1X0TA

Crystal structure of ribonuclease p protein ph1601p from pyrococcus horikoshii ot3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
IVKRRDWEKKEKKKIAIERIDTLFTLAERVARYSPDLAKRYVELALEIQKKAKVKIPRKWKRRYCKRCHTFLIPGVNARVRLRTKRMPHVVITCLECGYIMRYPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 4
publication title Crystal Structure of a Ribonuclease P Protein Ph1601p from Pyrococcus horikoshii OT3: An Archaeal Homologue of Human Nuclear Ribonuclease P Protein Rpp21(,)
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 33
structure length 106
sequence length 106
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2005-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1x0tA01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1x0tA02
3FXDA 2JWDA 1EDLA 3QWOC 1OVRA 2Q1KA 4NPDA 4GOFA 2M5AB 2KIKA 2LXBA 1EC5A 4GODA 3S1KA 3PH0A 1H0TA 5C39A 4NPFX 1LP1A 2KZIA 4KJMA 2QVAA 2UWJE 1FC2C 1Y47A 2I8DA 2WMMA 5K5GB 2M0BA 2KS1B 1LP1B 4K3AA 4BXLA 1Q2NA 3ZDMA 4ZMDA 1DEEG 4ASVA 2OTKE 4HJGH 2B88A 2QRXA 1EDKA 1S3JA 1OVUA 2KZJA 1NVOA 2B89A 1U7MA 1X0TA 2B87A 4MN4C 4IOIH 2KUBA 1SS1A 4CPGA 4EYYQ 3MHVA 2M5AA 1H0TB 4K35A 5EFWB 4HKZH 2KI7B 4ASWA 5CBNA 2HR3A 5DJUB 4ZNCA 5CBOA 2RKLA 2ZAEB 1EDJA 3FXEA 1JMBA 1U7JA 1EDIA 1JM0A 2R44A 2SPZA 5DJTB 1OVVA 1BDDA 2LR2A 1ZW0A 4WWIA 1MFTA 4GOEA 4NPEA 2K3RA 4HB1A 1LT1A 1ZXGA 2LXCB 2P58A 4JBZA 3RGUA 1BDCA 2B87B 3MZWB
chains in the Genus database with same CATH superfamily
1E5WA 3D6ZA 5APVA 2JR6A 2OGUA 2P2UA 3CCMP 1BE3D 3L71J 1L0LJ 5H2FH 1VQP1 2YNYA 3A7OA 3V2PA 3H1JD 2PGDA 1FZCB 1VQ5P 2QEXP 2N9YB 3L70E 1W5CE 4IL6X 3SWKA 2GTHA 3K7AI 2I8DA 4RVHA 1X22A 2VUMI 3CX5E 2W04A 1VQ71 2AXCA 1T6AA 4A3BI 2KLUA 3S2DI 3OAKA 4JPZB 3T97A 2G2KA 5AN9F 4UB8E 1KFNA 2NVQI 3TGUD 1N73C 1J1DB 2FYUG 3PP5A 1Q81Q 3CPWZ 5B66H 4H0LD 2B89A 3ABVC 4H0LC 3R4YA 2E2HI 3BCCJ 2M48A 2O01J 2BCCE 4E2WA 1S4XA 1FBMA 1AVOA 3HUSA 3MHVA 5EFWB 1MV8A 2NPSD 1PZQA 1VQM1 3VMIA 2NPSC 3H25A 1VQ8Z 3TE5B 1ML8A 1M1JA 4H13D 3C9IA 5CCHD 2WSSH 3SFEC 3L37A 5CCHC 1X8YA 3H1KJ 5GTHH 2JMOA 1PGQA 1JM0A 1FDIA 3B71A 2QM8A 3H1IG 3KIHA 4TNUA 2M6NA 3E1RA 4NPEA 3CC4P 3OW2Y 2J59M 3SWYA 2OZKA 3BRTB 1ZXGA 1N2DC 1SQQE 3VN0A 2Y0EA 1VQPP 4A7PA 1M8OB 2OTJ1 2OYHB 2KIKA 3CCRP 3K5BA 4DGLA 1T3JA 1K9MQ 1RF0A 2K9JB 2O3JA 2V8JA 1N7LA 4XA4A 1VQ7P 3MGNA 4A3MI 5KJ7A 3VMHA 3V4WA 3VMAA 3HOWI 2DE6A 1JEKA 2QSIA 1VF5B 3CX5H 1BE3G 1EXIA 4DK1A 1M57D 3H1JG 5APYA 1K05A 1L0NE 1IFPA 1RQUA 3QH9A 2OTKE 3EFGA 1N7SB 1SLQA 5FLMI 1WRGA 3D6YA 2JUBA 1P9NA 4A93I 1S5LH 2YMKA 5KKZB 3AEEC 1USEA 4HH4A 1P84E 1SFCC 5CBNA 1R5SA 4BXXI 2LFUA 1YIT1 2OQQA 4PD4E 2O53A 2O4HA 4TLFA 3MD0A 1PP9E 1Q7YQ 1NJIQ 2IYPA 1IFMA 2WSEH 1MFTA 3GW6A 1S721 1RF1B 3CMA1 3KZIH 2O1KA 1DEBA 1ZR2A 3G9RA 3RK3D 1Q861 4U7JA 2V3VA 3HE5A 5KJ7D 1VQ91 1GW3A 1YJ91 3KXDA 1OFCX 4U3FE 5KJ7C 2WVRA 1KYOE 3V2RA 2E76D 3VTNA 1P84I 4H44C 1FDOA 3PJSK 3F3FC 1NTMJ 4PD4I 2R5DA 1VQLP 1H8AA 1VQ6Z 2XV5A 1YTZT 3RK2C 3F89A 2QRCB 5KTBA 3CC7Z 4KJMA 4PJ0H 3IF8A 1M56D 4W7YA 2CPBA 4MXUA 1ZMEC 2HPCA 1NHLA 4L76A 1NP6A 2YADA 2FXMA 3HD7C 2GUVA 2FYUE 4IL6H 1WIIA 1XTGB 3AECC 3L70D 2JIPA 4H13B 1Y1WI 1JWHC 5B5EE 2YMYA 1QXFA 4XFJA 4DQYB 1LTBC 4KT0J 1A02F 4GDOA 1SQVK 3CX5D 2VPXA 2XKMA 4RJTA 1LTJB 2RH0A 1J1EB 1NH4A 1YBKA 2P67A 1IFIA 2OTLZ 1KB9H 2Q6QA 3AE9C 3G3ZA 1BCCD 3JSVC 1JTHA 1XTCC 4E30A 3AE5C 2W90A 1KD11 4LGDE 4HKZH 4Y28J 2JS4A 2WAQA 3AE6C 1ZH1A 2YO2A 1LGHB 5IP9I 4A3KI 5DJUB 3P8MC 3M9HA 2QREB 3TSIA 2R6MA 1IC2A 4BY7I 3AE4C 2P1JA 2BCCD 3HOZI 4L74A 1IFNA 3V2NA 4I6MC 2QJPC 2QA4Z 2Z5IA 2P28A 3G6EZ 1GL2A 1URQC 1NTKK 1RH5B 4W80A 5APTA 2M8RA 4AYCA 2AEJA 2V7QJ 3AE3C 2JIOA 5T67A 3TYYA 2Q7CA 1KYOH 2KSEA 3CD61 4NBAA 1SQBJ 2PFXA 3H0GI 4HGYA 3HUSB 1DX7A 3KQGA 2WPRA 2KSJA 5AW6B 1QX8A 5E79H 1PPJD 3IF4A 2PM9A 4AQRD 1ZB9A 3BG0B 2XU6A 1M1JB 2QVAA 1WMKA 2UWJE 2LKMA 2D2CD 2L5GB 3H1JE 1KC81 4E2YA 2RBLA 3L75D 4YXDC 3I55Z 2PK7A 3WU2H 2W83C 3VP9A 2YU9I 3CCL1 2VPZA 5B5EH 1SQPJ 4OWFA 1LNQA 1W2BY 3TGUE 1GK6A 3RL0g 1YHQZ 2ZXEB 2YKQA 4E2XA 4RS4A 3L70G 4AUWA 1GK4A 3RK3B 3S1QI 5C3EI 2QE7H 1PGJA 1NOHA 1GL2D 3GTMS 1VQN1 5IT9b 1NTZK 1U57A 2E76B 1PFIA 1M901 1QVFZ 1KB9D 3EERA 3I5CA 1FZCC 1BCCG 1KV4A 3S14I 1OIPA 2ZVNB 1VQ5Z 3E7KA 3VB9A 2QEXZ 5KLVJ 1PV3A 2ZXXA 4D6TE 5APWA 1NJI2 1N8RQ 2K9JA 3IR9A 1RO0A 3U1CA 4MD7A 2BCCG 2IZ4A 1KN7A 1FZAA 1I3QI 3M3YI 2P10A 3RL0D 1J1DC 3H3VJ 2QLVB 1E79H 4OGQB 3CCJZ 4NPFX 4U3FD 1KYOD 1SIWA 3USSA 1Q90D 3OW2Z 3LW5H 4NBGA 5C4XI 3LIDA 1JY3O 2B63I 1VL2A 1NKZB 3TDHB 4N78D 3A0BH 1JB0J 2A06D 1KZUB 5H2FE 1DH3A 3IN6A 1PPJG 4RESB 1FZGA 1MFZA 4XE5B 1L4AA 4RVFA 1CW5A 1GZLA 3HE5B 3G6EP 1EDKA 3CC21 5D1PA 4EIJA 4R4LA 5AW3B 3L75G 3M9QA 3CC4Z 2KUBA 1VQPZ 3P8CE 1SQXJ 2IFMA 2Q5UA 1CI6A 3S4RA 2N9BA 4NBDA 4Y52I 2OYHC 4DOJA 3CL3D 3L36A 5B66E 5IP7I 3CCRZ 2QR1B 1NWQA 2FYNB 2QRDB 1YJW1 5APXA 3FXEA 1BGYJ 1LT9A 4JF7A 1KQFB 1VQ7Z 1T2KD 2A45H 4GOEA 1QL1A 4EOTA 4E2ZA 2D2CB 1VF5D 2QJYB 4OVNF 