1X0TA

Crystal structure of ribonuclease p protein ph1601p from pyrococcus horikoshii ot3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
IVKRRDWEKKEKKKIAIERIDTLFTLAERVARYSPDLAKRYVELALEIQKKAKVKIPRKWKRRYCKRCHTFLIPGVNARVRLRTKRMPHVVITCLECGYIMRYPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Ribonuclease P Protein Ph1601p from Pyrococcus horikoshii OT3: An Archaeal Homologue of Human Nuclear Ribonuclease P Protein Rpp21(,)
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 4
total genus 33
structure length 106
sequence length 106
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2005-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1x0tA01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1x0tA02
4GOEA 1Q2NA 1EC5A 4K3AA 4NPEA 2QVAA 4EYYQ 4IOIH 5CBNA 1FC2C 1EDIA 3RGUA 2I8DA 2M5AB 4WWIA 3S1KA 2JWDA 4K35A 1H0TA 3FXDA 2B87B 1JMBA 5EFWB 1OVVA 2Q1KA 1LP1B 2M0BA 1MFTA 2QRXA 1LT1A 1S3JA 2K3RA 3ZDMA 1ZXGA 1EDLA 5DJUB 2R44A 2KS1B 1JM0A 2LXBA 4HB1A 2WMMA 2OTKE 2UWJE 1NVOA 4ZNCA 5CBOA 1DEEG 1X0TA 1LP1A 1OVUA 2ZAEB 4CPGA 1SS1A 1H0TB 4MN4C 2KUBA 1BDDA 4ASWA 3PH0A 4HJGH 4JBZA 4NPFX 5K5GB 3MHVA 1OVRA 1EDKA 2P58A 2B89A 3FXEA 3MZWB 2KZIA 4HKZH 4ASVA 1BDCA 1Y47A 4BXLA 2LXCB 4GODA 4KJMA 2RKLA 2B88A 5DJTB 1U7MA 1U7JA 2HR3A 2SPZA 2KIKA 3QWOC 1ZW0A 1EDJA 2B87A 5C39A 4GOFA 2LR2A 4NPDA 2KZJA 2KI7B 2M5AA 4ZMDA
chains in the Genus database with same CATH superfamily
1WCMI 2BJOA 3Q1MA 1G1JA 1L4AC 2IX7C 2WQYC 4EIJA 5AW0B 4RVDA 2QM8A 3GMAA 3L70E 2OTLP 4QTUA 3HUSA 1Q821 1I50I 3AEFC 2K9JA 2G3AA 1OXZA 2JIOA 3AECC 3I4MI 2H85A 1VPCA 1BGYE 3KZIH 3N4XA 3CCM1 5C3EI 1Q861 3SWFA 5T67A 3H1JJ 2Y0CA 3P8MC 4U3FJ 1M1JB 1VQKZ 2KS1B 4IFFA 3I55Z 3B71A 1RE4C 3H32A 3CCSZ 1JTHB 4Y52I 1LTJB 1DIPA 3P8CD 2WTYA 5CBOA 2GUSA 1IFIA 1S9KD 2A06D 2K88A 3L75E 1QEXA 4WY4C 3AE2C 2O1JA 2AXCA 5C4XI 1NWQA 2E9HA 4PV1C 2XKMA 5TISH 2OYIC 5AVWB 5CMZA 3CMEZ 3I56P 1NTZD 2A06E 2GA1A 2C9NY 3MZLB 2OYIB 2A45I 2B89A 2VUGA 3RL0B 1URQB 1GDTA 1VQ4Z 4NBCA 5AVXB 3I07A 2NVXI 2H8PD 4GODA 4BRYB 1TWHI 4I7ZC 4I1LA 1AFOA 3O6QA 2A45G 1RQUA 4NBBA 2HR3A 2WSSH 1SQXE 1I6HI 4IFDK 3RL0C 1RQVA 1TU3F 1VQ71 2KI7B 3L73G 5IT9b 1IZNB 5APUA 1Q81Q 2E2JI 3L74G 1AV1A 1M7LA 4C7RA 1N7LA 3IFUA 3AE8C 2HODA 3G6EP 2JA6I 1IC2A 3USSA 4PJ0E 5AVSB 3S1KA 2P10A 1WZNA 3BG0B 3EWKA 1NTMJ 4L75A 4HGZA 4W80A 5KJ7C 1RO0A 2WAQA 1RF1A 1G2CA 2DW3A 4YXDC 1JOCA 3AEGC 3HTKA 3FQMA 3GTQI 3PO3I 4RS4A 5KAFE 2DE5A 1AA6A 5C44I 1LWUB 1AQ5A 1HH0A 2FYZA 1AVYA 1SFCA 2V4HA 4PV1B 4NBHA 1VQ4P 3VTNA 2IZ0A 3L70D 3E1IA 2K37A 3KYQA 3C8VA 4NPFX 1YIJ1 3EERA 2R6MA 3CC2P 5KJ7A 3CCS1 2BCCJ 2W6JH 3A0BE 4OVNF 1EXJA 1LTIC 3IF4A 1YJWZ 1NTKD 2E5TA 1Z03A 2OTJ1 4TNUA 1Q16A 4NBAA 2RT9A 5CCGA 2R7ZI 3C1LA 5B66H 1BDCA 3GTMI 4BXLA 1NU1J 2HF1A 3CC2Z 2IYPA 2IBZE 1U7MA 4Y99B 3CMAP 3PO3S 4A3II 1L0LD 3J81b 2K1AA 4H44D 2WPSA 2J59M 5KLVJ 1H88A 2XNDH 1MV8A 1YJ9P 1NOHA 4JYCA 1ZMEC 2AXTH 2WWWA 5B66E 1PP9G 3S1QI 1DL6A 3U59A 2QVAA 2QG4A 3H1HE 1Q7Y1 3RBXA 1L0NG 5AW3B 4TLFA 1YTZI 3P7KA 3K5BA 3B5NA 1W5CE 3M9HA 3LIDA 1N7SB 2C0WA 2I1JA 1A02F 1BGYJ 1SQBJ 1KC81 2E2II 3GTKI 2C0XA 3AEDC 1QF8A 3GHGB 1L0NK 4D6TG 2YO2A 5AW6B 2IFMA 3SSUA 1GL2B 2LXBA 2ZT9D 4PD4E 4C46A 4WVZA 1OWAA 4PJ0H 3TE5B 1VF5C 4NB8A 5BU5A 1NU1E 1KILE 3MIWA 5KJ7D 5KLVG 4R4MA 4HJGH 3CCQP 1KYOD 3MHVA 2E74C 2WSFH 3FQQA 2OOXB 1K8A2 3CD6P 3D6WA 4RO0A 1VQ81 1NUIA 3TGUE 3MZWB 2YO3A 1JO5A 2QA4P 2EGTA 3RBZA 3NH8A 2Z5HA 3LUSA 1NTKG 4E2XA 2O01J 1HUCA 1NTMG 1RNIA 1VQN1 1BE3D 5CJ0A 1M57D 4EWCA 1MFZA 1S72P 1XTCC 3GF3A 1FBMA 1LTAC 3CCUZ 3P5JB 1SLQA 3NFZA 5LL6f 1N2FA 4A3FI 2NVYI 2VF1A 3F89A 1NTKJ 2KLUA 3CX5E 4MD8A 3S15I 1FZAA 3CPWO 1NTZK 2N9YB 2WB1A 3OJAB 2QRCB 3OW2Y 2GUVA 1NAFA 1W2BO 3L71J 1HGVA 1Q7YQ 2ZYAA 1VQ91 3CXCY 2Q3IA 4I7ZB 1VQM1 2FFDC 1QVFZ 1LP1B 2QRXA 2GTIA 2V7QJ 1YBKA 2YKPA 5DJUB 3G4SZ 1PV3A 4RESB 2B9BA 3CME1 1FDOA 3TGUJ 4NBEA 4MONA 1N73C 1P84H 1NVOA 1LGHB 2KXPB 2Y0DA 5APVA 1N73B 2IFNA 3W67A 1NTZJ 2IZ3A 1VQ9Z 2W03A 1TWAI 2IPPA 1OX3A 2WSCJ 3V6IA 2E74B 2ZT9B 3RK2C 4ASWA 2NVQI 3HOWI 3R2PA 1GU5A 3PH0A 3WUVA 1D7MA 1BGYD 5KLIC 1USEA 2QR1B 2R3CA 3HOUI 5CJ4A 3H1JG 3L36A 3ABVC 2P58A 1YIJP 1Q811 4Y28J 3VMZA 1ZB8A 1SQBG 2ZVNB 1NTKE 2MKVA 1VQ51 1QLED 3H1KE 3P32A 2VPYA 2E75D 4HGYA 2HODB 2OTJP 3CCLZ 1YHQZ 2M48A 2RPRA 2JA8I 4HYTB 1KB9D 1VQNP 1LT9C 3CCVZ 2ZYDA 4H13B 2Q7CA 3K7AI 1OW7A 3P8CE 1VQMP 3FWNA 1PGQA 2NRGA 4W7YA 1YJ91 4LGDE 3H0GI 3HE5A 3V2RA 1JNMA 1ZRTE 1L4AB 1FC2C 2AXTE 3L75G 4OGQD 3CMA1 2M5AB 3V4QA 1VQ5P 1GMJA 1UIIA 1SQBE 1OW8A 1PIXA 4YXWH 3D6YA 1M56D 1GL2D 1MFTA 3CCJP 1LT1A 1S3JA 3BCCG 4W7ZA 3TF5A 1KYOE 3EFGA 3VOPA 3J80b 3CCQZ 2FYUE 4Y99C 4OGQC 1SFCC 3L35A 2YIUB 3M0DC 2QJYC 3RK3D 1SQXD 1NTKK 3S9OA 4CPGA 4MN4C 1JY3P 1KB9E 1K04A 2WPRA 1NTMD 1RE3A 5FLMI 4JBZA 4BBSI 2KNCA 2FYUK 1P9NA 2JKVA 1NAYA 1SP4A 1PGOA 1URQC 2RH0A 3O8ZA 1X8YA 4GDOA 2N1TD 1M8OB 1KQSO 4KJMA 3Q5PA 2GU2A 3U1CA 2K9YA 1AVOA 3V4WA 