1X0TA

Crystal structure of ribonuclease p protein ph1601p from pyrococcus horikoshii ot3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
b'IVKRRDWEKKEKKKIAIERIDTLFTLAERVARYSPDLAKRYVELALEIQKKAKVKIPRKWKRRYCKRCHTFLIPGVNARVRLRTKRMPHVVITCLECGYIMRYPYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 4
publication title Crystal Structure of a Ribonuclease P Protein Ph1601p from Pyrococcus horikoshii OT3: An Archaeal Homologue of Human Nuclear Ribonuclease P Protein Rpp21(,)
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 33
structure length 106
sequence length 106
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2005-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1x0tA01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1x0tA02
2KI7B 5CBOA 2HR3A 2Q1KA 1DEEG 1ZW0A 2OTKE 4JBZA 2B89A 1Y47A 5C39A 2KS1B 3QWOC 4NPDA 5DJTB 4HB1A 1Q2NA 4GOFA 2JWDA 1BDCA 4K3AA 4ZMDA 1EC5A 5EFWB 4ASVA 2R44A 1LP1A 1X0TA 2KIKA 4GODA 1EDKA 2KZJA 4KJMA 4WWIA 2I8DA 1H0TB 2M0BA 1EDLA 4ZNCA 1S3JA 2P58A 3S1KA 3ZDMA 1H0TA 1FC2C 3MHVA 4HKZH 2B87B 3PH0A 1LT1A 1ZXGA 1EDIA 1JMBA 5CBNA 2M5AB 2ZAEB 2QRXA 2B87A 3MZWB 2QVAA 5K5GB 2WMMA 4GOEA 1MFTA 1OVVA 4CPGA 2K3RA 2RKLA 1U7MA 3FXEA 4ASWA 2UWJE 1SS1A 4K35A 2LXBA 2KUBA 3FXDA 5DJUB 2SPZA 1U7JA 4NPFX 2LR2A 2M5AA 4BXLA 4NPEA 2LXCB 2B88A 1NVOA 1BDDA 1EDJA 4EYYQ 4HJGH 4MN4C 2KZIA 1JM0A 1LP1B 3RGUA 1OVRA 4IOIH 1OVUA
chains in the Genus database with same CATH superfamily