3H1LD 1VF5C 1AVYA 4NB8A 1HJ0A 1BDCA 2XNDH 5IT9f 5GTHE 2H88C 2CK3H 3RK3E 2WPQA 1JTHB 4NBHA 1RLYA 1N7SC 2HG5D 3C8VA 1PGOA 2GU2A 1Y8CA 1YYCA 1H0TA 3EEDA 3L4FA 2HODB 1VQMZ 4PV1D 1L4AD 4NOZA 3GTKI 2K5RA 2JDIH 5KKZC 3V2QA 1BSNA 2J5UA 1LTJA 3CME1 2P7JA 2JA6I 1GL2B 4GIFA 4K3AA 4U3FG 2NZ2A 3WUTA 4R4MA 3CWBD 2K1AA 1AFOA 1Q82Q 3KYQA 3L74D 2IYOA 4WB4A 1T8ZA 2XZRA 3CCQ1 2ZJSE 1YJN1 1IK7A 1RF1C 1KILD 2F4MA 3AEDC 2R7ZI 2YXRB 3L73D 1KORA 3GTGI 2YKPA 1UIIA 1K73Q 2F4OA 1SQVD 1YJWP 1QVFY 1YUKA 4ASWA 1BCCE 4EWCA 3R2PA 3RL0B 2GM4A 2BASA 2BCCJ 3VMZA 3F5HA 3CCJP 1R8EA 1IFJA 2R3SA 1VQLZ 3D70A 5AVRB 3I561 2W6JH 1VQ41 3GG2A 1S5LE 3G711 2PP6A 3FKII 4A3EI 1YIJ1 3CX5I 2WQYC 2OYIA 2N1TD 2PAJA 4H13C 3NFQA 1N8R2 4NPDA 2Y0DA 1NTKD 4D6TD 4DJGA 3M9BA 1IK9A 4CL1A 3I4MI 3VMYA 2K9YA 1SQQJ 1LTJC 1J1EC 3BCCE 4I1LA 3H1HD 1IFDA 3Q87A 3KZIE 2JIMA 2W03A 3L72D 2OARA 2AEMA 2I1JA 1WCMI 2Q4ZA 1PPJE 1PL5A 5C44I 1DL6A 2JNYA 5AVQB 3JAMb 3CCQP 3TNUB 4IFFA 3Q1MA 1LP1B 3AEGC 2AXTH 1YUAA 3BASA 3CQZI 2E75B 2KNCA 1K8A2 3L75E 1Q2NA 1S72Z 3WMM0 1R5LA 3CMAZ 2JR8A 4PJ0E 1N86A 2NRGA 3MZLB 2NVYI 1M1K2 3GCFA 1UIXA 1YJ9Z 1NU1J 4IL6E 1L0NJ 3W67A 2ZYGA 1K83I 3VP8A 1NTMK 4OH8B 3CWBG 3TDKA 2NVXI 3S2HI 3L74G 3HUSC 1TWCI 1JY3N 1NUIA 1VDFA 1VQMP 1YIJP 1M1JC 3L73G 3P8CD 1KB9E 1X79B 3IFMA 2LR2A 1W2BZ 4PV1B 5CCGA 1HH0A 1L4AB 1SQVG 2E9HA 1NTZD 3TK1A 3FWLA 3D2LA 3TGUG 1FJKA 2P58A 2R32A 4S1TA 1NYHA 1PP9J 1GMJA 3CXHH 3EFFK 5AW9B 1Y8AA 3II6A 1Y1VS 3CLQA 1JNMA 2LXBA 5M1BA 1CI6B 1YI21 4UB6H 2O01H 1VQO1 4YPCA 4U3FJ 1JMMA 1KB9I 5AVTB 2OTJP 1FC2C 1KILB 3G4S1 1JCCA 1RF0C 1RE4A 3N7NA 3RK3C 2A45G 4C46A 1RNIA 1LT9B 1NTKG 3AEBC 2Z4EA 3PO3I 4D6TG 3JC22 3RBZA 2Q51A 2JEEA 2E76C 2E5TA 1KMIZ 3H1HG 2KLVA 3L72G 5E79E 3NDJA 3W68A 3ZDMA 4N78E 1KTMA 4Y7NI 3MONA 2A06E 1VLAA 1ZN5A 1FZBA 3V5BA 1JJ2Z 1L2PA 2FYUJ 1U7MA 1FOSF 3VTPC 3S1RI 5AW2B 1HUCA 3ITKA 5AVYB 2WSFJ 3WU2E 1Q86Q 4NBFA 1SQBK 2KK7A 2POHA 1H0TB 1HGVA 2N1TB 1NTME 3S9OA 5CCGD 1KYOI 3JAMf 5CCGC 4XX2A 3U1AA 4OGQD 4OGQC 3T4NB 1Q812 1OVVA 3L71D 1BDDA 1YITP 3H1IJ 1Z01A 3A0HH 3S17I 1AA6A 1RO2A 2HFED 3NTNA 1QEXA 2LXCB 4JBZA 3S15I 3CPWO 3GF3A 2HODA 2VPWA 5FLXb 3CCS1 1YI2P 2H85A 1SQPK 1S72P 1VQOP 2WSCJ 2W6AA 3H1LE 3CMAP 1QVGO 4ZKPA 1RE4C 3G4SP 1AV1A 3HOYI 3FGAD 3SWFA 5AW0B 1NTZG 1WJ2A 1VQ9P 3CXCZ 1JY2O 1YJ9P 1OW7A 3CXHD 3S1KA 3RZOI 3AE1C 1RHZB 4DZOA 1S2EA 3O6QB 1LWUB 5AW5B 1VQNZ 5KLIB 4NBBA 1KD1Q 3BCCD 2WMMA 1YQ4C 2RT9A 2WT7B 2C0WA 1BE3J 2QG4A 4HH2A 2G3AA 2IPPA 2FYZA 3PLNA 2FYNC 4BXLA 2OYIB 3H1JJ 5KLVK 3I07A 2B88A 2QRXA 3M0DA 1K9M2 3H1KD 1FZEA 2D2CC 3CWBE 4A3FI 2QJYC 4WY4A 2V8KA 3L35A 3CCE1 3L74E 4GKGA 3J80b 3A0BE 3MUDA 3WUUA 3GMAA 1USPA 1SQBE 3KHUA 4HGZA 1KILE 4A3DI 4QMAA 4QTUA 2OOXB 3L73E 2AYDA 3FQMA 4N6JA 3TGUJ 4ZNCA 5CBOA 4L75A 3GHGA 1SQVE 1LTAC 2H8PD 5KAFH 2OTL1 5BU8B 1GTWA 3HTKB 2RIQA 3V6IA 1Z02A 2WZ7A 3VMGA 3PTZA 1AA0A 1ZW0A 1J2JB 2BEZF 2QM7A 3CCSP 2KNCB 5A2Qb 5APSA 3CCU1 2WSFH 1FDMA 4MONA 1KC8Q 3MZKB 2FFDA 4A3JI 2P3YA 1GL2C 3M91A 4BBRI 3CC2Z 3FXDA 1L1OC 1H89A 4I7ZB 1LTSC 3L71G 2JIRA 2QA41 3VOPA 4D6TJ 4JYCA 1ZR4A 5TISH 1JY3P 1WT6A 1NTKE 3TNUA 3JCUH 4BRYB 5C39A 1LP1A 3M0AA 3CD6P 1Q7Y2 1X3ZA 3VMXA 1SQXK 3NMDA 3H1HE 3RBXA 5AW8B 3L72E 2FBWC 4LLHA 3PHLA 1YJWZ 3VYIA 1LTGC 2RN0A 2XDJA 3U59A 2V8IA 5FLXf 4WY4D 3BATA 3RL0C 1M90Q 1QYPA 1M7LA 1Y9BA 2I3CA 1JJ2Y 1K8A1 2R93I 1DEEG 4ASVA 3MUDC 3NXSA 5KLVE 3PO3S 1S3JA 2KZJA 2QJKB 1M1K1 1TWAI 2A45I 3CCLP 3BCCG 2H7HA 1GD2E 5D1OB 2V7QH 1QF8A 1KQSO 1SVFA 4C7NB 1EZVD 3E1IA 1H88A 1ZB8A 2ZFCA 3OJAB 2YXQB 2ZYDA 1S9KD 2HF1A 1FOSE 4NBEA 3H1KG 2H43A 2ZYAA 5LL6f 4NB9A 4Z1MH 1YHQ1 1RE3A 2G8YA 2LEXA 3HOXI 3GKQA 2SPZA 1A02J 1NTMD 1VQNP 1WZNA 3EWKA 1GDTA 2ITAA 3P32A 1T3UA 1L0LK 2VPYA 3CCM1 1NTZE 1JO5A 3J7A4 2E75D 2OOYB 3AE8C 1KILA 3CCQZ 2E75C 1NO4A 2BEQD 3CXCY 1VQ51 5C4JI 1G2CA 2Z5HA 1NAFA 2B9BA 1EC5A 1T2KC 4QTTA 2KZIA 3NH8A 1GU4A 2AKLA 3CI9A 2Q9IA 2ZT9D 3LIEA 4GT1A 1RY3A 4MRIA 3IX0A 1HTLC 2EGTA 1BGYE 1FAVA 3J81b 3MTUE 2N1TA 2I1KA 1YIJZ 1CSBA 4IFMA 4PV1C 1L4AC 1NVOA 5T6BA 2B87A 4Y99B 5GTIH 4MN4C 2FY8A 2YO3A 2E7ZA 1JY2N 3CC2P 1RE3C 2HU9A 4BBSI 2AXTE 2E74D 3P7KA 3L70J 1HJBA 3A2AA 1SQQK 3FX0A 2C9NY 2M3EA 2IX7C 2W6BA 3CC41 4NBCA 1SQBD 1EDJA 1RQFA 1EZVG 1Q811 1KILC 2A06G 1KQLA 1BCCJ 2OTJZ 1VQK1 3B4SA 1LT9C 1GU5A 3L71E 1L0LE 3GTOI 1ZV8A 3O8ZA 3CCR1 3MZWB 4E32A 4WY4B 3O6QA 1LWUA 3QWOC 1KC82 3HRNA 3UIAA 1NTMG 4GOFA 1USPB 3IAOA 2E43A 3H6PA 2WT7A 1NU1K 3NDIA 3CCV1 1L0NK 1SQPD 3HOUI 2YIUB 3Q3DA 1DIPA 1X9VA 3BRVB 3GHGB 4O9BA 3HE4A 1QVFO 1Y47A 3CXHE 2JP3A 2Y9YA 3GTJI 2N1TC 2IV2X 1NAYA 5AVSB 2KXPB 1QVGZ 2WSEJ 2AEFA 3AEAC 5K5GB 2KS1B 3GLMA 2QKDA 3S1MI 4EDFA 5CMZA 4RO0A 4UB6E 1HGZA 2FFDB 1OXZA 3H1LG 3CMEP 1M902 1K9M1 2GUSA 1YITZ 2K37A 2E42A 4IOIH 2WPVB 3Q5PA 1AQTA 3L75J 3HTKA 1SFCA 3H1KE 4EYYQ 1N2FA 5KLVD 3CXHI 2M5AA 3ESWA 5AW4B 1YJNP 2Y9ZA 3KDPB 1YI2Z 1VQOZ 3EQ2A 4NFRA 3J81f 2RKLA 2RPRA 2O01N 3OW2O 1VQKP 2C9LY 3Q2YA 3G4SZ 2Q3IA 