1M901 3IN6A 2J5UA 2XV5A 2OTLZ 3CD61 2M3BA 2QEX1 3J7A4 3A3YB 1BE3E 1W2EA 2LIYA 1Q2NA 3S1RI 5AVYB 1SQQJ 1KFNA 3GHGC 3G4SP 2F4OA 1J2JB 2D2CB 1L0LK 2P2UA 2ZVOB 3NH4A 5APSA 3HE4A 1Y1VI 1QX8A 1VL2A 1EZVD 3HD7B 4H44C 1TWCI 1OMIA 1Q862 1LJ2A 3L72E 2IDBA 4OGQB 3CXHH 3G6E1 2IBZI 3G6EZ 1ZOYC 4NFRA 2MJZA 1N73A 2AEJA 1GZLA 3CCV1 1FAVA 1SQPD 4RKUJ 3CMEP 1LNQA 1VQL1 1LP1A 3S17I 2RHBA 3BRTB 4UB6H 2OARA 1YITZ 1X3WA 1KC8Q 1NU1G 5CHXA 1EDKA 2PMZA 1MUUA 1QVGO 1K731 3J80f 4QMAA 1BE3J 3C9IA 1NU1K 3BRVB 2KK7A 2JS4A 1JMMA 3TK1A 4EDFA 5FLXb 3H1KG 3KIFA 2HLOA 5BVZA 2B88A 4C7NA 1SQPK 2W04A 2PP6A 4U3FE 3NMDA 3H32B 2P3YA 3M4OI 3IAOA 2BCCG 5B5EH 1S4XA 2POHA 2V8JA 1EC5A 4MRIA 3GG2A 1JJ2Y 3NXSA 3L73E 1HBWA 1WW9A 4IOIH 5APQA 5A2Qf 3CCVP 3L74D 2IZ1A 3RK3E 3QWUA 1LTTC 2P1JA 1FJKA 3CPWZ 2FYUD 4AYBA 1S2EA 1AJYA 3OW2Z 1RE3C 2AEFA 3RK3B 3UIAA 1KILC 4N6JA 4UB8E 2UWJE 2M6NA 3VP8A 2M3EA 2FXMA 5AW8B 2V45A 2A06G 1KORA 3L71D 3CQZI 4A3LI 1YHQ1 1S7MA 1P84I 3CL3D 3AE6C 1LTGC 3HOXI 2HPCA 1T3UA 3L71G 2JIPA 5KAIE 1PZQA 3FXEA 1PL5A 2JDIH 1IO4A 3N7NA 2OOYB 1N8R1 3AE5C 1S72Z 4A7PA 2HYNA 3HOYI 4IL6X 1VF5B 1BGYG 4HH2A 3MP7B 2OQQA 3CWBE 3TGUG 2YADA 3W68A 2DE6A 1E5WA 3MD0A 2HG5D 3H1JE 1SQQK 2I1KA 1GTWA 1JWHC 2YXRB 1YJNP 2B87A 3GLMA 5E79H 4DOJA 3S4RA 2ZXEB 1USPB 4CL1A 3L73D 3V2PA 3EEDA 1Q7Y2 1Z01A 4E31A 1N7SC 1M1JC 1SQXG 3HD7A 3CXHD 1EXIA 3RGUA 2H88C 3HOVI 1PGPA 3B5NC 3I56Z 3M0AA 2M0BA 3GKQA 3D2LA 1BCCE 1N7SD 2PRRA 3BASA 1N8R2 3H25A 2O53A 3S1NI 4A3GI 1PP9J 3H1HJ 2ZJSE 3NFQA 2FY8A 3CCL1 3FWLA 2ZAEB 1M1K1 1S5LX 1NTZG 3NDJA 3A0BH 3CCMP 1SVFA 1FZCC 1T2KD 2K5RA 1GK4A 2KSEA 2JIMA 1VQ8Z 2P7JA 1K9M2 3GCFA 5AVQB 1KQSY 4UB8H 2DE7A 4O9BA 2CPSA 2YNYA 1JTHA 2FFDA 1NHLA 1R5SA 2LKMA 3TSIA 1AQTA 1ZLLA 1K8A1 1M1K2 2HFED 4AUWA 3G3ZA 3Q5RA 1LWUC 4RVHA 1U7JA 4E2WA 4LC1A 2J58A 2Z5IA 3HRNA 4U3FG 3F3FC 2Q51A 2N1TA 2O1KA 3PO2I 2OGUA 1L1OC 3GTLI 4MD7A 3EQ2A 4ZMDA 1LTJC 2QREB 2QRDB 4JQ0D 5AVUB 2Q6QA 2JWAA 1RF1C 3S14I 1X22A 4L76A 3CMAZ 5AW1B 1VQ7P 1L0NJ 2R92I 4WBAA 1L4AD 4A3CI 3H1HG 2IYOA 1NKNA 2O01H 1S5LE 1RF0C 3CCMZ 2E76C 1EDLA 4NH1C 1IFMA 1JCCA 1GW4A 2E5YA 2E74D 3NH5A 1FDMA 2WMMA 2A45H 1R5LA 3S2DI 3CXHI 1SQQD 1LTSC 1KD1Q 5KLIB 3B5NB 3JC22 2Y9ZA 4PD4D 1VQ41 3MUDA 2QA41 1GL2A 5CM2M 4H0LD 3I55P 4S1TA 2YKOA 4R4LA 3GW6A 3AE4C 4NBGA 1QL1A 2E75C 1URQD 2IBZG 3CCQ1 4D6TD 2W90A 2JIQA 1JB0J 3VTPC 2E75B 1VF5D 2KZIA 2AEMA 1NJI1 1KB9I 1JUNA 5IP9I 3D9XA 3H1HD 4GKGA 1PFIA 1VQ61 1W2BZ 1VDFA 1QVFY 2RKLA 2XDJA 4N3YB 4N78E 1CSBA 1CW5A 4OWFA 3G4S1 1L0NE 1GL2C 1J1EB 3G71P 3KXDA 3CCRZ 2V3VA 5C39A 3TDKA 2W8ZA 2OTL1 1YUKA 2ZYGA 5AW4B 4B86A 3CXHE 3CCJZ 1Q86Q 3BG1B 1FZEA 1IFJA 4H13D 1BSHA 3M06A 3H6PA 4DQYB 3CC4P 5CBNA 1VQ9P 3CCUP 4WWIA 1DEBA 3H1LD 1ZR4A 2JWDA 2C9LY 2M8RA 3PTZA 1RO2A 2JJLA 3CD6Z 4WY4D 2PGDA 1SFOI 3VMGA 2J6AA 3H3VJ 2BEQD 3RL0g 2WT7B 3Q87A 3VB9A 1YTZT 2QJKB 3E1RA 4PV1D 1RF1B 1PP9E 1JY3N 5CCHD 1VQPP 1PPJE 3BVHA 1YI2Z 1YI21 5D1PA 2RIQA 2YKQA 4BRYA 4E32A 5IT9f 2XNXA 3H1KJ 4IL6E 2NAPA 5K5GB 3M9BA 1MZ9A 3RZDI 4IL6H 1JJ2Z 3IR9A 4X6AI 2QLVB 3RZOI 1VQKP 2KP8A 1OFCX 2NPSD 4NBDA 4HKZH 1JCDA 3I561 5B5EE 1QYPA 2QJPB 3L37A 3S1MI 3WU2H 2R5BA 5APTA 1LTJA 5TISE 1IFPA 2XZRA 3F3PC 1YJ9Z 5IP7I 1FZBA 2OZKA 1J1DB 2N1TB 1W2BY 3V5BA 1ZW0A 3CCU1 3CC41 2V8IA 2H7HA 1RQFA 2KZJA 2V8KA 1SQXK 1Q822 1NTZE 2WPVB 3HD7C 1KYOI 1KILB 2GTHA 2YU9I 2NZ2A 4KHXA 4K3AA 2NVTI 5AVTB 3CCLP 3AE3C 3AE7C 3PP5A 2XU6A 3PHLA 4E33A 2JA5I 1VLAA 1KILA 3CWBG 3BCCE 5CCGC 3L75D 1PGJA 3JAMf 3AE9C 5AVRB 3AE1C 1BCCG 3ESWA 4A3BI 3GTJI 1NO4A 3CWBD 1BCCJ 1K9MQ 1SQPJ 3MUDC 1ZV8A 3BCCD 1FDIA 4A3DI 2FXPA 3HD7D 3NTNA 1ZXGA 1OZHA 3VMXA 2FKWB 2E43A 4BXXI 3OAKA 3M9QA 1JM0A 1LT9B 1DH3A 3V2NA 1S9KE 3RK2D 2JR8A 1H89A 2WSEJ 2NPSA 5AN9F 1QVFO 1K9M1 2E2HI 3LW5H 1XTGB 3CCEZ 4DK1A 3VMYA 1PPJD 2VRSA 3WUUA 3OW2O 2CK3H 2KUBA 2OYIA 3HOZI 1YYCA 5AW2B 3H1LG 1K732 4WY4A 5L8RJ 1RO4A 3H1IG 4Y7NI 1GU4A 3CC7P 1Z02A 1TWFI 3M91A 3TDHB 2K9JB 2PAJA 1USPA 1ZP0C 3M3YI 1WT6A 1KV4A 3CCR1 2H89C 2V7QH 3VMHA 2E76B 2WSFJ 2NPSB 5KKZB 1M1JA 3L72J 1LTBC 1RY3A 5DJTB 3H1KD 4ZKUA 1ZN5A 3H1LE 2WZ7A 1Z56A 2SPZA 1OW6A 4EI2A 3QWOC 2FYUJ 2O4HA 3GTPI 2OYHC 2Q9IA 5E79E 4NPDA 3HUSC 3L74J 1VQLZ 2H43A 2M5AA 3CI9A 4N78D 5CCGD 4LLHA 4GOEA 1Y1VS 1VQO1 4HH4A 5T64A 2YXQB 1ZR2A 1SQXJ 3I5CA 2JR6A 1EDIA 3FKII 3I551 4U3FD 1HJ0A 4H0LC 1IJDB 5KAFH 2B87B 1YJW1 2QIWA 1L0LJ 1U57A 5T6BA 3PRJA 1E79H 1RLYA 3GHGA 1SFCD 2VPZA 1M902 1SQQG 2R44A 3T97B 1FZFA 4DJGA 4WB4A 1QL2A 3CC7Z 4RVGA 1X79B 2KPIA 4NOZA 3F5HA 3SFDC 3T97A 3JSVC 2NPSC 1VQ5Z 2ZXXA 1T3JA 2KB7P 1G2CB 1RHZB 3RK2B 1NJI2 2ZT9C 3TYYA 1IFDA 1N86A 1L0ND 2O3JA 3VMIA 3D6ZA 3RL0D 3BATA 3WMM0 2FYNB 3IF8A 2Z4EA 2R93I 1YUAA 2FYUG 1X9VA 1SQQE 3L73J 4PD4H 1YI2P 1UIXA 1SQPG 2QSIA 3HE4B 2KNCB 2RMZA 3II6A 1NTMK 4ASVA 2L5GB 3S16I 4D6TE 4DGLA 3CXCZ 1R9TI 5C4JI 1KB9H 1YHQP 2OTJZ 2JUBA 1Y1WI 1SQVJ 1FZCB 2WT7A 2F4MA 3HTKB 1NH4A 1YJWP 1SQVK 3IX0A 1S5LH 2JP3A 3ITKA 3M0DA 4MD9A 