3OJAB 1QL2A 1FDIA 4A3II 1SFCC 1KC8Q 3F3PC 4A93I 1IFNA 4HB1A 2YKQA 3H32B 1J1EB 3ABVC 3CWBG 4KHXA 2A06D 4QTTA 1YUAA 3O6QA 2BASA 5IT9f 3D71A 2WVRA 3K5BA 3CPWY 1X0TA 2FXOA 1N8R2 2KZJA 3I56Z 4DQYB 2OOYB 2QSIA 1ZH1A 3L70D 1LT9A 3CC2P 3S1QI 2IZ0A 2Q4ZA 3VN0A 3SWFA 1GU4A 1R5LA 1Z02A 4PV1C 3S14I 2RMZA 3II6A 1H88A 3RK2B 1PFIA 3AE3C 3P8CE 2GUVA 2CK3H 4HH2A 1K83I 4E32A 3Q87A 4I7ZC 5CCHA 1YIJZ 4BBSI 4U3FD 1Y1WI 2P28A 2G8YA 2QM7A 2AEFA 3OW2Y 5AW1B 2JKVA 2R3CA 4LC1A 3KYQA 2W90A 4C46A 1SS1A 3CCUP 4H44B 3HRNA 3AE7C 3M0DC 1X9VA 1IFPA 1IO4A 1N8R1 1BE3D 2B9BA 1SLQA 3B71A 1PPJG 2OYHB 2ZFCA 4TLFA 4RVFA 1DH3A 3WU2H 2O53A 1LGHB 1FZCA 3MUDC 4OGQD 2N9YB 1WW9A 2JDIH 5AVXB 1ZRTD 2RN0A 5AVYB 3EQ2A 3M9QA 1JOCA 2GUSA 1RF0A 3NH5A 3NXSA 1EZVI 3H0GI 1VQ8Z 4AYCA 4K3AA 3NDIA 5KKZC 4NBDA 1L0LG 1T3UA 1TWGI 1S1CX 3GW6A 3H1HG 1JCDA 4D6TE 5AVVB 5C3EI 1USDA 3G6E1 1T6AA 4PD4H 2P7JA 3NTNA 3FWNA 1SQXJ 1KQGB 4RKUJ 4H0LD 2Y0DA 1IZNB 1WT6A 2W6JH 3CCSP 2ZYDA 3VP8A 2POHA 5KLIC 3KIHA 1FBMA 2H88C 1SQXE 1NHLA 2D2CC 1SQVG 2KNCA 2GTIA 1FDMA 3USSA 3FXEA 5GTIE 1SIWA 2V8KA 1RLYA 2E75C 5CM2M 1TWAI 4BXLA 2I3CA 1VQ51 2AXTE 4NPEA 2WT7A 4MXUA 2WZ7A 3AE6C 1EDJA 3VMIA 3AEFC 4H13C 4GIFA 2WITA 2H43A 1S72Z 3H1IG 3GLMA 3L74D 5BU5A 1LP1B 3CC71 1PGQA 1L0LJ 1NTKE 4NB8A 3CMAZ 5AW8B 2BCCJ 3RK3B 4PD4I 4GKGA 2KS1B 3J7A4 2V45A 2BCCE 1LWUB 1I3QI 1HTLC 3B4SA 5AW2B 1YI2P 1P84H 1JUNA 2WSSH 1BCCG 2R92I 2O1KA 1VF5C 2PFXA 4DJGA 3C1LA 1TWCI 1H89A 1N7SA 3TGUD 3RL0C 1RE4A 2GU2A 3I07A 2ZVOB 1PZQA 1RE3C 2KIKA 5CCHD 2JNYA 1H0TB 1KQFB 1KILC 2P2UA 1YQ3C 1GL2D 2IBZE 3GHGA 3CCRP 2BEZF 4IFDK 2BEQD 1NUIA 4EDFA 1QGKB 3MGNA 1K04A 3F3FC 1QYPA 1XTGB 1S5LE 2Y9YA 3H1JG 3I561 3B5NC 2G3AA 3L71E 3BG0B 1S9KE 3NFZA 5APSA 1YJ9Z 4IL6X 3BCCD 1EQ7A 1P84I 1N7LA 2OTJ1 3LUSA 5AW0B 3CC4P 1QVGO 3MONA 1VL2A 1KORA 2A06G 2SPZA 3G71P 2NPSD 3H3VJ 1YIJ1 1RQUA 4E2XA 1L4AA 3FGAD 1BCCJ 2Y9ZA 3CWBD 3GTQI 3BASA 1LTJB 1FZGA 2R6MA 4NBBA 3TDKA 4EYYQ 4TT3H 