1X0TA

Crystal structure of ribonuclease p protein ph1601p from pyrococcus horikoshii ot3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
IVKRRDWEKKEKKKIAIERIDTLFTLAERVARYSPDLAKRYVELALEIQKKAKVKIPRKWKRRYCKRCHTFLIPGVNARVRLRTKRMPHVVITCLECGYIMRYPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 4
publication title Crystal Structure of a Ribonuclease P Protein Ph1601p from Pyrococcus horikoshii OT3: An Archaeal Homologue of Human Nuclear Ribonuclease P Protein Rpp21(,)
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 33
structure length 106
sequence length 106
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2005-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1x0tA01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1x0tA02
1EDKA 4NPFX 2M5AB 5DJTB 5EFWB 5DJUB 1ZXGA 2B89A 1LT1A 4MN4C 4JBZA 2M5AA 2HR3A 2QVAA 2LXCB 2OTKE 1EDLA 4CPGA 3PH0A 1Q2NA 1U7JA 4ZMDA 2KUBA 4HJGH 5C39A 1OVRA 4NPEA 2P58A 1SS1A 4EYYQ 1EDJA 2Q1KA 4K35A 2RKLA 5CBNA 2KZJA 5K5GB 4BXLA 1MFTA 4IOIH 2B88A 2LXBA 4NPDA 1NVOA 2JWDA 3FXDA 1ZW0A 2B87B 2KIKA 4ZNCA 4ASVA 2WMMA 1BDCA 1EDIA 2K3RA 2B87A 2ZAEB 4GODA 5CBOA 2I8DA 2QRXA 2R44A 3MZWB 4WWIA 2KI7B 1BDDA 4GOFA 1U7MA 4ASWA 1X0TA 2LR2A 1FC2C 1Y47A 1EC5A 3RGUA 3ZDMA 1DEEG 4GOEA 2KZIA 2UWJE 3FXEA 1S3JA 4HKZH 4K3AA 1H0TB 1JMBA 4KJMA 1OVUA 3QWOC 2M0BA 1LP1B 1H0TA 1OVVA 2KS1B 1JM0A 4HB1A 3S1KA 2SPZA 1LP1A 3MHVA
chains in the Genus database with same CATH superfamily
4D6TE 2M5AB 1GL2B 3CQZI 1SQQK 1TFIA 1TWAI 4IL6H 3S17I 5KLVD 5AW7B 3CCJ1 3G6EP 4D6TJ 2QREB 1RF0C 3I4NI 2QRCB 3IN6A 3L74E 4DJGA 1KMIZ 2LKMA 2KUBA 2HLOA 5C39A 1JJ2Y 3K5BA 3L74J 2Y9ZA 2C0XA 4QTUA 1KD1Q 2YU9I 4U3FE 2O1KA 3H1KE 3M4OI 2NVTI 3GF7A 4U7JA 3CCUP 1LWUA 1WMKA 4U3FJ 3H1KJ 3GTMI 3A0HH 4WY4C 3MUDA 3HE4A 3J80b 1HH0A 2WSEJ 1FZCA 2K37A 5APUA 3CD6Z 2LXBA 5KAIE 1M90Q 2FFDB 1KQSY 1Q812 1QVGO 3Q87A 4L75A 1Y9BA 4EOTA 1YUKA 2CPBA 3VMYA 3CMEZ 4PJ0H 1VQOP 2K3RA 2RN0A 4AYCA 1VQ9P 1X8YA 5AVSB 2QE7H 3LIDA 4DZOA 1EXJA 2POHA 2B9BA 2R32A 4L74A 3SFEC 3E1IA 3VMGA 3GLMA 1JJ2Z 1VQ4Z 3CI9A 3HTKA 3H32A 1QX8A 4WB4A 2WT7A 4NB8A 4IFFA 4KJMA 1GL2C 1YQ4C 1VDFA 2R93I 3GHGB 2HODA 2BASA 4RJTA 3L75G 1BGYD 5C44I 2NPSA 3KZIE 3CCV1 1L0LG 2FYUE 2QSIA 5B5EH 3AECC 1KYOD 1EZVE 1QEXA 1SQBG 2IFMA 3V4QA 1CW5A 2IZ1A 1HGVA 1RNIA 1KQSZ 2A45H 2FYUJ 1KFNA 3D6WA 2WZ7A 4CPGA 3CXHD 1VQM1 3CCQZ 2KP8A 3IR9A 2NZ2A 4HJGH 1YTZI 4JPZB 1VL2A 3K7AI 1G1IA 1YJ91 3KPEA 1USPB 1SQPE 4D6TD 2E74D 4BBSI 1FJPA 1NU1D 3MIWA 3I5CA 3HE4B 2FFDC 3T4NB 1YYCA 4H44D 3GTPI 1SQPJ 1QLED 3G711 1L4AD 1PGJA 3L74D 1SQVG 2RH0A 1S5LE 1OXZA 1AVOA 1IO4A 3ESWA 3A3YB 2F4OA 2QJPB 1P84E 3NDJA 4U3FD 1VQP1 3H1KD 1OX3A 2HPCB 3HRNA 1N73C 3CCJZ 1KILA 2FY8A 1P9NA 2FYNB 1SFCD 2ZAEB 3M3YI 4GODA 4RESB 5AVTB 1GZLA 5C4XI 4WWIA 1YHQ1 1BDDA 1FE6A 3GHGC 3HTKB 3FQQA 1M1KQ 3H32B 3H25A 2WT7B 2H43A 1I6HI 2HODB 2N9YB 5GTIH 4IFMA 1S5LX 1VQNP 1KYOH 1OVUA 1PL5A 2NPSB 2KLVA 3CCQP 2WSFH 2G3AA 2QA41 2RMZA 1ZOYC 3CXHH 4A3EI 3TGUE 3L71E 3D70A 2OYHA 1USDA 2PP6A 3FKII 1NTZG 5KLVK 1Y1WI 1I50I 3TGUJ 2Q6QA 3L71J 3EWKA 1SQQE 2IYOA 1RO0A 3CC4Z 3MUDC 5LL6f 2C9NY 1FZCC 1SQQJ 3OA7A 5AVZB 3NDIA 3P5JB 3Q1MA 1PV3A 2FYUD 5AW4B 1EDJA 3CCJP 4RKUJ 2O1JA 2O01J 2QJPC 1RH5B 3Q5RA 1XTCC 3R4YA 2N1TD 2ZFCA 1VF5D 1UIXA 1JY3P 4UB6E 2E2II 3H1HE 1T8ZA 4BXLA 2OTLZ 1JB0J 2FYNC 2IFNA 3OAKA 3QWUA 2JNYA 3CCVZ 1QVFO 3NFZA 1KILB 2MJZA 3H1HJ 1SFOI 2GUSA 3L4FA 2QIWA 2JEEA 4NFRA 3H0GI 4DGLA 1VQMZ 2B87A 4BRYA 2QG4A 1N7SA 3QH9A 1NH4A 4R4LA 2NPSC 2V8IA 5CCGC 1YJ9Z 1DEBA 3PO3I 4NBHA 3VMIA 3R2PA 3RL0B 1P84D 2GA1A 3WUTA 1L0NG 3AEBC 3FXEA 1JNMA 3VTNA 3H1IG 3PO2I 4LGDE 3RK2B 3CC4P 3CCM1 3G71Z 3AE8C 3RL0g 1SP4A 2M0BA 1KFMA 2PK7A 3LIEA 1Y8CA 2W27A 2B63I 1BE3G 4KHXA 1VQ71 4NPFX 1VQPZ 2E2JI 3M9BA 5D1PA 5IP9I 1LT1A 3L70G 1FZAA 4AUWA 1DH3A 2OTLP 1AA6A 3N4XA 1YHQZ 3CCVP 4ZMDA 3G6E1 3CXCY 2M3EA 2OYIB 3TGUD 3L71D 1NU1K 1OFCX 3A0BE 2O01N 1K9M1 3LW5J 1KILC 4MONA 3V2NA 1SQQD 1ZH1A 5APSA 2V4HA 2QA4Z 3CCU1 1BCCE 3HD7D 1YJ9P 2ITAA 3H1LD 1HF9A 1RY3A 1BCCJ 3D6ZA 3IF8A 1S5LH 1OMIA 2B87B 3AE3C 3G71P 1N7SB 3M0DA 1KB9I 1LT9A 1P84H 3A0HE 3RL0C 3AE1C 2OARA 1EDIA 2IBZG 3V2QA 3RK2C 4YXWH 1VQO1 4M3LA 1HGZA 2MKVA 3AEDC 3J7A4 1VQPP 3JCUE 3BVHA 4N3YB 3CXCZ 3T97B 1SQXE 3VMZA 4EIJA 3AEAC 4GOEA 1GK4A 1AFOA 1PFIA 3L72G 1OW6A 1SQXJ 1NKNA 3CWBG 1JUNA 2J58A 1NTMG 1QF8A 2Y0DA 3EQ2A 1YHQP 4TT3H 1GW4A 2GM4A 1U57A 1L2PA 2IBZI 4PD4I 1YIT1 2W8ZA 1PGQA 3CCLP 3OW2O 1K9MQ 3BG1B 1L4AA 4H0LD 1I3QI 1Q90D 3H6PA 1N7LA 4JQ0D 1ZXGA 5AW5B 1X3WA 2FBWC 1IK7A 3GTGI 2PGDA 4DOJA 4MN4C 2WVRA 2RT9A 2QA4P 3PTZA 2QJKB 1CZQA 2NVYI 1ZRTE 3IAOA 4TNUA 2JA7I 3AEFC 3RZDI 2D2CB 2FYUK 2AYDA 2WPVB 4AYBA 3PHLA 2O01H 2Z5IA 2QM7A 4ZKUA 3CCMZ 1QVGZ 2W6BA 1PPJG 2W90A 1HVVA 2GTHA 2KPIA 1N7SC 2R5DA 1RQUA 1FZFA 4NBCA 1Q7Y2 2OTJ1 1W2BO 1VQ7Z 3CX5I 1K83I 4UB6H 3CPWY 1SQVE 3NFQA 2E75D 1LT9B 2KNCA 1AJYA 2O4HA 3VOPA 1IFMA 3GTJI 4B86A 1KC82 2BEZF 