1PP9D 1IFNA 2BCCE 2FXOA 4I2LC 3U50C 3AEBC 2HU9A 3A5TA 1HF9A 1DD4A 4RV9A 3G9RA 2I8DA 1KILD 3CCEP 1SQVG 2YMYA 3L72D 1T2KC 3CCSP 4K35A 1SQPE 2QEXP 5EFWB 2ITAA 4E2ZA 3WUTA 2Y0SA 2W6BA 1J1DC 2N1TC 4HB1A 3KHUA 5D1OB 4M3LA 1SFCB 3CPWY 1JY2O 4L74A 4BY7I 1PPJG 1FS0E 3L4FA 5H2FE 1IK7A 3SWYA 1JEKA 1KRLA 4DZOA 5GTHE 3Q3DA 1N2DC 1T6AA 3H1ID 2JNYA 5GTHH 1DX7A 4XFJA 3FX0A 1VQPZ 2KSJA 1TFIA 1TWGI 1IK9A 1VQMZ 2HPCB 1GW3A 4JYBA 1G1IA 1Y47A 1VQ6Z 5FLXf 1Q90D 2QJYB 4H44B 2G8YA 3MTUE 1FE6A 2RN0A 4C7NB 4BY1I 5CCHA 3VN0A 3LIEA 3D71A 1AA0A 1KFMA 4QTTA 2FBWC 3H1JD 4JF7A 1A02J 1KQGB 1NP6A 1GD2E 1KC82 1S1CX 3CCRP 1QXFA 1BCCD 4EYYQ 2D2CC 3G71Z 3SWKA 1JY3O 3KPEA 5AW5B 2QM7A 5BU8B 2JMOA 1KYOH 3CC71 1M1KQ 2KLVA 1JMBA 1YIJZ 1JY2N 2K3RA 2PM9A 4NB9A 3CCJ1 1K83I 3JAMb 3B5ND 1FZCA 4IFMA 3L71E 3PJSK 5D1OA 1KZUB 4Z1MH 3CWBJ 1SQBD 3A0HE 4PD4I 5AVZB 1RH5B 2LEXA 1OVUA 3HUSB 1SS1A 1H0TB 1PFTA 1VQOZ 1S721 3Q5SA 2JA7I 2Q4ZA 2LFUA 5KKZC 1NYHA 4JPZB 1VQNZ 2RBLA 4H0LB 1FOSE 2E42A 4E30A 2KYVA 2QJKC 3A7OA 2E7ZA 4A3MI 2WSCH 4NBFA 4D6TJ 1Y9BA 1FJPA 2AYDA 3KZIE 1GK6A 3HE5B 1YIT1 1I3QI 3VYIA 3CC21 3H1LJ 1VQK1 5AW9B 2QKDA 5APYA 1KD11 2G2KA 1USDA 1SQBK 4EOTA 1CZQA 5APWA 4KT0J 2OYHA 3CX5I 4GIFA 3L74E 3CC4Z 4DT0A 3S2HI 1P84D 2QA4Z 3T4NB 3R4YA 1FOSF 2D2CD 1HWTC 2P67A 4A93I 2PK7A 2FFDB 2JEEA 1L4AA 3CX5D 1CI6B 3GTOI 2CPBA 1MKMA 3CCE1 4WY4B 2VPWA 1FU1A 1YJNZ 1YJN1 2N9BA 1KQSZ 1CI6A 3L70J 1Y8CA 5KLVK 2JIRA 1L0LE 5AW7B 3V2QA 5CCHC 1RF0A 1ZB9A 3GF7A 3GTGI 1OVVA 4DCKA 4MXUA 3H1IE 2AKLA 3HKZA 3ZDMA 2P28A 3A0HH 2OYHB 3KDPB 2JO1A 2WVRA 5AVVB 1KN7A 2Q5UA 3D70A 1Q812 2BEZF 3KIHA 1YQ3C 3GTMS 3VMAA 4L73A 2KOGA 1KD12 1WIIA 5GTIE 1ZH1A 2QEXZ 2W27A 1K05A 2IV2X 2B63I 1WJ2A 2R3SA 5GTIH 3B8EB 1BDDA 1NKZB 4BBRI 1N8RQ 1EZVG 2Y0EA 1OVRA 5H2FH 5A2Qb 1OIPA 4I6MC 2R5DA 4BWNA 1WRGA 5KLVD 1JY2P 1KTMA 1N7SA 3RK3C 5KAIH 2Q3EA 1X3ZA 5APXA 3TGUD 2I3CA 1NGMB 1J1EC 1SQVD 2LXCB 1VQ8P 2BCCD 4OH8B 3L75J 1LQLA 3AEEC 4U7JA 3B4SA 1LT9A 4E2YA 1SQVE 4XX2A 1SIWA 1M90Q 1EZVE 2KIKA 1EDJA 3G711 2WITA 1NU1D 4AQRD 5TJHA 1BE3G 3LW5J 2W6AA 1DD3A 1HVVA 5KLVE 4XE5B 1FZGA 1R8EA 4XA4A 1L2PA 3J81f 3FGAD 2GM4A 1NJIQ 3WU2E 4NPEA 2WSEH 1P84E 1BSNA 2L91A 2BASA 3TNUB 3AEAC 1KQLA 2IBZD 1H0TA 3FXDA 1HJBA 1ML8A 4A3JI 2Q1KA 1T8ZA 1QVGZ 1VQOP 3IR7A 4MH4A 3JCUE 1L0LG 1WMKA 3EFFK 1QGKB 1RE4A 2WPQA 3L72G 1KMIZ 2Y9YA 2OTKE 1VQP1 3QH9A 3O6QB 4ZNCA 1EZVI 3BCCJ 4A3EI 1DEEG 1X0TA 3IFMA 1VQ7Z 1LWUA 3KQGA 3MGNA 1NTME 1Y8AA 3A2AA 3TNUA 2W83C 1URQA 3I4NI 3MONA 2R32A 2YIUC 4GT1A 2YMKA 4UB6E 5M1BA 3JCUH 3U1AA 1K73Q 2FYNC 3SFEC 1HGZA 4RVFA 2IZ4A 3CX5H 1HTLC 2ZFCA 3PLNA 2VPXA 1VQLP 1KQFB 5KTBA 2VUMI 2O01N 4AYCA 4YPCA 3OA7A 1YITP 1QVGY 3L70G 4A3KI 4TT3H 2OYOA 1H8AA 2PFXA 4ZKPA 2QE7H 3Q2YA 1YQ4C 2QJPC 1EQ7A 2E76D 4H13C 3MZKB 3E7KA 3H1IJ 4GOFA 1ZRTD 2KS1A 4RJTA 2LR2A 1K8AQ 1VQ6P 3VP9A 3CLQA 3NDIA 4YTPC 1Q82Q
chains in the Genus database with same CATH topology
1WCMI 2BJOA 4MD9A 2QREB 1YJ91 2QRDB 3H0GI 4RVDA 3U50C 2HU9A 4QTUA 3S14I 4RV9A 1FC2C 3CMA1 2I8DA 3CMAZ 2M5AB 1Q821 1I50I 2R92I 4K35A 5EFWB 3I4MI 2H85A 4A3CI 1MFTA 1LT1A 1S3JA 3CCMZ 3CCM1 5C3EI 1Q861 4E2ZA 1EDLA 5T67A 4NH1C 3J80b 3CCQZ 2Y0SA 1VQKZ 2KS1B 3NH5A 3I55Z 4HB1A 2WMMA 5D1OB 3CCSZ 3S2DI 4Y52I 3CPWY 5CBOA 1VQ41 4BY7I 2QA41 4CPGA 4MN4C 5CM2M 4S1TA 1KRLA 5C4XI 5FLMI 2E9HA 4JBZA 4NBGA 4BBSI 3CMEZ 3CCQ1 2JNYA 1P9NA 3MZLB 1VQPZ 2B89A 1TFIA 1TWGI 2VUGA 1VQMZ 2KZIA 1NJI1 1VQ4Z 4NBCA 5IP9I 3D9XA 3I07A 1Y47A 1VQ61 1VQ6Z 1W2BZ 2NVXI 4GODA 4KJMA 5FLXf 1QVFY 1TWHI 2RKLA 2GU2A 4NBBA 3G4S1 4BY1I 1M901 2HR3A 3CCRZ 1I6HI 5C39A 4QTTA 2OTLZ 2OTL1 3CD61 1YUKA 1VQ71 2QEX1 3J7A4 3CCJZ 2KI7B 5IT9b 3BG1B 1NP6A 2LIYA 2E2JI 1Q2NA 3S1RI 1KC82 4EYYQ 2F4OA 3IFUA 3G71Z 4DQYB 2JA6I 3NH4A 5CBNA 4WWIA 3S1KA 1Y1VI 2JMOA 3BG0B 3CC71 2JWDA 1TWCI 1Q862 4HGZA 1RO2A 1JMBA 3CD6Z 1YIJZ 1RO0A 2WAQA 1SFOI 3VMGA 2J6AA 3H3VJ 3G6E1 3G6EZ 2K3RA 2PM9A 4NB9A 3FQMA 3CCJ1 3Q87A 1K83I 3VB9A 3JAMb 3GTQI 3PO3I 4RS4A 4NFRA 2DE5A 5D1OA 5C44I 3CCV1 1YI2Z 1YI21 5D1PA 1VQL1 2RIQA 1LP1A 4E32A 5IT9f 3S17I 1OVUA 2RHBA 4NBHA 1SS1A 1H0TB 1YITZ 3VTNA 1PFTA 1VQOZ 1X3WA 1S721 2JA7I 4NPFX 2LFUA 2Q4ZA 5K5GB 1YIJ1 3EERA 2R6MA 3RZDI 1VQNZ 2RBLA 1JJ2Z 1EDKA 2PMZA 3CCS1 2QLVB 4X6AI 3RZOI 1K731 3J80f 4E30A 1YJWZ 1Z03A 2OTJ1 4TNUA 4A3MI 4NBAA 2RT9A 4NBDA 4HKZH 3I561 1QYPA 4NBFA 2R7ZI 2JS4A 5FLXb 1BDCA 3GTMI 4BXLA 2HF1A 3KIFA 1YIT1 3S1MI 1I3QI 2B88A 3CC2Z 3CC21 1VQK1 2QKDA 3F3PC 1YJ9Z 1KD11 2G2KA 5IP7I 2OZKA 2W04A 1U7MA 1W2BY 3PO3S 4A3II 3J81b 1ZW0A 3CCU1 2P3YA 3CC4Z 3CC41 2V8IA 2QA4Z 3S2HI 3T4NB 3M4OI 1RQFA 2KZJA 2V8KA 4A93I 1Q822 2PK7A 2V8JA 1EC5A 4MRIA 2GTHA 2YU9I 1JJ2Y 4K3AA 3GTOI 2NVTI 3S1QI 1DL6A 2QVAA 1WW9A 4IOIH 4E33A 2JA5I 1VLAA 3CCE1 5A2Qf 1Q7Y1 1YJNZ 1YJN1 1KQSZ 3JAMf 3QWUA 3ESWA 4A3BI 1ZB9A 3GTJI 3CPWZ 3GTGI 1OVVA 4MXUA 2AKLA 1KC81 2E2II 3GTKI 1QF8A 4AYBA 3HKZA 4A3DI 3ZDMA 1ZXGA 2P28A 3OW2Z 4BXXI 1JM0A 2LXBA 2UWJE 2M6NA 1Q812 