4YPCA 4MRIA 3L72D 2JA7I 3GF3A 1VQNP 1NTMD 3L70G 1KYOE 3S2HI 3CCLZ 1PV3A 1FOSE 4YXDC 2J5UA 4WBAA 2P67A 3WUUA 1RHZB 3C8VA 1TU3F 2NVTI 4IL6E 1KFMA 3GTGI 3TNUA 4GOFA 4U3FG 5AN9F 2RPRA 3H32A 1VQ6P 1AA0A 3V2QA 1KV4A 3PJSK 3VMAA 1HBWA 2JUBA 4EOTA 2QIWA 1X8YA 1Y8AA 3ZDMA 5L8RJ 4E2WA 1VQ81 4A3BI 2PMZA 3QH9A 2JIOA 2QA4Z 2L5GB 1BE3G 1LTGC 5APXA 3PO2I 4NBFA 1GD2E 2QRXA 1NTZD 1ZP0C 1RO4A 2V8IA 1E5WA 2KB7P 1HGVA 3R2PA 3CCEZ 4PV1B 1DEBA 4I6MC 3AE9C 1VQPP 3Q5PA 1IFJA 3IFMA 2J59M 4C7RA 4I7ZB 1L0NG 3HD7A 1VQOZ 3JCUH 1U57A 2K88A 4NBEA 2R32A 5KLVJ 2QRCB 2ZXEB 2YO3A 2YIUC 1OWAA 2OTLP 3RBXA 3HOVI 2R3SA 4OGQC 4U3FJ 3VOPA 5KLVE 2FY8A 1NVOA 2N1TD 5GTIH 3Q5SA 3I55P 2OYHA 4N3YB 4Y99C 2H7HA 1RF1C 4WY4B 1NWQA 5APUA 4A3FI 1NP6A 3VMGA 3L73E 3EFFK 2IV2X 3NMDA 1BE3J 1VQ9P 2WPQA 3J80b 1WCMI 3BATA 4WB4A 1S721 1URQA 1QVGZ 4L74A 2VPZA 3CMA1 3PP5A 5EFWB 5CJ4A 5B66H 1PIXA 1VPCA 4UB6H 1KN7A 4HH4A 5KKZB 1SQVD 1S3JA 3R4YA 2O01N 1KB9H 3PRJA 2IX7C 3SSUA 1EXJA 4H0LC 1VQ7Z 1KQLA 3C9IA 2JR8A 1YUKA 2G2KA 3KHUA 1SQXK 3SWYA 3S2DI 2RH0A 3CL3D 2A45I 5AVQB 3L74G 5CMZA 1J2JB 1SQBG 1L4AD 3A5TA 2AYDA 3SFDC 2QJKC 3AEEC 1Q812 3S1RI 3H1ID 4CL1A 1TWHI 2VUMI 1PL5A 1PP9E 3BRTB 5T6BA 3J80f 2W04A 3HE5B 1GK6A 3NH8A 3D6WA 5KLIB 2E2II 1AQ5A 2OOXB 1X22A 2D2CB 1A02F 1NJI2 3RL0g 1M1JC 2IYOA 2LXCB 3TGUG 1VQ5Z 1YJ91 2KOGA 1QEXA 1SQQE 2E75B 1TWFI 1L0LK 1GU5A 4DGLA 4MN4C 1VQ4Z 4IOIH 4H13B 2JO1A 2VPWA 4RVGA 2HODB 4QMAA 4Y28J 3Q3DA 2IBZI 5CHXA 1AFOA 1Q811 5B5EE 1FJPA 5CCHC 2KS1A 4EI2A 1Q2NA 2K5RA 2E5TA 1LWUA 4MONA 4DZOA 3CCVP 3L74J 3IN6A 2J6AA 1GL2C 1QVGY 1JO5A 3M3YI 1P84E 1PFTA 1BGYJ 3V5BA 1W2BO 1JB0J 3KDPB 2DE6A 2DE7A 1Q82Q 3H1KD 3OAKA 1NJI1 4XFJA 2H85A 2E2HI 1WRGA 1GTWA 4IL6H 5KTBA 