1X0TA

Crystal structure of ribonuclease p protein ph1601p from pyrococcus horikoshii ot3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
IVKRRDWEKKEKKKIAIERIDTLFTLAERVARYSPDLAKRYVELALEIQKKAKVKIPRKWKRRYCKRCHTFLIPGVNARVRLRTKRMPHVVITCLECGYIMRYPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 4
publication title Crystal Structure of a Ribonuclease P Protein Ph1601p from Pyrococcus horikoshii OT3: An Archaeal Homologue of Human Nuclear Ribonuclease P Protein Rpp21(,)
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 33
structure length 106
sequence length 106
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2005-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1x0tA01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1x0tA02
5C39A 1EDIA 3RGUA 1S3JA 1FC2C 2K3RA 1OVVA 4WWIA 1JM0A 2SPZA 1LP1A 2R44A 2I8DA 1EDKA 3MZWB 4NPDA 2ZAEB 4GODA 1H0TA 1OVUA 1H0TB 4HJGH 4HKZH 4ASWA 2KIKA 5K5GB 4IOIH 1EDLA 2P58A 5EFWB 5DJUB 3S1KA 2HR3A 2WMMA 1BDDA 2B87B 1MFTA 1EC5A 1DEEG 1LT1A 5CBNA 4ASVA 2QVAA 4EYYQ 1U7MA 4NPEA 2Q1KA 2OTKE 4KJMA 2KI7B 2B89A 2KUBA 4ZMDA 5DJTB 4MN4C 3QWOC 1ZXGA 4BXLA 4K35A 2LR2A 2B87A 4K3AA 1X0TA 2KS1B 1OVRA 2QRXA 1U7JA 4HB1A 3ZDMA 3FXEA 2LXCB 3MHVA 4NPFX 4JBZA 1EDJA 1NVOA 2UWJE 3PH0A 2RKLA 3FXDA 2LXBA 4ZNCA 2KZJA 1Q2NA 1ZW0A 1SS1A 1BDCA 1JMBA 1LP1B 2M0BA 2M5AA 5CBOA 2M5AB 4GOEA 2B88A 4CPGA 2JWDA 2KZIA 4GOFA 1Y47A
chains in the Genus database with same CATH superfamily
1YJ9Z 2K88A 3P8MC 4PJ0H 3B5NC 3GHGB 1T3UA 1VQ5Z 2AXTE 3CX5H 5A2Qb 2R44A 2WT7A 1LTGC 1OVUA 3KXDA 1QX8A 3WUVA 5D1PA 5E79E 3CCQZ 2JEEA 1RY3A 1SQPE 3USSA 3NDJA 1AQTA 1DD3A 1JWHC 2Q51A 1Q811 4NOZA 3AE1C 1JY2N 1SFCD 3M0DC 3GHGC 4RKUJ 1NKZB 2LEXA 1KYOI 4A3GI 4KJMA 3CXHD 2FYUG 4M3LA 4ZMDA 3BRTB 4MN4C 3S15I 4JQ0D 5KKZB 1KILB 2RH0A 3OJAB 3TSIA 2PK7A 1ZN5A 1P84H 3CME1 3D6ZA 2K5RA 2JA6I 1RF0A 3GW6A 4H13B 4E33A 2KB7P 2J58A 4A3LI 5AW6B 1Q86Q 3EERA 5AVQB 5KLVG 2IBZE 3P8CD 1I6HI 1SFCB 2KYVA 3JCUH 1PIXA 2B63I 2WPSA 3VTPC 3L36A 1KILC 5KKZC 3WUUA 1FOSF 2E7ZA 2QREB 3S1QI 1BDCA 3H1JE 4Y99B 2ZXEB 1WZNA 1ZH1A 2O01J 1H88A 3H1KG 4H13C 2JWDA 1N2DC 3RZOI 4A93I 4XE5B 4JPZB 3TNUB 3MGNA 1MZ9A 1N8R1 1LTAC 1SFCC 4C7RA 2JA7I 2C9NY 2K3RA 1VQKZ 3ABVC 1X8YA 4Y99C 1NWQA 1KQFB 2ITAA 5K5GB 1IFJA 4IL6E 5AVWB 1BCCE 3KHUA 1L0NG 3Q5SA 3MUDC 3V2RA 1RH5B 3V2PA 2YXQB 3CXHI 1YUAA 3TE5B 1SVFA 3JAMf 3IFUA 1G1IA 3MP7B 3V6IA 1PPJE 4NBCA 5D1OB 1X3WA 5AVYB 4IFDK 4IFFA 2KI7B 2DE5A 3AECC 4O9BA 5KAIH 5GTHE 1GDTA 1M7LA 2IV2X 1YHQ1 1A02F 2GUSA 3L74G 1I3QI 2Q7CA 4L76A 2IZ0A 2R5DA 4KT0J 4YTPC 5H2FH 5FLXf 1NVOA 1T3JA 2Y0CA 2W6BA 3CCLZ 2JMOA 2RPRA 1VPCA 3GTKI 1M1K2 3CMEZ 2A45G 2FYNC 1N2FA 2QM8A 1RF1B 2QA4P 1N73B 2K9JB 2C0XA 1VDFA 5A2Qf 2R3CA 2FYUE 1EXIA 2JP3A 3AE7C 2JR6A 4E2XA 2R93I 1FC2C 4A3FI 1SQXD 1Q822 3S1NI 1Q7Y1 3AEAC 4NPDA 2QJKB 2ZAEB 1RF1C 1PGJA 3IN6A 5KLVE 1SQXJ 2D2CC 1N73C 1EXJA 1QXFA 1S721 1LTJA 1TWFI 4HH2A 1KC8Q 2J59M 1RE3A 3Q1MA 4HYTB 3H3VJ 2QE7H 3U1CA 1BE3G 1VL2A 3BCCJ 2P67A 3HTKA 4E30A 1N7SD 4OH8B 2K9YA 4ASVA 3QH9A 1LQLA 3O6QA 4NBGA 4NPEA 2QJKC 2PRRA 2FFDB 1EQ7A 2JKVA 2VPWA 1PP9G 4QMAA 5AVSB 3V2QA 3AEGC 4A3EI 2R7ZI 3RZDI 1H89A 5LL6f 3M3YI 2NPSA 1KB9H 1GU4A 2WSSH 3FXEA 1ZR2A 4WBAA 3KQGA 1KZUB 2WSFJ 1L0NE 2UWJE 3H1HE 1KQSZ 3RL0C 2FFDC 1NTZD 1N7SB 2N1TA 2YMYA 1AJYA 1YHQZ 1FZBA 3VMYA 3HOWI 3GLMA 3CCM1 2ZVOB 3H1ID 4D6TE 5CCHA 1NTZJ 2I3CA 3N7NA 2E75D 1RNIA 3AE8C 4GOEA 2H43A 1G2CB 2O01N 3H1IJ 2IZ1A 3IFMA 1IJDB 3A0BH 2AKLA 1Y1WI 3VTNA 3L72G 2IX7C 2POHA 2V7QJ 3L71G 2PGDA 5AW2B 2M48A 3D2LA 3CC4P 1OVVA 1BGYD 3CCJP 1USPA 1JO5A 1VQLP 1SQVD 1QL2A 3VMZA 1LWUB 1R9TI 1PGOA 1BGYJ 4WY4D 3PHLA 1FU1A 1L4AA 1EDLA 3KZIE 2Z5IA 4UB6H 5KAFH 4R4MA 1SQVJ 1EZVD 5KJ7A 2FXMA 4DK1A 2KSEA 1FOSE 2JIOA 1KYOH 3S1MI 3D70A 2HLOA 3M91A 3S16I 4EOTA 4E2ZA 3CCV1 5CBNA 3Q5RA 4RVGA 3PTZA 1S72Z 5CHXA 5CCGA 1VQ8P 3NH4A 2O3JA 2OTKE 1LWUC 3I4MI 3L75G 4E31A 3PJSK 2VUGA 1CI6A 4A7PA 2B87A 4PV1D 5CM2M 2ZVNB 5FLMI 3CXCZ 1QVGZ 1ZLLA 2O1KA 2V8IA 4QTTA 1WRGA 2LXCB 3MZKB 3U50C 2KLUA 2QA41 3BRVB 3JC22 5IP7I 2LXBA 3HE4A 1YI21 1NAFA 1NH4A 1ZW0A 5L8RJ 3S2DI 1MFZA 1RHZB 1Q81Q 2M0BA 5CBOA 1RQUA 2E76D 3LIDA 2V8KA 1GL2D 3CD6P 2KXPB 2R92I 3WU2E 5TISE 5CMZA 1KV4A 1KC81 3HD7A 4IL6X 3NDIA 1YITP 3PRJA 3BVHA 3B4SA 4AUWA 3K7AI 1LNQA 1KB9D 1H0TA 1H8AA 1URQB 4HJGH 1QLED 3L74D 1T6AA 3CXHH 1SQXK 1KFMA 4C46A 4A3DI 2WTYA 1NTKG 1GL2B 1NU1G 1QGKB 1SP4A 1QL1A 2FXOA 2E2JI 1M902 2ZXXA 1KRLA 1ZR4A 1KILE 4H44B 2XV5A 3GTPI 1ZOYC 2M3BA 3HE5A 1FDMA 1URQC 1K9M2 1XTCC 2J5UA 4L75A 3L71E 2IBZG 5BU5A 1RQVA 2H89C 5C4JI 4R4LA 1YTZT 4RS4A 1S5LX 1GL2C 2PFXA 5APXA 3EFGA 3CCVZ 3H1JG 2MJZA 4E2WA 1MUUA 3HOXI 1SFOI 2OOYB 2YXRB 4Y28J 1IFDA 4H44C 4JYCA 4MONA 1OW8A 4NBDA 3MIWA 4I7ZB 2W6AA 3L73J 1JMBA 2ZT9D 1FJPA 4L74A 2WT7B 3CC41 1AA0A 4CPGA 4UB8E 1NTZK 3CCJ1 2QA4Z 4GOFA 1VQL1 3P8CE 2OTL1 1BE3D 1S3JA 2V4HA 2QKDA 2DW3A 3CCUP 4I7ZC 4DQYB 2WWWA 2BJOA 5E79H 