3TE5B 5AN9F 3KIHA 1K9M1 2E2HI 3GTMS 3CCEZ 4NB8A 4DK1A 1KD12 1WIIA 1ZH1A 2QEXZ 2B63I 2KUBA 1BDDA 3CQZI 4A3LI 1YHQ1 4BBRI 1S7MA 3HOZI 4HJGH 3MHVA 1K732 1RO4A 1OVRA 3FQQA 2OOXB 5A2Qb 3HOXI 1K8A2 3D6WA 4Y7NI 1Z02A 1TWFI 3TDHB 1VQ81 3FXEA 1NUIA 3MZWB 1X3ZA 1USPA 3M3YI 2OOYB 3CCR1 1N8R1 2I3CA 2EGTA 1S72Z 3NH8A 3HOYI 3VMHA 2LXCB 3LUSA 4E2XA 1LQLA 1RNIA 2YADA 1VQN1 2DE6A 4E2YA 4EWCA 4XX2A 5DJTB 3CCUZ 3P5JB 2SPZA 1JWHC 2KIKA 3QWOC 1EDJA 3G711 2B87A 2O4HA 3NFZA 5LL6f 3GTPI 1N2FA 4NPDA 1VQLZ 4A3FI 2NVYI 1USPB 4CL1A 2VF1A 2M5AA 3EEDA 4GOEA 1Z01A 1Q7Y2 1Y1VS 4MD8A 4E31A 3J81f 4HH4A 1VQO1 3S15I 2WB1A 5T64A 4NPEA 2QRCB 3OW2Y 2JR6A 1EDIA 3FKII 3RGUA 3I551 1VQ91 3HOVI 3CXCY 1VQM1 1H0TA 3FXDA 3I56Z 2B87B 1YJW1 1ML8A 4A3JI 2Q1KA 1LP1B 1QVFZ 5T6BA 2M0BA 3GKQA 1QVGZ 2QRXA 4MH4A 2GTIA 1RLYA 1M902 5DJUB 3G4SZ 2R44A 1N8R2 3CME1 2O53A 4NBEA 3CC7Z 3S1NI 4MONA 4A3GI 4RVGA 2OTKE 2KPIA 1VQP1 1NVOA 4NOZA 4ZNCA 4A3EI 3CCL1 1DEEG 2IZ3A 1X0TA 1VQ5Z 1VQ9Z 2W03A 1VQ7Z 2ZAEB 1TWAI 1M1K1 1NJI2 3NDJA 4ASWA 2NVQI 3HOWI 3VMIA 2K5RA 3PH0A 3I4NI 3MONA 3HOUI 2QR1B 1VQ8Z 3IF8A 2P58A 2R93I 1K9M2 1YUAA 3GCFA 1Q811 1KQSY 1ZB8A 4RVFA 2IZ4A 2DE7A 2VUMI 1VQ51 4HGYA 1YHQZ 3CCLZ 4ASVA 1QVGY 2M48A 3S16I 2RPRA 4A3KI 4DGLA 1K8A1 2JA8I 1M1K2 3CXCZ 1R9TI 5C4JI 2OTJZ 4RVHA 1U7JA 2JUBA 4E2WA 3CCVZ 1Y1WI 3MZKB 2F4MA 4GOFA 3K7AI 3F3FC 2LR2A 2Q51A 3IX0A 3PO2I 1L1OC 3GTLI 4MD7A 3NDIA 4ZMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOE A;  1Q2N A;  1EC5 A;  4K3A A;  4NPE A;  2QVA A;  4EYY Q;  4IOI H;  5CBN A;  1FC2 C;  1EDI A;  3RGU A;  2I8D A;  2M5A B;  4WWI A;  3S1K A;  2JWD A;  4K35 A;  1H0T A;  3FXD A;  2B87 B;  1JMB A;  5EFW B;  1OVV A;  2Q1K A;  1LP1 B;  2M0B A;  1MFT A;  2QRX A;  1LT1 A;  1S3J A;  2K3R A;  3ZDM A;  1ZXG A;  1EDL A;  5DJU B;  2R44 A;  2KS1 B;  1JM0 A;  2LXB A;  4HB1 A;  2WMM A;  2OTK E;  2UWJ E;  1NVO A;  4ZNC A;  5CBO A;  1DEE G;  1X0T A;  1LP1 A;  1OVU A;  2ZAE B;  4CPG A;  1SS1 A;  1H0T B;  4MN4 C;  2KUB A;  1BDD A;  4ASW A;  3PH0 A;  4HJG H;  4JBZ A;  4NPF X;  5K5G B;  3MHV A;  1OVR A;  1EDK A;  2P58 A;  2B89 A;  3FXE A;  3MZW B;  2KZI A;  4HKZ H;  4ASV A;  1BDC A;  1Y47 A;  4BXL A;  2LXC B;  4GOD A;  4KJM A;  2RKL A;  2B88 A;  5DJT B;  1U7M A;  1U7J A;  2HR3 A;  2SPZ A;  2KIK A;  3QWO C;  1ZW0 A;  1EDJ A;  2B87 A;  5C39 A;  4GOF A;  2LR2 A;  4NPD A;  2KZJ A;  2KI7 B;  2M5A A;  4ZMD A; 
#chains in the Genus database with same CATH topology
 1WCM I;  2BJO A;  3Q1M A;  1G1J A;  1L4A C;  2IX7 C;  2WQY C;  4EIJ A;  5AW0 B;  4RVD A;  2QM8 A;  3GMA A;  3L70 E;  2OTL P;  4QTU A;  3HUS A;  1Q82 1;  1I50 I;  3AEF C;  2K9J A;  2G3A A;  1OXZ A;  2JIO A;  3AEC C;  3I4M I;  2H85 A;  1VPC A;  1BGY E;  3KZI H;  3N4X A;  3CCM 1;  5C3E I;  1Q86 1;  3SWF A;  5T67 A;  3H1J J;  2Y0C A;  3P8M C;  4U3F J;  1M1J B;  1VQK Z;  2KS1 B;  4IFF A;  3I55 Z;  3B71 A;  1RE4 C;  3H32 A;  3CCS Z;  1JTH B;  4Y52 I;  1LTJ B;  1DIP A;  3P8C D;  2WTY A;  5CBO A;  2GUS A;  1IFI A;  1S9K D;  2A06 D;  2K88 A;  3L75 E;  1QEX A;  4WY4 C;  3AE2 C;  2O1J A;  2AXC A;  5C4X I;  1NWQ A;  2E9H A;  4PV1 C;  2XKM A;  5TIS H;  2OYI C;  5AVW B;  5CMZ A;  3CME Z;  3I56 P;  1NTZ D;  2A06 E;  2GA1 A;  2C9N Y;  3MZL B;  2OYI B;  2A45 I;  2B89 A;  2VUG A;  3RL0 B;  1URQ B;  1GDT A;  1VQ4 Z;  4NBC A;  5AVX B;  3I07 A;  2NVX I;  2H8P D;  4GOD A;  4BRY B;  1TWH I;  4I7Z C;  4I1L A;  1AFO A;  3O6Q A;  2A45 G;  1RQU A;  4NBB A;  2HR3 A;  2WSS H;  1SQX E;  1I6H I;  4IFD K;  3RL0 C;  1RQV A;  1TU3 F;  1VQ7 1;  2KI7 B;  3L73 G;  5IT9 b;  1IZN B;  5APU A;  1Q81 Q;  2E2J I;  3L74 G;  1AV1 A;  1M7L A;  4C7R A;  1N7L A;  3IFU A;  3AE8 C;  2HOD A;  3G6E P;  2JA6 I;  1IC2 A;  3USS A;  4PJ0 E;  5AVS B;  3S1K A;  2P10 A;  1WZN A;  3BG0 B;  3EWK A;  1NTM J;  4L75 A;  4HGZ A;  4W80 A;  5KJ7 C;  1RO0 A;  2WAQ A;  1RF1 A;  1G2C A;  2DW3 A;  4YXD C;  1JOC A;  3AEG C;  3HTK A;  3FQM A;  3GTQ I;  3PO3 I;  4RS4 A;  5KAF E;  2DE5 A;  1AA6 A;  5C44 I;  1LWU B;  1AQ5 A;  1HH0 A;  2FYZ A;  1AVY A;  1SFC A;  2V4H A;  4PV1 B;  4NBH A;  1VQ4 P;  3VTN A;  2IZ0 A;  3L70 D;  3E1I A;  2K37 A;  3KYQ A;  3C8V A;  4NPF X;  1YIJ 1;  3EER A;  2R6M A;  3CC2 P;  5KJ7 A;  3CCS 1;  2BCC J;  2W6J H;  3A0B E;  4OVN F;  1EXJ A;  1LTI C;  3IF4 A;  1YJW Z;  1NTK D;  2E5T A;  1Z03 A;  2OTJ 1;  4TNU A;  1Q16 A;  4NBA A;  2RT9 A;  5CCG A;  2R7Z I;  3C1L A;  5B66 H;  1BDC A;  3GTM I;  4BXL A;  1NU1 J;  2HF1 A;  3CC2 Z;  2IYP A;  2IBZ E;  1U7M A;  4Y99 B;  3CMA P;  3PO3 S;  4A3I I;  1L0L D;  3J81 b;  2K1A A;  4H44 D;  2WPS A;  2J59 M;  5KLV J;  1H88 A;  2XND H;  1MV8 A;  1YJ9 P;  1NOH A;  4JYC A;  1ZME C;  2AXT H;  2WWW A;  5B66 E;  1PP9 G;  3S1Q I;  1DL6 A;  3U59 A;  2QVA A;  2QG4 A;  3H1H E;  1Q7Y 1;  3RBX A;  1L0N G;  5AW3 B;  4TLF A;  1YTZ I;  3P7K A;  3K5B A;  3B5N A;  1W5C E;  3M9H A;  3LID A;  1N7S B;  2C0W A;  2I1J