3IX0A 1VQKZ 1BGYE 2QEXZ 1FZBA 1H0TA 3HD7D 3VYIA 3ESWA 1FZAA 3MHVA 2QJYC 2B87B 1N73C 1JY3N 3A2AA 3CCLP 3HOZI 3TGUJ 3L72G 1NTMG 4MD7A 1RQVA 4S1TA 4BXXI 4H44D 4NBAA 3AE4C 3RBZA 1T3JA 3CX5E 3HOUI 3B5NB 2NPSC 1Q81Q 2VF1A 2QA41 4DT0A 4JF7A 3RZOI 1KYOI 1FJKA 1RO0A 4LGDE 2JIMA 2UWJE 2WTYA 2OTJZ 3CCE1 1HGZA 3H25A 2W03A 1RQFA 5DJUB 1KQSO 2M5AA 1SQPJ 2B88A 2E7ZA 4QTUA 4PJ0E 1NJIQ 1JY2N 2Q3EA 1CI6A 5CCGC 1DIPA 3BCCJ 1URQD 1FAVA 4A3EI 1VQO1 3P5JB 2QE7H 2RBLA 2KSJA 1LTJA 1NU1G 1SQPE 1M902 1IFIA 1K732 1GDTA 3BCCE 2K9YA 5APYA 1W2EA 1ZW0A 5AVRB 3V6IA 3GTMI 1GW3A 5C39A 1NTZG 3CWBJ 2M3BA 1GW4A 2YMYA 3HE4B 3CCJ1 2FKWB 2M3EA 2JJLA 3L72J 2YADA 3GTMS 2IYPA 1NTMJ 2OYIA 1BDCA 3G3ZA 3CWBE 1YQ4C 4L75A 2FFDC 3HOYI 2KLUA 1YJWZ 3U1CA 3HUSA 1L0ND 3JSVC 1HF9A 2JEEA 2FYUD 3Q5RA 1JTHB 5APQA 1JJ2Z 3CMEZ 1E79H 1M901 5AVTB 2RIQA 3CXHD 1K731 2HYNA 5KAIE 4RVDA 2FYNB 1OIPA 4NBCA 4N6JA 2N9BA 3MTUE 1VQ71 2K3RA 1BSHA 5KLVK 1YHQ1 4OVNF 1M8OB 3I5CA 3L37A 1HJ0A 4N78D 2N1TC 2Y0EA 3JCUE 2W83C 3VMYA 4JPZB 2AEMA 3RK3D 3VB9A 5APTA 1MKMA 2QG4A 3HOXI 2YIUB 1M1K1 2WB1A 3H1LD 4OGQB 3CCQZ 5AW6B 3S1NI 1PPJE 2KYVA 2HPCA 1IFMA 1RO2A 3T97B 5D1OA 1M90Q 3IR7A 1T2KD 2HR3A 3E7KA 2XNDH 2Q1KA 1OFCX 3G6EP 1K73Q 4C7NB 2WWWA 4AYBA 4Y99B 1KTMA 4WY4A 4NB9A 4E33A 2MJZA 3P7KA 1QF8A 4DK1A 3WUVA 2HG5D 1VQ41 4L76A 4GT1A 1SQBD 2C0XA 1KQSZ 3CD6Z 3L4FA 4I2LC 2R44A 4WVZA 3GTKI 4HYTB 3H1HJ 1NKNA 3A3YB 1OXZA 5B66E 2O01J 4UB6E 5B5EH 1VLAA 1YITZ 1L0LE 2Z5IA 3SWKA 5LL6f 1M1KQ 2DE5A 1L4AC 2W6BA 1LT1A 3H1HE 1KB9E 4KT0J 1VQMZ 2IZ4A 1JJ2Y 2QKDA 2ZAEB 4H0LB 3MZWB 3CC7P 5A2Qb 2WPRA 1VQK1 1SQVJ 2QEX1 1MFTA 3J81b 2IZ3A 2XDJA 4OWFA 2Q7CA 3A0BE 3U50C 2PRRA 2F4OA 3G4SZ 1WIIA 1OMIA 3VMZA 1SQQK 3CCMZ 1SQVE 