  1TWF I;  2J6A A;  3OW2 Z;  1USP B;  4AYB A;  3K7A I;  3CCU 1;  3OW2 Y;  2ZAE B;  4E33 A;  4RV9 A;  1KQS Z;  1VQP 1;  2YU9 I;  1N2F A;  3F3F C;  2W04 A;  1WW9 A;  1M90 2;  4NOZ A;  2O4H A;  3CME Z;  3CC4 1;  3S1M I;  2YAD A;  5C4J I;  1WCM I;  1FDO A;  3CC2 Z;  4A3D I;  3CCS Z;  2EGT A;  1SIW A;  3HOV I;  4RVD A;  2JS4 A;  3ESW A;  1WZN A;  3RZD I;  3I56 1;  1VQL 1;  1Q82 1;  2E9H A;  2P3Y A;  1Y1W I;  2NVT I;  3G71 1;  1LQL A;  3D9X A;  1QYP A;  2F4M A;  2QA4 Z;  1KC8 1;  2QEX 1;  1R9T I;  4S1T A;  1VQ5 Z;  1YJW 1;  1K73 2;  3D6W A;  4NBC A;  2JA7 I;  5CM2 M;  5T67 A;  3NH8 A;  4NB9 A;  1M1K 2;  4NBA A;  1KRL A;  1YI2 1;  1K8A 2;  4A3J I;  2M48 A;  3FQQ A;  3U50 C;  1YHQ Z;  3G6E 1;  2V8I A;  2F4O A;  2QKD A;  2RPR A;  4X6A I;  3CCQ 1;  1FDI A;  1I6H I;  4HGY A;  3CCR Z;  2RT9 A;  1S7M A;  2R7Z I;  3NFZ A;  1VQ8 1;  2KI7 B;  3H3V J;  2OOY B;  2JA6 I;  2GTH A;  1TWH I;  4Y7N I;  1TWG I;  4EWC A;  3CMA Z;  1VQ4 1;  1X3W A;  4NBE A;  3Q87 A;  1WJ2 A;  3HKZ A;  1VQ9 Z;  4QTT A;  5FLX b;  3CCM 1;  4TNU A;  2OTL Z;  3MON A;  3G4S Z;  1RQF A;  1NJI 1;  1YJ9 Z;  2NVX I;  1TWA I;  2JMO A;  3IR7 A;  4BY1 I;  1N8R 2;  4DK1 A;  3IF8 A;  4BXX I;  1QVG Z;  3LUS A;  1QVG Y;  1RLY A;  3M4O I;  3S15 I;  2JIO A;  2VF1 A;  1K9M 2;  4HGZ A;  3MZL B;  3GTK I;  1Y1V S;  3CQZ I;  2V8J A;  4NH1 C;  3CPW Z;  4DGL A;  5D1O B;  2RHB A;  3S17 I;  3CCL Z;  1Q81 1;  3S1N I;  2JIQ A;  1SFO I;  1JJ2 Z;  1ZB9 A;  1VQK Z;  2QRD B;  4NBB A;  3CCJ Z;  2Q51 A;  4NFR A;  1KQS Y;  3I55 Z;  2VPX A;  3CME 1; 
#chains in the Genus database with same CATH homology
 2HU9 A;  3CCV Z;  2M6N A;  2QRE B;  1L1O C;  4A3C I;  5IT9 b;  3JAM b;  1ML8 A;  3FQM A;  3J80 b;  3MZK B;  3I07 A;  4NB8 A;  3CC2 1;  3I4N I;  5IP9 I;  1YUA A;  2JA8 I;  2K3R A;  4XX2 A;  4E2Y A;  2W03 A;  2QRC B;  1NP6 A;  4RVG A;  3GTJ I;  2AKL A;  3PO3 S;  4A3M I;  3CC4 Z;  2JNY A;  3H0G I;  1KD1 1;  3CCE Z;  3BG0 