A;  1A02 F;  1BGY J;  1SQB J;  1KC8 1;  2E2I I;  3GTK I;  2C0X A;  3AED C;  1QF8 A;  3GHG B;  1L0N K;  4D6T G;  2YO2 A;  5AW6 B;  2IFM A;  3SSU A;  1GL2 B;  2LXB A;  2ZT9 D;  4PD4 E;  4C46 A;  4WVZ A;  1OWA A;  4PJ0 H;  3TE5 B;  1VF5 C;  4NB8 A;  5BU5 A;  1NU1 E;  1KIL E;  3MIW A;  5KJ7 D;  5KLV G;  4R4M A;  4HJG H;  3CCQ P;  1KYO D;  3MHV A;  2E74 C;  2WSF H;  3FQQ A;  2OOX B;  1K8A 2;  3CD6 P;  3D6W A;  4RO0 A;  1VQ8 1;  1NUI A;  3TGU E;  3MZW B;  2YO3 A;  1JO5 A;  2QA4 P;  2EGT A;  3RBZ A;  3NH8 A;  2Z5H A;  3LUS A;  1NTK G;  4E2X A;  2O01 J;  1HUC A;  1NTM G;  1RNI A;  1VQN 1;  1BE3 D;  5CJ0 A;  1M57 D;  4EWC A;  1MFZ A;  1S72 P;  1XTC C;  3GF3 A;  1FBM A;  1LTA C;  3CCU Z;  3P5J B;  1SLQ A;  3NFZ A;  5LL6 f;  1N2F A;  4A3F I;  2NVY I;  2VF1 A;  3F89 A;  1NTK J;  2KLU A;  3CX5 E;  4MD8 A;  3S15 I;  1FZA A;  3CPW O;  1NTZ K;  2N9Y B;  2WB1 A;  3OJA B;  2QRC B;  3OW2 Y;  2GUV A;  1NAF A;  1W2B O;  3L71 J;  1HGV A;  1Q7Y Q;  2ZYA A;  1VQ9 1;  3CXC Y;  2Q3I A;  4I7Z B;  1VQM 1;  2FFD C;  1QVF Z;  1LP1 B;  2QRX A;  2GTI A;  2V7Q J;  1YBK A;  2YKP A;  5DJU B;  3G4S Z;  1PV3 A;  4RES B;  2B9B A;  3CME 1;  1FDO A;  3TGU J;  4NBE A;  4MON A;  1N73 C;  1P84 H;  1NVO A;  1LGH B;  2KXP B;  2Y0D A;  5APV A;  1N73 B;  2IFN A;  3W67 A;  1NTZ J;  2IZ3 A;  1VQ9 Z;  2W03 A;  1TWA I;  2IPP A;  1OX3 A;  2WSC J;  3V6I A;  2E74 B;  2ZT9 B;  3RK2 C;  4ASW A;  2NVQ I;  3HOW I;  3R2P A;  1GU5 A;  3PH0 A;  3WUV A;  1D7M A;  1BGY D;  5KLI C;  1USE A;  2QR1 B;  2R3C A;  3HOU I;  5CJ4 A;  3H1J G;  3L36 A;  3ABV C;  2P58 A;  1YIJ P;  1Q81 1;  4Y28 J;  3VMZ A;  1ZB8 A;  1SQB G;  2ZVN B;  1NTK E;  2MKV A;  1VQ5 1;  1QLE D;  3H1K E;  3P32 A;  2VPY A;  2E75 D;  4HGY A;  2HOD B;  2OTJ P;  3CCL Z;  1YHQ Z;  2M48 A;  2RPR A;  2JA8 I;  4HYT B;  1KB9 D;  1VQN P;  1LT9 C;  3CCV Z;  2ZYD A;  4H13 B;  2Q7C A;  3K7A I;  1OW7 A;  3P8C E;  1VQM P;  3FWN A;  1PGQ A;  2NRG A;  4W7Y A;  1YJ9 1;  4LGD E;  3H0G I;  3HE5 A;  3V2R A;  1JNM A;  1ZRT E;  1L4A B;  1FC2 C;  2AXT E;  3L75 G;  4OGQ D;  3CMA 1;  2M5A B;  3V4Q A;  1VQ5 P;  1GMJ A;  1UII A;  1SQB E;  1OW8 A;  1PIX A;  4YXW H;  3D6Y A;  1M56 D;  1GL2 D;  1MFT A;  3CCJ P;  1LT1 A;  1S3J A;  3BCC G;  4W7Z A;  3TF5 A;  1KYO E;  3EFG A;  3VOP A;  3J80 b;  3CCQ Z;  2FYU E;  4Y99 C;  4OGQ C;  1SFC C;  3L35 A;  2YIU B;  3M0D C;  2QJY C;  3RK3 D;  1SQX D;  1NTK K;  3S9O A;  4CPG A;  4MN4 C;  1JY3 P;  1KB9 E;  1K04 A;  2WPR A;  1NTM D;  1RE3 A;  5FLM I;  4JBZ A;  4BBS I;  2KNC A;  2FYU K;  1P9N A;  2JKV A;  1NAY A;  1SP4 A;  1PGO A;  1URQ C;  2RH0 A;  3O8Z A;  1X8Y A;  4GDO A;  2N1T D;  1M8O B;  1KQS O;  4KJM A;  3Q5P A;  2GU2 A;  3U1C A;  2K9Y A;  1AVO A;  3V4W A;  1M90 1;  3IN6 A;  2J5U A;  2XV5 A;  2OTL Z;  3CD6 1;  2M3B A;  2QEX 1;  3J7A 4;  3A3Y B;  1BE3 E;  1W2E A;  2LIY A;  1Q2N A;  3S1R I;  5AVY B;  1SQQ J;  1KFN A;  3GHG C;  3G4S P;  2F4O A;  1J2J B;  2D2C B;  1L0L K;  2P2U A;  2ZVO B;  3NH4 A;  5APS A;  3HE4 A;  1Y1V I;  1QX8 A;  1VL2 A;  1EZV D;  3HD7 B;  4H44 C;  1TWC I;  1OMI A;  1Q86 2;  1LJ2 A;  3L72 E;  2IDB A;  4OGQ B;  3CXH H;  3G6E 1;  2IBZ I;  3G6E Z;  1ZOY C;  4NFR A;  2MJZ A;  1N73 A;  2AEJ A;  1GZL A;  3CCV 1;  1FAV A;  1SQP D;  4RKU J;  3CME P;  1LNQ A;  1VQL 1;  1LP1 A;  3S17 I;  2RHB A;  3BRT B;  4UB6 H;  2OAR A;  1YIT Z;  1X3W A;  1KC8 Q;  1NU1 G;  5CHX A;  1EDK A;  2PMZ A;  1MUU A;  1QVG O;  1K73 1;  3J80 f;  4QMA A;  1BE3 J;  3C9I A;  1NU1 K;  3BRV B;  2KK7 A;  2JS4 A;  1JMM A;  3TK1 A;  4EDF A;  5FLX b;  3H1K G;  3KIF A;  2HLO A;  5BVZ A;  2B88 A;  4C7N A;  1SQP K;  2W04 A;  2PP6 A;  4U3F E;  3NMD A;  3H32 B;  2P3Y A;  3M4O I;  3IAO A;  2BCC G;  5B5E H;  1S4X A;  2POH A;  2V8J A;  1EC5 A;  4MRI A;  3GG2 A;  1JJ2 Y;  3NXS A;  3L73 E;  1HBW A;  1WW9 A;  4IOI H;  5APQ A;  5A2Q f;  3CCV P;  3L74 D;  2IZ1 A;  3RK3 E;  3QWU A;  1LTT C;  2P1J A;  1FJK A;  3CPW Z;  2FYU D;  4AYB A;  1S2E A;  1AJY A;  3OW2 Z;  1RE3 C;  2AEF A;  3RK3 B;  3UIA A;  1KIL C;  4N6J A;  4UB8 E;  2UWJ E;  2M6N A;  3VP8 A;  2M3E A;  2FXM A;  5AW8 B;  2V45 A;  2A06 G;  1KOR A;  3L71 D;  3CQZ I;  4A3L I;  1YHQ 1;  1S7M A;  1P84 I;  3CL3 D;  3AE6 C;  1LTG C;  3HOX I;  2HPC A;  1T3U A;  3L71 G;  2JIP A;  5KAI E;  1PZQ A;  3FXE A;  1PL5 A;  2JDI H;  1IO4 A;  3N7N A;  2OOY B;  1N8R 1;  3AE5 C;  1S72 Z;  4A7P A;  2HYN A;  3HOY I;  4IL6 X;  1VF5 B;  1BGY G;  4HH2 A;  3MP7 B;  2OQQ A;  3CWB E;  3TGU G;  2YAD A;  3W68 A;  2DE6 A;  1E5W A;  3MD0 A;  2HG5 D;  3H1J E;  1SQQ K;  2I1K A;  1GTW A;  1JWH C;  2YXR B;  1YJN P;  2B87 A;  3GLM A;  5E79 H;  4DOJ A;  3S4R A;  2ZXE B;  1USP B;  4CL1 A;  3L73 D;  3V2P A;  3EED A;  1Q7Y 2;  1Z01 A;  4E31 A;  1N7S C;  1M1J C;  1SQX G;  3HD7 A;  3CXH D;  1EXI A;  3RGU A;  2H88 C;  3HOV I;  1PGP A;  3B5N C;  3I56 Z;  3M0A A;  2M0B A;  3GKQ A;  3D2L A;  1BCC E;  1N7S