3D9XA 1VQ9Z 1U7JA 1EDIA 4A3II 2JA5I 4ZKUA 2PRRA 1LWUC 2IBZD 1G1IA 5CHXA 4RV9A 5KLIC 4WWIA 4MH4A 4RKUJ 2ZT9B 2HLOA 3B5NB 3I56P 1VQ4P 3WUVA 4RVDA 3V4QA 4BRYA 3G71P 1VQL1 2C0XA 3AEFC 3CCVP 1TU3F 2JWDA 1SQBG 3FWNA 1HBWA 1OVRA 1FJPA 2OYIC 2FYUK 3BG1B 4GODA 3M4OI 3MIWA 1NU1E 2R5BA 3A0HE 3Q5SA 4UB8H 1VQ81 1Q7Y1 3Q5RA 5CM2M 2WITA 1NJI1 2MJZA 3HD7A 2J58A 3RZDI 1JUNA 2NVTI 5L8RJ 2W8ZA 3GTMI 2QIWA 3GTLI 3HKZA 2VUGA 3FQQA 2KPIA 2E74B 1Z56A 5AVXB 1CZQA 5D1OA 5AVWB 4B86A 2Y0CA 4C7NA 1SQXD 1TWHI 1SFCD 1SQPG 4I2LC 4IFDK 2V4HA 4ZMDA 3D6WA 2W27A 3SFDC 3N4XA 1QLED 1PGPA 1PFTA 3CCSZ 2KOGA 1BGYD 1G2CB 1KRLA 4M3LA 4I7ZC 4DT0A 2JKVA 1EZVE 2HR3A 3S16I 2FKWB 2Q3EA 4RVGA 1I6HI 4H44D 2IZ0A 3I4NI 2E2II 1YTZI 1S9KE 1URQA 1JMBA 1Q822 2R44A 1N73B 1KQSZ 2WWWA 3B8EB 5KLVG 3CD6Z 2E2JI 3RK2D 3PO2I 1QGKB 4H0LB 1KQGB 1KFMA 3RGUA 2JA8I 2B87B 1X3WA 1K732 1JY2P 3HD7D 1ZRTE 5KAFE 1VQ8P 4E33A 1EZVI 2NPSB 2IBZG 1DD4A 3CCEZ 3NH5A 1HF9A 1L0LD 3H32A 2QJKC 2J6AA 5AW1B 1EXJA 3CPWY 1MKMA 1NKNA 1LJ2A 3CCLZ 3H1LJ 2IFNA 1QVGY 4TT3H 4A3GI 2M3BA 2DE5A 1G1JA 2FXOA 1TWFI 1MUUA 1OZHA 1JOCA 2OYOA 5TISE 3KPEA 3JCUE 4WVZA 1P84H 3CCUZ 1OWAA 3H1IE 2E5YA 4PD4H 1LQLA 4A3LI 3GTPI 3T97B 1SS1A 1URQD 1SQXG 1VQ61 1S1CX 3CC71 3HE4B 3LW5J 1YQ3C 3CWBJ 4MD8A 3NFZA 1FZCA 3L74J 2YKOA 4JYBA 1BGYG 1SFOI 3BVHA 4YXWH 3OA7A 5AVZB 1EQ7A 5CJ0A 1SQQD 3L73J 2VF1A 4L73A 2K3RA 1SQVJ 1BE3E 3M06A 3C1LA 1EDLA 4E31A 1S7MA 1SFCB 2RHBA 2M5AB 4AYBA 5TJHA 1R9TI 1FE6A 4Y99C 2KS1A 5KAIE 4EI2A 2GA1A 5AVUB 2NAPA 1RO4A 1TWGI 1D7MA 1SP4A 1VPCA 3TF5A 5T64A 1SQPE 4DCKA 2Y0SA 3A3YB 1K04A 2KP8A 3AE7C 1N8R1 1NU1D 2IZ3A 1L0LG 1NTKJ 2M0BA 1L0ND 3G6E1 3AE2C 5APQA 1W2BO 2HYNA 2KB7P 2IZ1A 3LUSA 3H1HJ 1AQ5A 3L72J 4H44B 4HJGH 1FS0E 3IR7A 3MP7B 1VQ6P 1USDA 2KYVA 2WB1A 3CCMZ 1PIXA 2V45A 3QWUA 2JO1A 3CC7P 3S1NI 1MZ9A 3RK2B 1IJDB 3M0DC 3KIFA 2XNXA 2K88A 1P84D 4BWNA 2MKVA 2WSCH 1OW8A 4WY4C 2OYHA 1JCDA 4K35A 4A3CI 4PD4D 3HD7B 1I50I 3CCEP 4JQ0D 1PP9D 3NH4A 1OW6A 4N3YB 3A5TA 2DE7A 3B5NA 1KQSY 5GTIE 2R3CA 2BJOA 3D71A 3SSUA 3I551 2YIUC 3GHGC 5BU5A 1FU1A 2OTLP 4WBAA 1LT1A 2IBZE 4W7ZA 2CPSA 1Q862 2FXPA 1HVVA 1N7SA 4NH1C 3HOVI 3CCUP 4X6AI 2FFDC 1ZLLA 2RMZA 2Q1KA 1K8AQ 5BVZA 1SQQG 3CMEZ 3F3PC 3GTQI 3PH0A 1NTZJ 1M1KQ 5CJ4A 5KAIH 1BSHA 1ZRTD 3J80f 3IFUA 2QA4P 3P5JB 1LTIC 2QJPB 3GF7A 2FYUD 1HWTC 2VRSA 1NGMB 1URQB 5APUA 2JIQA 1YJNZ 2IBZI 1Z03A 4BY1I 2GTIA 1ZP0C 2QEX1 2JJLA 2JA7I 2LIYA 2ZVOB 1FZFA 2DW3A 2WTYA 1VQKZ 5AW7B 1RF1A 2HPCB 1DD3A 4C7RA 5A2Qf 1SQXE 3PRJA 1OVUA 2PMZA 1S5LX 1X0TA 4KHXA 1IO4A 1RQVA 1NU1G 2ZT9C 3B5ND 1L0NG 3B5NC 3H32B 1ZOYC 1LTTC 4CPGA 1OX3A 3H1ID 1TFIA 1Y1VI 3I56Z 1VQ4Z 1N73A 1AJYA 1WW9A 4HYTB 3G71Z 1KD12 3CCJ1 5AVVB 3I55P 3CCVZ 2IDBA 2KI7B 2H89C 2R92I 2JWAA 4LC1A 1Q16A 1W2EA 1GW4A 2ZAEB 1N7SD 1Q821 5DJTB 2NPSA 1QL2A 2O1JA 1YHQP 4YTPC 4HB1A 1OMIA 2E74C 1PP9G 5CCHA 3U50C 1K731 2WPSA 2L91A 1IZNB 4MD9A
chains in the Genus database with same CATH topology
5FLXb 1VQL1 3CCS1 2H85A 1I3QI 2JWDA 3M3YI 2JR6A 1OVRA 3H3VJ 3BG1B 3HOYI 1VQP1 2QLVB 4GODA 3M4OI 3CXCZ 3RZOI 3S1KA 1VQ81 1Q7Y1 3CCJZ 4NPFX 5CM2M 1NJI1 3RZDI 1VQNZ 2GTHA 2NVTI 3OW2Z 3K7AI 2I8DA 4NBGA 4NBBA 3GTMI 3GTLI 3HKZA 2VUGA 3FQQA 4RVHA 5C4XI 2KPIA 2B63I 2VUMI 1VQ71 2WMMA 2W04A 2RT9A 3TDHB 5D1OA 4A3BI 3S2DI 1TWHI 2G2KA 5AN9F 4BXLA 4RVFA 4ZMDA 2NVQI 3D6WA 3I07A 2B88A 2QRXA 1EDKA 3CC21 5D1PA 3CPWZ 2B89A 1K9M2 1PFTA 3CCSZ 4A3FI 2V8KA 3CCE1 1KRLA 2E2HI 3CC4Z 2M48A 2KUBA 3J80b 4E2WA 1USPA 3MHVA 4HGZA 1VQPZ 5EFWB 4A3DI 4QTUA 2OOXB 1VQM1 3VMIA 3FQMA 1VQ8Z 3TE5B 4NBDA 2HR3A 1ML8A 4Y52I 4ZNCA 5CBOA 3S16I 4RVGA 5IP7I 3CCRZ 1I6HI 2QR1B 2OTL1 2QRDB 3I4NI 1YJW1 2E2II 2JMOA 3FXEA 2RIQA 1JMBA 1Z02A 1Q822 1JM0A 2R44A 1KQSZ 1VQ7Z 3CD6Z 3VMGA 3KIHA 4TNUA 2E2JI 2M6NA 1ZW0A 5A2Qb 4GOEA 3PO2I 4NPEA 4E2ZA 3CCU1 3OW2Y 2OZKA 4MONA 3MZKB 1ZXGA 3RGUA 4NB8A 4A3JI 2P3YA 1BDCA 2B87B 1X3WA 2JA8I 1K732 4BBRI 3CC2Z 3FXDA 1L1OC 5IT9f 4E33A 4NBHA 2QA41 1RLYA 3CCEZ 2OTJ1 2KIKA 3NH5A 2J6AA 2GU2A 4DGLA 3CPWY 1H0TA 2V8JA 5C39A 1LP1A 3EEDA 3CCLZ 1Q7Y2 1X3ZA 4A3MI 1VQMZ 4NOZA 3GTKI 2K5RA 1QVGY 3VMHA 4A3GI 2DE5A 3HOWI 2DE6A 3CME1 1TWFI 1YJWZ 2V8IA 5FLXf 4DK1A 2JA6I 1QYPA 2I3CA 4K3AA 1JJ2Y 1K8A1 2R93I 1DEEG 4ASVA 3CCUZ 2OTKE 3PO3S 1S3JA 2KZJA 1LQLA 3CCQ1 1M1K1 1TWAI 5FLMI 1YJN1 4A3LI 3GTPI 5D1OB 2F4MA 2R7ZI 1QF8A 2JUBA 1P9NA 4A93I 1SS1A 3GTGI 1VQ61 2F4OA 3CC71 4HH4A 1YUKA 1ZB8A 1QVFY 4ASWA 5CBNA 4EWCA 4BXXI 4MD8A 2HF1A 2LFUA 3NFZA 4NBEA 1YIT1 2O53A 5LL6f 4NB9A 1YHQ1 2O4HA 1SFOI 1VQLZ 3HOXI 3GKQA 2SPZA 3I561 1VQ41 3G711 2VF1A 1MFTA 1S721 3FKII 3CMA1 2K3RA 4A3EI 1YIJ1 1Q861 3CCM1 3J7A4 1VQ91 2OOYB 1EDLA 1YJ91 3CCQZ 4E31A 1S7MA 4NPDA 3VTNA 1N8R2 3CXCY 1VQ51 2RHBA 5C4JI 2M5AB 3F3FC 4CL1A 4AYBA 3I4MI 1R9TI 1EC5A 1VQ6Z 3Q87A 4QTTA 2W03A 2QRCB 3CC7Z 2KZIA 4KJMA 3IF8A 1RO4A 1TWGI 3NH8A 4MXUA 1WCMI 2AKLA 2Q4ZA 5T64A 1NP6A 2Y0SA 2YADA 5C44I 1DL6A 1N8R1 2IZ3A 4MRIA 2JNYA 3IX0A 2EGTA 2M0BA 1WIIA 3G6E1 