2NRGA 3FWLA 3U1AA 2WPSA 3FXDA 4NPFX 2Q6QA 1JNMA 3UIAA 2JMOA 3CX5H 1PGPA 3H1IJ 2GTHA 1BDDA 3P8CD 1K8A2 2R7ZI 1X3WA 3H1KG 2K9JB 1M1JB 3O6QB 5CJ0A 3TE5B 3B8EB 1Z01A 3L75G 1LTBC 3H1IE 2FXPA 2C9LY 3PTZA 3D2LA 3F89A 4A7PA 2E74D 3T4NB 1JY3P 3CLQA 4PJ0H 2P10A 1SP4A 2E42A 3I56P 4JQ0D 3J81f 1Q862 1KILE 2R5DA 1KD1Q 2Q5UA 3PHLA 5KJ7A 4NBHA 4BRYB 3MZKB 5D1PA 3V2NA 1R9TI 1BCCE 2O3JA 3HD7C 2OTJP 4RESB 1KQSY 4GODA 1GL2B 1X79B 2M0BA 4PV1D 4Y7NI 1T8ZA 1D7MA 3CX5I 2FBWC 1EZVG 1YIJP 1FC2C 3A7OA 1SFCB 4H44C 1JY2P 4RO0A 2ZYGA 1JWHC 1K8A1 3EERA 3H1JJ 3GG2A 2P3YA 2EGTA 2B87A 1R5SA 2C9NY 1YJW1 2QVAA 3CPWO 2LEXA 5AW3B 1ZB8A 1N73B 3H1KJ 3CC2Z 3H1JE 2FYZA 4GOEA 1NU1D 2K1AA 4CPGA 1LTTC 3CME1 1Q861 2E76D 1K9M1 5APWA 4DOJA 1K05A 2CPBA 2NPSB 1URQC 4E31A 5FLMI 1VQP1 1SQPK 5KAIH 4D6TD 1KZUB 1AQTA 4WY4D 5M1BA 2YMKA 3M06A 2IPPA 2A06E 1FZFA 3N4XA 2OGUA 4XX2A 2V4HA 3L70J 3S16I 3GF7A 1SFOI 3OW2O 2QRDB 3N7NA 1LTIC 1YJN1 1K8AQ 2DW3A 3CCUZ 1VQ8P 2FYUG 3AEBC 4EIJA 1TFIA 3L70E 1VQL1 4W7ZA 5APVA 1Y47A 2E5YA 3LW5J 5DJTB 2XKMA 4A3KI 1NTMK 3CCQ1 2O4HA 2L91A 5AVZB 1Q86Q 3CCJZ 1K9MQ 3HE4A 4NFRA 1MV8A 1N7SD 4U3FE 3AEGC 2H8PD 5H2FE 1Y9BA 4MH4A 1NH4A 1NTKD 4I1LA 1UIXA 2FFDB 2LFUA 4O9BA 3V4WA 1S4XA 4R4LA 1USEA 5GTHE 2ZT9D 1P9NA 3D9XA 2PM9A 1CSBA 1JTHA 2BCCD 2K37A 3H1LG 3SFEC 3CD61 1Q822 1BE3E 1Q7Y2 2NAPA 1WZNA 3AE5C 1S2EA 3HTKB 4TNUA 1YIT1 5K5GB 1L0NJ 2WMMA 2JIRA 3IFUA 4NBGA 1ZOYC 1QLED 1WMKA 2FYUJ 1L1OC 2O01H 1VQM1 1ZRTE 3S15I 1YHQZ 1L0NE 2IFMA 2IBZD 1S72P 4K35A 2KP8A 3CQZI 3CCSZ 1CZQA 5AW4B 3W67A 1PGOA 3CMAP 4YXWH 2N1TB 3FQMA 3A0BH 4NOZA 4W80A 3TDHB 1T2KC 3G4S1 4ZKPA 3GKQA 3CXHE 3CXCZ 1YBKA 5E79E 5KJ7D 3P8MC 3S17I 3CCM1 1FU1A 4EWCA 4A3CI 3L71D 2WQYC 1OX3A 4JYBA 1Q821 