B;  2Q4Z A;  1Q82 2;  2GU2 A;  1VQ5 1;  4DQY B;  1VQ6 1;  3VTN A;  4MH4 A;  1P9N A;  1KC8 2;  3HOU I;  4MD8 A;  3T4N B;  4E32 A;  1QVF Z;  1YUK A;  1W2B Z;  3VB9 A;  3P5J B;  1Q86 1;  1W2B Y;  4RVH A;  1YHQ 1;  4BBR I;  1DL6 A;  1Z02 A;  1VQ7 Z;  1VQO Z;  1VQN Z;  1K73 1;  3G71 Z;  3NH4 A;  3J7A 4;  5D1O A;  5A2Q b;  1YJN Z;  2QEX Z;  1NUI A;  1USP A;  2G2K A;  3KIH A;  4CL1 A;  3CCR 1;  4A3G I;  2O53 A;  1K8A 1;  2NVQ I;  3HOY I;  3S2H I;  2K5R A;  5FLX f;  4A93 I;  2PK7 A;  4QTU A;  3VMH A;  3CD6 Z;  1S72 1;  3CMA 1;  4MRI A;  1Y1V I;  3TDH B;  1VQ9 1;  4E31 A;  3EED A;  4NBF A;  2OTL 1;  4Y52 I;  2Y0S A;  2KPI A;  4A3K I;  3VMG A;  3CCQ Z;  2OZK A;  2WB1 A;  3HOZ I;  5LL6 f;  1JWH C;  5C44 I;  1NJI 2;  3NDI A;  3CXC Z;  3BG1 B;  1VQM Z;  2GTI A;  2DE7 A;  2V8K A;  2OOX B;  3CC7 Z;  1VQ4 Z;  3M3Y I;  4A3E I;  2P28 A;  1RO0 A;  3NH5 A;  3KIF A;  3CPW Y;  3GTM S;  2I3C A;  1YIT Z;  4A3F I;  1Q81 2;  5IT9 f;  3JAM f;  3I55 1;  1JJ2 Y;  2E2J I;  3J80 f;  2QLV B;  1PFT A;  2DE6 A;  1K9M 1;  1YIJ Z;  2RBL A;  3CCV 1;  1Q7Y 1;  3NDJ A;  2IZ3 A;  2OTJ Z;  4E2X A;  1X3Z A;  1RO2 A;  2IZ4 A;  3RZO I;  3J81 b;  2VUM I;  3CCS 1;  3CCU Z;  3S16 I;  1M90 1;  2E2I I;  1ZH1 A;  1VQP Z;  4A3I I;  4MD9 A;  4MON A;  4A3B I;  5T64 A;  3CCE 1;  2HF1 A;  4MXU A;  3S1R I;  3HOW I;  2QA4 1;  2JR6 A;  3GTL I;  1I3Q I;  1KD1 2;  3VMI A;  2PMZ A;  3TE5 B;  3GCF A;  3I4M I;  4NBH A;  5A2Q f;  4NBD A;  4RS4 A;  3IX0 A;  3I56 Z;  3S1Q I;  1Z01 A;  1VQL Z;  1QVF Y;  5FLM I;  1VQ7 1;  3GTG I;  1VQO 1;  2VUG A;  3EER A;  1VQN 1;  1Z03 A;  5AN9 F;  4E2W A;  1K83 I;  3F3P C;  1YJN 1;  1Q86 2;  1WII A;  3GTP I;  1VQ6 Z;  4E30 A;  1M1K 1;  1YJW Z;  3S2D I;  1TWC I;  3HOX I;  3FKI I;  3CD6 1;  4BBS I;  5D1P A;  4MD7 A;  2JA5 I;  1YI2 Z;  1ZB8 A;  2LIY A;  3G6E Z;  5C3E I;  1RNI A;  4RVF A;  2DE5 A;  3G4S 1;  3GTM I;  1YJ9 1;  1TFI A;  3S14 I;  2NVY I;  2WAQ A;  3GKQ A;  4E2Z