D;  2PRR A;  3BAS A;  1N8R 2;  3H25 A;  2O53 A;  3S1N I;  4A3G I;  1PP9 J;  3H1H J;  2ZJS E;  3NFQ A;  2FY8 A;  3CCL 1;  3FWL A;  2ZAE B;  1M1K 1;  1S5L X;  1NTZ G;  3NDJ A;  3A0B H;  3CCM P;  1SVF A;  1FZC C;  1T2K D;  2K5R A;  1GK4 A;  2KSE A;  2JIM A;  1VQ8 Z;  2P7J A;  1K9M 2;  3GCF A;  5AVQ B;  1KQS Y;  4UB8 H;  2DE7 A;  4O9B A;  2CPS A;  2YNY A;  1JTH A;  2FFD A;  1NHL A;  1R5S A;  2LKM A;  3TSI A;  1AQT A;  1ZLL A;  1K8A 1;  1M1K 2;  2HFE D;  4AUW A;  3G3Z A;  3Q5R A;  1LWU C;  4RVH A;  1U7J A;  4E2W A;  4LC1 A;  2J58 A;  2Z5I A;  3HRN A;  4U3F G;  3F3F C;  2Q51 A;  2N1T A;  2O1K A;  3PO2 I;  2OGU A;  1L1O C;  3GTL I;  4MD7 A;  3EQ2 A;  4ZMD A;  1LTJ C;  2QRE B;  2QRD B;  4JQ0 D;  5AVU B;  2Q6Q A;  2JWA A;  1RF1 C;  3S14 I;  1X22 A;  4L76 A;  3CMA Z;  5AW1 B;  1VQ7 P;  1L0N J;  2R92 I;  4WBA A;  1L4A D;  4A3C I;  3H1H G;  2IYO A;  1NKN A;  2O01 H;  1S5L E;  1RF0 C;  3CCM Z;  2E76 C;  1EDL A;  4NH1 C;  1IFM A;  1JCC A;  1GW4 A;  2E5Y A;  2E74 D;  3NH5 A;  1FDM A;  2WMM A;  2A45 H;  1R5L A;  3S2D I;  3CXH I;  1SQQ D;  1LTS C;  1KD1 Q;  5KLI B;  3B5N B;  3JC2 2;  2Y9Z A;  4PD4 D;  1VQ4 1;  3MUD A;  2QA4 1;  1GL2 A;  5CM2 M;  4H0L D;  3I55 P;  4S1T A;  2YKO A;  4R4L A;  3GW6 A;  3AE4 C;  4NBG A;  1QL1 A;  2E75 C;  1URQ D;  2IBZ G;  3CCQ 1;  4D6T D;  2W90 A;  2JIQ A;  1JB0 J;  3VTP C;  2E75 B;  1VF5 D;  2KZI A;  2AEM A;  1NJI 1;  1KB9 I;  1JUN A;  5IP9 I;  3D9X A;  3H1H D;  4GKG A;  1PFI A;  1VQ6 1;  1W2B Z;  1VDF A;  1QVF Y;  2RKL A;  2XDJ A;  4N3Y B;  4N78 E;  1CSB A;  1CW5 A;  4OWF A;  3G4S 1;  1L0N E;  1GL2 C;  1J1E B;  3G71 P;  3KXD A;  3CCR Z;  2V3V A;  5C39 A;  3TDK A;  2W8Z A;  2OTL 1;  1YUK A;  2ZYG A;  5AW4 B;  4B86 A;  3CXH E;  3CCJ Z;  1Q86 Q;  3BG1 B;  1FZE A;  1IFJ A;  4H13 D;  1BSH A;  3M06 A;  3H6P A;  4DQY B;  3CC4 P;  5CBN A;  1VQ9 P;  3CCU P;  4WWI A;  1DEB A;  3H1L D;  1ZR4 A;  2JWD A;  2C9L Y;  2M8R A;  3PTZ A;  1RO2 A;  2JJL A;  3CD6 Z;  4WY4 D;  2PGD A;  1SFO I;  3VMG A;  2J6A A;  3H3V J;  2BEQ D;  3RL0 g;  2WT7 B;  3Q87 A;  3VB9 A;  1YTZ T;  2QJK B;  3E1R A;  4PV1 D;  1RF1 B;  1PP9 E;  1JY3 N;  5CCH D;  1VQP P;  1PPJ E;  3BVH A;  1YI2 Z;  1YI2 1;  5D1P A;  2RIQ A;  2YKQ A;  4BRY A;  4E32 A;  5IT9 f;  2XNX A;  3H1K J;  4IL6 E;  2NAP A;  5K5G B;  3M9B A;  1MZ9 A;  3RZD I;  4IL6 H;  1JJ2 Z;  3IR9 A;  4X6A I;  2QLV B;  3RZO I;  1VQK P;  2KP8 A;  1OFC X;  2NPS D;  4NBD A;  4HKZ H;  1JCD A;  3I56 1;  5B5E E;  1QYP A;  2QJP B;  3L37 A;  3S1M I;  3WU2 H;  2R5B A;  5APT A;  1LTJ A;  5TIS E;  1IFP A;  2XZR A;  3F3P C;  1YJ9 Z;  5IP7 I;  1FZB A;  2OZK A;  1J1D B;  2N1T B;  1W2B Y;  3V5B A;  1ZW0 A;  3CCU 1;  3CC4 1;  2V8I A;  2H7H A;  1RQF A;  2KZJ A;  2V8K A;  1SQX K;  1Q82 2;  1NTZ E;  2WPV B;  3HD7 C;  1KYO I;  1KIL B;  2GTH A;  2YU9 I;  2NZ2 A;  4KHX A;  4K3A A;  2NVT I;  5AVT B;  3CCL P;  3AE3 C;  3AE7 C;  3PP5 A;  2XU6 A;  3PHL A;  4E33 A;  2JA5 I;  1VLA A;  1KIL A;  3CWB G;  3BCC E;  5CCG C;  3L75 D;  1PGJ A;  3JAM f;  3AE9 C;  5AVR B;  3AE1 C;  1BCC G;  3ESW A;  4A3B I;  3GTJ I;  1NO4 A;  3CWB D;  1BCC J;  1K9M Q;  1SQP J;  3MUD C;  1ZV8 A;  3BCC D;  1FDI A;  4A3D I;  2FXP A;  3HD7 D;  3NTN A;  1ZXG A;  1OZH A;  3VMX A;  2FKW B;  2E43 A;  4BXX I;  3OAK A;  3M9Q A;  1JM0 A;  1LT9 B;  1DH3 A;  3V2N A;  1S9K E;  3RK2 D;  2JR8 A;  1H89 A;  2WSE J;  2NPS A;  5AN9 F;  1QVF O;  1K9M 1;  2E2H I;  3LW5 H;  1XTG B;  3CCE Z;  4DK1 A;  3VMY A;  1PPJ D;  2VRS A;  3WUU A;  3OW2 O;  2CK3 H;  2KUB A;  2OYI A;  3HOZ I;  1YYC A;  5AW2 B;  3H1L G;  1K73 2;  4WY4 A;  5L8R J;  1RO4 A;  3H1I G;  4Y7N I;  1GU4 A;  3CC7 P;  1Z02 A;  1TWF I;  3M91 A;  3TDH B;  2K9J B;  2PAJ A;  1USP A;  1ZP0 C;  3M3Y I;  1WT6 A;  1KV4 A;  3CCR 1;  2H89 C;  2V7Q H;  3VMH A;  2E76 B;  2WSF J;  2NPS B;  5KKZ B;  1M1J A;  3L72 J;  1LTB C;  1RY3 A;  5DJT B;  3H1K D;  4ZKU A;  1ZN5 A;  3H1L E;  2WZ7 A;  1Z56 A;  2SPZ A;  1OW6 A;  4EI2 A;  3QWO C;  2FYU J;  2O4H A;  3GTP I;  2OYH C;  2Q9I A;  5E79 E;  4NPD A;  3HUS C;  3L74 J;  1VQL Z;  2H43 A;  2M5A A;  3CI9 A;  4N78 D;  5CCG D;  4LLH A;  4GOE A;  1Y1V S;  1VQO 1;  4HH4 A;  5T64 A;  2YXQ B;  1ZR2 A;  1SQX J;  3I5C A;  2JR6 A;  1EDI A;  3FKI I;  3I55 1;  4U3F D;  1HJ0 A;  4H0L C;  1IJD B;  5KAF H;  2B87 B;  1YJW 1;  2QIW A;  1L0L J;  1U57 A;  5T6B A;  3PRJ A;  1E79 H;  1RLY A;  3GHG A;  1SFC D;  2VPZ A;  1M90 2;  1SQQ G;  2R44 A;  3T97 B;  1FZF A;  4DJG A;  4WB4 A;  1QL2 A;  3CC7 Z;  4RVG A;  1X79 B;  2KPI A;  4NOZ A;  3F5H A;  3SFD C;  3T97 A;  3JSV C;  2NPS C;  1VQ5 Z;  2ZXX A;  1T3J A;  2KB7 P;  1G2C B;  1RHZ B;  3RK2 B;  1NJI 2;  2ZT9 C;  3TYY A;  1IFD A;  1N86 A;  1L0N D;  2O3J A;  3VMI A;  3D6Z A;  3RL0 D;  3BAT A;  3WMM 0;  2FYN B;  3IF8 A;  2Z4E A;  2R93 I;  1YUA A;  2FYU G;  1X9V A;  1SQQ E;  3L73 J;  4PD4 H;  1YI2 P;  1UIX A;  1SQP G;  2QSI A;  3HE4 