3JAMb 1LP1B 3J81b 1YUAA 3LUSA 3CQZI 1Y1WI 1JWHC 1K8A2 1S72Z 1Q2NA 3CMAZ 4HJGH 4DQYB 1YIJZ 2WB1A 3MZLB 1NVOA 3CCMZ 2NVYI 2B87A 5T6BA 1M1K2 3QWUA 3GCFA 3S1NI 4MN4C 1YJ9Z 2OTLZ 3KIFA 2HU9A 4E30A 4BBSI 1K83I 4K35A 1KD11 4A3CI 4HKZH 2JS4A 2WAQA 1I50I 1ZH1A 2NVXI 3S2HI 5IP9I 4A3KI 5DJUB 3NH4A 1TWCI 2R6MA 2QREB 4BY7I 2DE7A 1NUIA 1KQSY 3HOZI 3CC41 4NBCA 2BJOA 1EDJA 1RQFA 3I551 1Q811 2QA4Z 2LR2A 2P28A 3G6EZ 1W2BZ 2OTJZ 2E9HA 1VQK1 3GTOI 1LT1A 2P58A 3CCR1 4S1TA 3MZWB 1Q862 4E32A 5T67A 3QWOC 4NH1C 1KC82 3HOVI 4X6AI 2Q1KA 1Y1VS 4NBAA 3CD61 3H0GI 4GOFA 1USPB 4HGYA 3CMEZ 2LXBA 1YI21 3F3PC 3NDIA 3CCV1 3GTQI 3PH0A 1VQO1 2PM9A 1ZB9A 3BG0B 3J80f 3IFUA 3HOUI 2QVAA 3P5JB 2UWJE 1FC2C 3G4S1 1Y47A 3GTJI 1RNIA 1KC81 3PO3I 1YJNZ 1QVGZ 4E2YA 2RBLA 1Z03A 2Q51A 5K5GB 4BY1I 3I55Z 2GTIA 2KS1B 2QKDA 2QEX1 2PK7A 2JA7I 2LIYA 3S1MI 2YU9I 3CCL1 3NDJA 1VQKZ 3ZDMA 4Y7NI 3MONA 1VLAA 5A2Qf 1M902 1JJ2Z 1OVUA 2PMZA 1K9M1 1U7MA 1X0TA 1YITZ 1W2BY 4IOIH 3S1RI 1YHQZ 4CPGA 4E2XA 4RS4A 4EYYQ 1N2FA 1TFIA 1Y1VI 4NBFA 3I56Z 1VQ4Z 2M5AA 3ESWA 3S1QI 1WW9A 1H0TB 3G71Z 1KD12 3CCJ1 5C3EI 1YI2Z 3CCVZ 3JAMf 2KI7B 1VQOZ 4XX2A 3GTMS 1VQN1 5IT9b 2R92I 4NFRA 3J81f 1M901 2RKLA 2RPRA 1QVFZ 3G4SZ 3D9XA 3EERA 2ZAEB 1VQ9Z 3T4NB 1Q821 1U7JA 1EDIA 4A3II 2JA5I 5DJTB 1OVVA 1Q812 1BDDA 3S14I 4RV9A 1VQ5Z 4WWIA 4MH4A 3VB9A 2QEXZ 1Z01A 3S17I 1RO2A 4HB1A 2LXCB 1NJI2 4JBZA 3S15I 3U50C 4RVDA 1K731 1RO0A 4MD7A 2IZ4A 4MD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXD A;  2JWD A;  1EDL A;  3QWO C;  1OVR A;  2Q1K A;  4NPD A;  4GOF A;  2M5A B;  2KIK A;  2LXB A;  1EC5 A;  4GOD A;  3S1K A;  3PH0 A;  1H0T A;  5C39 A;  4NPF X;  1LP1 A;  2KZI A;  4KJM A;  2QVA A;  2UWJ E;  1FC2 C;  1Y47 A;  2I8D A;  2WMM A;  5K5G B;  2M0B A;  2KS1 B;  1LP1 B;  4K3A A;  4BXL A;  1Q2N A;  3ZDM A;  4ZMD A;  1DEE G;  4ASV A;  2OTK E;  4HJG H;  2B88 A;  2QRX A;  1EDK A;  1S3J A;  1OVU A;  2KZJ A;  1NVO A;  2B89 A;  1U7M A;  1X0T A;  2B87 A;  4MN4 C;  4IOI H;  2KUB A;  1SS1 A;  4CPG A;  4EYY Q;  3MHV A;  2M5A A;  1H0T B;  4K35 A;  5EFW B;  4HKZ H;  2KI7 B;  4ASW A;  5CBN A;  2HR3 A;  5DJU B;  4ZNC A;  5CBO A;  2RKL A;  2ZAE B;  1EDJ A;  3FXE A;  1JMB A;  1U7J A;  1EDI A;  1JM0 A;  2R44 A;  2SPZ A;  5DJT B;  1OVV A;  1BDD A;  2LR2 A;  1ZW0 A;  4WWI A;  1MFT A;  4GOE A;  4NPE A;  2K3R A;  4HB1 A;  1LT1 A;  1ZXG A;  2LXC B;  2P58 A;  4JBZ A;  3RGU A;  1BDC A;  2B87 B;  3MZW B; 
#chains in the Genus database with same CATH topology
 1E5W A;  3D6Z A;  5APV A;  2JR6 A;  2OGU A;  2P2U A;  3CCM P;  1BE3 D;  3L71 J;  1L0L J;  5H2F H;  1VQP 1;  2YNY A;  3A7O A;  3V2P A;  3H1J D;  2PGD A;  1FZC B;  1VQ5 P;  2QEX P;  2N9Y B;  3L70 E;  1W5C E;  4IL6 X;  3SWK A;  2GTH A;  3K7A I;  2I8D A;  4RVH A;  1X22 A;  2VUM I;  3CX5 E;  2W04 A;  1VQ7 1;  2AXC A;  1T6A A;  4A3B I;  2KLU A;  3S2D I;  3OAK A;  4JPZ B;  3T97 A;  2G2K A;  5AN9 F;  4UB8 E;  1KFN A;  2NVQ I;  3TGU D;  1N73 C;  1J1D B;  2FYU G;  3PP5 A;  1Q81 Q;  3CPW Z;  5B66 H;  4H0L D;  2B89 A;  3ABV C;  4H0L C;  3R4Y A;  2E2H I;  3BCC J;  2M48 A;  2O01 J;  2BCC E;  4E2W A;  1S4X A;  1FBM A;  1AVO A;  3HUS A;  3MHV A;  5EFW B;  1MV8 A;  2NPS D;  1PZQ A;  1VQM 1;  3VMI A;  2NPS C;  3H25 A;  1VQ8 Z;  3TE5 B;  1ML8 A;  1M1J A;  4H13 D;  3C9I A;  5CCH D;  2WSS H;  3SFE C;  3L37 A;  5CCH C;  1X8Y A;  3H1K J;  5GTH H;  2JMO A;  1PGQ A;  1JM0 A;  1FDI A;  3B71 A;  2QM8 A;  3H1I G;  3KIH A;  4TNU A;  2M6N A;  3E1R A;  4NPE A;  3CC4 P;  3OW2 Y;  2J59 M;  3SWY A;  2OZK A;  3BRT B;  1ZXG A;  1N2D C;  1SQQ E;  3VN0 A;  2Y0E A;  1VQP P;  4A7P A;  1M8O B;  2OTJ 1;  2OYH B;  2KIK A;  3CCR P;  3K5B A;  4DGL A;  1T3J A;  1K9M Q;  1RF0 A;  2K9J B;  2O3J A;  2V8J A;  1N7L A;  4XA4 A;  1VQ7 P;  3MGN A;  4A3M I;  5KJ7 A;  3VMH A;  3V4W A;  3VMA A;  3HOW I;  2DE6 A;  1JEK A;  2QSI A;  1VF5 B;  3CX5 H;  1BE3 G;  1EXI A;  4DK1 A;  1M57 D;  3H1J G;  5APY A;  1K05 A;  1L0N E;  1IFP A;  1RQU A;  3QH9 A;  2OTK E;  3EFG A;  1N7S B;  1SLQ A;  5FLM I;  1WRG A;  3D6Y A;  2JUB A;  1P9N A;  4A93 I;  1S5L H;  2YMK A;  5KKZ B;  3AEE C;  1USE A;  4HH4 A;  1P84 E;  1SFC C;  5CBN A;  1R5S A;  4BXX I;  2LFU A;  1YIT 1;  2OQQ A;  4PD4 E;  2O53 A;  2O4H A;  4TLF A;  3MD0 A;  1PP9 E;  1Q7Y Q;  1NJI Q;  2IYP A;  1IFM A;  2WSE H;  1MFT A;  3GW6 A;  1S72 1;  1RF1 B;  3CMA 1;  3KZI H;  2O1K A;  1DEB A;  1ZR2 A;  3G9R A;  3RK3 D;  1Q86 1;  4U7J A;  2V3V A;  3HE5 A;  5KJ7 D;  1VQ9 1;  1GW3 A;  1YJ9 1;  3KXD A;  1OFC X;  4U3F E;  5KJ7 C;  2WVR A;  1KYO E;  3V2R A;  2E76 D;  3VTN A;  1P84 I;  4H44 C;  1FDO A;  3PJS K;  3F3F C;  1NTM J;  4PD4 I;  2R5D A;  1VQL P;  1H8A A;  1VQ6 Z;  2XV5 A;  1YTZ T;  3RK2 C;  3F89 A;  2QRC B;  5KTB A;  3CC7 Z;  4KJM A;  4PJ0 H;  3IF8 A;  1M56 D;  4W7Y A;  2CPB A;  4MXU A;  1ZME C;  2HPC A;  1NHL A;  4L76 A;  1NP6 A;  2YAD A;  2FXM A;  3HD7 C;  2GUV A;  2FYU E;  4IL6 