3T97A 2N9BA 2YU9I 4W7YA 2Q9IA 1PPJG 4KHXA 5AVTB 2RBLA 1Q82Q 3FQQA 3H0GI 2ZT9B 1LT9A 5CJ4A 1MV8A 5AW1B 4RESB 5T67A 2HR3A 3L70G 1IK9A 1VQ81 3Q87A 4OGQD 2A45I 1Z01A 2W27A 1SQVK 1VQO1 3BG1B 2H7HA 1DEBA 2NVQI 3E7KA 1PFIA 3P32A 3VP8A 1WW9A 1Y1VS 1QVFZ 1ZB8A 2ZT9C 2Q3IA 1RO4A 3CMA1 2EGTA 3RBZA 3Q5PA 4U7JA 1OWAA 3WUTA 3MZLB 1SQQD 2VPXA 2KPIA 3F3FC 2KS1A 2HPCB 1X0TA 1L0LD 1Q7YQ 1S72P 1FZFA 1K731 2E74D 4OGQB 3H1LD 1SQQJ 1W2EA 5IP9I 3PH0A 1L0LJ 4JF7A 3B5NA 1JY2P 1NTMG 2FKWB 1NTKE 3CD61 1JOCA 2E42A 2I1KA 4C7NA 1NU1E 3SFDC 4W7ZA 3H1LJ 1FDIA 3I4NI 4PJ0E 1SQBD 3OW2Y 1AVOA 2A06D 5B5EH 2CPBA 2M5AB 4HGZA 1YIT1 3CX5E 2OYHB 2JIMA 4PD4D 4RV9A 2KNCB 3TGUD 1SQBJ 4LLHA 2BCCD 1IC2A 3A0HH 1Y47A 1VQMP 3FWLA 3TGUJ 2OGUA 1K732 2BCCJ 2HODB 3GHGA 2NRGA 3M0DA 5AW7B 2VUMI 2JR8A 2YNYA 1NP6A 3CC4Z 2YKQA 1HJBA 2C0WA 5T6BA 4IL6H 5C44I 4HKZH 2OYHC 3CWBD 3CCJZ 2WPQA 2M6NA 1VQLZ 2P58A 2P2UA 2JUBA 3AEFC 3I56P 3CCMP 5T64A 3J81b 2PMZA 2I1JA 3CWBJ 4XX2A 2W04A 2Y0DA 2NVXI 1P84E 1SQXE 3KDPB 2WSFH 2JO1A 3I551 3AE6C 1LT1A 1VF5D 4EYYQ 4DZOA 5AW8B 2GM4A 1NJI2 2KUBA 1KILA 1BSNA 3C8VA 1ZXGA 4NBHA 3H1HG 3SWKA 1VQ8Z 3BCCE 1LTIC 2PAJA 3JCUE 1YJWP 2N9YB 4K3AA 1VQOZ 3AEBC 3OA7A 1YJNP 4I6MC 3ZDMA 4D6TG 2OARA 1M1K1 2V7QH 4E32A 2HU9A 1SQPD 2RKLA 4YXDC 1S5LH 3SSUA 1SFCA 2OQQA 4PD4I 3L70E 1J1EB 1WIIA 1VF5B 4NBBA 1YTZI 3CMAZ 3CPWY 2YMKA 2AYDA 4TLFA 3CCVP 1HUCA 1SQPJ 1UIIA 3A3YB 1HTLC 4NBAA 3PO3I 1GZLA 1GU5A 3I5CA 4A3JI 3F3PC 1FZAA 1S7MA 3CCU1 1KTMA 1Q821 1W2BZ 1U57A 1JUNA 1OW6A 2ZJSE 3MUDA 3TNUA 3S17I 2NPSD 3CD6Z 5C39A 3VMGA 3IX0A 1NTZE 1KD12 2JNYA 4GKGA 1HF9A 1J1EC 1VF5C 3G3ZA 4BRYB 3HRNA 2WITA 1LP1A 1X79B 1YITZ 1JB0J 2N1TD 2ZYDA 4OVNF 1JY3O 4B86A 1QYPA 2VRSA 4AYCA 1YI2P 1ZRTE 1Q90D 1NTME 4A3MI 5CCHD 3S1KA 4NB8A 5KAIE 3HUSB 2LIYA 3RL0g 3KIHA 1TWHI 1DD4A 3VN0A 1RE3C 3H1JD 4XA4A 4ZKUA 2XZRA 1BGYE 2NPSB 3VYIA 4NFRA 3A7OA 1HJ0A 1YQ3C 3H25A 1AFOA 2G8YA 2Q1KA 1M90Q 2B89A 5H2FE 4N3YB 3PO2I 2K37A 2N1TB 1AA6A 3L73G 1KQSO 1EZVE 4EWCA 3RBXA 2AXCA 3HUSC 1L4AD 2H8PD 2WVRA 5KJ7D 1R5SA 4U3FG 2DE6A 3AE9C 2NPSC 2Q5UA 2OZKA 3MHVA 1BCCD 1USDA 3VB9A 1SQQK 3BG0B 1BCCJ 1L0LK 2N1TC 5CCGD 1VQM1 1RF1A 4BXXI 2IZ3A 1N73A 2WQYC 1N7LA 1WT6A 2JIPA 1UIXA 4NBEA 3CQZI 5B66H 3IAOA 3KPEA 3G6EP 1IFMA 1SQBK 3RGUA 3LW5H 4A3II 1M1JB 2P7JA 2QIWA 1JTHA 1NHLA 3J81f 3I561 3LIEA 3M06A 3RK3D 3P5JB 3CCUZ 2IFMA 3HOUI 2ZYGA 1VQ6P 1KN7A 1RE4C 2A45H 3QWUA 2OYIB 1Q862 4Z1MH 1NKNA 1K8A2 2B87B 1T2KD 4RVDA 1GTWA 1N7SC 3D9XA 1M1JC 2IZ4A 5KTBA 1JY2O 2QEXP 3TK1A 1QVGO 3HD7D 1YJW1 2FYUD 1FZCB 2OTLP 1VQN1 1KB9E 2OTJ1 3M4OI 3PO3S 1U7MA 2FFDA 3NMDA 2WSEH 1YJN1 1CW5A 3RK3B 3CL3D 2FYUJ 2E75B 3EFFK 2VF1A 2OYIC 3V5BA 1IK7A 5KLVD 3ESWA 4I2LC 3AEEC 1NYHA 1NO4A 1FJKA 3V4WA 1FZCC 1S4XA 2R3SA 1OXZA 5KLVJ 3A0BE 5AN9F 2LKMA 2MKVA 1LTBC 1GW4A 3GKQA 1VQOP 1VQ4P 3RK3C 2E75C 1TWAI 3O8ZA 4WY4B 3H1KD 3VMXA 2Y9YA 3IR7A 1M57D 1SQPK 2O1JA 3GCFA 3AE3C 1CZQA 1G2CA 1LGHB 3E1IA 2YIUB 3M0AA 1JJ2Z 3H1KJ 3CMAP 3M9BA 1RLYA 1VQ7P 1L2PA 2AEJA 4JYBA 3L73E 4UB6E 5KAFE 5TJHA 3MD0A 1GK4A 1ZP0C 1VQMZ 2SPZA 2Y0SA 1KQSY 4U3FE 1KYOE 4WY4C 3D6WA 1L0ND 1LWUA 1NUIA 1OX3A 1Y1VI 4ASWA 1FS0E 1K73Q 2QSIA 4PV1B 3HE5B 1M901 3MTUE 2YIUC 2WMMA 1L0NJ 3A5TA 5CJ0A 5AVRB 1TWGI 1K9M1 3I56Z 3CCMZ 3GTLI 1TU3F 2IPPA 2J6AA 4OWFA 1HVVA 3G4SP 3G711 4HH4A 5GTIH 1RO0A 3E1RA 3F89A 1IFNA 1KQLA 2WZ7A 4PV1C 3GTJI 4K35A 3SWYA 2QRCB 2E76B 3L4FA 1N86A 2BASA 3B71A 3AE5C 3L74J 3LW5J 3S4RA 1YJWZ 3GMAA 4PD4H 2OTJZ 1S9KD 2GU2A 1LTTC 4DJGA 4NPFX 4JBZA 1YJNZ 4BY1I 1YBKA 1I50I 2QR1B 4EIJA 3II6A 1X3ZA 1OIPA 2Z5HA 3EWKA 3I55P 3G6E1 2E76C 2BEZF 2GA1A 4H0LD 1KFNA 1L0LE 2L91A 1JY3N 3CXCY 1QVGY 3BATA 1VQ9P 1T8ZA 3CXHE 3A2AA 3CCEP 1DL6A 1VQ61 2JJLA 2WSEJ 4WWIA 3R4YA 1JM0A 4N6JA 1SIWA 2CPSA 4L73A 2A06E 1SQXG 2K1AA 1KD1Q 1AV1A 1URQA 1W5CE 1S2EA 2AEFA 1M1KQ 2QEX1 3TGUE 2BCCE 4H0LB 3S1RI 1YI2Z 1BDDA 1GL2A 3FGAD 2IDBA 4DOJA 1QVFO 3VMHA 2AXTH 1WMKA 2FXPA 3BCCG 3VMAA 1BE3J 1FBMA 3Q2YA 2XKMA 4ZKPA 2JIQA 4IFMA 2YKPA 2OYOA 1OW7A 1PP9D 5KLIB 1ZMEC 4A3BI 5DJTB 2M3EA 2E2HI 2E5TA 4RVHA 5APUA 2NVTI 1PP9J 2LR2A 4H0LC 2LFUA 3H32A 3M9QA 2FYUK 2P10A 2P28A 1Z02A 1A02J 3W67A 1VQ41 1SLQA 3NH8A 4A3KI 1G1JA 2XNDH 1BSHA 1OZHA 1PGPA 3VOPA 5KLIC 1Z03A 1RQFA 5IT9b 1Q2NA 5KLVK 1VQ71 1NTZG 2QG4A 1KILD 5AW9B 1RF0C 3H1IG 3L72D 2CK3H 3L71D 2V8JA 4H13D 1GMJA 2E9HA 1YIJP 2QJYB 3L72J 1PFTA 2HYNA 3GG2A 3L71J 3G6EZ 4BWNA 3EEDA 4MD8A 2L5GB 4S1TA 3MZWB 2Y0EA 2WPRA 2WSCH 1OFCX 2E43A 4MRIA 3CPWZ 2RIQA 1LJ2A 1BGYG 3KYQA 1IFIA 2R6MA 2PP6A 3CCL1 1SQVG 4IOIH 3GF3A 3G4S1 3NFZA 4OGQC 1DX7A 5DJUB 3G9RA 2H88C 1VQ6Z 1TFIA 2E74B 1NJI1 2QJYC 1EZVG 1L0NK 4RVFA 1K8AQ 1J1DB 3L75D 3N4XA 2HG5D 3CCRP 1KQGB 3TDKA 3W68A 3TF5A 2QEXZ 4N78D 3MONA 4LC1A 1Q812 2OTLZ 3V4QA 2JDIH 3R2PA 3L75J 5APYA 2NAPA 2Q3EA 1M8OB 1R5LA 1QF8A 2HPCA 2E74C 3UIAA 3V2NA 1HGVA 1OVRA 2QRXA 1ML8A 5B5EE 1FE6A 3P7KA 3J80b 3C9IA 1HH0A 1EDJA 3CCSP 3CC7P 3AEDC 4GIFA 2VPZA 1J1DC 5GTHH 