B;  2KNC B;  2RMZ A;  3II6 A;  1NTM K;  4ASV A;  2L5G B;  3S16 I;  4D6T E;  4DGL A;  3CXC Z;  1R9T I;  5C4J I;  1KB9 H;  1YHQ P;  2OTJ Z;  2JUB A;  1Y1W I;  1SQV J;  1FZC B;  2WT7 A;  2F4M A;  3HTK B;  1NH4 A;  1YJW P;  1SQV K;  3IX0 A;  1S5L H;  2JP3 A;  3ITK A;  3M0D A;  4MD9 A;  1PP9 D;  1IFN A;  2BCC E;  2FXO A;  4I2L C;  3U50 C;  3AEB C;  2HU9 A;  3A5T A;  1HF9 A;  1DD4 A;  4RV9 A;  3G9R A;  2I8D A;  1KIL D;  3CCE P;  1SQV G;  2YMY A;  3L72 D;  1T2K C;  3CCS P;  4K35 A;  1SQP E;  2QEX P;  5EFW B;  2ITA A;  4E2Z A;  3WUT A;  2Y0S A;  2W6B A;  1J1D C;  2N1T C;  4HB1 A;  3KHU A;  5D1O B;  4M3L A;  1SFC B;  3CPW Y;  1JY2 O;  4L74 A;  4BY7 I;  1PPJ G;  1FS0 E;  3L4F A;  5H2F E;  1IK7 A;  3SWY A;  1JEK A;  1KRL A;  4DZO A;  5GTH E;  3Q3D A;  1N2D C;  1T6A A;  3H1I D;  2JNY A;  5GTH H;  1DX7 A;  4XFJ A;  3FX0 A;  1VQP Z;  2KSJ A;  1TFI A;  1TWG I;  1IK9 A;  1VQM Z;  2HPC B;  1GW3 A;  4JYB A;  1G1I A;  1Y47 A;  1VQ6 Z;  5FLX f;  1Q90 D;  2QJY B;  4H44 B;  2G8Y A;  3MTU E;  1FE6 A;  2RN0 A;  4C7N B;  4BY1 I;  5CCH A;  3VN0 A;  3LIE A;  3D71 A;  1AA0 A;  1KFM A;  4QTT A;  2FBW C;  3H1J D;  4JF7 A;  1A02 J;  1KQG B;  1NP6 A;  1GD2 E;  1KC8 2;  1S1C X;  3CCR P;  1QXF A;  1BCC D;  4EYY Q;  2D2C C;  3G71 Z;  3SWK A;  1JY3 O;  3KPE A;  5AW5 B;  2QM7 A;  5BU8 B;  2JMO A;  1KYO H;  3CC7 1;  1M1K Q;  2KLV A;  1JMB A;  1YIJ Z;  1JY2 N;  2K3R A;  2PM9 A;  4NB9 A;  3CCJ 1;  1K83 I;  3JAM b;  3B5N D;  1FZC A;  4IFM A;  3L71 E;  3PJS K;  5D1O A;  1KZU B;  4Z1M H;  3CWB J;  1SQB D;  3A0H E;  4PD4 I;  5AVZ B;  1RH5 B;  2LEX A;  1OVU A;  3HUS B;  1SS1 A;  1H0T B;  1PFT A;  1VQO Z;  1S72 1;  3Q5S A;  2JA7 I;  2Q4Z A;  2LFU A;  5KKZ C;  1NYH A;  4JPZ B;  1VQN Z;  2RBL A;  4H0L B;  1FOS E;  2E42 A;  4E30 A;  2KYV A;  2QJK C;  3A7O A;  2E7Z A;  4A3M I;  2WSC H;  4NBF A;  4D6T J;  1Y9B A;  1FJP A;  2AYD A;  3KZI E;  1GK6 A;  3HE5 B;  1YIT 1;  1I3Q I;  3VYI A;  3CC2 1;  3H1L J;  1VQK 1;  5AW9 B;  2QKD A;  5APY A;  1KD1 1;  2G2K A;  1USD A;  1SQB K;  4EOT A;  1CZQ A;  5APW A;  4KT0 J;  2OYH A;  3CX5 I;  4GIF A;  3L74 E;  3CC4 Z;  4DT0 A;  3S2H I;  1P84 D;  2QA4 Z;  3T4N B;  3R4Y A;  1FOS F;  2D2C D;  1HWT C;  2P67 A;  4A93 I;  2PK7 A;  2FFD B;  2JEE A;  1L4A A;  3CX5 D;  1CI6 B;  3GTO I;  2CPB A;  1MKM A;  3CCE 1;  4WY4 B;  2VPW A;  1FU1 A;  1YJN Z;  1YJN 1;  2N9B A;  1KQS Z;  1CI6 A;  3L70 J;  1Y8C A;  5KLV K;  2JIR A;  1L0L E;  5AW7 B;  3V2Q A;  5CCH C;  1RF0 A;  1ZB9 A;  3GF7 A;  3GTG I;  1OVV A;  4DCK A;  4MXU A;  3H1I E;  2AKL A;  3HKZ A;  3ZDM A;  2P28 A;  3A0H H;  2OYH B;  3KDP B;  2JO1 A;  2WVR A;  5AVV B;  1KN7 A;  2Q5U A;  3D70 A;  1Q81 2;  2BEZ F;  3KIH A;  1YQ3 C;  3GTM S;  3VMA A;  4L73 A;  2KOG A;  1KD1 2;  1WII A;  5GTI E;  1ZH1 A;  2QEX Z;  2W27 A;  1K05 A;  2IV2 X;  2B63 I;  1WJ2 A;  2R3S A;  5GTI H;  3B8E B;  1BDD A;  1NKZ B;  4BBR I;  1N8R Q;  1EZV G;  2Y0E A;  1OVR A;  5H2F H;  5A2Q b;  1OIP A;  4I6M C;  2R5D A;  4BWN A;  1WRG A;  5KLV D;  1JY2 P;  1KTM A;  1N7S A;  3RK3 C;  5KAI H;  2Q3E A;  1X3Z A;  5APX A;  3TGU D;  2I3C A;  1NGM B;  1J1E C;  1SQV D;  2LXC B;  1VQ8 P;  2BCC D;  4OH8 B;  3L75 J;  1LQL A;  3AEE C;  4U7J A;  3B4S A;  1LT9 A;  4E2Y A;  1SQV E;  4XX2 A;  1SIW A;  1M90 Q;  1EZV E;  2KIK A;  1EDJ A;  3G71 1;  2WIT A;  1NU1 D;  4AQR D;  5TJH A;  1BE3 G;  3LW5 J;  2W6A A;  1DD3 A;  1HVV A;  5KLV E;  4XE5 B;  1FZG A;  1R8E A;  4XA4 A;  1L2P A;  3J81 f;  3FGA D;  2GM4 A;  1NJI Q;  3WU2 E;  4NPE A;  2WSE H;  1P84 E;  1BSN A;  2L91 A;  2BAS A;  3TNU B;  3AEA C;  1KQL A;  2IBZ D;  1H0T A;  3FXD A;  1HJB A;  1ML8 A;  4A3J I;  2Q1K A;  1T8Z A;  1QVG Z;  1VQO P;  3IR7 A;  4MH4 A;  3JCU E;  1L0L G;  1WMK A;  3EFF K;  1QGK B;  1RE4 A;  2WPQ A;  3L72 G;  1KMI Z;  2Y9Y A;  2OTK E;  1VQP 1;  3QH9 A;  3O6Q B;  4ZNC A;  1EZV I;  3BCC J;  4A3E I;  1DEE G;  1X0T A;  3IFM A;  1VQ7 Z;  1LWU A;  3KQG A;  3MGN A;  1NTM E;  1Y8A A;  3A2A A;  3TNU A;  2W83 C;  1URQ A;  3I4N I;  3MON A;  2R32 A;  2YIU C;  4GT1 A;  2YMK A;  4UB6 E;  5M1B A;  3JCU H;  3U1A A;  1K73 Q;  2FYN C;  3SFE C;  1HGZ A;  4RVF A;  2IZ4 A;  3CX5 H;  1HTL C;  2ZFC A;  3PLN A;  2VPX A;  1VQL P;  1KQF B;  5KTB A;  2VUM I;  2O01 N;  4AYC A;  4YPC A;  3OA7 A;  1YIT P;  1QVG Y;  3L70 G;  4A3K I;  4TT3 H;  2OYO A;  1H8A A;  2PFX A;  4ZKP A;  2QE7 H;  3Q2Y A;  1YQ4 C;  2QJP C;  1EQ7 A;  2E76 D;  4H13 C;  3MZK B;  3E7K A;  3H1I J;  4GOF A;  1ZRT D;  2KS1 A;  4RJT A;  2LR2 A;  1K8A Q;  1VQ6 P;  3VP9 A;  3CLQ A;  3NDI A;  4YTP C;  1Q82 Q; 
#chains in the Genus database with same CATH homology