1X3ZA 4RV9A 2IV2X 3G6EZ 2ZYDA 3FWLA 3MZWB 4PV1D 4JF7A 2LR2A 1S1CX 2JA5I 1KD11 2M8RA 1FDMA 2E76C 5CJ0A 1JMBA 3SWFA 4MRIA 3CCUZ 3GTMS 2WSCH 1L4AB 2Z4EA 1VQN1 3H1JG 3FWNA 1T2KD 2QJKC 1JM0A 1EDKA 2D2CC 1SQXD 3USSA 1HJ0A 1JEKA 2JKVA 2M3BA 2XU6A 3VP8A 1NTZE 3F89A 2ZYAA 2P3YA 1N8R1 4I7ZB 5AVUB 1M57D 3CXHE 1VQ7P 1VQOZ 1GW3A 1ZV8A 2WSFJ 4A3JI 3L36A 1FS0E 3GHGA 3AE9C 1VQK1 3L37A 4Z1MH 3G3ZA 1VPCA 1NTKG 3LW5H 1PIXA 3S1QI 2CPSA 1NU1E 3M0DC 2WWWA 3A0BH 1LT9C 2I3CA 2WTYA 2JDIH 1SQBD 3O6QA 1NU1J 1KORA 1T6AA 1YITZ 3SWKA 1ZRTD 2JP3A 1S72Z 2KNCB 2WSSH 3F3FC 4OWFA 3MP7B 2JIMA 2Y0CA 1URQD 1ZW0A 3L73E 4WBAA 2E5YA 5KTBA 3HOXI 4XE5B 1USPA 5CBOA 3L73J 1VQ8Z 3TNUB 4DK1A 1AQ5A 3PJSK 3M9HA 4ASWA 1Y1VI 3JC22 1UIIA 1SQVD 3B4SA 1L4AC 1L1OC 2VPYA 1N2DC 3ZDMA 3JCUH 3CCEZ 1N8RQ 4YXDC 2KSJA 4NB9A 2OTJZ 2HG5D 2HPCA 3SWYA 2N1TB 1VF5B 2C0WA 2XZRA 3CC41 3FQMA 2R3SA 4W7YA 2Y9YA 1TU3F 2H89C 3E1RA 2KS1A 3B71A 1K8A1 3CC71 3HE5A 4HH2A 1YITP 3S1RI 2OTKE 1S72P 4N78E 4IFDK 5APYA 2LIYA 5CCGA 4NBGA 2GUVA 2OTL1 1QL2A 1D7MA 4O9BA 1M1K1 2IYPA 3O6QB 1NTZD 1VQ8P 1PP9E 1M8OB 2YKQA 2ZJSE 1VQNZ 5BVZA 2W04A 2P2UA 1PP9J 4BXXI 2WPSA 1AA0A 4NPDA 5KLVG 2O3JA 3CCEP 1Q861 2QR1B 3CCRP 3O8ZA 4YTPC 3F3PC 2OTJP 3CL3D 1NO4A 1K731 1USEA 4BWNA 2V7QH 1X79B 1JCDA 2A45G 1VQKZ 1U7MA 1M902 2HU9A 1LQLA 1FC2C 1VF5C 2HF1A 1LTBC 4WY4D 3D9XA 1K8AQ 1DD4A 3B5NA 3L73D 2AEMA 4OGQD 2JO1A 5TISE 2I1JA 1FOSE 1HBWA 3AEEC 1YI2P 1OVVA 2KS1B 1NTME 1SQXK 5KJ7A 2YMKA 2ZXXA 3H3VJ 2A45I 2J5UA 2YADA 5C4JI 3HE5B 1NTMJ 3CCL1 1MFZA 4A3MI 2LXCB 1OW8A 1TWHI 2CK3H 3ITKA 1T3JA 1A02J 3NXSA 1NP6A 1GL2D 4GIFA 1YJNP 4A7PA 2LFUA 1Q86Q 3PO3S 2A06G 4I2LC 2H85A 3KIFA 2IZ3A 1ZB9A 4A93I 1NJI1 2BCCE 3U59A 1K73Q 1SQBK 4E2YA 5AW8B 1BGYG 2K88A 2PMZA 1N2FA 3L70D 2BCCJ 5T6BA 1LTTC 3KHUA 4E30A 4RVFA 5K5GB 4R4MA 1VQKP 4GDOA 2K9YA 4N78D 1NOHA 3H1LE 2C9LY 2XKMA 1IJDB 1AQTA 3CC7Z 1TWGI 2YMYA 4H0LB 2OYIA 5BU8B 3H1LJ 1KQFB 1KB9D 4EDFA 2AXTE 5B66E 1PP9D 2JR8A 2H7HA 1Q821 1SQVK 4D6TG 3B5NB 5CCHA 2AEJA 1JWHC 1KYOI 1SLQA 3OW2Z 1NGMB 1WT6A 2IZ0A 3RGUA 4A3GI 4A3LI 2WPRA 3SSUA 3L74G 1EXIA 2VF1A 3RBZA 3IR7A 2WB1A 2PFXA 3VYIA 1FU1A 2KK7A 1M1K2 2IBZD 1VQL1 1RE3A 4U3FG 3IFUA 3H1KG 1IK9A 3CC2P 2J59M 1NJIQ 3H1JE 1R5SA 2M6NA 1M56D 1S9KE 3RK3B 4RVGA 1KQSO 2V3VA 3HKZA 3H1JJ 3T97A 4EI2A 1EDLA 3L72D 1PGPA 2WSCJ 3GTOI 1NTMD 4I1LA 1VLAA 1M1JA 2E43A 1CI6A 1W2BZ 5FLXf 4NPEA 1LTGC 3CC7P 2QRDB 2Q1KA 1NTZK 3II6A 2JA8I 2RIQA 3D71A 1SIWA 4H13D 3G4S1 1Q82Q 2QM8A 2M48A 4H0LC 3GMAA 1KB9H 1KN7A 3MZKB 3L35A 2AKLA 4X6AI 1KRLA 4E33A 1E79H 2JWDA 1Y8AA 3CCLZ 3B5NC 2W6JH 3C9IA 2BCCD 2KIKA 1HWTC 2JUBA 1NKZB 2PRRA 4HGZA 1DD3A 3VN0A 2DE7A 1NAFA 2WPQA 5KJ7C 4BY1I 1Z02A 1EZVG 3MGNA 2E7ZA 1KTMA 2W03A 2JJLA 3I561 3IF4A 3VB9A 3S1MI 3N7NA 3JAMf 3HOVI 2DE6A 3RK3C 1QYPA 2RBLA 1FZGA 3VP9A 5TISH 1KQGB 1OZHA 1SQPG 1Z03A 1LP1A 2Y0EA 3MHVA 3BATA 2JA6I 1EZVI 1QVGY 5EFWB 3S16I 3CMAP 1MKMA 3CCSP 2QVAA 3AE4C 2OOXB 2ZT9D 2RHBA 3HOUI 3LUSA 1M1JB 4UB8H 1CI6B 4LLHA 4DCKA 2FXMA 3KDPB 1FJKA 3I551 1T3UA 1S721 3ABVC 4MXUA 3L75E 1R9TI 1VQ5P 3H1JD 3U50C 3A7OA 1S9KD 2OYIC 4A3DI 1T2KC 1L0LE 3L75J 2Q9IA 4YPCA 4MH4A 1SQBE 1X9VA 2OQQA 1L0LJ 1VQLZ 2JIPA 1WIIA 2E9HA 1VQ81 2IX7C 1YIJ1 1MFTA 3S2HI 5CCHC 1SQBJ 1JY2O 2KYVA 1P84I 3GCFA 3VMHA 1SFCA 4KT0J 3S4RA 3UIAA 2H88C 3CCE1 5APXA 2YO2A 2KXPB 3CCR1 1Q811 3TGUG 3L71G 2AXTH 5B66H 1RE3C 2QLVB 4C46A 3GTQI 3WU2H 1FZBA 2JMOA 2FKWB 3W67A 3D6YA 2IPPA 3KQGA 4DQYB 4E2XA 1SQQG 3U1CA 3IFMA 3G4SZ 1SQVJ 2P1JA 3TE5B 2VPWA 3GF3A 4BBRI 1LP1B 3NH8A 1G2CA 3HUSA 1GU5A 2Q3EA 5M1BA 1ZR2A 1M1JC 2V7QJ 3S1KA 2SPZA 3BCCG 1YI21 3J80f 3TNUA 1JY2N 4A3II 2K9JB 1IFDA 3IX0A 4NBEA 5C3EI 2E74B 2HR3A 2WAQA 3EFFK 3BASA 3H1HG 1VQLP 1TWCI 1NTMK 3B8EB 1KV4A 2QKDA 4H44B 2K1AA 5T67A 1K9M2 4NOZA 5KLIB 1Y1VS 1IFJA 3I56Z 2N1TA 3VMAA 2XV5A 1YJN1 2P10A 2RPRA 1FOSF 1Q81Q 5CBNA 4OGQB 1MZ9A 1SFCB 1JTHB 1NTZJ 4IOIH 3HOZI 5AVQB 2WITA 3L75D 3NH5A 5CMZA 3G4SP 2E42A 4E31A 3P7KA 1KQLA 1WCMI 3EEDA 1ZMEC 1A02F 1L0LD 2R6MA 2VUMI 3I55Z 1TWFI 1G1JA 4TLFA 4Y52I 2R5BA 2F4MA 1Y47A 1N7SD 1EC5A 5AVXB 4E2WA 2NAPA 4NBAA 2K5RA 2G8YA 3MZLB 1G2CB 3HUSB 3V2PA 3VMXA 2P28A 2E74C 1YIJZ 1IFNA 2KSEA 4Y28J 3I56P 4HGYA 1GU4A 1QVFY 4H44C 3HOYI 5L8RJ 5KLIC 3Q2YA 3CC21 1S4XA 3BG0B 1BCCG 5AW3B 3CCRZ 5AW2B 1L0NE 1RQFA 1JMMA 3TF5A 3H1IE 3M91A 3PH0A 3V6IA 1VQ6P 2E76D 4RVHA 2JIOA 4OGQC 1L0NJ 1OVRA 4I7ZC 3H1IJ 3TDKA 3GTLI 1DIPA 1SFCC 1SS1A 3RZOI 3HD7A 1BE3E 4K35A 1RQVA 1WRGA 2JIQA 3BRTB 2W83C 2E2HI 5H2FE 3W68A 3L70E 3I55P 3V4WA 1BE3J 2D2CD 2V8KA 1MUUA 2PAJA 1SQXG 2LEXA 1YI2Z 3L70J 1N73B 3NMDA 4ZKPA 1LGHB 5IT9f 1NTKK 2KOGA 1QVFZ 2A06D 3WMM0 4ZNCA 3AE6C 3J81f 1KB9E 1H8AA 1BSNA 1LTJB 5BU5A 1YIJP 4MD8A 2I8DA 1LTAC 2QRXA 3A2AA 4Y7NI 3HUSC 1OWAA 3P32A 3PRJA 1PZQA 2VUGA 5E79E 2KI7B 4GOFA 1KD12 1YJNZ 1GK6A 4CL1A 5TJHA 4JYCA 2OYOA 4XX2A 1S3JA 3NH4A 1DL6A 4BY7I 2YNYA 5KKZB 1AVYA 3E7KA 4H13B 5AVYB 1IZNB 2ZVOB 1YBKA 5AW0B 4MD7A 3CD6P 