1W2BO 2HF1A 3A0HE 3D6YA 1VQ91 1VQNP 2OTJP 4DGLA 1D7MA 1LP1B 2M5AA 5AW3B 1Q16A 4MD7A 3CCE1 2OYHA 1QVFY 1VQ4Z 1KD11 2B88A 2KNCA 2JS4A 3BASA 2Q4ZA 2W03A 5C3EI 5BU8B 4NBFA 1YQ4C 3CC2P 2XNXA 3JSVC 1OMIA 1VQ7Z 2HODA 1FZEA 2JA8I 2RN0A 1TWCI 2I8DA 2P1JA 2W90A 3TYYA 1J2JB 1N8R2 1LTJB 3GTQI 1NTKD 5EFWB 2D2CD 1NU1D 3T4NB 2F4MA 2FYNB 2GUVA 3M9HA 5APSA 5AVUB 4RJTA 1VQPP 3Q3DA 4TT3H 1NTKJ 3CX5D 1DEEG 1NU1J 2ZYAA 3H1IE 2Q6QA 3HTKB 4YXWH 1DH3A 3RK3E 1JMMA 2IBZD 1KORA 4WB4A 2FYZA 3O6QB 5AVXB 3G4SZ 2OOXB 1QEXA 3RK2D 3S9OA 1LTJC 1S5LE 1CSBA 2KOGA 2Y9ZA 1E5WA 5APVA 5IT9f 2GTHA 2D2CB 1L1OC 3HOZI 5D1OA 2W8ZA 2FBWC 3J7A4 3H1JJ 4A3CI 1SQVE 3FXDA 2WSCJ 1Z56A 2KZJA 5C4XI 1P84D 3GTOI 1MKMA 1JTHB 3RL0D 4MD9A 3GTGI 3G71P 2YO3A 1K9MQ 1YIJ1 3RK2B 4CL1A 3I55Z 2IFNA 1YJ9P 3HOVI 2DE7A 1PGQA 4X6AI 3NTNA 2V45A 2R5BA 1IFPA 3BCCD 1VQ5P 1S1CX 4QTUA 2O53A 3PP5A 1JCCA 4BRYA 5AVVB 1VQ9Z 4Y52I 1PPJD 3CCEZ 3CCQP 3H1KE 1Q861 1USPB 1K8A1 1ZV8A 2K9JA 3HKZA 3RK2C 5CCHC 3CX5I 1Y8AA 3RL0B 3L70D 1L4AB 1Q7Y2 2G2KA 1E79H 3AE2C 4YPCA 5BVZA 2IBZI 3VMIA 3HUSA 3CCR1 4GDOA 1W2BY 4DCKA 2G3AA 2XDJA 3L70J 2IYPA 5APQA 2E2II 3FQMA 3KZIH 2P3YA 3J80f 1PV3A 1HWTC 1JCDA 1L4AC 1CI6B 3CCS1 3CC71 1WJ2A 5KJ7C 3GTMI 2Z4EA 1P84I 1U7JA 4EI2A 4HB1A 1R8EA 1ZRTD 1SQQG 2XU6A 1WCMI 1PL5A 1L0LG 1NTMD 4WVZA 3TDHB 3U59A 5B66E 1PZQA 1IO4A 4HGYA 2YADA 3NH5A 2O4HA 3H1LG 3HE4B 5AW5B 5CCGC 3L74E 4EDFA 1GW3A 1VLAA 1NTMJ 1SS1A 1X22A 3CC21 2VPYA 3SFEC 1FDOA 1SQBG 1DIPA 1RE4A 2A06G 1RO2A 1P9NA 1S9KE 1HBWA 1M56D 3S2HI 2B9BA 3TGUG 1N7SA 1EDIA 1FZGA 3HOYI 2BCCG 3HD7B 1M1JA 1VQKP 3CI9A 3AE4C 1YIJZ 2KSJA 1VQP1 1H0TB 3F5HA 4W80A 4MXUA 3WU2H 5TISH 3FWNA 1T2KC 3CWBG 2OYIA 1K05A 1MFTA 3GF7A 1EC5A 3HD7C 4MH4A 2F4OA 2JA5I 3PLNA 1K04A 2KK7A 1AQ5A 2YKOA 3NXSA 1FZCA 1NTKK 2QVAA 1NU1K 5M1BA 3H1HD 3LUSA 4BY7I 4XFJA 4BXLA 3CCRZ 1URQD 1BE3E 3H1HJ 4D6TD 3L37A 1ZB9A 4GT1A 2ZFCA 3CCLP 3CLQA 4D6TJ 4E2YA 2RHBA 1PP9E 1XTGB 3CMEP 1Y9BA 3WMM0 3VP9A 1YJ91 2JIRA 4ZNCA 1KMIZ 1SQPG 3CCSZ 3CC7Z 4H44D 2NZ2A 2RT9A 1HGZA 4WY4A 1EZVI 4Y7NI 1VQ51 1NJIQ 1JNMA 2QM7A 3IR9A 1Y8CA 1YUKA 1K83I 1VQNZ 2KZIA 4AYBA 3I07A 1LTSC 3CCQ1 2V3VA 3KIFA 2PM9A 3OW2O 2M8RA 1X9VA 4DT0A 2WAQA 1NAYA 3EQ2A 3CC2Z 1EDKA 5AW0B 4RO0A 1SQQE 2JWAA 2WPVB 1KC82 4GODA 3T97B 4UB8H 3U1AA 2R32A 3GTMS 2KIKA 4BBRI 2YO2A 3L72E 3H1LE 5GTIE 1LT9B 3H6PA 2O01H 1FAVA 2W6JH 1JY3P 1N8RQ 3IF4A 2C9LY 3H32B 1JJ2Y 2QLVB 2QJPB 3NFQA 3B8EB 2W83C 1SQBE 2HFED 3B5ND 1VQPZ 2GTIA 1IZNB 1USEA 4TNUA 2NVYI 3FKII 4PD4E 2KP8A 3L73D 3OW2Z 1GK6A 2RMZA 3QWOC 4I1LA 5AW4B 2AEMA 2E5YA 4NB9A 3JAMb 1GD2E 4BBSI 1LT9C 2FY8A 3OAKA 4LGDE 4NH1C 4U3FD 2BEQD 1KYOD 4AQRD 3D71A 2KS1B 3FX0A 2QJPC 5APTA 2WB1A 3K5BA 4U3FJ 1YHQP 3L75E 1KB9I 3L35A 3SWFA 3CWBE 4N78E 1YYCA 3B5NB 1BCCG 2QRDB 1AVYA 4C7NB 3S14I 3IF8A 5AVZB 2KLVA 1VQK1 1NTMK 5FLXb 1JEKA 3C1LA 3ITKA 3G71Z 2IYOA 3CPWO 5APWA 2H85A 1NOHA 1NGMB
chains in the Genus database with same CATH topology
1YJ9Z 4NBFA 3RGUA 3NDIA 4A3II 1VQ7Z 3K7AI 3J81f 3I561 2JA8I 1TWCI 1VQ5Z 5A2Qb 2R44A 2I8DA 3P5JB 1H0TA 1OVUA 3CCUZ 5D1PA 4HJGH 3HOUI 1N8R2 3CCQZ 3GTQI 5EFWB 3T4NB 3QWUA 2F4MA 3NDJA 1Q862 4A3DI 1K8A2 2B87B 1JWHC 2Q51A 4RVDA 1Q811 4NOZA 2E2JI 1DEEG 2IZ4A 3D9XA 1M902 1KRLA 1YJW1 1VQN1 2OTJ1 3M4OI 3PO3S 1U7MA 3GTPI 4A3GI 4KJMA 1K9M2 1YJN1 4ZMDA 3G4SZ 2OOXB 4MN4C 3S15I 2PK7A 5C4JI 3CME1 4RS4A 2VF1A 2K5RA 2JA6I 5IT9f 2GTHA 1L1OC 3ESWA 4E33A 3CCVZ 3HOZI 5D1OA 4E2WA 4A3LI 3J7A4 3EERA 3HOXI 4A3CI 1SFOI 2OOYB 1I6HI 3FXDA 5AN9F 4MONA 3GKQA 2KZJA 2B63I 5C4XI 4NBDA 3GTOI 4MD9A 1TWAI 3GTGI 2QREB 3S1QI 1BDCA 1JMBA 1YIJ1 4CL1A 3I55Z 1ZH1A 3CC41 3GCFA 3HOVI 2DE7A 4CPGA 2JWDA 1JJ2Z 3CCJ1 3RZOI 2QA4Z 1RLYA 4A93I 4X6AI 4GOFA 1VQL1 2OTL1 1S3JA 2QKDA 1N8R1 4QTUA 2O53A 2JA7I 1VQMZ 2K3RA 1VQ9Z 4Y52I 2SPZA 2Y0SA 4DQYB 3CCEZ 1KQSY 2BJOA 1VQKZ 1Q861 3D6WA 1USPB 1K8A1 2YU9I 1NUIA 3HKZA 1Y1VI 4ASWA 2RBLA 1M901 5K5GB 3FQQA 3H0GI 1Q7Y2 2G2KA 5T67A 2HR3A 3VMIA 2WMMA 3CCR1 1VQ81 1W2BY 3Q87A 1YUAA 3TE5B 1TWGI 1Z01A 3I56Z 1K9M1 3CCMZ 3JAMf 3GTLI 1VQO1 3BG1B 3IFUA 2J6AA 4NBCA 2E2II 5D1OB 2NVQI 3FQMA 3G711 1X3WA 4HH4A 2P3YA 3J80f 2KI7B 1WW9A 2DE5A 1RO0A 1Y1VS 1QVFZ 3GTJI 1ZB8A 1RO4A 4K35A 3CMA1 2EGTA 2QRCB 1YHQ1 3CCS1 3CC71 3GTMI 3MZLB 2KPIA 3F3FC 1I3QI 1X0TA 1U7JA 1YJWZ 4HB1A 1K731 2OTJZ 2GU2A 1WCMI 4NPFX 4JBZA 5FLXf 1NVOA 3TDHB 3PH0A 5IP9I 1YJNZ 4BY1I 3CCLZ 4HGYA 2YADA 2JMOA 3NH5A 2O4HA 1I50I 2QR1B 2RPRA 3CD61 1X3ZA 1VLAA 1SS1A 1M1K2 3CMEZ 3GTKI 3I4NI 3G6E1 1N2FA 3OW2Y 3CC21 2M5AB 4HGZA 1YIT1 4RV9A 1RO2A 5A2Qf 1P9NA 3CXCY 1QVGY 1Y47A 2JR6A 3S2HI 4E2XA 1EDIA 3HOYI 2R93I 1DL6A 1FC2C 1VQ61 4A3FI 1K732 4WWIA 1Q822 1Q7Y1 3S1NI 1JM0A 1YIJZ 2VUMI 1VQP1 1NP6A 3CC4Z 4NPDA 2ZAEB 1H0TB 5T6BA 5C44I 4HKZH 4MXUA 1S721 3CCJZ 2QEX1 1TWFI 2M6NA 1VQLZ 2P58A 2JUBA 5T64A 3S1RI 3J81b 1YI2Z 3H3VJ 1BDDA 2PMZA 4XX2A 2W04A 1MFTA 3VMHA 1EC5A 4MH4A 2NVXI 2F4OA 2JA5I 3I551 4E30A 1LT1A 4ASVA 2QVAA 4EYYQ 1LQLA 4NBGA 