 1WCM I;  2BJO A;  4MD9 A;  2QRE B;  1YJ9 1;  2QRD B;  3H0G I;  4RVD A;  3U50 C;  2HU9 A;  4QTU A;  3S14 I;  4RV9 A;  1FC2 C;  3CMA 1;  2I8D A;  3CMA Z;  2M5A B;  1Q82 1;  1I50 I;  2R92 I;  4K35 A;  5EFW B;  3I4M I;  2H85 A;  4A3C I;  1MFT A;  1LT1 A;  1S3J A;  3CCM Z;  3CCM 1;  5C3E I;  1Q86 1;  4E2Z A;  1EDL A;  5T67 A;  4NH1 C;  3J80 b;  3CCQ Z;  2Y0S A;  1VQK Z;  2KS1 B;  3NH5 A;  3I55 Z;  4HB1 A;  2WMM A;  5D1O B;  3CCS Z;  3S2D I;  4Y52 I;  3CPW Y;  5CBO A;  1VQ4 1;  4BY7 I;  2QA4 1;  4CPG A;  4MN4 C;  5CM2 M;  4S1T A;  1KRL A;  5C4X I;  5FLM I;  2E9H A;  4JBZ A;  4NBG A;  4BBS I;  3CME Z;  3CCQ 1;  2JNY A;  1P9N A;  3MZL B;  1VQP Z;  2B89 A;  1TFI A;  1TWG I;  2VUG A;  1VQM Z;  2KZI A;  1NJI 1;  1VQ4 Z;  4NBC A;  5IP9 I;  3D9X A;  3I07 A;  1Y47 A;  1VQ6 1;  1VQ6 Z;  1W2B Z;  2NVX I;  4GOD A;  4KJM A;  5FLX f;  1QVF Y;  1TWH I;  2RKL A;  2GU2 A;  4NBB A;  3G4S 1;  4BY1 I;  1M90 1;  2HR3 A;  3CCR Z;  1I6H I;  5C39 A;  4QTT A;  2OTL Z;  2OTL 1;  3CD6 1;  1YUK A;  1VQ7 1;  2QEX 1;  3J7A 4;  3CCJ Z;  2KI7 B;  5IT9 b;  3BG1 B;  1NP6 A;  2LIY A;  2E2J I;  1Q2N A;  3S1R I;  1KC8 2;  4EYY Q;  2F4O A;  3IFU A;  3G71 Z;  4DQY B;  2JA6 I;  3NH4 A;  5CBN A;  4WWI A;  3S1K A;  1Y1V I;  2JMO A;  3BG0 B;  3CC7 1;  2JWD A;  1TWC I;  1Q86 2;  4HGZ A;  1RO2 A;  1JMB A;  3CD6 Z;  1YIJ Z;  1RO0 A;  2WAQ A;  1SFO I;  3VMG A;  2J6A A;  3H3V J;  3G6E 1;  3G6E Z;  2K3R A;  2PM9 A;  4NB9 A;  3FQM A;  3CCJ 1;  3Q87 A;  1K83 I;  3VB9 A;  3JAM b;  3GTQ I;  3PO3 I;  4RS4 A;  4NFR A;  2DE5 A;  5D1O A;  5C44 I;  3CCV 1;  1YI2 Z;  1YI2 1;  5D1P A;  1VQL 1;  2RIQ A;  1LP1 A;  4E32 A;  5IT9 f;  3S17 I;  1OVU A;  2RHB A;  4NBH A;  1SS1 A;  1H0T B;  1YIT Z;  3VTN A;  1PFT A;  1VQO Z;  1X3W A;  1S72 1;  2JA7 I;  4NPF X;  2LFU A;  2Q4Z A;  5K5G B;  1YIJ 1;  3EER A;  2R6M A;  3RZD I;  1VQN Z;  2RBL A;  1JJ2 Z;  1EDK A;  2PMZ A;  3CCS 1;  2QLV B;  4X6A I;  3RZO I;  1K73 1;  3J80 f;  4E30 A;  1YJW Z;  1Z03 A;  2OTJ 1;  4TNU A;  4A3M I;  4NBA A;  2RT9 A;  4NBD A;  4HKZ H;  3I56 1;  1QYP A;  4NBF A;  2R7Z I;  2JS4 A;  5FLX b;  1BDC A;  3GTM I;  4BXL A;  2HF1 A;  3KIF A;  1YIT 1;  3S1M I;  1I3Q I;  2B88 A;  3CC2 Z;  3CC2 1;  1VQK 1;  2QKD A;  3F3P C;  1YJ9 Z;  1KD1 1;  2G2K A;  5IP7 I;  2OZK A;  2W04 A;  1U7M A;  1W2B Y;  3PO3 S;  4A3I I;  3J81 b;  1ZW0 A;  3CCU 1;  2P3Y A;  3CC4 Z;  3CC4 1;  2V8I A;  2QA4 Z;  3S2H I;  3T4N B;  3M4O I;  1RQF A;  2KZJ A;  2V8K A;  4A93 I;  1Q82 2;  2PK7 A;  2V8J A;  1EC5 A;  4MRI A;  2GTH A;  2YU9 I;  1JJ2 Y;  4K3A A;  3GTO I;  2NVT I;  3S1Q I;  1DL6 A;  2QVA A;  1WW9 A;  4IOI H;  4E33 A;  2JA5 I;  1VLA A;  3CCE 1;  5A2Q f;  1Q7Y 1;  1YJN Z;  1YJN 1;  1KQS Z;  3JAM f;  3QWU A;  3ESW A;  4A3B I;  1ZB9 A;  3GTJ I;  3CPW Z;  3GTG I;  1OVV A;  4MXU A;  2AKL A;  1KC8 1;  2E2I I;  3GTK I;  1QF8 A;  4AYB A;  3HKZ A;  4A3D I;  3ZDM A;  1ZXG A;  2P28 A;  3OW2 Z;  4BXX I;  1JM0 A;  2LXB A;  2UWJ E;  2M6N A;  1Q81 2;  3TE5 B;  5AN9 F;  3KIH A;  1K9M 1;  2E2H I;  3GTM S;  3CCE Z;  4NB8 A;  4DK1 A;  1KD1 2;  1WII A;  1ZH1 A;  2QEX Z;  2B63 I;  2KUB A;  1BDD A;  3CQZ I;  4A3L I;  1YHQ 1;  4BBR I;  1S7M A;  3HOZ I;  4HJG H;  3MHV A;  1K73 2;  1RO4 A;  1OVR A;  3FQQ A;  2OOX B;  5A2Q b;  3HOX I;  1K8A 2;  3D6W A;  4Y7N I;  1Z02 A;  1TWF I;  3TDH B;  1VQ8 1;  3FXE A;  1NUI A;  3MZW B;  1X3Z A;  1USP A;  3M3Y I;  2OOY B;  3CCR 1;  1N8R 1;  2I3C A;  2EGT A;  1S72 Z;  3NH8 A;  3HOY I;  3VMH A;  2LXC B;  3LUS A;  4E2X A;  1LQL A;  1RNI A;  2YAD A;  1VQN 1;  2DE6 A;  4E2Y A;  4EWC A;  4XX2 A;  5DJT B;  3CCU Z;  3P5J B;  2SPZ A;  1JWH C;  2KIK A;  3QWO C;  1EDJ A;  3G71 1;  2B87 A;  2O4H A;  3NFZ A;  5LL6 f;  3GTP I;  1N2F A;  4NPD A;  1VQL Z;  4A3F I;  2NVY I;  1USP B;  4CL1 A;  2VF1 A;  2M5A A;  3EED A;  4GOE A;  1Z01 A;  1Q7Y 2;  1Y1V S;  4MD8 A;  4E31 A;  3J81 f;  4HH4 A;  1VQO 1;  3S15 I;  2WB1 A;  5T64 A;  4NPE A;  2QRC B;  3OW2 Y;  2JR6 A;  1EDI A;  3FKI I;  3RGU A;  3I55 1;  1VQ9 1;  3HOV I;  3CXC Y;  1VQM 1;  1H0T A;  3FXD A;  3I56 Z;  2B87 B;  1YJW 1;  1ML8 A;  4A3J I;  2Q1K A;  1LP1 B;  1QVF Z;  5T6B A;  2M0B A;  3GKQ A;  1QVG Z;  2QRX A;  4MH4 A;  2GTI A;  1RLY A;  1M90 2;  5DJU B;  3G4S Z;  2R44 A;  1N8R 2;  3CME 1;  2O53 A;  4NBE A;  3CC7 Z;  3S1N I;  4MON A;  4A3G I;  4RVG A;  2OTK E;  2KPI A;  1VQP 1;  1NVO A;  4NOZ A;  4ZNC A;  4A3E I;  3CCL 1;  1DEE G;  2IZ3 A;  1X0T A;  1VQ5 Z;  1VQ9 Z;  2W03 A;  1VQ7 Z;  2ZAE B;  1TWA I;  1M1K 1;  1NJI 2;  3NDJ A;  4ASW A;  2NVQ I;  3HOW I;  3VMI A;  2K5R A;  3PH0 A;  3I4N I;  3MON A;  3HOU I;  2QR1 B;  1VQ8 Z;  3IF8 A;  2P58 A;  2R93 I;  1K9M 2;  1YUA A;  3GCF A;  1Q81 1;  1KQS Y;  1ZB8 A;  4RVF A;  2IZ4 A;  2DE7 A;  2VUM I;  1VQ5 1;  4HGY A;  1YHQ Z;  3CCL Z;  4ASV A;  1QVG Y;  2M48 A;  3S16 I;  2RPR A;  4A3K I;  4DGL A;  1K8A 1;  2JA8 I;  1M1K 2;  3CXC Z;  1R9T I;  5C4J I;  2OTJ Z;  4RVH A;  1U7J A;  2JUB A;  4E2W A;  3CCV Z;  1Y1W I;  3MZK B;  2F4M A;  4GOF A;  3K7A I;  3F3F C;  2LR2 A;  2Q51 A;  3IX0 A;  3PO2 I;  1L1O C;  3GTL I;  4MD7 A;  3NDI A;  4ZMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...