2IBZE 2NVQI 4PD4E 3CPWO 1LWUB 4MD9A 2N1TC 1FBMA 1N8R2 3S1NI 2VPZA 3CMEP 5AW9B 1S2EA 4OVNF 2ZVNB 2L5GB 1FZCB 1PGOA 5KAFE 3CMA1 3L72E 1ZP0C 3CWBE 1RO2A 3CCS1 3NTNA 1GTWA 1NWQA 4QTTA 3V2RA 3HD7B 1WJ2A 1FAVA 1VQ4P 2NRGA 2P58A 3L72J 1J1DB 4RO0A 3CWBJ 2N9BA 1YJW1 1EQ7A 1VQ51 4UB8E 4AQRD 5AW1B 1FDIA 2RKLA 2XNXA 1L0ND 4NBFA 1XTGB 2Y0SA 3H1ID 1AV1A 3HOWI 1Z01A 1ZN5A 1IFPA 3AEGC 1LTJC 5AVRB 3A5TA 3M9QA 3OW2Y 3CX5E 5FLMI 1NVOA 2R92I 2Q4ZA 1L0LK 2ZYGA 3CC2Z 1BE3D 3CLQA 3C8VA 2I1KA 5D1OA 2GTIA 2H8PD 4RS4A 1PPJE 2ZT9B 2R44A 5KKZC 5IT9b 3G9RA 4H13C 1X0TA 2BJOA 2P7JA 1WZNA 3J81b 2DE5A 3AE7C 1JO5A 3V5BA 1LWUC 2Q7CA 4A3KI 1ZB8A 3WU2E 1CSBA 1W2BY 1LTSC 2YKPA 1K8A2 1OW7A 2W6AA 3PLNA 1NU1G 1KZUB 3D2LA 5AN9F 3BCCE 3HD7C 2FYZA 5DJUB 2QEX1 2B89A 1EZVD 1J1DC 2IDBA 3CXHI 4NBBA 3BCCJ 2OZKA 3P8MC 2WSEH 2V45A 3FX0A 3SFDC 5IP7I 2WQYC 4PD4D 1RO4A 1QL1A 3L73G 5APWA 3TDHB 2E5TA 4EYYQ 1SQPD 1W2EA 2E75B 2YXRB 5KAIH 1IFIA 2VRSA 2KZJA 1LNQA 1IC2A 1URQA 1GMJA 1Q862 3CWBD 1K05A 1NYHA 5H2FH 1R5LA 3KXDA 2B88A 3VTPC 2ZT9C 4PV1B 5CM2M 1K732 1Q7Y1 5D1OB 4A3FI 1RE4A 2R7ZI 3S9OA 3EFGA 1M7LA 2KB7P 1NTKE 3CMAZ 2OYHB 3CCSZ 1LJ2A 5GTHE 1KC81 4RVDA 1NTKJ 1KILE 1NAYA 3CX5D 1YJWZ 4W7ZA 5E79H 4OH8B 4Y99B 3KZIH 2UWJE 1VQ5Z 1JOCA 2XDJA 4N6JA 2YXQB 1RF1A 1HTLC 1JY3O 3S2DI 2PM9A 1PPJD 2JWAA 3P8CE 2VPXA 2JS4A 3TK1A 1MV8A 2FYUG 3RK3E 5CHXA 1JY2P 1ML8A 4I6MC 4IL6E 3EERA 4PD4H 3FGAD 4LC1A 2ZXEB 1PP9G 2QJYB 2EGTA 5A2Qf 3M0AA 1VQMP 5T64A 1J1EB 2P67A 2R3CA 3KYQA 2YIUB 2E75C 4W80A 3F5HA 3U1AA 3I07A 1NJI2 3GTKI 5APQA 5KAFH 1HJBA 1Q7YQ 3AE2C 3I4MI 4GT1A 1VQ61 4BRYB 3BCCD 1YUAA 4NH1C 1L0NK 4PV1C 2NPSD 1URQB 4L76A 5CCGD 2K9JA 1RF0A 3WUUA 2FXPA 1KC8Q 4IL6X 1GDTA 1R8EA 4L73A 2O53A 1H89A 3H1HD 1JY3N 2V8JA 1YJWP 2OYHC 1VQ91 3Q5SA 2QEXZ 3FXDA 1RLYA 4C7RA 4PJ0E 1OIPA 3CX5H 1Q822 2WMMA 4Y99C 4NBDA 4E2ZA 1BDCA 1YTZT 3C1LA 4WY4A 2FXOA 5FLXb 5AW6B 2KLUA 4HH4A 1FZEA 3PP5A 1BSHA 3MTUE 2E76B 3JSVC 1RF1B 1W5CE 1JTHA 1DEEG 3KIHA 5KLVE 1S7MA 4K3AA 4S1TA 1NTKD 2Q51A 2IZ4A 2QJYC 4WVZA 3B5ND 4A3CI 3Q3DA 1J1EC 1H0TA 5KLVJ 1X22A 2YIUC 2JR6A 4QMAA 1KILD 5B5EE 2BCCG 3S14I 2Q3IA 3CD61 2AEFA 5DJTB 2BEQD 3AE5C 4C7NA 5AVVB 2HYNA 1FDOA 4JBZA 5KJ7D 2YO3A 2M5AA 1GL2A 3CME1 1J2JB 2AXCA 3H1LG 3MD0A 1URQC 3OJAB 4EWCA 1Q2NA 1U7JA 3P8CD 1WW9A 3RK3D 2L91A 1SQPK 3RL0D 2QEXP 5A2Qb 1YQ3C 3BRVB 3JAMb 1RE4C 3RK2D 1VQ41 1ZLLA 1GD2E 2HFED 2GU2A 3M06A 1ZR4A 3TSIA 1BCCD 4DT0A 3GW6A 2DW3A 4GKGA 2XNDH 4JYBA 3MONA 2YKOA 5APTA 1LTIC 2A06E 1JCCA 4WY4B 4XA4A 2J6AA 1RF1C 2OGUA 1Z56A 1HUCA 4ASVA 3WUVA 2FFDA 4E32A 2NVXI 3GKQA 1N86A 4XFJA 1E5WA 1BGYE 1DX7A 5APVA 5AVWB 3CCQ1 1QGKB 5CJ4A 1H88A 3GG2A 1NUIA 5GTHH 1Q16A 1PFTA 1VQ6Z 4HYTB 5GTIE 1BGYJ 3CCMP 3CPWZ 2OOYB 1KYOE 1K04A 2KZIA 3S15I 2Z5HA 1RHZB 4HKZH 1N73A 2JIRA 1M901 2G2KA 1H0TB 5CCHD 3QWOC 4A3BI 1NHLA 3RBXA 1QXFA 1SVFA 3TYYA 1VQ9Z 4C7NB 4HB1A 1LTJA 3Q5PA 2Q5UA
chains in the Genus database with same CATH topology
4MD9A 3BG1B 2M6NA 1I3QI 2M5AB 1N8R2 4RVGA 3S1NI 3CQZI 1ZXGA 1TFIA 1TWAI 1X3WA 3HKZA 3GTGI 3S17I 4MN4C 2RT9A 3CCJ1 2QREB 3I4NI 2QRCB 1EDLA 2NVYI 3CMA1 4TNUA 2JA7I 1RO2A 3CCS1 3RZDI 3GTOI 2KUBA 5C39A 4QTTA 1VLAA 1JJ2Y 1W2BZ 5FLXf 4NPEA 2P58A 4AYBA 4QTUA 2QRDB 2YU9I 2Q1KA 1YJW1 3M4OI 2NVTI 2JA8I 2RIQA 3CCMZ 1QVGZ 1VQ51 2RKLA 3G4S1 2M48A 4NBFA 2GTHA 3GTMI 2KPIA 2Y0SA 3HOWI 1Q7Y2 1Z01A 4NBCA 2OTJ1 3J80b 3MZKB 2AKLA 1VQ7Z 1K83I 4X6AI 3CPWY 3OW2Y 1KRLA 4E33A 3CD6Z 2LXBA 5FLMI 1NVOA 2JWDA 2Q4ZA 2R92I 1KQSY 3CC2Z 3CCLZ 1Q812 2O4HA 3Q87A 2KIKA 3GTJI 1KC82 1YUKA 3CMEZ 2JUBA 2GTIA 5D1OA 2K3RA 1X3ZA 4RV9A 4RS4A 3G6EZ 4HGZA 2R44A 5IT9b 3MZWB 2DE7A 4BY1I 1X0TA 1Z02A 2BJOA 2LR2A 3VMGA 3J81b 2W03A 2DE5A 1JJ2Z 3I561 1VQ4Z 2JA5I 3VB9A 3S1MI 1KD11 3JAMf 3HOVI 2DE6A 4NB8A 1JMBA 4A3KI 1QYPA 4KJMA 2RBLA 4MRIA 3CCUZ 2R93I 1ZB8A 3GTMS 1W2BY 1VQN1 5C44I 1Z03A 1JM0A 1K8A2 1LP1A 3MHVA 1EDKA 3CCV1 2JA6I 5AN9F 1QVGY 5EFWB 5DJUB 2QEX1 2B89A 3S16I 1RNIA 1KQSZ 2QVAA 2OOXB 2P3YA 2RHBA 4NBBA 1N8R1 2OZKA 3LUSA 3HOUI 3D6WA 4CPGA 1VQM1 1VQOZ 3CCQZ 4A3JI 4HJGH 3I551 5IP7I 1S721 1RO4A 4MXUA 1VQK1 3K7AI 1R9TI 3TDHB 1YJ91 3U50C 1USPB 4EYYQ 3S1QI 4BBSI 4A3DI 2I3CA 3T4NB 3GTPI 4MH4A 3G711 2KZJA 1YITZ 1VQLZ 1WIIA 2E9HA 1S72Z 1Q862 1VQ81 1YIJ1 1MFTA 3S2HI 3ESWA 3F3FC 2F4OA 2B88A 3GCFA 3VMHA 5CM2M 1K732 1Q7Y1 5D1OB 4A3FI 3NDJA 1ZW0A 1VQP1 2R7ZI 3CCJZ 3HOXI 1P9NA 3CCE1 1USPA 3CMAZ 3CCR1 2ZAEB 3M3YI 4GODA 5CBOA 1VQ8Z 1Q811 3CCSZ 4DK1A 1KC81 4RVDA 5C4XI 4WWIA 2QLVB 1YHQ1 3GTQI 1BDDA 4ASWA 2JMOA 1Y1VI 3FQQA 1L1OC 1YJWZ 4DQYB 4E2XA 1I6HI 3ZDMA 2UWJE 1VQ5Z 3CCEZ 3G4SZ 3TE5B 1OVUA 4NB9A 2OTJZ 4BBRI 1LP1B 3NH8A 3S2DI 2PM9A 2QA41 3CC41 2JS4A 3FQMA 4A3EI 3S1KA 1ML8A 2SPZA 1YI21 3EERA 3J80f 4A3II 3FKII 1Y1WI 3IX0A 1I50I 2EGTA 4NBEA 5A2Qf 1K8A1 5C3EI 3CC71 5T64A 2HR3A 2WAQA 1RO0A 3S1RI 1TWCI 2OTKE 3CC4Z 2QKDA 5LL6f 5T67A 3I07A 1NJI2 1K9M2 3GTKI 4NOZA 1Y1VS 2LIYA 4NBGA 2OTL1 3I4MI 3NDIA 3P5JB 3I56Z 1VQ61 1EDJA 