4NPEA 3LUSA 1NJI2 4A3BI 2KUBA 5DJTB 2E2HI 4BY7I 1ZXGA 4NBHA 4BXLA 4RVHA 3CCRZ 2NVTI 1VQ8Z 2LR2A 2LFUA 4K3AA 4A3EI 2R7ZI 1VQOZ 3RZDI 5LL6f 2P28A 1Z02A 3M3YI 1ZB9A 1VQ41 3NH8A 3ZDMA 4A3KI 3FXEA 1M1K1 4E32A 2HU9A 4E2YA 2UWJE 2RHBA 2RKLA 1KQSZ 1Z03A 1YJ91 4ZNCA 1RQFA 1WIIA 4NBBA 3CMAZ 5IT9b 1YHQZ 3CPWY 3CCSZ 1Q2NA 3CC7Z 2RT9A 1VQ71 3HOWI 3CCM1 4NBAA 4Y7NI 3PO3I 1VQ51 2I3CA 4A3JI 1RNIA 4GOEA 1YUKA 3F3PC 1S7MA 3CCU1 1K83I 1VQNZ 1Q821 2KZIA 1W2BZ 4AYBA 3I07A 3CCQ1 3KIFA 2V8JA 2PM9A 2AKLA 1Y1WI 3S17I 3VTNA 3CD6Z 5C39A 3VMGA 2E9HA 2M48A 3IX0A 1KD12 2JNYA 1PFTA 3G6EZ 3EEDA 1OVVA 2WAQA 4MD8A 1LP1A 4S1TA 3CC2Z 3MZWB 1EDKA 1YITZ 1USPA 1KC82 4GODA 4MRIA 3CPWZ 2RIQA 3GTMS 1QYPA 2KIKA 4BBRI 1R9TI 2R6MA 3CCL1 4IOIH 1EDLA 4A3MI 3G4S1 3NFZA 5DJUB 3S1KA 4NB8A 4DK1A 2LIYA 1VQ6Z 3KIHA 1TWHI 1TFIA 1JJ2Y 1NJI1 2QLVB 3S1MI 4RVFA 1VQPZ 3S16I 4NFRA 4E2ZA 3CCV1 5CBNA 2GTIA 4TNUA 4RVGA 2NVYI 1S72Z 3FKII 2QEXZ 3MONA 2Q1KA 3NH4A 3OW2Z 2OTKE 2B89A 1Q812 3I4MI 3PO2I 2OTLZ 3QWOC 4E31A 4NB9A 2VUGA 3JAMb 4BBSI 4EWCA 4NH1C 2B87A 5CM2M 1QF8A 5FLMI 3CXCZ 1QVGZ 2KS1B 1OVRA 2QRXA 1ML8A 2V8IA 2DE6A 4QTTA 3J80b 2WB1A 2LXCB 2OZKA 3MHVA 3MZKB 3U50C 1EDJA 2QA41 3VB9A 5IP7I 2LXBA 2HF1A 1YI21 2QRDB 1ZW0A 3BG0B 3S14I 3IF8A 3S2DI 1VQM1 1VQ91 4DGLA 1LP1B 2M0BA 2M5AA 5CBOA 2IZ3A 4MD7A 3CCE1 4BXXI 1VQK1 1QVFY 1VQ4Z 5FLXb 1KD11 2B88A 2V8KA 3G71Z 4NBEA 2JS4A 3CQZI 5C3EI 2Q4ZA 2W03A 2H85A 2R92I 1KC81
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C39 A;  1EDI A;  3RGU A;  1S3J A;  1FC2 C;  2K3R A;  1OVV A;  4WWI A;  1JM0 A;  2SPZ A;  1LP1 A;  2R44 A;  2I8D A;  1EDK A;  3MZW B;  4NPD A;  2ZAE B;  4GOD A;  1H0T A;  1OVU A;  1H0T B;  4HJG H;  4HKZ H;  4ASW A;  2KIK A;  5K5G B;  4IOI H;  1EDL A;  2P58 A;  5EFW B;  5DJU B;  3S1K A;  2HR3 A;  2WMM A;  1BDD A;  2B87 B;  1MFT A;  1EC5 A;  1DEE G;  1LT1 A;  5CBN A;  4ASV A;  2QVA A;  4EYY Q;  1U7M A;  4NPE A;  2Q1K A;  2OTK E;  4KJM A;  2KI7 B;  2B89 A;  2KUB A;  4ZMD A;  5DJT B;  4MN4 C;  3QWO C;  1ZXG A;  4BXL A;  4K35 A;  2LR2 A;  2B87 A;  4K3A A;  1X0T A;  2KS1 B;  1OVR A;  2QRX A;  1U7J A;  4HB1 A;  3ZDM A;  3FXE A;  2LXC B;  3MHV A;  4NPF X;  4JBZ A;  1EDJ A;  1NVO A;  2UWJ E;  3PH0 A;  2RKL A;  3FXD A;  2LXB A;  4ZNC A;  2KZJ A;  1Q2N A;  1ZW0 A;  1SS1 A;  1BDC A;  1JMB A;  1LP1 B;  2M0B A;  2M5A A;  5CBO A;  2M5A B;  4GOE A;  2B88 A;  4CPG A;  2JWD A;  2KZI A;  4GOF A;  1Y47 A; 
#chains in the Genus database with same CATH topology
 1YJ9 Z;  2K88 A;  3P8M C;  4PJ0 H;  3B5N C;  3GHG B;  1T3U A;  1VQ5 Z;  2AXT E;  3CX5 H;  5A2Q b;  2R44 A;  2WT7 A;  1LTG C;  1OVU A;  3KXD A;  1QX8 A;  3WUV A;  5D1P A;  5E79 E;  3CCQ Z;  2JEE A;  1RY3 A;  1SQP E;  3USS A;  3NDJ A;  1AQT A;  1DD3 A;  1JWH C;  2Q51 A;  1Q81 1;  4NOZ A;  3AE1 C;  1JY2 N;  1SFC D;  3M0D C;  3GHG C;  4RKU J;  1NKZ B;  2LEX A;  1KYO I;  4A3G I;  4KJM A;  3CXH D;  2FYU G;  4M3L A;  4ZMD A;  3BRT B;  4MN4 C;  3S15 I;  4JQ0 D;  5KKZ B;  1KIL B;  2RH0 A;  3OJA B;  3TSI A;  2PK7 A;  1ZN5 A;  1P84 H;  3CME 1;  3D6Z A;  2K5R A;  2JA6 I;  1RF0 A;  3GW6 A;  4H13 B;  4E33 A;  2KB7 P;  2J58 A;  4A3L I;  5AW6 B;  1Q86 Q;  3EER A;  5AVQ B;  5KLV G;  2IBZ E;  3P8C D;  1I6H I;  1SFC B;  2KYV A;  3JCU H;  1PIX A;  2B63 I;  2WPS A;  3VTP C;  3L36 A;  1KIL C;  5KKZ C;  3WUU A;  1FOS F;  2E7Z A;  2QRE B;  3S1Q I;  1BDC A;  3H1J E;  4Y99 B;  2ZXE B;  1WZN A;  1ZH1 A;  2O01 J;  1H88 A;  3H1K G;  4H13 C;  2JWD A;  1N2D C;  3RZO I;  4A93 I;  4XE5 B;  4JPZ B;  3TNU B;  3MGN A;  1MZ9 A;  1N8R 1;  1LTA C;  1SFC C;  4C7R A;  2JA7 I;  2C9N Y;  2K3R A;  1VQK Z;  3ABV C;  1X8Y A;  4Y99 C;  1NWQ A;  1KQF B;  2ITA A;  5K5G B;  1IFJ A;  4IL6 E;  5AVW B;  1BCC E;  3KHU A;  1L0N G;  3Q5S A;  3MUD C;  3V2R A;  1RH5 B;  3V2P A;  2YXQ B;  3CXH I;  1YUA A;  3TE5 B;  1SVF A;  3JAM f;  3IFU A;  1G1I A;  3MP7 B;  3V6I A;  1PPJ E;  4NBC A;  5D1O B;  1X3W A;  5AVY B;  4IFD K;  4IFF A;  2KI7 B;  2DE5 A;  3AEC C;  4O9B A;  5KAI H;  5GTH E;  1GDT A;  1M7L A;  2IV2 X;  1YHQ 1;  1A02 F;  2GUS A;  3L74 G;  1I3Q I;  2Q7C A;  4L76 A;  2IZ0 A;  2R5D A;  4KT0 J;  4YTP C;  5H2F H;  5FLX f;  1NVO A;  1T3J A;  2Y0C A;  2W6B A;  3CCL Z;  2JMO A;  2RPR A;  1VPC A;  3GTK I;  1M1K 2;  3CME Z;  2A45 G;  2FYN C;  1N2F A;  2QM8 A;  1RF1 B;  2QA4 P;  1N73 B;  2K9J B;  2C0X A;  1VDF A;  5A2Q f;  2R3C A;  2FYU E;  1EXI A;  2JP3 A;  3AE7 C;  2JR6 A;  4E2X A;  2R93 I;  1FC2 C;  4A3F I;  1SQX D;  1Q82 2;  3S1N I;  1Q7Y 1;  3AEA C;  4NPD A;  2QJK B;  2ZAE B;  1RF1 C;  1PGJ A;  3IN6 A;  5KLV E;  1SQX J;  2D2C C;  1N73 C;  1EXJ A;  1QXF A;  1S72 1;  1LTJ A;  1TWF I;  4HH2 A;  1KC8 Q;  2J59 M;  1RE3 A;  3Q1M A;  4HYT B;  3H3V J;  2QE7 H;  3U1C A;  1BE3 G;  1VL2 A;  3BCC J;  2P67 A;  3HTK A;  4E30 A;  1N7S D;  4OH8 B;  2K9Y A;  4ASV A;  3QH9 A;  1LQL A;  3O6Q A;  4NBG A;  4NPE A;  2QJK C;  2PRR A;  2FFD