H;  1WII A;  1XTG B;  3AEC C;  3L70 D;  2JIP A;  4H13 B;  1Y1W I;  1JWH C;  5B5E E;  2YMY A;  1QXF A;  4XFJ A;  4DQY B;  1LTB C;  4KT0 J;  1A02 F;  4GDO A;  1SQV K;  3CX5 D;  2VPX A;  2XKM A;  4RJT A;  1LTJ B;  2RH0 A;  1J1E B;  1NH4 A;  1YBK A;  2P67 A;  1IFI A;  2OTL Z;  1KB9 H;  2Q6Q A;  3AE9 C;  3G3Z A;  1BCC D;  3JSV C;  1JTH A;  1XTC C;  4E30 A;  3AE5 C;  2W90 A;  1KD1 1;  4LGD E;  4HKZ H;  4Y28 J;  2JS4 A;  2WAQ A;  3AE6 C;  1ZH1 A;  2YO2 A;  1LGH B;  5IP9 I;  4A3K I;  5DJU B;  3P8M C;  3M9H A;  2QRE B;  3TSI A;  2R6M A;  1IC2 A;  4BY7 I;  3AE4 C;  2P1J A;  2BCC D;  3HOZ I;  4L74 A;  1IFN A;  3V2N A;  4I6M C;  2QJP C;  2QA4 Z;  2Z5I A;  2P28 A;  3G6E Z;  1GL2 A;  1URQ C;  1NTK K;  1RH5 B;  4W80 A;  5APT A;  2M8R A;  4AYC A;  2AEJ A;  2V7Q J;  3AE3 C;  2JIO A;  5T67 A;  3TYY A;  2Q7C A;  1KYO H;  2KSE A;  3CD6 1;  4NBA A;  1SQB J;  2PFX A;  3H0G I;  4HGY A;  3HUS B;  1DX7 A;  3KQG A;  2WPR A;  2KSJ A;  5AW6 B;  1QX8 A;  5E79 H;  1PPJ D;  3IF4 A;  2PM9 A;  4AQR D;  1ZB9 A;  3BG0 B;  2XU6 A;  1M1J B;  2QVA A;  1WMK A;  2UWJ E;  2LKM A;  2D2C D;  2L5G B;  3H1J E;  1KC8 1;  4E2Y A;  2RBL A;  3L75 D;  4YXD C;  3I55 Z;  2PK7 A;  3WU2 H;  2W83 C;  3VP9 A;  2YU9 I;  3CCL 1;  2VPZ A;  5B5E H;  1SQP J;  4OWF A;  1LNQ A;  1W2B Y;  3TGU E;  1GK6 A;  3RL0 g;  1YHQ Z;  2ZXE B;  2YKQ A;  4E2X A;  4RS4 A;  3L70 G;  4AUW A;  1GK4 A;  3RK3 B;  3S1Q I;  5C3E I;  2QE7 H;  1PGJ A;  1NOH A;  1GL2 D;  3GTM S;  1VQN 1;  5IT9 b;  1NTZ K;  1U57 A;  2E76 B;  1PFI A;  1M90 1;  1QVF Z;  1KB9 D;  3EER A;  3I5C A;  1FZC C;  1BCC G;  1KV4 A;  3S14 I;  1OIP A;  2ZVN B;  1VQ5 Z;  3E7K A;  3VB9 A;  2QEX Z;  5KLV J;  1PV3 A;  2ZXX A;  4D6T E;  5APW A;  1NJI 2;  1N8R Q;  2K9J A;  3IR9 A;  1RO0 A;  3U1C A;  4MD7 A;  2BCC G;  2IZ4 A;  1KN7 A;  1FZA A;  1I3Q I;  3M3Y I;  2P10 A;  3RL0 D;  1J1D C;  3H3V J;  2QLV B;  1E79 H;  4OGQ B;  3CCJ Z;  4NPF X;  4U3F D;  1KYO D;  1SIW A;  3USS A;  1Q90 D;  3OW2 Z;  3LW5 H;  4NBG A;  5C4X I;  3LID A;  1JY3 O;  2B63 I;  1VL2 A;  1NKZ B;  3TDH B;  4N78 D;  3A0B H;  1JB0 J;  2A06 D;  1KZU B;  5H2F E;  1DH3 A;  3IN6 A;  1PPJ G;  4RES B;  1FZG A;  1MFZ A;  4XE5 B;  1L4A A;  4RVF A;  1CW5 A;  1GZL A;  3HE5 B;  3G6E P;  1EDK A;  3CC2 1;  5D1P A;  4EIJ A;  4R4L A;  5AW3 B;  3L75 G;  3M9Q A;  3CC4 Z;  2KUB A;  1VQP Z;  3P8C E;  1SQX J;  2IFM A;  2Q5U A;  1CI6 A;  3S4R A;  2N9B A;  4NBD A;  4Y52 I;  2OYH C;  4DOJ A;  3CL3 D;  3L36 A;  5B66 E;  5IP7 I;  3CCR Z;  2QR1 B;  1NWQ A;  2FYN B;  2QRD B;  1YJW 1;  5APX A;  3FXE A;  1BGY J;  1LT9 A;  4JF7 A;  1KQF B;  1VQ7 Z;  1T2K D;  2A45 H;  4GOE A;  1QL1 A;  4EOT A;  4E2Z A;  2D2C B;  1VF5 D;  2QJY B;  4OVN F;  3H1L D;  1VF5 C;  1AVY A;  4NB8 A;  1HJ0 A;  1BDC A;  2XND H;  5IT9 f;  5GTH E;  2H88 C;  2CK3 H;  3RK3 E;  2WPQ A;  1JTH B;  4NBH A;  1RLY A;  1N7S C;  2HG5 D;  3C8V A;  1PGO A;  2GU2 A;  1Y8C A;  1YYC A;  1H0T A;  3EED A;  3L4F A;  2HOD B;  1VQM Z;  4PV1 D;  1L4A D;  4NOZ A;  3GTK I;  2K5R A;  2JDI H;  5KKZ C;  3V2Q A;  1BSN A;  2J5U A;  1LTJ A;  3CME 1;  2P7J A;  2JA6 I;  1GL2 B;  4GIF A;  4K3A A;  4U3F G;  2NZ2 A;  3WUT A;  4R4M A;  3CWB D;  2K1A A;  1AFO A;  1Q82 Q;  3KYQ A;  3L74 D;  2IYO A;  4WB4 A;  1T8Z A;  2XZR A;  3CCQ 1;  2ZJS E;  1YJN 1;  1IK7 A;  1RF1 C;  1KIL D;  2F4M A;  3AED C;  2R7Z I;  2YXR B;  3L73 D;  1KOR A;  3GTG I;  2YKP A;  1UII A;  1K73 Q;  2F4O A;  1SQV D;  1YJW P;  1QVF Y;  1YUK A;  4ASW A;  1BCC E;  4EWC A;  3R2P A;  3RL0 B;  2GM4 A;  2BAS A;  2BCC J;  3VMZ A;  3F5H A;  3CCJ P;  1R8E A;  1IFJ A;  2R3S A;  1VQL Z;  3D70 A;  5AVR B;  3I56 1;  2W6J H;  1VQ4 1;  3GG2 A;  1S5L E;  3G71 1;  2PP6 A;  3FKI I;  4A3E I;  1YIJ 1;  3CX5 I;  2WQY C;  2OYI A;  2N1T D;  2PAJ A;  4H13 C;  3NFQ A;  1N8R 2;  4NPD A;  2Y0D A;  1NTK D;  4D6T D;  4DJG A;  3M9B A;  1IK9 A;  4CL1 A;  3I4M I;  3VMY A;  2K9Y A;  1SQQ J;  1LTJ C;  1J1E C;  3BCC E;  4I1L A;  3H1H D;  1IFD A;  3Q87 A;  3KZI E;  2JIM A;  2W03 A;  3L72 D;  2OAR A;  2AEM A;  2I1J A;  1WCM I;  2Q4Z A;  1PPJ E;  1PL5 A;  5C44 I;  1DL6 A;  2JNY A;  5AVQ B;  3JAM b;  3CCQ P;  3TNU B;  4IFF A;  3Q1M A;  1LP1 B;  3AEG C;  2AXT H;  1YUA A;  3BAS A;  3CQZ I;  2E75 B;  2KNC A;  1K8A 2;  3L75 E;  1Q2N A;  1S72 Z;  3WMM 0;  1R5L A;  3CMA Z;  2JR8 A;  4PJ0 E;  1N86 A;  2NRG A;  3MZL B;  2NVY I;  1M1K 2;  3GCF A;  1UIX A;  1YJ9 Z;  1NU1 J;  4IL6 E;  1L0N J;  3W67 A;  2ZYG A;  1K83 I;  3VP8 A;  1NTM K;  4OH8 B;  3CWB G;  3TDK A;  2NVX I;  3S2H I;  3L74 G;  3HUS C;  1TWC I;  1JY3 N;  1NUI A;  1VDF A;  1VQM P;  1YIJ P;  1M1J C;  3L73 G;  3P8C D;  1KB9 E;  1X79 B;  3IFM A;  2LR2 A;  1W2B Z;  4PV1 B;  5CCG A;  1HH0 A;  1L4A B;  1SQV G;  2E9H A;  1NTZ D;  3TK1 A;  3FWL A;  3D2L A;  3TGU G;  1FJK A;  2P58 A;  2R32 A;  4S1T A;  1NYH A;  1PP9 J;  1GMJ A;  3CXH H;  3EFF K;  5AW9 B;  1Y8A A;  3II6 A;  