1M1K1 1YJN1 1YUAA 4NH1C 2RPRA 5CBNA 1VQNZ 2E2II 2O53A 2W04A 4BXLA 2OTLZ 2V8JA 4IOIH 3QWUA 3HOZI 2JNYA 3CCVZ 4BXXI 1VQ91 3NFZA 4NPDA 2QEXZ 3NH5A 3FXDA 1RLYA 1Q861 2QR1B 1SFOI 4E31A 1Q822 1WCMI 3EEDA 2R6MA 3F3PC 4NFRA 2WMMA 4NBDA 4E2ZA 3H0GI 2VUMI 1BDCA 1K731 4DGLA 1VQMZ 2B87A 5FLXb 3I55Z 1TWFI 4HH4A 1VQKZ 2V8IA 1U7MA 1M902 1YJ9Z 2HU9A 3PO3I 4NBHA 1LQLA 3VMIA 2F4MA 4Y52I 1FC2C 1Y47A 2HF1A 3D9XA 1EC5A 4E2WA 1DEEG 3KIHA 4NBAA 2K5RA 3VTNA 3FXEA 3PO2I 1S7MA 3MZLB 4K3AA 4S1TA 3CCM1 3G71Z 2Q51A 2IZ4A 2M0BA 2PK7A 2P28A 4A3CI 1H0TA 1OVVA 1YIJZ 2KS1B 2JR6A 2B63I 4HGYA 1VQ71 3H3VJ 1QVFY 2YADA 3HOYI 5C4JI 4NPFX 1VQPZ 3S14I 3CD61 2E2JI 5DJTB 5D1PA 5IP9I 1LT1A 3CC21 3CCL1 3BG0B 4JBZA 4A3MI 2M5AA 3CCRZ 2LXCB 1RQFA 1TWHI 3CME1 3PH0A 4EWCA 1Q2NA 1YHQZ 1U7JA 4ZMDA 3G6E1 4RVHA 3CXCY 1WW9A 1NP6A 1OVRA 2LFUA 5A2Qb 3PO3S 3GTLI 1SS1A 3JAMb 3RZOI 2H85A 3KIFA 2IZ3A 1ZB9A 4A93I 1NJI1 1K9M1 4K35A 1VQ41 4E2YA 4MONA 2E2HI 1ZH1A 2PMZA 1N2FA 2GU2A 4E30A 5T6BA 2QA4Z 3CCU1 4RVFA 2V8KA 5K5GB 1YI2Z 3IF8A 5IT9f 3MONA 3CC7Z 1TWGI 1QVFZ 2B87B 4ZNCA 2J6AA 3J81f 4ASVA 4E32A 2NVXI 3GKQA 1EDIA 4MD8A 2I8DA 4Y7NI 2QRXA 1Q821 1VQO1 2VUGA 3CCQ1 2KI7B 4GOFA 1KD12 3J7A4 1NUIA 1PFTA 1VQ6Z 1JWHC 3CXCZ 3CPWZ 3OW2Z 2OOYB 1YJNZ 3RGUA 4CL1A 4A3GI 4A3LI 4GOEA 2KZIA 4XX2A 3S15I 1S3JA 3NH4A 4HKZH 1M901 1DL6A 4BY7I 2G2KA 2VF1A 1H0TB 3QWOC 4A3BI 2WB1A 1QF8A 1YIT1 4MD7A 1M1K2 1VQL1 2NVQI 1VQ9Z 3IFUA 4HB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDK A;  4NPF X;  2M5A B;  5DJT B;  5EFW B;  5DJU B;  1ZXG A;  2B89 A;  1LT1 A;  4MN4 C;  4JBZ A;  2M5A A;  2HR3 A;  2QVA A;  2LXC B;  2OTK E;  1EDL A;  4CPG A;  3PH0 A;  1Q2N A;  1U7J A;  4ZMD A;  2KUB A;  4HJG H;  5C39 A;  1OVR A;  4NPE A;  2P58 A;  1SS1 A;  4EYY Q;  1EDJ A;  2Q1K A;  4K35 A;  2RKL A;  5CBN A;  2KZJ A;  5K5G B;  4BXL A;  1MFT A;  4IOI H;  2B88 A;  2LXB A;  4NPD A;  1NVO A;  2JWD A;  3FXD A;  1ZW0 A;  2B87 B;  2KIK A;  4ZNC A;  4ASV A;  2WMM A;  1BDC A;  1EDI A;  2K3R A;  2B87 A;  2ZAE B;  4GOD A;  5CBO A;  2I8D A;  2QRX A;  2R44 A;  3MZW B;  4WWI A;  2KI7 B;  1BDD A;  4GOF A;  1U7M A;  4ASW A;  1X0T A;  2LR2 A;  1FC2 C;  1Y47 A;  1EC5 A;  3RGU A;  3ZDM A;  1DEE G;  4GOE A;  2KZI A;  2UWJ E;  3FXE A;  1S3J A;  4HKZ H;  4K3A A;  1H0T B;  1JMB A;  4KJM A;  1OVU A;  3QWO C;  2M0B A;  1LP1 B;  1H0T A;  1OVV A;  2KS1 B;  1JM0 A;  4HB1 A;  3S1K A;  2SPZ A;  1LP1 A;  3MHV A; 
#chains in the Genus database with same CATH topology
 4D6T E;  2M5A B;  1GL2 B;  3CQZ I;  1SQQ K;  1TFI A;  1TWA I;  4IL6 H;  3S17 I;  5KLV D;  5AW7 B;  3CCJ 1;  3G6E P;  4D6T J;  2QRE B;  1RF0 C;  3I4N I;  2QRC B;  3IN6 A;  3L74 E;  4DJG A;  1KMI Z;  2LKM A;  2KUB A;  2HLO A;  5C39 A;  1JJ2 Y;  3K5B A;  3L74 J;  2Y9Z A;  2C0X A;  4QTU A;  1KD1 Q;  2YU9 I;  4U3F E;  2O1K A;  3H1K E;  3M4O I;  2NVT I;  3GF7 A;  4U7J A;  3CCU P;  1LWU A;  1WMK A;  4U3F J;  3H1K J;  3GTM I;  3A0H H;  4WY4 C;  3MUD A;  3HE4 A;  3J80 b;  1HH0 A;  2WSE J;  1FZC A;  2K37 A;  5APU A;  3CD6 Z;  2LXB A;  5KAI E;  1M90 Q;  2FFD B;  1KQS Y;  1Q81 2;  1QVG O;  3Q87 A;  4L75 A;  1Y9B A;  4EOT A;  1YUK A;  2CPB A;  3VMY A;  3CME Z;  4PJ0 H;  1VQO P;  2K3R A;  2RN0 A;  4AYC A;  1VQ9 P;  1X8Y A;  5AVS B;  2QE7 H;  3LID A;  4DZO A;  1EXJ A;  2POH A;  2B9B A;  2R32 A;  4L74 A;  3SFE C;  3E1I A;  3VMG A;  3GLM A;  1JJ2 Z;  1VQ4 Z;  3CI9 A;  3HTK A;  3H32 A;  1QX8 A;  4WB4 A;  2WT7 A;  4NB8 A;  4IFF A;  4KJM A;  1GL2 C;  1YQ4 C;  1VDF A;  2R93 I;  3GHG B;  2HOD A;  2BAS A;  4RJT A;  3L75 G;  1BGY D;  5C44 I;  2NPS A;  3KZI E;  3CCV 1;  1L0L G;  2FYU E;  2QSI A;  5B5E H;  3AEC C;  1KYO D;  1EZV E;  1QEX A;  1SQB G;  2IFM A;  3V4Q A;  1CW5 A;  2IZ1 A;  1HGV A;  1RNI A;  1KQS Z;  2A45 H;  2FYU J;  1KFN A;  3D6W A;  2WZ7 A;  4CPG A;  3CXH D;  1VQM 1;  3CCQ Z;  2KP8 A;  3IR9 A;  2NZ2 A;  4HJG H;  1YTZ I;  4JPZ B;  1VL2 A;  3K7A I;  1G1I A;  1YJ9 1;  3KPE A;  1USP B;  1SQP E;  4D6T D;  2E74 D;  4BBS I;  1FJP A;  1NU1 D;  3MIW A;  3I5C A;  3HE4 B;  2FFD C;  3T4N B;  1YYC A;  4H44 D;  3GTP I;  1SQP J;  1QLE D;  3G71 1;  1L4A D;  1PGJ A;  3L74 D;  1SQV G;  2RH0 A;  1S5L E;  1OXZ A;  1AVO A;  1IO4 A;  3ESW A;  3A3Y B;  2F4O A;  2QJP B;  1P84 E;  3NDJ A;  4U3F D;  1VQP 1;  3H1K D;  1OX3 A;  2HPC B;  3HRN A;  1N73 C;  3CCJ Z;  1KIL A;  2FY8 A;  1P9N A;  2FYN B;  1SFC D;  2ZAE B;  3M3Y I;  4GOD A;  4RES B;  5AVT B;  1GZL A;  5C4X I;  4WWI A;  1YHQ 1;  1BDD A;  1FE6 A;  3GHG C;  3HTK B;  3FQQ A;  1M1K Q;  3H32 B;  3H25 A;  2WT7 B;  2H43 A;  1I6H I;  2HOD B;  2N9Y B;  5GTI H;  4IFM A;  1S5L X;  1VQN P;  1KYO H;  1OVU A;  1PL5 A;  2NPS B;  2KLV A;  3CCQ P;  2WSF H;  2G3A A;  2QA4 1;  2RMZ A;  1ZOY C;  3CXH H;  4A3E I;  3TGU E;  3L71 E;  3D70 A;  2OYH A;  1USD A;  2PP6 A;  3FKI I;  1NTZ G;  5KLV K;  1Y1W I;  1I50 I;  3TGU J;  2Q6Q A;  3L71 J;  3EWK A;  1SQQ E;  2IYO