A;  4A3L I;  2LFU A;  2JUB A;  1VQM 1;  1VQ8 Z;  2R6M A;  3CXC Y;  1QF8 A;  1S72 Z;  3CC7 1;  2QR1 B;  4NBG A;  1X0T A;  2PM9 A;  3PO2 I;  4BY7 I;  2R93 I;  3CCL 1;  3GTO I;  5C4X I;  1N8R 1;  3CCM Z;  3IFU A;  5T6B A;  1YIT 1;  2H85 A;  1VQK 1;  3CCJ 1;  2RIQ A;  4HH4 A;  5IP7 I;  1YIJ 1;  1I50 I;  3PO3 I;  3J81 f;  3GTQ I;  2B63 I;  3QWU A;  2BJO A;  2R92 I;  2OTJ 1;  2E2H I;  1VLA A;  1Q7Y 2;  1RO4 A;  1TWF I;  2J6A A;  3OW2 Z;  1USP B;  4AYB A;  3K7A I;  3CCU 1;  3OW2 Y;  2ZAE B;  4E33 A;  4RV9 A;  1KQS Z;  1VQP 1;  2YU9 I;  1N2F A;  3F3F C;  2W04 A;  1WW9 A;  1M90 2;  4NOZ A;  2O4H A;  3CME Z;  3CC4 1;  3S1M I;  2YAD A;  5C4J I;  1WCM I;  3CC2 Z;  4A3D I;  3CCS Z;  2EGT A;  3HOV I;  4RVD A;  2JS4 A;  3ESW A;  3RZD I;  3I56 1;  1VQL 1;  1Q82 1;  2E9H A;  2P3Y A;  1Y1W I;  2NVT I;  3G71 1;  1LQL A;  3D9X A;  1QYP A;  2F4M A;  2QA4 Z;  1KC8 1;  2QEX 1;  1R9T I;  4S1T A;  1VQ5 Z;  1YJW 1;  1K73 2;  3D6W A;  4NBC A;  2JA7 I;  5CM2 M;  5T67 A;  3NH8 A;  4NB9 A;  1M1K 2;  4NBA A;  1KRL A;  1YI2 1;  1K8A 2;  4A3J I;  2M48 A;  3FQQ A;  3U50 C;  1YHQ Z;  3G6E 1;  2V8I A;  2F4O A;  2QKD A;  2RPR A;  4X6A I;  3CCQ 1;  1I6H I;  4HGY A;  3CCR Z;  2RT9 A;  1S7M A;  2R7Z I;  3NFZ A;  1VQ8 1;  2KI7 B;  3H3V J;  2OOY B;  2JA6 I;  2GTH A;  1TWH I;  4Y7N I;  1TWG I;  4EWC A;  3CMA Z;  1VQ4 1;  1X3W A;  4NBE A;  3Q87 A;  3HKZ A;  1VQ9 Z;  4QTT A;  5FLX b;  3CCM 1;  4TNU A;  2OTL Z;  3MON A;  3G4S Z;  1RQF A;  1NJI 1;  1YJ9 Z;  2NVX I;  1TWA I;  2JMO A;  4BY1 I;  1N8R 2;  4DK1 A;  3IF8 A;  4BXX I;  1QVG Z;  3LUS A;  1QVG Y;  1RLY A;  3M4O I;  3S15 I;  2VF1 A;  1K9M 2;  4HGZ A;  3MZL B;  3GTK I;  1Y1V S;  3CQZ I;  2V8J A;  4NH1 C;  3CPW Z;  4DGL A;  5D1O B;  2RHB A;  3S17 I;  3CCL Z;  1Q81 1;  3S1N I;  1SFO I;  1JJ2 Z;  1ZB9 A;  1VQK Z;  2QRD B;  4NBB A;  3CCJ Z;  2Q51 A;  4NFR A;  1KQS Y;  3I55 Z;  3CME 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...