B;  1EQ7 A;  2JKV A;  2VPW A;  1PP9 G;  4QMA A;  5AVS B;  3V2Q A;  3AEG C;  4A3E I;  2R7Z I;  3RZD I;  1H89 A;  5LL6 f;  3M3Y I;  2NPS A;  1KB9 H;  1GU4 A;  2WSS H;  3FXE A;  1ZR2 A;  4WBA A;  3KQG A;  1KZU B;  2WSF J;  1L0N E;  2UWJ E;  3H1H E;  1KQS Z;  3RL0 C;  2FFD C;  1NTZ D;  1N7S B;  2N1T A;  2YMY A;  1AJY A;  1YHQ Z;  1FZB A;  3VMY A;  3HOW I;  3GLM A;  3CCM 1;  2ZVO B;  3H1I D;  4D6T E;  5CCH A;  1NTZ J;  2I3C A;  3N7N A;  2E75 D;  1RNI A;  3AE8 C;  4GOE A;  2H43 A;  1G2C B;  2O01 N;  3H1I J;  2IZ1 A;  3IFM A;  1IJD B;  3A0B H;  2AKL A;  1Y1W I;  3VTN A;  3L72 G;  2IX7 C;  2POH A;  2V7Q J;  3L71 G;  2PGD A;  5AW2 B;  2M48 A;  3D2L A;  3CC4 P;  1OVV A;  1BGY D;  3CCJ P;  1USP A;  1JO5 A;  1VQL P;  1SQV D;  1QL2 A;  3VMZ A;  1LWU B;  1R9T I;  1PGO A;  1BGY J;  4WY4 D;  3PHL A;  1FU1 A;  1L4A A;  1EDL A;  3KZI E;  2Z5I A;  4UB6 H;  5KAF H;  4R4M A;  1SQV J;  1EZV D;  5KJ7 A;  2FXM A;  4DK1 A;  2KSE A;  1FOS E;  2JIO A;  1KYO H;  3S1M I;  3D70 A;  2HLO A;  3M91 A;  3S16 I;  4EOT A;  4E2Z A;  3CCV 1;  5CBN A;  3Q5R A;  4RVG A;  3PTZ A;  1S72 Z;  5CHX A;  5CCG A;  1VQ8 P;  3NH4 A;  2O3J A;  2OTK E;  1LWU C;  3I4M I;  3L75 G;  4E31 A;  3PJS K;  2VUG A;  1CI6 A;  4A7P A;  2B87 A;  4PV1 D;  5CM2 M;  2ZVN B;  5FLM I;  3CXC Z;  1QVG Z;  1ZLL A;  2O1K A;  2V8I A;  4QTT A;  1WRG A;  2LXC B;  3MZK B;  3U50 C;  2KLU A;  2QA4 1;  3BRV B;  3JC2 2;  5IP7 I;  2LXB A;  3HE4 A;  1YI2 1;  1NAF A;  1NH4 A;  1ZW0 A;  5L8R J;  3S2D I;  1MFZ A;  1RHZ B;  1Q81 Q;  2M0B A;  5CBO A;  1RQU A;  2E76 D;  3LID A;  2V8K A;  1GL2 D;  3CD6 P;  2KXP B;  2R92 I;  3WU2 E;  5TIS E;  5CMZ A;  1KV4 A;  1KC8 1;  3HD7 A;  4IL6 X;  3NDI A;  1YIT P;  3PRJ A;  3BVH A;  3B4S A;  4AUW A;  3K7A I;  1LNQ A;  1KB9 D;  1H0T A;  1H8A A;  1URQ B;  4HJG H;  1QLE D;  3L74 D;  1T6A A;  3CXH H;  1SQX K;  1KFM A;  4C46 A;  4A3D I;  2WTY A;  1NTK G;  1GL2 B;  1NU1 G;  1QGK B;  1SP4 A;  1QL1 A;  2FXO A;  2E2J I;  1M90 2;  2ZXX A;  1KRL A;  1ZR4 A;  1KIL E;  4H44 B;  2XV5 A;  3GTP I;  1ZOY C;  2M3B A;  3HE5 A;  1FDM A;  1URQ C;  1K9M 2;  1XTC C;  2J5U A;  4L75 A;  3L71 E;  2IBZ G;  5BU5 A;  1RQV A;  2H89 C;  5C4J I;  4R4L A;  1YTZ T;  4RS4 A;  1S5L X;  1GL2 C;  2PFX A;  5APX A;  3EFG A;  3CCV Z;  3H1J G;  2MJZ A;  4E2W A;  1MUU A;  3HOX I;  1SFO I;  2OOY B;  2YXR B;  4Y28 J;  1IFD A;  4H44 C;  4JYC A;  4MON A;  1OW8 A;  4NBD A;  3MIW A;  4I7Z B;  2W6A A;  3L73 J;  1JMB A;  2ZT9 D;  1FJP A;  4L74 A;  2WT7 B;  3CC4 1;  1AA0 A;  4CPG A;  4UB8 E;  1NTZ K;  3CCJ 1;  2QA4 Z;  4GOF A;  1VQL 1;  3P8C E;  2OTL 1;  1BE3 D;  1S3J A;  2V4H A;  2QKD A;  2DW3 A;  3CCU P;  4I7Z C;  4DQY B;  2WWW A;  2BJO A;  5E79 H;  3T97 A;  2N9B A;  2YU9 I;  4W7Y A;  2Q9I A;  1PPJ G;  4KHX A;  5AVT B;  2RBL A;  1Q82 Q;  3FQQ A;  3H0G I;  2ZT9 B;  1LT9 A;  5CJ4 A;  1MV8 A;  5AW1 B;  4RES B;  5T67 A;  2HR3 A;  3L70 G;  1IK9 A;  1VQ8 1;  3Q87 A;  4OGQ D;  2A45 I;  1Z01 A;  2W27 A;  1SQV K;  1VQO 1;  3BG1 B;  2H7H A;  1DEB A;  2NVQ I;  3E7K A;  1PFI A;  3P32 A;  3VP8 A;  1WW9 A;  1Y1V S;  1QVF Z;  1ZB8 A;  2ZT9 C;  2Q3I A;  1RO4 A;  3CMA 1;  2EGT A;  3RBZ A;  3Q5P A;  4U7J A;  1OWA A;  3WUT A;  3MZL B;  1SQQ D;  2VPX A;  2KPI A;  3F3F C;  2KS1 A;  2HPC B;  1X0T A;  1L0L D;  1Q7Y Q;  1S72 P;  1FZF A;  1K73 1;  2E74 D;  4OGQ B;  3H1L D;  1SQQ J;  1W2E A;  5IP9 I;  3PH0 A;  1L0L J;  4JF7 A;  3B5N A;  1JY2 P;  1NTM G;  2FKW B;  1NTK E;  3CD6 1;  1JOC A;  2E42 A;  2I1K A;  4C7N A;  1NU1 E;  3SFD C;  4W7Z A;  3H1L J;  1FDI A;  3I4N I;  4PJ0 E;  1SQB D;  3OW2 Y;  1AVO A;  2A06 D;  5B5E H;  2CPB A;  2M5A B;  4HGZ A;  1YIT 1;  3CX5 E;  2OYH B;  2JIM A;  4PD4 D;  4RV9 A;  2KNC B;  3TGU D;  1SQB J;  4LLH A;  2BCC D;  1IC2 A;  3A0H H;  1Y47 A;  1VQM P;  3FWL A;  3TGU J;  2OGU A;  1K73 2;  2BCC J;  2HOD B;  3GHG A;  2NRG A;  3M0D A;  5AW7 B;  2VUM I;  2JR8 A;  2YNY A;  1NP6 A;  3CC4 Z;  2YKQ A;  1HJB A;  2C0W A;  5T6B A;  4IL6 H;  5C44 I;  4HKZ H;  2OYH C;  3CWB D;  3CCJ Z;  2WPQ A;  2M6N A;  1VQL Z;  2P58 A;  2P2U A;  2JUB A;  3AEF C;  3I56 P;  3CCM P;  5T64 A;  3J81 b;  2PMZ A;  2I1J A;  3CWB J;  4XX2 A;  2W04 A;  2Y0D A;  2NVX I;  1P84 E;  1SQX E;  3KDP B;  2WSF H;  2JO1 A;  3I55 1;  3AE6 C;  1LT1 A;  1VF5 D;  4EYY Q;  4DZO A;  5AW8 B;  2GM4 A;  1NJI 2;  2KUB A;  1KIL A;  1BSN A;  3C8V A;  1ZXG A;  4NBH A;  3H1H G;  3SWK A;  1VQ8 Z;  3BCC E;  1LTI C;  2PAJ A;  3JCU E;  1YJW P;  2N9Y B;  4K3A A;  1VQO Z;  3AEB C;  3OA7 A;  1YJN P;  4I6M C;  3ZDM A;  4D6T G;  2OAR A;  1M1K 1;  2V7Q H;  4E32 A;  2HU9 A;  1SQP D;  2RKL A;  4YXD C;  1S5L H;  3SSU A;  1SFC A;  2OQQ A;  4PD4 I;  3L70 E;  1J1E B;  1WII A;  1VF5 B;  4NBB A;  1YTZ I;  3CMA Z;  3CPW Y;  2YMK A;  2AYD A;  4TLF A;  3CCV P;  1HUC A;  1SQP J;  1UII A;  3A3Y B;  1HTL C;  4NBA A;  3PO3 I;  1GZL A;  1GU5 A;  3I5C A;  4A3J I;  3F3P C;  