A;  1RO0 A;  3CC4 Z;  3MUD C;  5LL6 f;  2C9N Y;  1FZC C;  1SQQ J;  3OA7 A;  5AVZ B;  3NDI A;  3P5J B;  3Q1M A;  1PV3 A;  2FYU D;  5AW4 B;  1EDJ A;  3CCJ P;  4RKU J;  2O1J A;  2O01 J;  2QJP C;  1RH5 B;  3Q5R A;  1XTC C;  3R4Y A;  2N1T D;  2ZFC A;  1VF5 D;  1UIX A;  1JY3 P;  4UB6 E;  2E2I I;  3H1H E;  1T8Z A;  4BXL A;  2OTL Z;  1JB0 J;  2FYN C;  2IFN A;  3OAK A;  3QWU A;  2JNY A;  3CCV Z;  1QVF O;  3NFZ A;  1KIL B;  2MJZ A;  3H1H J;  1SFO I;  2GUS A;  3L4F A;  2QIW A;  2JEE A;  4NFR A;  3H0G I;  4DGL A;  1VQM Z;  2B87 A;  4BRY A;  2QG4 A;  1N7S A;  3QH9 A;  1NH4 A;  4R4L A;  2NPS C;  2V8I A;  5CCG C;  1YJ9 Z;  1DEB A;  3PO3 I;  4NBH A;  3VMI A;  3R2P A;  3RL0 B;  1P84 D;  2GA1 A;  3WUT A;  1L0N G;  3AEB C;  3FXE A;  1JNM A;  3VTN A;  3H1I G;  3PO2 I;  4LGD E;  3RK2 B;  3CC4 P;  3CCM 1;  3G71 Z;  3AE8 C;  3RL0 g;  1SP4 A;  2M0B A;  1KFM A;  2PK7 A;  3LIE A;  1Y8C A;  2W27 A;  2B63 I;  1BE3 G;  4KHX A;  1VQ7 1;  4NPF X;  1VQP Z;  2E2J I;  3M9B A;  5D1P A;  5IP9 I;  1LT1 A;  3L70 G;  1FZA A;  4AUW A;  1DH3 A;  2OTL P;  1AA6 A;  3N4X A;  1YHQ Z;  3CCV P;  4ZMD A;  3G6E 1;  3CXC Y;  2M3E A;  2OYI B;  3TGU D;  3L71 D;  1NU1 K;  1OFC X;  3A0B E;  2O01 N;  1K9M 1;  3LW5 J;  1KIL C;  4MON A;  3V2N A;  1SQQ D;  1ZH1 A;  5APS A;  2V4H A;  2QA4 Z;  3CCU 1;  1BCC E;  3HD7 D;  1YJ9 P;  2ITA A;  3H1L D;  1HF9 A;  1RY3 A;  1BCC J;  3D6Z A;  3IF8 A;  1S5L H;  1OMI A;  2B87 B;  3AE3 C;  3G71 P;  1N7S B;  3M0D A;  1KB9 I;  1LT9 A;  1P84 H;  3A0H E;  3RL0 C;  3AE1 C;  2OAR A;  1EDI A;  2IBZ G;  3V2Q A;  3RK2 C;  4YXW H;  1VQO 1;  4M3L A;  1HGZ A;  2MKV A;  3AED C;  3J7A 4;  1VQP P;  3JCU E;  3BVH A;  4N3Y B;  3CXC Z;  3T97 B;  1SQX E;  3VMZ A;  4EIJ A;  3AEA C;  4GOE A;  1GK4 A;  1AFO A;  1PFI A;  3L72 G;  1OW6 A;  1SQX J;  1NKN A;  3CWB G;  1JUN A;  2J58 A;  1NTM G;  1QF8 A;  2Y0D A;  3EQ2 A;  1YHQ P;  4TT3 H;  1GW4 A;  2GM4 A;  1U57 A;  1L2P A;  2IBZ I;  4PD4 I;  1YIT 1;  2W8Z A;  1PGQ A;  3CCL P;  3OW2 O;  1K9M Q;  3BG1 B;  1L4A A;  4H0L D;  1I3Q I;  1Q90 D;  3H6P A;  1N7L A;  4JQ0 D;  1ZXG A;  5AW5 B;  1X3W A;  2FBW C;  1IK7 A;  3GTG I;  2PGD A;  4DOJ A;  4MN4 C;  2WVR A;  2RT9 A;  2QA4 P;  3PTZ A;  2QJK B;  1CZQ A;  2NVY I;  1ZRT E;  3IAO A;  4TNU A;  2JA7 I;  3AEF C;  3RZD I;  2D2C B;  2FYU K;  2AYD A;  2WPV B;  4AYB A;  3PHL A;  2O01 H;  2Z5I A;  2QM7 A;  4ZKU A;  3CCM Z;  1QVG Z;  2W6B A;  1PPJ G;  2W90 A;  1HVV A;  2GTH A;  2KPI A;  1N7S C;  2R5D A;  1RQU A;  1FZF A;  4NBC A;  1Q7Y 2;  2OTJ 1;  1W2B O;  1VQ7 Z;  3CX5 I;  1K83 I;  4UB6 H;  3CPW Y;  1SQV E;  3NFQ A;  2E75 D;  1LT9 B;  2KNC A;  1AJY A;  2O4H A;  3VOP A;  1IFM A;  3GTJ I;  4B86 A;  1KC8 2;  2BEZ F;  1X3Z A;  4RV9 A;  2IV2 X;  3G6E Z;  2ZYD A;  3FWL A;  3MZW B;  4PV1 D;  4JF7 A;  2LR2 A;  1S1C X;  2JA5 I;  1KD1 1;  2M8R A;  1FDM A;  2E76 C;  5CJ0 A;  1JMB A;  3SWF A;  4MRI A;  3CCU Z;  3GTM S;  2WSC H;  1L4A B;  2Z4E A;  1VQN 1;  3H1J G;  3FWN A;  1T2K D;  2QJK C;  1JM0 A;  1EDK A;  2D2C C;  1SQX D;  3USS A;  1HJ0 A;  1JEK A;  2JKV A;  2M3B A;  2XU6 A;  3VP8 A;  1NTZ E;  3F89 A;  2ZYA A;  2P3Y A;  1N8R 1;  4I7Z B;  5AVU B;  1M57 D;  3CXH E;  1VQ7 P;  1VQO Z;  1GW3 A;  1ZV8 A;  2WSF J;  4A3J I;  3L36 A;  1FS0 E;  3GHG A;  3AE9 C;  1VQK 1;  3L37 A;  4Z1M H;  3G3Z A;  1VPC A;  1NTK G;  3LW5 H;  1PIX A;  3S1Q I;  2CPS A;  1NU1 E;  3M0D C;  2WWW A;  3A0B H;  1LT9 C;  2I3C A;  2WTY A;  2JDI H;  1SQB D;  3O6Q A;  1NU1 J;  1KOR A;  1T6A A;  1YIT Z;  3SWK A;  1ZRT D;  2JP3 A;  1S72 Z;  2KNC B;  2WSS H;  3F3F C;  4OWF A;  3MP7 B;  2JIM A;  2Y0C A;  1URQ D;  1ZW0 A;  3L73 E;  4WBA A;  2E5Y A;  5KTB A;  3HOX I;  4XE5 B;  1USP A;  5CBO A;  3L73 J;  1VQ8 Z;  3TNU B;  4DK1 A;  1AQ5 A;  3PJS K;  3M9H A;  4ASW A;  1Y1V I;  3JC2 2;  1UII A;  1SQV D;  3B4S A;  1L4A C;  1L1O C;  2VPY A;  1N2D C;  3ZDM A;  3JCU H;  3CCE Z;  1N8R Q;  4YXD C;  2KSJ A;  4NB9 A;  2OTJ Z;  2HG5 D;  2HPC A;  3SWY A;  2N1T B;  1VF5 B;  2C0W A;  2XZR A;  3CC4 1;  3FQM A;  2R3S A;  4W7Y A;  2Y9Y A;  1TU3 F;  2H89 C;  3E1R A;  2KS1 A;  3B71 A;  1K8A 1;  3CC7 1;  3HE5 A;  4HH2 A;  1YIT P;  3S1R I;  2OTK E;  1S72 P;  4N78 E;  4IFD K;  5APY A;  2LIY A;  5CCG A;  4NBG A;  2GUV A;  2OTL 1;  1QL2 A;  1D7M A;  4O9B A;  1M1K 1;  2IYP A;  3O6Q B;  1NTZ D;  1VQ8 P;  1PP9 E;  1M8O B;  2YKQ A;  2ZJS E;  1VQN Z;  5BVZ A;  2W04 A;  2P2U A;  1PP9 J;  4BXX I;  2WPS A;  1AA0 A;  4NPD A;  5KLV G;  2O3J A;  3CCE P;  1Q86 1;  2QR1 B;  3CCR P;  3O8Z A;  4YTP C;  3F3P C;  2OTJ P;  3CL3 D;  1NO4 A;  1K73 1;  1USE A;  4BWN A;  2V7Q H;  1X79 B;  1JCD A;  2A45 G;  1VQK Z;  1U7M A;  1M90 2;  2HU9 A;  1LQL A;  1FC2 C;  1VF5 C;  2HF1 A;  1LTB C;  4WY4 D;  3D9X A;  1K8A Q;  1DD4 A;  3B5N A;  3L73 D;  2AEM A;  4OGQ D;  2JO1 A;  5TIS E;  2I1J A;  1FOS E;  1HBW A;  3AEE C;  1YI2 P;  1OVV A;  2KS1 B;  1NTM E;  1SQX K;  