1Y1V S;  3CLQ A;  1JNM A;  2LXB A;  5M1B A;  1CI6 B;  1YI2 1;  4UB6 H;  2O01 H;  1VQO 1;  4YPC A;  4U3F J;  1JMM A;  1KB9 I;  5AVT B;  2OTJ P;  1FC2 C;  1KIL B;  3G4S 1;  1JCC A;  1RF0 C;  1RE4 A;  3N7N A;  3RK3 C;  2A45 G;  4C46 A;  1RNI A;  1LT9 B;  1NTK G;  3AEB C;  2Z4E A;  3PO3 I;  4D6T G;  3JC2 2;  3RBZ A;  2Q51 A;  2JEE A;  2E76 C;  2E5T A;  1KMI Z;  3H1H G;  2KLV A;  3L72 G;  5E79 E;  3NDJ A;  3W68 A;  3ZDM A;  4N78 E;  1KTM A;  4Y7N I;  3MON A;  2A06 E;  1VLA A;  1ZN5 A;  1FZB A;  3V5B A;  1JJ2 Z;  1L2P A;  2FYU J;  1U7M A;  1FOS F;  3VTP C;  3S1R I;  5AW2 B;  1HUC A;  3ITK A;  5AVY B;  2WSF J;  3WU2 E;  1Q86 Q;  4NBF A;  1SQB K;  2KK7 A;  2POH A;  1H0T B;  1HGV A;  2N1T B;  1NTM E;  3S9O A;  5CCG D;  1KYO I;  3JAM f;  5CCG C;  4XX2 A;  3U1A A;  4OGQ D;  4OGQ C;  3T4N B;  1Q81 2;  1OVV A;  3L71 D;  1BDD A;  1YIT P;  3H1I J;  1Z01 A;  3A0H H;  3S17 I;  1AA6 A;  1RO2 A;  2HFE D;  3NTN A;  1QEX A;  2LXC B;  4JBZ A;  3S15 I;  3CPW O;  3GF3 A;  2HOD A;  2VPW A;  5FLX b;  3CCS 1;  1YI2 P;  2H85 A;  1SQP K;  1S72 P;  1VQO P;  2WSC J;  2W6A A;  3H1L E;  3CMA P;  1QVG O;  4ZKP A;  1RE4 C;  3G4S P;  1AV1 A;  3HOY I;  3FGA D;  3SWF A;  5AW0 B;  1NTZ G;  1WJ2 A;  1VQ9 P;  3CXC Z;  1JY2 O;  1YJ9 P;  1OW7 A;  3CXH D;  3S1K A;  3RZO I;  3AE1 C;  1RHZ B;  4DZO A;  1S2E A;  3O6Q B;  1LWU B;  5AW5 B;  1VQN Z;  5KLI B;  4NBB A;  1KD1 Q;  3BCC D;  2WMM A;  1YQ4 C;  2RT9 A;  2WT7 B;  2C0W A;  1BE3 J;  2QG4 A;  4HH2 A;  2G3A A;  2IPP A;  2FYZ A;  3PLN A;  2FYN C;  4BXL A;  2OYI B;  3H1J J;  5KLV K;  3I07 A;  2B88 A;  2QRX A;  3M0D A;  1K9M 2;  3H1K D;  1FZE A;  2D2C C;  3CWB E;  4A3F I;  2QJY C;  4WY4 A;  2V8K A;  3L35 A;  3CCE 1;  3L74 E;  4GKG A;  3J80 b;  3A0B E;  3MUD A;  3WUU A;  3GMA A;  1USP A;  1SQB E;  3KHU A;  4HGZ A;  1KIL E;  4A3D I;  4QMA A;  4QTU A;  2OOX B;  3L73 E;  2AYD A;  3FQM A;  4N6J A;  3TGU J;  4ZNC A;  5CBO A;  4L75 A;  3GHG A;  1SQV E;  1LTA C;  2H8P D;  5KAF H;  2OTL 1;  5BU8 B;  1GTW A;  3HTK B;  2RIQ A;  3V6I A;  1Z02 A;  2WZ7 A;  3VMG A;  3PTZ A;  1AA0 A;  1ZW0 A;  1J2J B;  2BEZ F;  2QM7 A;  3CCS P;  2KNC B;  5A2Q b;  5APS A;  3CCU 1;  2WSF H;  1FDM A;  4MON A;  1KC8 Q;  3MZK B;  2FFD A;  4A3J I;  2P3Y A;  1GL2 C;  3M91 A;  4BBR I;  3CC2 Z;  3FXD A;  1L1O C;  1H89 A;  4I7Z B;  1LTS C;  3L71 G;  2JIR A;  2QA4 1;  3VOP A;  4D6T J;  4JYC A;  1ZR4 A;  5TIS H;  1JY3 P;  1WT6 A;  1NTK E;  3TNU A;  3JCU H;  4BRY B;  5C39 A;  1LP1 A;  3M0A A;  3CD6 P;  1Q7Y 2;  1X3Z A;  3VMX A;  1SQX K;  3NMD A;  3H1H E;  3RBX A;  5AW8 B;  3L72 E;  2FBW C;  4LLH A;  3PHL A;  1YJW Z;  3VYI A;  1LTG C;  2RN0 A;  2XDJ A;  3U59 A;  2V8I A;  5FLX f;  4WY4 D;  3BAT A;  3RL0 C;  1M90 Q;  1QYP A;  1M7L A;  1Y9B A;  2I3C A;  1JJ2 Y;  1K8A 1;  2R93 I;  1DEE G;  4ASV A;  3MUD C;  3NXS A;  5KLV E;  3PO3 S;  1S3J A;  2KZJ A;  2QJK B;  1M1K 1;  1TWA I;  2A45 I;  3CCL P;  3BCC G;  2H7H A;  1GD2 E;  5D1O B;  2V7Q H;  1QF8 A;  1KQS O;  1SVF A;  4C7N B;  1EZV D;  3E1I A;  1H88 A;  1ZB8 A;  2ZFC A;  3OJA B;  2YXQ B;  2ZYD A;  1S9K D;  2HF1 A;  1FOS E;  4NBE A;  3H1K G;  2H43 A;  2ZYA A;  5LL6 f;  4NB9 A;  4Z1M H;  1YHQ 1;  1RE3 A;  2G8Y A;  2LEX A;  3HOX I;  3GKQ A;  2SPZ A;  1A02 J;  1NTM D;  1VQN P;  1WZN A;  3EWK A;  1GDT A;  2ITA A;  3P32 A;  1T3U A;  1L0L K;  2VPY A;  3CCM 1;  1NTZ E;  1JO5 A;  3J7A 4;  2E75 D;  2OOY B;  3AE8 C;  1KIL A;  3CCQ Z;  2E75 C;  1NO4 A;  2BEQ D;  3CXC Y;  1VQ5 1;  5C4J I;  1G2C A;  2Z5H A;  1NAF A;  2B9B A;  1EC5 A;  1T2K C;  4QTT A;  2KZI A;  3NH8 A;  1GU4 A;  2AKL A;  3CI9 A;  2Q9I A;  2ZT9 D;  3LIE A;  4GT1 A;  1RY3 A;  4MRI A;  3IX0 A;  1HTL C;  2EGT A;  1BGY E;  1FAV A;  3J81 b;  3MTU E;  2N1T A;  2I1K A;  1YIJ Z;  1CSB A;  4IFM A;  4PV1 C;  1L4A C;  1NVO A;  5T6B A;  2B87 A;  4Y99 B;  5GTI H;  4MN4 C;  2FY8 A;  2YO3 A;  2E7Z A;  1JY2 N;  3CC2 P;  1RE3 C;  2HU9 A;  4BBS I;  2AXT E;  2E74 D;  3P7K A;  3L70 J;  1HJB A;  3A2A A;  1SQQ K;  3FX0 A;  2C9N Y;  2M3E A;  2IX7 C;  2W6B A;  3CC4 1;  4NBC A;  1SQB D;  1EDJ A;  1RQF A;  1EZV G;  1Q81 1;  1KIL C;  2A06 G;  1KQL A;  1BCC J;  2OTJ Z;  1VQK 1;  3B4S A;  1LT9 C;  1GU5 A;  3L71 E;  1L0L E;  3GTO I;  1ZV8 A;  3O8Z A;  3CCR 1;  3MZW B;  4E32 A;  4WY4 B;  3O6Q A;  1LWU A;  3QWO C;  1KC8 2;  3HRN A;  3UIA A;  1NTM G;  4GOF A;  1USP B;  3IAO A;  2E43 A;  3H6P A;  2WT7 A;  1NU1 K;  3NDI A;  3CCV 1;  1L0N K;  1SQP D;  3HOU I;  2YIU B;  3Q3D A;  1DIP A;  1X9V A;  3BRV B;  3GHG B;  4O9B A;  3HE4 A;  1QVF O;  1Y47 A;  3CXH E;  2JP3 A;  2Y9Y A;  3GTJ I;  2N1T C;  2IV2 X;  1NAY A;  5AVS B;  2KXP B;  1QVG Z;  2WSE J;  2AEF A;  3AEA C;  5K5G B;  2KS1 B;  3GLM A;  2QKD A;  3S1M I;  4EDF A;  5CMZ A;  4RO0 A;  4UB6 E;  1HGZ A;  2FFD B;  1OXZ A;  3H1L G;  3CME P;  1M90 2;  1K9M 1;  2GUS A;  1YIT Z;  2K37 A;  2E42 A;  4IOI H;  2WPV B;  3Q5P A;  1AQT