1FZA A;  1S7M A;  3CCU 1;  1KTM A;  1Q82 1;  1W2B Z;  1U57 A;  1JUN A;  1OW6 A;  2ZJS E;  3MUD A;  3TNU A;  3S17 I;  2NPS D;  3CD6 Z;  5C39 A;  3VMG A;  3IX0 A;  1NTZ E;  1KD1 2;  2JNY A;  4GKG A;  1HF9 A;  1J1E C;  1VF5 C;  3G3Z A;  4BRY B;  3HRN A;  2WIT A;  1LP1 A;  1X79 B;  1YIT Z;  1JB0 J;  2N1T D;  2ZYD A;  4OVN F;  1JY3 O;  4B86 A;  1QYP A;  2VRS A;  4AYC A;  1YI2 P;  1ZRT E;  1Q90 D;  1NTM E;  4A3M I;  5CCH D;  3S1K A;  4NB8 A;  5KAI E;  3HUS B;  2LIY A;  3RL0 g;  3KIH A;  1TWH I;  1DD4 A;  3VN0 A;  1RE3 C;  3H1J D;  4XA4 A;  4ZKU A;  2XZR A;  1BGY E;  2NPS B;  3VYI A;  4NFR A;  3A7O A;  1HJ0 A;  1YQ3 C;  3H25 A;  1AFO A;  2G8Y A;  2Q1K A;  1M90 Q;  2B89 A;  5H2F E;  4N3Y B;  3PO2 I;  2K37 A;  2N1T B;  1AA6 A;  3L73 G;  1KQS O;  1EZV E;  4EWC A;  3RBX A;  2AXC A;  3HUS C;  1L4A D;  2H8P D;  2WVR A;  5KJ7 D;  1R5S A;  4U3F G;  2DE6 A;  3AE9 C;  2NPS C;  2Q5U A;  2OZK A;  3MHV A;  1BCC D;  1USD A;  3VB9 A;  1SQQ K;  3BG0 B;  1BCC J;  1L0L K;  2N1T C;  5CCG D;  1VQM 1;  1RF1 A;  4BXX I;  2IZ3 A;  1N73 A;  2WQY C;  1N7L A;  1WT6 A;  2JIP A;  1UIX A;  4NBE A;  3CQZ I;  5B66 H;  3IAO A;  3KPE A;  3G6E P;  1IFM A;  1SQB K;  3RGU A;  3LW5 H;  4A3I I;  1M1J B;  2P7J A;  2QIW A;  1JTH A;  1NHL A;  3J81 f;  3I56 1;  3LIE A;  3M06 A;  3RK3 D;  3P5J B;  3CCU Z;  2IFM A;  3HOU I;  2ZYG A;  1VQ6 P;  1KN7 A;  1RE4 C;  2A45 H;  3QWU A;  2OYI B;  1Q86 2;  4Z1M H;  1NKN A;  1K8A 2;  2B87 B;  1T2K D;  4RVD A;  1GTW A;  1N7S C;  3D9X A;  1M1J C;  2IZ4 A;  5KTB A;  1JY2 O;  2QEX P;  3TK1 A;  1QVG O;  3HD7 D;  1YJW 1;  2FYU D;  1FZC B;  2OTL P;  1VQN 1;  1KB9 E;  2OTJ 1;  3M4O I;  3PO3 S;  1U7M A;  2FFD A;  3NMD A;  2WSE H;  1YJN 1;  1CW5 A;  3RK3 B;  3CL3 D;  2FYU J;  2E75 B;  3EFF K;  2VF1 A;  2OYI C;  3V5B A;  1IK7 A;  5KLV D;  3ESW A;  4I2L C;  3AEE C;  1NYH A;  1NO4 A;  1FJK A;  3V4W A;  1FZC C;  1S4X A;  2R3S A;  1OXZ A;  5KLV J;  3A0B E;  5AN9 F;  2LKM A;  2MKV A;  1LTB C;  1GW4 A;  3GKQ A;  1VQO P;  1VQ4 P;  3RK3 C;  2E75 C;  1TWA I;  3O8Z A;  4WY4 B;  3H1K D;  3VMX A;  2Y9Y A;  3IR7 A;  1M57 D;  1SQP K;  2O1J A;  3GCF A;  3AE3 C;  1CZQ A;  1G2C A;  1LGH B;  3E1I A;  2YIU B;  3M0A A;  1JJ2 Z;  3H1K J;  3CMA P;  3M9B A;  1RLY A;  1VQ7 P;  1L2P A;  2AEJ A;  4JYB A;  3L73 E;  4UB6 E;  5KAF E;  5TJH A;  3MD0 A;  1GK4 A;  1ZP0 C;  1VQM Z;  2SPZ A;  2Y0S A;  1KQS Y;  4U3F E;  1KYO E;  4WY4 C;  3D6W A;  1L0N D;  1LWU A;  1NUI A;  1OX3 A;  1Y1V I;  4ASW A;  1FS0 E;  1K73 Q;  2QSI A;  4PV1 B;  3HE5 B;  1M90 1;  3MTU E;  2YIU C;  2WMM A;  1L0N J;  3A5T A;  5CJ0 A;  5AVR B;  1TWG I;  1K9M 1;  3I56 Z;  3CCM Z;  3GTL I;  1TU3 F;  2IPP A;  2J6A A;  4OWF A;  1HVV A;  3G4S P;  3G71 1;  4HH4 A;  5GTI H;  1RO0 A;  3E1R A;  3F89 A;  1IFN A;  1KQL A;  2WZ7 A;  4PV1 C;  3GTJ I;  4K35 A;  3SWY A;  2QRC B;  2E76 B;  3L4F A;  1N86 A;  2BAS A;  3B71 A;  3AE5 C;  3L74 J;  3LW5 J;  3S4R A;  1YJW Z;  3GMA A;  4PD4 H;  2OTJ Z;  1S9K D;  2GU2 A;  1LTT C;  4DJG A;  4NPF X;  4JBZ A;  1YJN Z;  4BY1 I;  1YBK A;  1I50 I;  2QR1 B;  4EIJ A;  3II6 A;  1X3Z A;  1OIP A;  2Z5H A;  3EWK A;  3I55 P;  3G6E 1;  2E76 C;  2BEZ F;  2GA1 A;  4H0L D;  1KFN A;  1L0L E;  2L91 A;  1JY3 N;  3CXC Y;  1QVG Y;  3BAT A;  1VQ9 P;  1T8Z A;  3CXH E;  3A2A A;  3CCE P;  1DL6 A;  1VQ6 1;  2JJL A;  2WSE J;  4WWI A;  3R4Y A;  1JM0 A;  4N6J A;  1SIW A;  2CPS A;  4L73 A;  2A06 E;  1SQX G;  2K1A A;  1KD1 Q;  1AV1 A;  1URQ A;  1W5C E;  1S2E A;  2AEF A;  1M1K Q;  2QEX 1;  3TGU E;  2BCC E;  4H0L B;  3S1R I;  1YI2 Z;  1BDD A;  1GL2 A;  3FGA D;  2IDB A;  4DOJ A;  1QVF O;  3VMH A;  2AXT H;  1WMK A;  2FXP A;  3BCC G;  3VMA A;  1BE3 J;  1FBM A;  3Q2Y A;  2XKM A;  4ZKP A;  2JIQ A;  4IFM A;  2YKP A;  2OYO A;  1OW7 A;  1PP9 D;  5KLI B;  1ZME C;  4A3B I;  5DJT B;  2M3E A;  2E2H I;  2E5T A;  4RVH A;  5APU A;  2NVT I;  1PP9 J;  2LR2 A;  4H0L C;  2LFU A;  3H32 A;  3M9Q A;  2FYU K;  2P10 A;  2P28 A;  1Z02 A;  1A02 J;  3W67 A;  1VQ4 1;  1SLQ A;  3NH8 A;  4A3K I;  1G1J A;  2XND H;  1BSH A;  1OZH A;  1PGP A;  3VOP A;  5KLI C;  1Z03 A;  1RQF A;  5IT9 b;  1Q2N A;  5KLV K;  1VQ7 1;  1NTZ G;  2QG4 A;  1KIL D;  5AW9 B;  1RF0 C;  3H1I G;  3L72 D;  2CK3 H;  3L71 D;  2V8J A;  4H13 D;  1GMJ A;  2E9H A;  1YIJ P;  2QJY B;  3L72 J;  1PFT A;  2HYN A;  3GG2 A;  3L71 J;  3G6E Z;  4BWN A;  3EED A;  4MD8 A;  2L5G B;  4S1T A;  3MZW B;  2Y0E A;  2WPR A;  2WSC H;  1OFC X;  2E43 A;  4MRI A;  3CPW Z;  2RIQ A;  1LJ2 A;  1BGY G;  3KYQ A;  1IFI A;  2R6M A;  2PP6 A;  3CCL 1;  1SQV G;  4IOI H;  3GF3 A;  3G4S 1;  3NFZ A;  4OGQ C;  1DX7 A;  5DJU B;  3G9R A;  2H88 C;  1VQ6 Z;  1TFI A;  2E74 B;  1NJI 1;  2QJY C;  1EZV G;  1L0N K;  4RVF A;  1K8A Q;  1J1D B;  3L75 D;  3N4X A;  2HG5 D;  3CCR P;  1KQG B;  3TDK A;  3W68 A;  3TF5 A;  2QEX Z;  4N78 D;  3MON A;  4LC1 A;  1Q81 2;  2OTL Z;  3V4Q A;  2JDI H;  3R2P A;  3L75 