5KJ7 A;  2YMK A;  2ZXX A;  3H3V J;  2A45 I;  2J5U A;  2YAD A;  5C4J I;  3HE5 B;  1NTM J;  3CCL 1;  1MFZ A;  4A3M I;  2LXC B;  1OW8 A;  1TWH I;  2CK3 H;  3ITK A;  1T3J A;  1A02 J;  3NXS A;  1NP6 A;  1GL2 D;  4GIF A;  1YJN P;  4A7P A;  2LFU A;  1Q86 Q;  3PO3 S;  2A06 G;  4I2L C;  2H85 A;  3KIF A;  2IZ3 A;  1ZB9 A;  4A93 I;  1NJI 1;  2BCC E;  3U59 A;  1K73 Q;  1SQB K;  4E2Y A;  5AW8 B;  1BGY G;  2K88 A;  2PMZ A;  1N2F A;  3L70 D;  2BCC J;  5T6B A;  1LTT C;  3KHU A;  4E30 A;  4RVF A;  5K5G B;  4R4M A;  1VQK P;  4GDO A;  2K9Y A;  4N78 D;  1NOH A;  3H1L E;  2C9L Y;  2XKM A;  1IJD B;  1AQT A;  3CC7 Z;  1TWG I;  2YMY A;  4H0L B;  2OYI A;  5BU8 B;  3H1L J;  1KQF B;  1KB9 D;  4EDF A;  2AXT E;  5B66 E;  1PP9 D;  2JR8 A;  2H7H A;  1Q82 1;  1SQV K;  4D6T G;  3B5N B;  5CCH A;  2AEJ A;  1JWH C;  1KYO I;  1SLQ A;  3OW2 Z;  1NGM B;  1WT6 A;  2IZ0 A;  3RGU A;  4A3G I;  4A3L I;  2WPR A;  3SSU A;  3L74 G;  1EXI A;  2VF1 A;  3RBZ A;  3IR7 A;  2WB1 A;  2PFX A;  3VYI A;  1FU1 A;  2KK7 A;  1M1K 2;  2IBZ D;  1VQL 1;  1RE3 A;  4U3F G;  3IFU A;  3H1K G;  1IK9 A;  3CC2 P;  2J59 M;  1NJI Q;  3H1J E;  1R5S A;  2M6N A;  1M56 D;  1S9K E;  3RK3 B;  4RVG A;  1KQS O;  2V3V A;  3HKZ A;  3H1J J;  3T97 A;  4EI2 A;  1EDL A;  3L72 D;  1PGP A;  2WSC J;  3GTO I;  1NTM D;  4I1L A;  1VLA A;  1M1J A;  2E43 A;  1CI6 A;  1W2B Z;  5FLX f;  4NPE A;  1LTG C;  3CC7 P;  2QRD B;  2Q1K A;  1NTZ K;  3II6 A;  2JA8 I;  2RIQ A;  3D71 A;  1SIW A;  4H13 D;  3G4S 1;  1Q82 Q;  2QM8 A;  2M48 A;  4H0L C;  3GMA A;  1KB9 H;  1KN7 A;  3MZK B;  3L35 A;  2AKL A;  4X6A I;  1KRL A;  4E33 A;  1E79 H;  2JWD A;  1Y8A A;  3CCL Z;  3B5N C;  2W6J H;  3C9I A;  2BCC D;  2KIK A;  1HWT C;  2JUB A;  1NKZ B;  2PRR A;  4HGZ A;  1DD3 A;  3VN0 A;  2DE7 A;  1NAF A;  2WPQ A;  5KJ7 C;  4BY1 I;  1Z02 A;  1EZV G;  3MGN A;  2E7Z A;  1KTM A;  2W03 A;  2JJL A;  3I56 1;  3IF4 A;  3VB9 A;  3S1M I;  3N7N A;  3JAM f;  3HOV I;  2DE6 A;  3RK3 C;  1QYP A;  2RBL A;  1FZG A;  3VP9 A;  5TIS H;  1KQG B;  1OZH A;  1SQP G;  1Z03 A;  1LP1 A;  2Y0E A;  3MHV A;  3BAT A;  2JA6 I;  1EZV I;  1QVG Y;  5EFW B;  3S16 I;  3CMA P;  1MKM A;  3CCS P;  2QVA A;  3AE4 C;  2OOX B;  2ZT9 D;  2RHB A;  3HOU I;  3LUS A;  1M1J B;  4UB8 H;  1CI6 B;  4LLH A;  4DCK A;  2FXM A;  3KDP B;  1FJK A;  3I55 1;  1T3U A;  1S72 1;  3ABV C;  4MXU A;  3L75 E;  1R9T I;  1VQ5 P;  3H1J D;  3U50 C;  3A7O A;  1S9K D;  2OYI C;  4A3D I;  1T2K C;  1L0L E;  3L75 J;  2Q9I A;  4YPC A;  4MH4 A;  1SQB E;  1X9V A;  2OQQ A;  1L0L J;  1VQL Z;  2JIP A;  1WII A;  2E9H A;  1VQ8 1;  2IX7 C;  1YIJ 1;  1MFT A;  3S2H I;  5CCH C;  1SQB J;  1JY2 O;  2KYV A;  1P84 I;  3GCF A;  3VMH A;  1SFC A;  4KT0 J;  3S4R A;  3UIA A;  2H88 C;  3CCE 1;  5APX A;  2YO2 A;  2KXP B;  3CCR 1;  1Q81 1;  3TGU G;  3L71 G;  2AXT H;  5B66 H;  1RE3 C;  2QLV B;  4C46 A;  3GTQ I;  3WU2 H;  1FZB A;  2JMO A;  2FKW B;  3W67 A;  3D6Y A;  2IPP A;  3KQG A;  4DQY B;  4E2X A;  1SQQ G;  3U1C A;  3IFM A;  3G4S Z;  1SQV J;  2P1J A;  3TE5 B;  2VPW A;  3GF3 A;  4BBR I;  1LP1 B;  3NH8 A;  1G2C A;  3HUS A;  1GU5 A;  2Q3E A;  5M1B A;  1ZR2 A;  1M1J C;  2V7Q J;  3S1K A;  2SPZ A;  3BCC G;  1YI2 1;  3J80 f;  3TNU A;  1JY2 N;  4A3I I;  2K9J B;  1IFD A;  3IX0 A;  4NBE A;  5C3E I;  2E74 B;  2HR3 A;  2WAQ A;  3EFF K;  3BAS A;  3H1H G;  1VQL P;  1TWC I;  1NTM K;  3B8E B;  1KV4 A;  2QKD A;  4H44 B;  2K1A A;  5T67 A;  1K9M 2;  4NOZ A;  5KLI B;  1Y1V S;  1IFJ A;  3I56 Z;  2N1T A;  3VMA A;  2XV5 A;  1YJN 1;  2P10 A;  2RPR A;  1FOS F;  1Q81 Q;  5CBN A;  4OGQ B;  1MZ9 A;  1SFC B;  1JTH B;  1NTZ J;  4IOI H;  3HOZ I;  5AVQ B;  2WIT A;  3L75 D;  3NH5 A;  5CMZ A;  3G4S P;  2E42 A;  4E31 A;  3P7K A;  1KQL A;  1WCM I;  3EED A;  1ZME C;  1A02 F;  1L0L D;  2R6M A;  2VUM I;  3I55 Z;  1TWF I;  1G1J A;  4TLF A;  4Y52 I;  2R5B A;  2F4M A;  1Y47 A;  1N7S D;  1EC5 A;  5AVX B;  4E2W A;  2NAP A;  4NBA A;  2K5R A;  2G8Y A;  3MZL B;  1G2C B;  3HUS B;  3V2P A;  3VMX A;  2P28 A;  2E74 C;  1YIJ Z;  1IFN A;  2KSE A;  4Y28 J;  3I56 P;  4HGY A;  1GU4 A;  1QVF Y;  4H44 C;  3HOY I;  5L8R J;  5KLI C;  3Q2Y A;  3CC2 1;  1S4X A;  3BG0 B;  1BCC G;  5AW3 B;  3CCR Z;  5AW2 B;  1L0N E;  1RQF A;  1JMM A;  3TF5 A;  3H1I E;  3M91 A;  3PH0 A;  3V6I A;  1VQ6 P;  2E76 D;  4RVH A;  2JIO A;  4OGQ C;  1L0N J;  1OVR A;  4I7Z C;  3H1I J;  3TDK A;  3GTL I;  1DIP A;  1SFC C;  1SS1 A;  3RZO I;  3HD7 A;  1BE3 E;  4K35 A;  1RQV A;  1WRG A;  2JIQ A;  3BRT B;  2W83 C;  2E2H I;  5H2F E;  3W68 A;  3L70 E;  3I55 P;  3V4W A;  1BE3 J;  2D2C D;  2V8K A;  1MUU A;  2PAJ A;  1SQX G;  2LEX A;  1YI2 Z;  3L70 J;  1N73 B;  3NMD A;  4ZKP A;  1LGH B;  5IT9 f;  1NTK K;  2KOG A;  1QVF Z;  2A06 D;  3WMM 0;  4ZNC A;  3AE6 C;  3J81 f;  1KB9 E;  1H8A A;  1BSN A;  1LTJ B;  5BU5 A;  1YIJ P;  4MD8 A;  2I8D A;  1LTA C;  2QRX A;  3A2A A;  4Y7N I;  3HUS C;  1OWA A;  3P32 A;  3PRJ A;  1PZQ A;  2VUG A;  5E79 E;  2KI7 B;  4GOF A;  1KD1 2;  1YJN Z;  1GK6 A;  4CL1 A;  5TJH A;  4JYC A;  2OYO A;  4XX2 A;  1S3J A;  3NH4 A;  1DL6 A;  4BY7 I;  2YNY A;  5KKZ B;  1AVY A;  3E7K A;  4H13 B;  5AVY B;  1IZN B;  2ZVO B;  1YBK A;  5AW0 B;  4MD7 A;  3CD6 P;  2IBZ E;  2NVQ I;  4PD4 E;  3CPW O;  1LWU B;  4MD9 A;  2N1T C;  1FBM A;  1N8R 2;  3S1N I;  2VPZ A;  3CME P;  5AW9 B;  1S2E A;  4OVN F;  2ZVN B;  2L5G B;  1FZC B;  1PGO A;  5KAF E;  3CMA 1;  3L72 E;  1ZP0 C;  3CWB E;  1RO2 A;  3CCS 1;  3NTN A;  1GTW A;  1NWQ A;  4QTT A;  3V2R A;  3HD7 B;  1WJ2 A;  1FAV A;  1VQ4 P;  2NRG A;  2P58 A;  3L72 J;  1J1D B;  4RO0 A;  3CWB J;  2N9B A;  1YJW 1;  1EQ7 A;  1VQ5 1;  4UB8 E;  4AQR D;  5AW1 B;  1FDI A;  2RKL A;  2XNX A;  1L0N D;  4NBF A;  1XTG B;  2Y0S A;  3H1I D;  1AV1 A;  3HOW I;  1Z01 A;  1ZN5 A;  1IFP A;  3AEG C;  1LTJ C;  5AVR B;  3A5T A;  3M9Q A;  3OW2 Y;  3CX5 E;  5FLM I;  1NVO A;  2R92 I;  2Q4Z A;  1L0L K;  2ZYG A;  3CC2 Z;  1BE3 D;  3CLQ A;  3C8V A;  2I1K A;  5D1O A;  2GTI A;  2H8P D;  4RS4 A;  1PPJ E;  2ZT9 B;  2R44 A;  5KKZ C;  5IT9 b;  3G9R A;  4H13 C;  1X0T A;  2BJO A;  2P7J A;  1WZN A;  3J81 b;  2DE5 A;  3AE7 C;  1JO5 A;  3V5B A;  1LWU C;  2Q7C A;  4A3K I;  1ZB8 A;  3WU2 E;  1CSB A;  1W2B Y;  1LTS C;  2YKP A;  1K8A 2;  1OW7 A;  2W6A A;  3PLN A;  1NU1 G;  1KZU B;  3D2L A;  5AN9 F;  3BCC E;  3HD7 C;  2FYZ A;  5DJU B;  2QEX 1;  2B89 A;  1EZV D;  1J1D C;  2IDB A;  3CXH I;  4NBB A;  3BCC J;  2OZK A;  3P8M C;  2WSE H;  2V45 A;  3FX0 A;  3SFD C;  5IP7 I;  2WQY C;  4PD4 D;  1RO4 A;  1QL1 A;  3L73 G;  5APW A;  3TDH B;  2E5T A;  4EYY Q;  1SQP D;  1W2E A;  2E75 B;  2YXR B;  5KAI H;  1IFI A;  2VRS A;  2KZJ A;  1LNQ A;  1IC2 A;  1URQ A;  1GMJ A;  1Q86 2;  3CWB D;  1K05 A;  1NYH A;  5H2F H;  1R5L A;  3KXD A;  2B88 A;  3VTP C;  2ZT9 C;  4PV1 B;  5CM2 M;  1K73 2;  1Q7Y 1;  5D1O B;  4A3F I;  1RE4 A;  2R7Z I;  3S9O A;  3EFG A;  1M7L A;  2KB7 P;  1NTK E;  3CMA Z;  2OYH B;  3CCS Z;  1LJ2 A;  5GTH E;  1KC8 1;  4RVD A;  1NTK J;  1KIL E;  1NAY A;  3CX5 D;  1YJW Z;  4W7Z A;  5E79 H;  4OH8 B;  4Y99 B;  3KZI H;  2UWJ E;  1VQ5 Z;  1JOC A;  2XDJ A;  4N6J A;  2YXQ B;  1RF1 A;  1HTL C;  1JY3 O;  3S2D I;  2PM9 A;  1PPJ D;  2JWA A;  3P8C E;  2VPX A;  2JS4 A;  3TK1 A;  1MV8 A;  2FYU G;  3RK3 E;  5CHX A;  1JY2 P;  1ML8 A;  4I6M C;  4IL6 E;  3EER A;  4PD4 H;  3FGA D;  4LC1 A;  2ZXE B;  1PP9 G;  2QJY B;  2EGT A;  5A2Q f;  3M0A A;  1VQM P;  5T64 A;  1J1E B;  2P67 A;  2R3C A;  3KYQ A;  2YIU B;  2E75 C;  4W80 A;  3F5H A;  3U1A A;  3I07 A;  1NJI 2;  3GTK I;  5APQ A;  5KAF H;  1HJB A;  1Q7Y Q;  3AE2 C;  3I4M I;  4GT1 A;  1VQ6 1;  4BRY B;  3BCC D;  1YUA A;  4NH1 C;  1L0N K;  4PV1 C;  2NPS D;  1URQ B;  4L76 A;  5CCG D;  2K9J A;  1RF0 A;  3WUU A;  2FXP A;  1KC8 Q;  4IL6 X;  1GDT A;  1R8E A;  4L73 A;  2O53 A;  1H89 A;  3H1H D;  1JY3 N;  2V8J A;  1YJW P;  2OYH C;  1VQ9 1;  3Q5S A;  2QEX Z;  3FXD A;  1RLY A;  4C7R A;  4PJ0 E;  1OIP A;  3CX5 H;  1Q82 2;  2WMM A;  4Y99 C;  4NBD A;  4E2Z A;  1BDC A;  1YTZ T;  3C1L A;  4WY4 A;  2FXO A;  5FLX b;  5AW6 B;  2KLU A;  4HH4 A;  1FZE A;  3PP5 A;  1BSH A;  3MTU E;  2E76 B;  3JSV C;  1RF1 B;  1W5C E;  1JTH A;  1DEE G;  3KIH A;  5KLV E;  1S7M A;  4K3A A;  4S1T A;  1NTK D;  2Q51 A;  2IZ4 A;  2QJY C;  4WVZ A;  3B5N D;  4A3C I;  3Q3D A;  1J1E C;  1H0T A;  5KLV J;  1X22 A;  2YIU C;  2JR6 A;  4QMA A;  1KIL D;  5B5E E;  2BCC G;  3S14 I;  2Q3I A;  3CD6 1;  2AEF A;  5DJT B;  2BEQ D;  3AE5 C;  4C7N A;  5AVV B;  2HYN A;  1FDO A;  4JBZ A;  5KJ7 D;  2YO3 A;  2M5A A;  1GL2 A;  3CME 1;  1J2J B;  2AXC A;  3H1L G;  3MD0 A;  1URQ C;  3OJA B;  4EWC A;  1Q2N A;  1U7J A;  3P8C D;  1WW9 A;  3RK3 D;  2L91 A;  1SQP K;  3RL0 D;  2QEX P;  5A2Q b;  1YQ3 C;  3BRV B;  3JAM b;  1RE4 C;  3RK2 D;  1VQ4 1;  1ZLL A;  1GD2 E;  2HFE D;  2GU2 A;  3M06 A;  1ZR4 A;  3TSI A;  1BCC D;  4DT0 A;  3GW6 A;  2DW3 A;  4GKG A;  2XND H;  4JYB A;  3MON A;  2YKO A;  5APT A;  1LTI C;  2A06 E;  1JCC A;  4WY4 B;  4XA4 A;  2J6A A;  1RF1 C;  2OGU A;  1Z56 A;  1HUC A;  4ASV A;  3WUV A;  2FFD A;  4E32 A;  2NVX I;  3GKQ A;  1N86 A;  4XFJ A;  1E5W A;  1BGY E;  1DX7 A;  5APV A;  5AVW B;  3CCQ 1;  1QGK B;  5CJ4 A;  1H88 A;  3GG2 A;  1NUI A;  5GTH H;  1Q16 A;  1PFT A;  1VQ6 Z;  4HYT B;  5GTI E;  1BGY J;  3CCM P;  3CPW Z;  2OOY B;  1KYO E;  1K04 A;  2KZI A;  3S15 I;  2Z5H A;  1RHZ B;  4HKZ H;  1N73 A;  2JIR A;  1M90 1;  2G2K A;  1H0T B;  5CCH D;  3QWO C;  4A3B I;  1NHL A;  3RBX A;  1QXF A;  1SVF A;  3TYY A;  1VQ9 Z;  4C7N B;  4HB1 A;  1LTJ A;  3Q5P A;  2Q5U A; 
#chains in the Genus database with same CATH homology