1Q7Y1 1ZN5A 2E2JI 2YKPA 4NPDA 4C7NA 2ZXXA 3Q1MA 4R4MA 3H1LJ 2F4MA 2Q51A 1FZEA 1KB9I 1DX7A 2KXPB 1LT9C 4IFFA 1OW7A 3NH4A 2PGDA 1LP1A 1LTAC 5AVSB 1KYOD 1IK9A 2I8DA 1NGMB 2QREB 3GMAA 2VRSA 2P58A 1YI2Z 3EFGA 2NZ2A 4L73A 2YNYA 1YJ9P 1Q16A 1PGJA 1SQBJ 1QX8A 2QJPC 3I4NI 5AW5B 3AE1C 3M91A 1SQVK 4X6AI 1BSNA 3RK2D 1VF5B 1Q7YQ 1R8EA 3CCRZ 4MD8A 1AVOA 3H6PA 3L74E 3IAOA 3RL0B 1FOSF 3L75D 2JA5I 4RS4A 1KILB 1J1DC 1M57D 3AE2C 4AUWA 2M6NA 1QVFO 5AW7B 2I1JA 1GMJA 2OYIC 2OZKA 1FZCC 3CC21 1U7JA 1QXFA 3TNUB 2E74C 2NVQI 3TGUE 3D6ZA 1EXIA 3HUSC 3CC4Z 4A3JI 3GTLI 2JIPA 3CXCY 3S1MI 1MFZA 1RF0C 2I1KA 4W7YA 2K9JA 1M1JA 1OVRA 1MUUA 3G71Z 2KI7B 5C44I 3M9HA 3HOWI 1EZVD 2H89C 4AQRD 1NO4A 1VQNZ 2JWAA 2Z5HA 3CCU1 1OZHA 1AVYA 3MP7B 5KLVD 4E2ZA 2QA4P 1VDFA 2PK7A 2YU9I 1X3ZA 4ASVA 4BRYA 1IJDB 2MKVA 4DCKA 3E1RA 4IFMA 4WWIA 3CCEP 3HD7B 1M56D 2V7QJ 3AECC 4D6TG 1GL2A 3FKII 1VQ6Z 5T64A 2JR6A 3LW5H 3L73D 5H2FH 1SFCA 2Z4EA 1LJ2A 5CBNA 1VQOP 2CPSA 2E76C 1Z03A 1Y1VI 2PP6A 3L72E 3KZIE 1NTME 3A0HH 1M1K2 1I6HI 3G9RA 3JAMb 1SQXG 1UIIA 5GTHH 1N73A 5TISH 4WY4C 1Y1VS 2O1JA 4OH8B 4BY1I 3NFQA 3KQGA 3K7AI 1U7MA 1MZ9A 4MD9A 4A3LI 2E9HA 3L35A 3GTJI 3CCJP 4UB8H 1JMMA 2A45G 1JCCA 3Q2YA 1FE6A 2Q3IA 1VQPZ 2NPSA 2W27A 3IR9A 4HGZA 4LLHA 3MZLB 1URQB 1NU1J 1OW6A 4Z1MH 2VPXA 5TJHA 4PD4D 5C4XI 1NTKG 4YTPC 3RGUA 2OTLZ 1YJNZ 1W2BZ 5AVWB 1PP9D 1NU1E 1NTZJ 2JA8I 1LQLA 3CCS1 4D6TJ 2NVYI 5CCGA 2R93I 5KAFH 2B89A 2BCCG 1VQLZ 2HFED 1N7SC 1N8RQ 2IZ1A 3F5HA 1USPB 1RE4C 3CXHH 3JAMf 5E79H 3I55Z 1NTZE 3VP9A 1NAFA 1DL6A 1QVFZ 1VQ7P 3TF5A 3GHGC 4HGYA 2HF1A 1YHQP 1SQQD 3IF4A 3M0DA 2ZT9C 1ZR2A 1EDKA 2KSEA 2IBZG 1OW8A 1HJBA 1VQ9Z 1RF1B 1KD12 3MUDA 3PO3I 3AEAC 2M8RA 2FFDA 3WMM0 1ZXGA 2LKMA 1NKZB 