J;  5APY A;  2NAP A;  2Q3E A;  1M8O B;  1R5L A;  1QF8 A;  2HPC A;  2E74 C;  3UIA A;  3V2N A;  1HGV A;  1OVR A;  2QRX A;  1ML8 A;  5B5E E;  1FE6 A;  3P7K A;  3J80 b;  3C9I A;  1HH0 A;  1EDJ A;  3CCS P;  3CC7 P;  3AED C;  4GIF A;  2VPZ A;  1J1D C;  5GTH H;  1W2B O;  2HF1 A;  3A0H E;  3D6Y A;  1VQ9 1;  1VQN P;  2OTJ P;  4DGL A;  1D7M A;  1LP1 B;  2M5A A;  5AW3 B;  1Q16 A;  4MD7 A;  3CCE 1;  2OYH A;  1QVF Y;  1VQ4 Z;  1KD1 1;  2B88 A;  2KNC A;  2JS4 A;  3BAS A;  2Q4Z A;  2W03 A;  5C3E I;  5BU8 B;  4NBF A;  1YQ4 C;  3CC2 P;  2XNX A;  3JSV C;  1OMI A;  1VQ7 Z;  2HOD A;  1FZE A;  2JA8 I;  2RN0 A;  1TWC I;  2I8D A;  2P1J A;  2W90 A;  3TYY A;  1J2J B;  1N8R 2;  1LTJ B;  3GTQ I;  1NTK D;  5EFW B;  2D2C D;  1NU1 D;  3T4N B;  2F4M A;  2FYN B;  2GUV A;  3M9H A;  5APS A;  5AVU B;  4RJT A;  1VQP P;  3Q3D A;  4TT3 H;  1NTK J;  3CX5 D;  1DEE G;  1NU1 J;  2ZYA A;  3H1I E;  2Q6Q A;  3HTK B;  4YXW H;  1DH3 A;  3RK3 E;  1JMM A;  2IBZ D;  1KOR A;  4WB4 A;  2FYZ A;  3O6Q B;  5AVX B;  3G4S Z;  2OOX B;  1QEX A;  3RK2 D;  3S9O A;  1LTJ C;  1S5L E;  1CSB A;  2KOG A;  2Y9Z A;  1E5W A;  5APV A;  5IT9 f;  2GTH A;  2D2C B;  1L1O C;  3HOZ I;  5D1O A;  2W8Z A;  2FBW C;  3J7A 4;  3H1J J;  4A3C I;  1SQV E;  3FXD A;  2WSC J;  1Z56 A;  2KZJ A;  5C4X I;  1P84 D;  3GTO I;  1MKM A;  1JTH B;  3RL0 D;  4MD9 A;  3GTG I;  3G71 P;  2YO3 A;  1K9M Q;  1YIJ 1;  3RK2 B;  4CL1 A;  3I55 Z;  2IFN A;  1YJ9 P;  3HOV I;  2DE7 A;  1PGQ A;  4X6A I;  3NTN A;  2V45 A;  2R5B A;  1IFP A;  3BCC D;  1VQ5 P;  1S1C X;  4QTU A;  2O53 A;  3PP5 A;  1JCC A;  4BRY A;  5AVV B;  1VQ9 Z;  4Y52 I;  1PPJ D;  3CCE Z;  3CCQ P;  3H1K E;  1Q86 1;  1USP B;  1K8A 1;  1ZV8 A;  2K9J A;  3HKZ A;  3RK2 C;  5CCH C;  3CX5 I;  1Y8A A;  3RL0 B;  3L70 D;  1L4A B;  1Q7Y 2;  2G2K A;  1E79 H;  3AE2 C;  4YPC A;  5BVZ A;  2IBZ I;  3VMI A;  3HUS A;  3CCR 1;  4GDO A;  1W2B Y;  4DCK A;  2G3A A;  2XDJ A;  3L70 J;  2IYP A;  5APQ A;  2E2I I;  3FQM A;  3KZI H;  2P3Y A;  3J80 f;  1PV3 A;  1HWT C;  1JCD A;  1L4A C;  1CI6 B;  3CCS 1;  3CC7 1;  1WJ2 A;  5KJ7 C;  3GTM I;  2Z4E A;  1P84 I;  1U7J A;  4EI2 A;  4HB1 A;  1R8E A;  1ZRT D;  1SQQ G;  2XU6 A;  1WCM I;  1PL5 A;  1L0L G;  1NTM D;  4WVZ A;  3TDH B;  3U59 A;  5B66 E;  1PZQ A;  1IO4 A;  4HGY A;  2YAD A;  3NH5 A;  2O4H A;  3H1L G;  3HE4 B;  5AW5 B;  5CCG C;  3L74 E;  4EDF A;  1GW3 A;  1VLA A;  1NTM J;  1SS1 A;  1X22 A;  3CC2 1;  2VPY A;  3SFE C;  1FDO A;  1SQB G;  1DIP A;  1RE4 A;  2A06 G;  1RO2 A;  1P9N A;  1S9K E;  1HBW A;  1M56 D;  3S2H I;  2B9B A;  3TGU G;  1N7S A;  1EDI A;  1FZG A;  3HOY I;  2BCC G;  3HD7 B;  1M1J A;  1VQK P;  3CI9 A;  3AE4 C;  1YIJ Z;  2KSJ A;  1VQP 1;  1H0T B;  3F5H A;  4W80 A;  4MXU A;  3WU2 H;  5TIS H;  3FWN A;  1T2K C;  3CWB G;  2OYI A;  1K05 A;  1MFT A;  3GF7 A;  1EC5 A;  3HD7 C;  4MH4 A;  2F4O A;  2JA5 I;  3PLN A;  1K04 A;  2KK7 A;  1AQ5 A;  2YKO A;  3NXS A;  1FZC A;  1NTK K;  2QVA A;  1NU1 K;  5M1B A;  3H1H D;  3LUS A;  4BY7 I;  4XFJ A;  4BXL A;  3CCR Z;  1URQ D;  1BE3 E;  3H1H J;  4D6T D;  3L37 A;  1ZB9 A;  4GT1 A;  2ZFC A;  3CCL P;  3CLQ A;  4D6T J;  4E2Y A;  2RHB A;  1PP9 E;  1XTG B;  3CME P;  1Y9B A;  3WMM 0;  3VP9 A;  1YJ9 1;  2JIR A;  4ZNC A;  1KMI Z;  1SQP G;  3CCS Z;  3CC7 Z;  4H44 D;  2NZ2 A;  2RT9 A;  1HGZ A;  4WY4 A;  1EZV I;  4Y7N I;  1VQ5 1;  1NJI Q;  1JNM A;  2QM7 A;  3IR9 A;  1Y8C A;  1YUK A;  1K83 I;  1VQN Z;  2KZI A;  4AYB A;  3I07 A;  1LTS C;  3CCQ 1;  2V3V A;  3KIF A;  2PM9 A;  3OW2 O;  2M8R A;  1X9V A;  4DT0 A;  2WAQ A;  1NAY A;  3EQ2 A;  3CC2 Z;  1EDK A;  5AW0 B;  4RO0 A;  1SQQ E;  2JWA A;  2WPV B;  1KC8 2;  4GOD A;  3T97 B;  4UB8 H;  3U1A A;  2R32 A;  3GTM S;  2KIK A;  4BBR I;  2YO2 A;  3L72 E;  3H1L E;  5GTI E;  1LT9 B;  3H6P A;  2O01 H;  1FAV A;  2W6J H;  1JY3 P;  1N8R Q;  3IF4 A;  2C9L Y;  3H32 B;  1JJ2 Y;  2QLV B;  2QJP B;  3NFQ A;  3B8E B;  2W83 C;  1SQB E;  2HFE D;  3B5N D;  1VQP Z;  2GTI A;  1IZN B;  1USE A;  4TNU A;  2NVY I;  3FKI I;  4PD4 E;  2KP8 A;  3L73 D;  3OW2 Z;  1GK6 A;  2RMZ A;  3QWO C;  4I1L A;  5AW4 B;  2AEM A;  2E5Y A;  4NB9 A;  3JAM b;  1GD2 E;  4BBS I;  1LT9 C;  2FY8 A;  3OAK A;  4LGD E;  4NH1 C;  4U3F D;  2BEQ D;  1KYO D;  4AQR D;  3D71 A;  2KS1 B;  3FX0 A;  2QJP C;  5APT A;  2WB1 A;  3K5B A;  4U3F J;  1YHQ P;  3L75 E;  1KB9 I;  3L35 A;  3SWF A;  3CWB E;  4N78 E;  1YYC A;  3B5N B;  1BCC G;  2QRD B;  1AVY A;  4C7N B;  3S14 I;  3IF8 A;  5AVZ B;  2KLV A;  1VQK 1;  1NTM K;  5FLX b;  1JEK A;  3C1L A;  3ITK A;  3G71 Z;  2IYO A;  3CPW O;  5APW A;  2H85 A;  1NOH A;  1NGM B; 
#chains in the Genus database with same CATH homology