A;  3L75 J;  3HTK A;  1SFC A;  3H1K E;  4EYY Q;  1N2F A;  5KLV D;  3CXH I;  2M5A A;  3ESW A;  5AW4 B;  1YJN P;  2Y9Z A;  3KDP B;  1YI2 Z;  1VQO Z;  3EQ2 A;  4NFR A;  3J81 f;  2RKL A;  2RPR A;  2O01 N;  3OW2 O;  1VQK P;  2C9L Y;  3Q2Y A;  3G4S Z;  2Q3I A;  3D9X A;  1VQ9 Z;  1U7J A;  1EDI A;  4A3I I;  2JA5 I;  4ZKU A;  2PRR A;  1LWU C;  2IBZ D;  1G1I A;  5CHX A;  4RV9 A;  5KLI C;  4WWI A;  4MH4 A;  4RKU J;  2ZT9 B;  2HLO A;  3B5N B;  3I56 P;  1VQ4 P;  3WUV A;  4RVD A;  3V4Q A;  4BRY A;  3G71 P;  1VQL 1;  2C0X A;  3AEF C;  3CCV P;  1TU3 F;  2JWD A;  1SQB G;  3FWN A;  1HBW A;  1OVR A;  1FJP A;  2OYI C;  2FYU K;  3BG1 B;  4GOD A;  3M4O I;  3MIW A;  1NU1 E;  2R5B A;  3A0H E;  3Q5S A;  4UB8 H;  1VQ8 1;  1Q7Y 1;  3Q5R A;  5CM2 M;  2WIT A;  1NJI 1;  2MJZ A;  3HD7 A;  2J58 A;  3RZD I;  1JUN A;  2NVT I;  5L8R J;  2W8Z A;  3GTM I;  2QIW A;  3GTL I;  3HKZ A;  2VUG A;  3FQQ A;  2KPI A;  2E74 B;  1Z56 A;  5AVX B;  1CZQ A;  5D1O A;  5AVW B;  4B86 A;  2Y0C A;  4C7N A;  1SQX D;  1TWH I;  1SFC D;  1SQP G;  4I2L C;  4IFD K;  2V4H A;  4ZMD A;  3D6W A;  2W27 A;  3SFD C;  3N4X A;  1QLE D;  1PGP A;  1PFT A;  3CCS Z;  2KOG A;  1BGY D;  1G2C B;  1KRL A;  4M3L A;  4I7Z C;  4DT0 A;  2JKV A;  1EZV E;  2HR3 A;  3S16 I;  2FKW B;  2Q3E A;  4RVG A;  1I6H I;  4H44 D;  2IZ0 A;  3I4N I;  2E2I I;  1YTZ I;  1S9K E;  1URQ A;  1JMB A;  1Q82 2;  2R44 A;  1N73 B;  1KQS Z;  2WWW A;  3B8E B;  5KLV G;  3CD6 Z;  2E2J I;  3RK2 D;  3PO2 I;  1QGK B;  4H0L B;  1KQG B;  1KFM A;  3RGU A;  2JA8 I;  2B87 B;  1X3W A;  1K73 2;  1JY2 P;  3HD7 D;  1ZRT E;  5KAF E;  1VQ8 P;  4E33 A;  1EZV I;  2NPS B;  2IBZ G;  1DD4 A;  3CCE Z;  3NH5 A;  1HF9 A;  1L0L D;  3H32 A;  2QJK C;  2J6A A;  5AW1 B;  1EXJ A;  3CPW Y;  1MKM A;  1NKN A;  1LJ2 A;  3CCL Z;  3H1L J;  2IFN A;  1QVG Y;  4TT3 H;  4A3G I;  2M3B A;  2DE5 A;  1G1J A;  2FXO A;  1TWF I;  1MUU A;  1OZH A;  1JOC A;  2OYO A;  5TIS E;  3KPE A;  3JCU E;  4WVZ A;  1P84 H;  3CCU Z;  1OWA A;  3H1I E;  2E5Y A;  4PD4 H;  1LQL A;  4A3L I;  3GTP I;  3T97 B;  1SS1 A;  1URQ D;  1SQX G;  1VQ6 1;  1S1C X;  3CC7 1;  3HE4 B;  3LW5 J;  1YQ3 C;  3CWB J;  4MD8 A;  3NFZ A;  1FZC A;  3L74 J;  2YKO A;  4JYB A;  1BGY G;  1SFO I;  3BVH A;  4YXW H;  3OA7 A;  5AVZ B;  1EQ7 A;  5CJ0 A;  1SQQ D;  3L73 J;  2VF1 A;  4L73 A;  2K3R A;  1SQV J;  1BE3 E;  3M06 A;  3C1L A;  1EDL A;  4E31 A;  1S7M A;  1SFC B;  2RHB A;  2M5A B;  4AYB A;  5TJH A;  1R9T I;  1FE6 A;  4Y99 C;  2KS1 A;  5KAI E;  4EI2 A;  2GA1 A;  5AVU B;  2NAP A;  1RO4 A;  1TWG I;  1D7M A;  1SP4 A;  1VPC A;  3TF5 A;  5T64 A;  1SQP E;  4DCK A;  2Y0S A;  3A3Y B;  1K04 A;  2KP8 A;  3AE7 C;  1N8R 1;  1NU1 D;  2IZ3 A;  1L0L G;  1NTK J;  2M0B A;  1L0N D;  3G6E 1;  3AE2 C;  5APQ A;  1W2B O;  2HYN A;  2KB7 P;  2IZ1 A;  3LUS A;  3H1H J;  1AQ5 A;  3L72 J;  4H44 B;  4HJG H;  1FS0 E;  3IR7 A;  3MP7 B;  1VQ6 P;  1USD A;  2KYV A;  2WB1 A;  3CCM Z;  1PIX A;  2V45 A;  3QWU A;  2JO1 A;  3CC7 P;  3S1N I;  1MZ9 A;  3RK2 B;  1IJD B;  3M0D C;  3KIF A;  2XNX A;  2K88 A;  1P84 D;  4BWN A;  2MKV A;  2WSC H;  1OW8 A;  4WY4 C;  2OYH A;  1JCD A;  4K35 A;  4A3C I;  4PD4 D;  3HD7 B;  1I50 I;  3CCE P;  4JQ0 D;  1PP9 D;  3NH4 A;  1OW6 A;  4N3Y B;  3A5T A;  2DE7 A;  3B5N A;  1KQS Y;  5GTI E;  2R3C A;  2BJO A;  3D71 A;  3SSU A;  3I55 1;  2YIU C;  3GHG C;  5BU5 A;  1FU1 A;  2OTL P;  4WBA A;  1LT1 A;  2IBZ E;  4W7Z A;  2CPS A;  1Q86 2;  2FXP A;  1HVV A;  1N7S A;  4NH1 C;  3HOV I;  3CCU P;  4X6A I;  2FFD C;  1ZLL A;  2RMZ A;  2Q1K A;  1K8A Q;  5BVZ A;  1SQQ G;  3CME Z;  3F3P C;  3GTQ I;  3PH0 A;  1NTZ J;  1M1K Q;  5CJ4 A;  5KAI H;  1BSH A;  1ZRT D;  3J80 f;  3IFU A;  2QA4 P;  3P5J B;  1LTI C;  2QJP B;  3GF7 A;  2FYU D;  1HWT C;  2VRS A;  1NGM B;  1URQ B;  5APU A;  2JIQ A;  1YJN Z;  2IBZ I;  1Z03 A;  4BY1 I;  2GTI A;  1ZP0 C;  2QEX 1;  2JJL A;  2JA7 I;  2LIY A;  2ZVO B;  1FZF A;  2DW3 A;  2WTY A;  1VQK Z;  5AW7 B;  1RF1 A;  2HPC B;  1DD3 A;  4C7R A;  5A2Q f;  1SQX E;  3PRJ A;  1OVU A;  2PMZ A;  1S5L X;  1X0T A;  4KHX A;  1IO4 A;  1RQV A;  1NU1 G;  2ZT9 C;  3B5N D;  1L0N G;  3B5N C;  3H32 B;  1ZOY C;  1LTT C;  4CPG A;  1OX3 A;  3H1I D;  1TFI A;  1Y1V I;  3I56 Z;  1VQ4 Z;  1N73 A;  1AJY A;  1WW9 A;  4HYT B;  3G71 Z;  1KD1 2;  3CCJ 1;  5AVV B;  3I55 P;  3CCV Z;  2IDB A;  2KI7 B;  2H89 C;  2R92 I;  2JWA A;  4LC1 A;  1Q16 A;  1W2E A;  1GW4 A;  2ZAE B;  1N7S D;  1Q82 1;  5DJT B;  2NPS A;  1QL2 A;  2O1J A;  1YHQ P;  4YTP C;  4HB1 A;  1OMI A;  2E74 C;  1PP9 G;  5CCH A;  3U50 C;  1K73 1;  2WPS A;  2L91 A;  1IZN B;  4MD9 A; 
#chains in the Genus database with same CATH homology
 5FLX b;  1VQL 1;  3CCS 1;  2H85 A;  1I3Q I;  2JWD A;  3M3Y I;  2JR6 A;  1OVR A;  3H3V J;  3BG1 B;  3HOY I;  1VQP 1;  2QLV B;  4GOD A;  3M4O I;  3CXC Z;  3RZO I;  3S1K A;  1VQ8 1;  1Q7Y 1;  3CCJ Z;  4NPF X;  5CM2 M;  1NJI 1;  3RZD I;  1VQN Z;  2GTH A;  2NVT I;  3OW2 Z;  3K7A I;  2I8D A;  4NBG A;  4NBB A;  3GTM I;  3GTL I;  3HKZ A;  2VUG A;  3FQQ A;  4RVH A;  5C4X I;  2KPI A;  2B63 I;  2VUM I;  1VQ7 1;  2WMM A;  2W04 A;  2RT9 A;  3TDH B;  5D1O A;  4A3B I;  3S2D I;  1TWH I;  2G2K A;  5AN9 F;  4BXL A;  4RVF A;  4ZMD A;  2NVQ I;  3D6W A;  3I07 A;  2B88 A;  2QRX A;  1EDK A;  3CC2 1;  5D1P A;  3CPW Z;  2B89 A;  1K9M 2;  1PFT A;  3CCS Z;  4A3F I;  2V8K A;  3CCE 1;  1KRL A;  2E2H I;  3CC4 Z;  2M48 A;  2KUB A;  3J80 b;  4E2W A;  1USP A;  3MHV A;  4HGZ A;  1VQP Z;  5EFW B;  4A3D I;  4QTU A;  2OOX B;  1VQM 1;  3VMI A;  3FQM A;  1VQ8 Z;  3TE5 B;  4NBD A;  2HR3 A;  1ML8 A;  4Y52 I;  4ZNC A;  5CBO A;  3S16 I;  4RVG A;  5IP7 I;  3CCR Z;  1I6H I;  2QR1 B;  2OTL 1;  2QRD B;  3I4N I;  1YJW 1;  2E2I I;  2JMO A;  3FXE A;  2RIQ A;  1JMB A;  1Z02 A;  1Q82 2;  1JM0 A;  2R44 A;  1KQS Z;  1VQ7 Z;  3CD6 Z;  3VMG A;  3KIH A;  4TNU A;  2E2J I;  2M6N A;  1ZW0 A;  5A2Q b;  4GOE A;  3PO2 I;  4NPE A;  4E2Z A;  3CCU 1;  3OW2 Y;  2OZK A;  4MON A;  3MZK B;  1ZXG A;  3RGU A;  4NB8 A;  4A3J I;  2P3Y A;  1BDC A;  2B87 B;  1X3W A;  2JA8 I;  1K73 2;  4BBR I;  3CC2 Z;  3FXD A;  1L1O C;  5IT9 f;  4E33 A;  4NBH A;  2QA4 1;  1RLY A;  3CCE Z;  2OTJ 1;  2KIK A;  3NH5 A;  2J6A A;  2GU2 A;  4DGL A;  3CPW Y;  1H0T A;  2V8J A;  5C39 A;  1LP1 A;  3EED A;  3CCL Z;  1Q7Y 2;  1X3Z A;  4A3M I;  1VQM Z;  4NOZ A;  3GTK I;  2K5R A;  1QVG Y;  3VMH A;  4A3G I;  2DE5 A;  3HOW I;  2DE6 A;  3CME 1;  1TWF I;  1YJW Z;  2V8I A;  5FLX f;  4DK1 A;  2JA6 I;  1QYP A;  2I3C A;  4K3A A;  1JJ2 Y;  1K8A 1;  2R93 I;  1DEE G;  4ASV A;  3CCU Z;  2OTK E;  3PO3 S;  1S3J A;  2KZJ A;  1LQL A;  3CCQ 1;  1M1K 1;  1TWA I;  5FLM I;  1YJN 1;  4A3L I;  3GTP I;  5D1O B;  2F4M A;  2R7Z I;  1QF8 A;  2JUB A;  1P9N A;  4A93 I;  1SS1 A;  3GTG I;  1VQ6 1;  2F4O A;  3CC7 1;  4HH4 A;  1YUK A;  1ZB8 A;  1QVF Y;  4ASW A;  5CBN A;  4EWC A;  4BXX I;  4MD8 A;  2HF1 A;  2LFU A;  3NFZ A;  4NBE A;  1YIT 1;  2O53 A;  5LL6 f;  4NB9 A;  1YHQ 1;  2O4H A;  1SFO I;  1VQL Z;  3HOX I;  3GKQ A;  2SPZ A;  3I56 1;  1VQ4 1;  3G71 1;  2VF1 A;  1MFT A;  1S72 1;  3FKI I;  3CMA 1;  2K3R A;  4A3E I;  1YIJ 1;  1Q86 1;  3CCM 1;  3J7A 4;  1VQ9 1;  2OOY B;  1EDL A;  1YJ9 1;  3CCQ Z;  4E31 A;  1S7M A;  4NPD A;  3VTN A;  1N8R 2;  3CXC Y;  1VQ5 1;  2RHB A;  5C4J I;  2M5A B;  3F3F C;  4CL1 A;  4AYB A;  3I4M I;  1R9T I;  1EC5 A;  1VQ6 Z;  3Q87 A;  4QTT A;  2W03 A;  2QRC B;  3CC7 Z;  2KZI A;  4KJM A;  3IF8 A;  1RO4 A;  1TWG I;  3NH8 A;  4MXU A;  1WCM I;  2AKL A;  2Q4Z A;  5T64 A;  1NP6 A;  2Y0S A;  2YAD A;  5C44 I;  1DL6 A;  1N8R 1;  2IZ3 A;  4MRI A;  2JNY A;  3IX0 A;  2EGT A;  2M0B A;  1WII A;  3G6E 1;  3JAM b;  1LP1 B;  3J81 b;  1YUA A;  3LUS A;  3CQZ I;  1Y1W I;  1JWH C;  1K8A 2;  1S72 Z;  1Q2N A;  3CMA Z;  4HJG H;  4DQY B;  1YIJ Z;  2WB1 A;  3MZL B;  1NVO A;  3CCM Z;  2NVY I;  2B87 A;  5T6B A;  1M1K 2;  3QWU A;  3GCF A;  3S1N I;  4MN4 C;  1YJ9 Z;  2OTL Z;  3KIF A;  2HU9 A;  4E30 A;  4BBS I;  1K83 I;  4K35 A;  1KD1 1;  4A3C I;  4HKZ H;  2JS4 A;  2WAQ A;  1I50 I;  1ZH1 A;  2NVX I;  3S2H I;  5IP9 I;  4A3K I;  5DJU B;  3NH4 A;  1TWC I;  2R6M A;  2QRE B;  4BY7 I;  2DE7 A;  1NUI A;  1KQS Y;  3HOZ I;  3CC4 1;  4NBC A;  2BJO A;  1EDJ A;  1RQF A;  3I55 1;  1Q81 1;  2QA4 Z;  2LR2 A;  2P28 A;  3G6E Z;  1W2B Z;  2OTJ Z;  2E9H A;  1VQK 1;  3GTO I;  1LT1 A;  2P58 A;  3CCR 1;  4S1T A;  3MZW B;  1Q86 2;  4E32 A;  5T67 A;  3QWO C;  4NH1 C;  1KC8 2;  3HOV I;  4X6A I;  2Q1K A;  1Y1V S;  4NBA A;  3CD6 1;  3H0G I;  4GOF A;  1USP B;  4HGY A;  3CME Z;  2LXB A;  1YI2 1;  3F3P C;  3NDI A;  3CCV 1;  3GTQ I;  3PH0 A;  1VQO 1;  2PM9 A;  1ZB9 A;  3BG0 B;  3J80 f;  3IFU A;  3HOU I;  2QVA A;  3P5J B;  2UWJ E;  1FC2 C;  3G4S 1;  1Y47 A;  3GTJ I;  1RNI A;  1KC8 1;  3PO3 I;  1YJN Z;  1QVG Z;  4E2Y A;  2RBL A;  1Z03 A;  2Q51 A;  5K5G B;  4BY1 I;  3I55 Z;  2GTI A;  2KS1 B;  2QKD A;  2QEX 1;  2PK7 A;  2JA7 I;  2LIY A;  3S1M I;  2YU9 I;  3CCL 1;  3NDJ A;  1VQK Z;  3ZDM A;  4Y7N I;  3MON A;  1VLA A;  5A2Q f;  1M90 2;  1JJ2 Z;  1OVU A;  2PMZ A;  1K9M 1;  1U7M A;  1X0T A;  1YIT Z;  1W2B Y;  4IOI H;  3S1R I;  1YHQ Z;  4CPG A;  4E2X A;  4RS4 A;  4EYY Q;  1N2F A;  1TFI A;  1Y1V I;  4NBF A;  3I56 Z;  1VQ4 Z;  2M5A A;  3ESW A;  3S1Q I;  1WW9 A;  1H0T B;  3G71 Z;  1KD1 2;  3CCJ 1;  5C3E I;  1YI2 Z;  3CCV Z;  3JAM f;  2KI7 B;  1VQO Z;  4XX2 A;  3GTM S;  1VQN 1;  5IT9 b;  2R92 I;  4NFR A;  3J81 f;  1M90 1;  2RKL A;  2RPR A;  1QVF Z;  3G4S Z;  3D9X A;  3EER A;  2ZAE B;  1VQ9 Z;  3T4N B;  1Q82 1;  1U7J A;  1EDI A;  4A3I I;  2JA5 I;  5DJT B;  1OVV A;  1Q81 2;  1BDD A;  3S14 I;  4RV9 A;  1VQ5 Z;  4WWI A;  4MH4 A;  3VB9 A;  2QEX Z;  1Z01 A;  3S17 I;  1RO2 A;  4HB1 A;  2LXC B;  1NJI 2;  4JBZ A;  3S15 I;  3U50 C;  4RVD A;  1K73 1;  1RO0 A;  4MD7 A;  2IZ4 A;  4MD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...