2JP3A 2AXCA 3PO3S 1HH0A 1L0NK 2GA1A 3L71G 1ZMEC 2FYUK 1NTKJ 1P84D 3P32A 1YI21 2WSEJ 3HTKA 3OA7A 5AW9B 1JEKA 3ITKA 4A3GI 3CXHI 1VQ5P 3JC22 4ZKUA 3VTPC 1BGYD 2AKLA 1S5LX 1DD4A 1VQ4P 4BY7I 2HLOA 5KJ7C 1H8AA 3CCR1 1N86A 5BVZA 3O8ZA 3VMXA 1G2CB 2ITAA 2N1TA 3FQQA 4RJTA 1KD11 3TYYA 2QJKB 1A02J 3PLNA 3CX5D 1HVVA 1W2BY 1AV1A 3M4OI 1Z56A 3HE5A 5CBOA 1DEEG 3AE8C 1J1EC 1NOHA 3EEDA 2OTKE 2WSFH 1NYHA 2JIQA 2XZRA 3CC41 1VQKP 2QEXP 1SFCD 3L71J 1M7LA 3G711 1QVFY 1EC5A 1YTZT 2M48A 1LT9B 1GZLA 5A2Qf 2OARA 4KJMA 4BBRI 1SQPD 1EDLA 5IP7I 4ZNCA 3TK1A 3BRVB 2Y0CA 1LNQA 1VQN1 2HODA 2GM4A 1NAYA 1ZR4A 3CCVZ 3RK2C 1K9M2 1Q90D 1SQBK 1QL1A 3PH0A 3WUTA 1EDIA 3KXDA 2M5AB 1IFDA 2V8JA 2BJOA 5IP9I 1FS0E 2WSCJ 3FX0A 3L36A 2Y0SA 1CI6B 3IF8A 2QJPB 4B86A 2P1JA 2IDBA 4E2YA 1VQ61 2HU9A 1FDOA 3I4MI 4XE5B 1WJ2A 2V7QH 4U7JA 2RT9A 1RE3A 1KILA 5CCGD 2RHBA 3KZIH 2OYHC 2LXBA 2QJYB 3KPEA 2JS4A 2IFNA 1J1DB 2LR2A 5KLVG 3E1IA 3D6YA 2VPYA 2R5BA 2XU6A 3AEDC 2OYIB 1FZCB 4GDOA 1ML8A 2KPIA 1W5CE 3L75J 4JYCA 2KK7A 1S7MA 5BU8B 3H1KE 4RV9A 3B5NA 2LIYA 2E74B 3VTNA 1OVUA 3HUSB 3L75E 1LTSC 3L73G 1HWTC 3MD0A 4JBZA 1IC2A 2J58A 1YJWP 3QWOC 4RVHA 1ZB9A 2XV5A 2ZJSE 2OTL1 1AJYA 2QLVB 4A3DI 2FYNC 4M3LA 3CMEP 3M0AA 2YKOA 3GTPI 2WAQA 1PPJD 1SQXD 2OQQA 3HKZA 3QWUA 3I551 2XNXA 2ZVNB 2WPVB 1IK7A 1EZVE 2ZYAA 3VMHA 1RH5B 1YJNP 3BVHA 2YO2A 1VQ91 1N2FA 1PP9G 3S4RA 2KNCB 2QR1B 2E76B 1VQLP 1OVVA 2HPCB 1Y8CA 3A0HE 5D1OB 5C4JI 3W68A 3L73J 5TISE 3WU2E 1GK4A 3CCQP 1CW5A 1L0LD 2A45H 2JA6I 2AXTH 2WT7B 1JY3O 2KUBA 4UB8E 1RNIA 4XA4A 3H1HD 3MIWA 1KB9D 4E30A 1NU1K 2D2CD 3KIFA 1SQQG 2E43A 3RK3C 4BWNA 2C0WA 2W8ZA 2E75D 2W6AA 1NTZK 2KZIA 2WSEH 5AVUB 5FLXb 2YXRB 1YTZI 1KC82 4A3MI 2FYUE 3TSIA 2Q9IA 1LWUC 