 1YJ9 Z;  4NBF A;  3RGU A;  3NDI A;  4A3I I;  1VQ7 Z;  3K7A I;  3J81 f;  3I56 1;  2JA8 I;  1TWC I;  1VQ5 Z;  5A2Q b;  2R44 A;  2I8D A;  3P5J B;  1H0T A;  1OVU A;  3CCU Z;  5D1P A;  4HJG H;  3HOU I;  1N8R 2;  3CCQ Z;  3GTQ I;  5EFW B;  3T4N B;  3QWU A;  2F4M A;  3NDJ A;  1Q86 2;  4A3D I;  1K8A 2;  2B87 B;  1JWH C;  2Q51 A;  4RVD A;  1Q81 1;  4NOZ A;  2E2J I;  1DEE G;  2IZ4 A;  3D9X A;  1M90 2;  1KRL A;  1YJW 1;  1VQN 1;  2OTJ 1;  3M4O I;  3PO3 S;  1U7M A;  3GTP I;  4A3G I;  4KJM A;  1K9M 2;  1YJN 1;  4ZMD A;  3G4S Z;  2OOX B;  4MN4 C;  3S15 I;  2PK7 A;  5C4J I;  3CME 1;  4RS4 A;  2VF1 A;  2K5R A;  2JA6 I;  5IT9 f;  2GTH A;  1L1O C;  3ESW A;  4E33 A;  3CCV Z;  3HOZ I;  5D1O A;  4E2W A;  4A3L I;  3J7A 4;  3EER A;  3HOX I;  4A3C I;  1SFO I;  2OOY B;  1I6H I;  3FXD A;  5AN9 F;  4MON A;  3GKQ A;  2KZJ A;  2B63 I;  5C4X I;  4NBD A;  3GTO I;  4MD9 A;  1TWA I;  3GTG I;  2QRE B;  3S1Q I;  1BDC A;  1JMB A;  1YIJ 1;  4CL1 A;  3I55 Z;  1ZH1 A;  3CC4 1;  3GCF A;  3HOV I;  2DE7 A;  4CPG A;  2JWD A;  1JJ2 Z;  3CCJ 1;  3RZO I;  2QA4 Z;  1RLY A;  4A93 I;  4X6A I;  4GOF A;  1VQL 1;  2OTL 1;  1S3J A;  2QKD A;  1N8R 1;  4QTU A;  2O53 A;  2JA7 I;  1VQM Z;  2K3R A;  1VQ9 Z;  4Y52 I;  2SPZ A;  2Y0S A;  4DQY B;  3CCE Z;  1KQS Y;  2BJO A;  1VQK Z;  1Q86 1;  3D6W A;  1USP B;  1K8A 1;  2YU9 I;  1NUI A;  3HKZ A;  1Y1V I;  4ASW A;  2RBL A;  1M90 1;  5K5G B;  3FQQ A;  3H0G I;  1Q7Y 2;  2G2K A;  5T67 A;  2HR3 A;  3VMI A;  2WMM A;  3CCR 1;  1VQ8 1;  1W2B Y;  3Q87 A;  1YUA A;  3TE5 B;  1TWG I;  1Z01 A;  3I56 Z;  1K9M 1;  3CCM Z;  3JAM f;  3GTL I;  1VQO 1;  3BG1 B;  3IFU A;  2J6A A;  4NBC A;  2E2I I;  5D1O B;  2NVQ I;  3FQM A;  3G71 1;  1X3W A;  4HH4 A;  2P3Y A;  3J80 f;  2KI7 B;  1WW9 A;  2DE5 A;  1RO0 A;  1Y1V S;  1QVF Z;  3GTJ I;  1ZB8 A;  1RO4 A;  4K35 A;  3CMA 1;  2EGT A;  2QRC B;  1YHQ 1;  3CCS 1;  3CC7 1;  3GTM I;  3MZL B;  2KPI A;  3F3F C;  1I3Q I;  1X0T A;  1U7J A;  1YJW Z;  4HB1 A;  1K73 1;  2OTJ Z;  2GU2 A;  1WCM I;  4NPF X;  4JBZ A;  5FLX f;  1NVO A;  3TDH B;  3PH0 A;  5IP9 I;  1YJN Z;  4BY1 I;  3CCL Z;  4HGY A;  2YAD A;  2JMO A;  3NH5 A;  2O4H A;  1I50 I;  2QR1 B;  2RPR A;  3CD6 1;  1X3Z A;  1VLA A;  1SS1 A;  1M1K 2;  3CME Z;  3GTK I;  3I4N I;  3G6E 1;  1N2F A;  3OW2 Y;  3CC2 1;  2M5A B;  4HGZ A;  1YIT 1;  4RV9 A;  1RO2 A;  5A2Q f;  1P9N A;  3CXC Y;  1QVG Y;  1Y47 A;  2JR6 A;  3S2H I;  4E2X A;  1EDI A;  3HOY I;  2R93 I;  1DL6 A;  1FC2 C;  1VQ6 1;  4A3F I;  1K73 2;  4WWI A;  1Q82 2;  1Q7Y 1;  3S1N I;  1JM0 A;  1YIJ Z;  2VUM I;  1VQP 1;  1NP6 A;  3CC4 Z;  4NPD A;  2ZAE B;  1H0T B;  5T6B A;  5C44 I;  4HKZ H;  4MXU A;  1S72 1;  3CCJ Z;  2QEX 1;  1TWF I;  2M6N A;  1VQL Z;  2P58 A;  2JUB A;  5T64 A;  3S1R I;  3J81 b;  1YI2 Z;  3H3V J;  1BDD A;  2PMZ A;  4XX2 A;  2W04 A;  1MFT A;  3VMH A;  1EC5 A;  4MH4 A;  2NVX I;  2F4O A;  2JA5 I;  3I55 1;  4E30 A;  1LT1 A;  4ASV A;  2QVA A;  4EYY Q;  1LQL A;  4NBG A;  4NPE A;  3LUS A;  1NJI 2;  4A3B I;  2KUB A;  5DJT B;  2E2H I;  4BY7 I;  1ZXG A;  4NBH A;  4BXL A;  4RVH A;  3CCR Z;  2NVT I;  1VQ8 Z;  2LR2 A;  2LFU A;  4K3A A;  4A3E I;  2R7Z I;  1VQO Z;  3RZD I;  5LL6 f;  2P28 A;  1Z02 A;  3M3Y I;  1ZB9 A;  1VQ4 1;  3NH8 A;  3ZDM A;  4A3K I;  3FXE A;  1M1K 1;  4E32 A;  2HU9 A;  4E2Y A;  2UWJ E;  2RHB A;  2RKL A;  1KQS Z;  1Z03 A;  1YJ9 1;  4ZNC A;  1RQF A;  1WII A;  4NBB A;  3CMA Z;  5IT9 b;  1YHQ Z;  3CPW Y;  3CCS Z;  1Q2N A;  3CC7 Z;  2RT9 A;  1VQ7 1;  3HOW I;  3CCM 1;  4NBA A;  4Y7N I;  3PO3 I;  1VQ5 1;  2I3C A;  4A3J I;  1RNI A;  4GOE A;  1YUK A;  3F3P C;  1S7M A;  3CCU 1;  1K83 I;  1VQN Z;  1Q82 1;  2KZI A;  1W2B Z;  4AYB A;  3I07 A;  3CCQ 1;  3KIF A;  2V8J A;  2PM9 A;  2AKL A;  1Y1W I;  3S17 I;  3VTN A;  3CD6 Z;  5C39 A;  3VMG A;  2E9H A;  2M48 A;  3IX0 A;  1KD1 2;  2JNY A;  1PFT A;  3G6E Z;  3EED A;  1OVV A;  2WAQ A;  4MD8 A;  1LP1 A;  4S1T A;  3CC2 Z;  3MZW B;  1EDK A;  1YIT Z;  1USP A;  1KC8 2;  4GOD A;  4MRI A;  3CPW Z;  2RIQ A;  3GTM S;  1QYP A;  2KIK A;  4BBR I;  1R9T I;  2R6M A;  3CCL 1;  4IOI H;  1EDL A;  4A3M I;  3G4S 1;  3NFZ A;  5DJU B;  3S1K A;  4NB8 A;  4DK1 A;  2LIY A;  1VQ6 Z;  3KIH A;  1TWH I;  1TFI A;  1JJ2 Y;  1NJI 1;  2QLV B;  3S1M I;  4RVF A;  1VQP Z;  3S16 I;  4NFR A;  4E2Z A;  3CCV 1;  5CBN A;  2GTI A;  4TNU A;  4RVG A;  2NVY I;  1S72 Z;  3FKI I;  2QEX Z;  3MON A;  2Q1K A;  3NH4 A;  3OW2 Z;  2OTK E;  2B89 A;  1Q81 2;  3I4M I;  3PO2 I;  2OTL Z;  3QWO C;  4E31 A;  4NB9 A;  2VUG A;  3JAM b;  4BBS I;  4EWC A;  4NH1 C;  2B87 A;  5CM2 M;  1QF8 A;  5FLM I;  3CXC Z;  1QVG Z;  2KS1 B;  1OVR A;  2QRX A;  1ML8 A;  2V8I A;  2DE6 A;  4QTT A;  3J80 b;  2WB1 A;  2LXC B;  2OZK A;  3MHV A;  3MZK B;  3U50 C;  1EDJ A;  2QA4 1;  3VB9 A;  5IP7 I;  2LXB A;  2HF1 A;  1YI2 1;  2QRD B;  1ZW0 A;  3BG0 B;  3S14 I;  3IF8 A;  3S2D I;  1VQM 1;  1VQ9 1;  4DGL A;  1LP1 B;  2M0B A;  2M5A A;  5CBO A;  2IZ3 A;  4MD7 A;  3CCE 1;  4BXX I;  1VQK 1;  1QVF Y;  1VQ4 Z;  5FLX b;  1KD1 1;  2B88 A;  2V8K A;  3G71 Z;  4NBE A;  2JS4 A;  3CQZ I;  5C3E I;  2Q4Z A;  2W03 A;  2H85 A;  2R92 I;  1KC8 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...