 4MD9 A;  3BG1 B;  2M6N A;  1I3Q I;  2M5A B;  1N8R 2;  4RVG A;  3S1N I;  3CQZ I;  1ZXG A;  1TFI A;  1TWA I;  1X3W A;  3HKZ A;  3GTG I;  3S17 I;  4MN4 C;  2RT9 A;  3CCJ 1;  2QRE B;  3I4N I;  2QRC B;  1EDL A;  2NVY I;  3CMA 1;  4TNU A;  2JA7 I;  1RO2 A;  3CCS 1;  3RZD I;  3GTO I;  2KUB A;  5C39 A;  4QTT A;  1VLA A;  1JJ2 Y;  1W2B Z;  5FLX f;  4NPE A;  2P58 A;  4AYB A;  4QTU A;  2QRD B;  2YU9 I;  2Q1K A;  1YJW 1;  3M4O I;  2NVT I;  2JA8 I;  2RIQ A;  3CCM Z;  1QVG Z;  1VQ5 1;  2RKL A;  3G4S 1;  2M48 A;  4NBF A;  2GTH A;  3GTM I;  2KPI A;  2Y0S A;  3HOW I;  1Q7Y 2;  1Z01 A;  4NBC A;  2OTJ 1;  3J80 b;  3MZK B;  2AKL A;  1VQ7 Z;  1K83 I;  4X6A I;  3CPW Y;  3OW2 Y;  1KRL A;  4E33 A;  3CD6 Z;  2LXB A;  5FLM I;  1NVO A;  2JWD A;  2Q4Z A;  2R92 I;  1KQS Y;  3CC2 Z;  3CCL Z;  1Q81 2;  2O4H A;  3Q87 A;  2KIK A;  3GTJ I;  1KC8 2;  1YUK A;  3CME Z;  2JUB A;  2GTI A;  5D1O A;  2K3R A;  1X3Z A;  4RV9 A;  4RS4 A;  3G6E Z;  4HGZ A;  2R44 A;  5IT9 b;  3MZW B;  2DE7 A;  4BY1 I;  1X0T A;  1Z02 A;  2BJO A;  2LR2 A;  3VMG A;  3J81 b;  2W03 A;  2DE5 A;  1JJ2 Z;  3I56 1;  1VQ4 Z;  2JA5 I;  3VB9 A;  3S1M I;  1KD1 1;  3JAM f;  3HOV I;  2DE6 A;  4NB8 A;  1JMB A;  4A3K I;  1QYP A;  4KJM A;  2RBL A;  4MRI A;  3CCU Z;  2R93 I;  1ZB8 A;  3GTM S;  1W2B Y;  1VQN 1;  5C44 I;  1Z03 A;  1JM0 A;  1K8A 2;  1LP1 A;  3MHV A;  1EDK A;  3CCV 1;  2JA6 I;  5AN9 F;  1QVG Y;  5EFW B;  5DJU B;  2QEX 1;  2B89 A;  3S16 I;  1RNI A;  1KQS Z;  2QVA A;  2OOX B;  2P3Y A;  2RHB A;  4NBB A;  1N8R 1;  2OZK A;  3LUS A;  3HOU I;  3D6W A;  4CPG A;  1VQM 1;  1VQO Z;  3CCQ Z;  4A3J I;  4HJG H;  3I55 1;  5IP7 I;  1S72 1;  1RO4 A;  4MXU A;  1VQK 1;  3K7A I;  1R9T I;  3TDH B;  1YJ9 1;  3U50 C;  1USP B;  4EYY Q;  3S1Q I;  4BBS I;  4A3D I;  2I3C A;  3T4N B;  3GTP I;  4MH4 A;  3G71 1;  2KZJ A;  1YIT Z;  1VQL Z;  1WII A;  2E9H A;  1S72 Z;  1Q86 2;  1VQ8 1;  1YIJ 1;  1MFT A;  3S2H I;  3ESW A;  3F3F C;  2F4O A;  2B88 A;  3GCF A;  3VMH A;  5CM2 M;  1K73 2;  1Q7Y 1;  5D1O B;  4A3F I;  3NDJ A;  1ZW0 A;  1VQP 1;  2R7Z I;  3CCJ Z;  3HOX I;  1P9N A;  3CCE 1;  1USP A;  3CMA Z;  3CCR 1;  2ZAE B;  3M3Y I;  4GOD A;  5CBO A;  1VQ8 Z;  1Q81 1;  3CCS Z;  4DK1 A;  1KC8 1;  4RVD A;  5C4X I;  4WWI A;  2QLV B;  1YHQ 1;  3GTQ I;  1BDD A;  4ASW A;  2JMO A;  1Y1V I;  3FQQ A;  1L1O C;  1YJW Z;  4DQY B;  4E2X A;  1I6H I;  3ZDM A;  2UWJ E;  1VQ5 Z;  3CCE Z;  3G4S Z;  3TE5 B;  1OVU A;  4NB9 A;  2OTJ Z;  4BBR I;  1LP1 B;  3NH8 A;  3S2D I;  2PM9 A;  2QA4 1;  3CC4 1;  2JS4 A;  3FQM A;  4A3E I;  3S1K A;  1ML8 A;  2SPZ A;  1YI2 1;  3EER A;  3J80 f;  4A3I I;  3FKI I;  1Y1W I;  3IX0 A;  1I50 I;  2EGT A;  4NBE A;  5A2Q f;  1K8A 1;  5C3E I;  3CC7 1;  5T64 A;  2HR3 A;  2WAQ A;  1RO0 A;  3S1R I;  1TWC I;  2OTK E;  3CC4 Z;  2QKD A;  5LL6 f;  5T67 A;  3I07 A;  1NJI 2;  1K9M 2;  3GTK I;  4NOZ A;  1Y1V S;  2LIY A;  4NBG A;  2OTL 1;  3I4M I;  3NDI A;  3P5J B;  3I56 Z;  1VQ6 1;  1EDJ A;  1M1K 1;  1YJN 1;  1YUA A;  4NH1 C;  2RPR A;  5CBN A;  1VQN Z;  2E2I I;  2O53 A;  2W04 A;  4BXL A;  2OTL Z;  2V8J A;  4IOI H;  3QWU A;  3HOZ I;  2JNY A;  3CCV Z;  4BXX I;  1VQ9 1;  3NFZ A;  4NPD A;  2QEX Z;  3NH5 A;  3FXD A;  1RLY A;  1Q86 1;  2QR1 B;  1SFO I;  4E31 A;  1Q82 2;  1WCM I;  3EED A;  2R6M A;  3F3P C;  4NFR A;  2WMM A;  4NBD A;  4E2Z A;  3H0G I;  2VUM I;  1BDC A;  1K73 1;  4DGL A;  1VQM Z;  2B87 A;  5FLX b;  3I55 Z;  1TWF I;  4HH4 A;  1VQK Z;  2V8I A;  1U7M A;  1M90 2;  1YJ9 Z;  2HU9 A;  3PO3 I;  4NBH A;  1LQL A;  3VMI A;  2F4M A;  4Y52 I;  1FC2 C;  1Y47 A;  2HF1 A;  3D9X A;  1EC5 A;  4E2W A;  1DEE G;  3KIH A;  4NBA A;  2K5R A;  3VTN A;  3FXE A;  3PO2 I;  1S7M A;  3MZL B;  4K3A A;  4S1T A;  3CCM 1;  3G71 Z;  2Q51 A;  2IZ4 A;  2M0B A;  2PK7 A;  2P28 A;  4A3C I;  1H0T A;  1OVV A;  1YIJ Z;  2KS1 B;  2JR6 A;  2B63 I;  4HGY A;  1VQ7 1;  3H3V J;  1QVF Y;  2YAD A;  3HOY I;  5C4J I;  4NPF X;  1VQP Z;  3S14 I;  3CD6 1;  2E2J I;  5DJT B;  5D1P A;  5IP9 I;  1LT1 A;  3CC2 1;  3CCL 1;  3BG0 B;  4JBZ A;  4A3M I;  2M5A A;  3CCR Z;  2LXC B;  1RQF A;  1TWH I;  3CME 1;  3PH0 A;  4EWC A;  1Q2N A;  1YHQ Z;  1U7J A;  4ZMD A;  3G6E 1;  4RVH A;  3CXC Y;  1WW9 A;  1NP6 A;  1OVR A;  2LFU A;  5A2Q b;  3PO3 S;  3GTL I;  1SS1 A;  3JAM b;  3RZO I;  2H85 A;  3KIF A;  2IZ3 A;  1ZB9 A;  4A93 I;  1NJI 1;  1K9M 1;  4K35 A;  1VQ4 1;  4E2Y A;  4MON A;  2E2H I;  1ZH1 A;  2PMZ A;  1N2F A;  2GU2 A;  4E30 A;  5T6B A;  2QA4 Z;  3CCU 1;  4RVF A;  2V8K A;  5K5G B;  1YI2 Z;  3IF8 A;  5IT9 f;  3MON A;  3CC7 Z;  1TWG I;  1QVF Z;  2B87 B;  4ZNC A;  2J6A A;  3J81 f;  4ASV A;  4E32 A;  2NVX I;  3GKQ A;  1EDI A;  4MD8 A;  2I8D A;  4Y7N I;  2QRX A;  1Q82 1;  1VQO 1;  2VUG A;  3CCQ 1;  2KI7 B;  4GOF A;  1KD1 2;  3J7A 4;  1NUI A;  1PFT A;  1VQ6 Z;  1JWH C;  3CXC Z;  3CPW Z;  3OW2 Z;  2OOY B;  1YJN Z;  3RGU A;  4CL1 A;  4A3G I;  4A3L I;  4GOE A;  2KZI A;  4XX2 A;  3S15 I;  1S3J A;  3NH4 A;  4HKZ H;  1M90 1;  1DL6 A;  4BY7 I;  2G2K A;  2VF1 A;  1H0T B;  3QWO C;  4A3B I;  2WB1 A;  1QF8 A;  1YIT 1;  4MD7 A;  1M1K 2;  1VQL 1;  2NVQ I;  1VQ9 Z;  3IFU A;  4HB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...