2QM8A 1ZV8A 1SVFA 3CD6P 4H13D 1I50I 3BG1B 1DD3A 3D70A 3V4QA 1KFNA 5KAFE 5T67A 3CI9A 2NVXI 1YITP 1JY2O 1USPA 1N7SB 1L2PA 2JWDA 2V3VA 4ZMDA 1S9KD 1PP9J 1VQMP 3G6EZ 3CPWZ 3LIEA 4PD4E 1G1JA 3LIDA 2AEJA 3GHGB 1BGYG 3S9OA 3T97A 2OYOA 1VF5D 1HUCA 2ZT9B 4N78E 3S1KA 3NDJA 1G1IA 1RF1A 3RL0D 4HKZH 1XTCC 3RK3E 3G4SP 3M9BA 1S5LH 1JMBA 1RY3A 1KILD 1SQQJ 5FLXf 3CCMP 1NTKK 3H1LE 1KC81 3EWKA 1BCCD 2VUGA 3OW2Z 3U59A 3CCV1 2B63I 1YYCA 3GTOI 2RKLA 1KMIZ 3RZDI 3B5ND 2KLVA 1N2DC 3V2RA 4ASWA 3CC7Z 1ZLLA 1AA6A 5IT9b 1L4AB 1LTJC 3GCFA 2WSCH 1SQBE 1KYOH 4HJGH 3V2PA 2FXMA 1SQPG 3CCL1 1G2CA 3H1JD 2YXQB 1KRLA 4Y52I 1JM0A 3BCCG 4NH1C 2PAJA 2WSFJ
chains in the Genus database with same CATH topology
2JA8I 1LQLA 3CCS1 4A3FI 2NVYI 3T4NB 4A3II 1NP6A 2R93I 3F3PC 2B89A 1VQLZ 3VMGA 4A93I 1USPB 3JAMf 4HB1A 3J81f 1Q862 3I55Z 3J80b 1WCMI 1S721 1QVGZ 1DL6A 1QVFZ 4NBHA 3MZKB 4QTTA 5D1PA 3CMA1 4HGYA 2HF1A 1YUAA 5EFWB 1R9TI 5IT9f 1KQSY 1X0TA 3CPWY 4GODA 4HH4A 1EDKA 1N8R2 2KZJA 3I56Z 4DQYB 2M0BA 2OOYB 1ZH1A 1VQ9Z 4Y7NI 1S3JA 1KD12 3S1QI 1FC2C 2Q4ZA 3PO3I 1VQ7Z 1JWHC 1K8A1 1Z02A 3EERA 1ZXGA 1YUKA 3S14I 2G2KA 2P3YA 3S2DI 2EGTA 2B87A 3PO3S 1YJW1 2QVAA 1ZB8A 1K83I 4E32A 3CC2Z 3Q87A 1YIJZ 4BBSI 1Q812 1YI21 1Y1WI 3S1RI 4GOEA 4CL1A 2P28A 1TWHI 4A3GI 2VUMI 4CPGA 3OW2Y 5T6BA 3J80f 3CME1 1Q861 2W04A 1K9M1 3NH8A 3D6WA 2E2II 2OOXB 2AKLA 1SS1A 4E31A 5FLMI 1VQP1 4BY7I 1NJI2 3CCR1 2LXCB 1N8R1 4XX2A 1VQ5Z 1YJ91 3S16I 4RVFA 1SFOI 3FQQA 1TWFI 1KD11 2O53A 2QRDB 4DGLA 1YJN1 4MN4C 3CCUZ 1VQ4Z 1WW9A 4IOIH 1TFIA 1W2BY 3M4OI 5CBOA 4RVGA 1DEEG 1VQL1 3EEDA 2OTKE 1Y47A 5DJTB 3NH5A 4A3KI 1Q811 3CCQ1 3CC41 2K5RA 2O4HA 1Q2NA 3H0GI 1VQ8Z 3CCJZ 4MONA 2J6AA 4NFRA 4K3AA 1QVGY 3NDIA 3G711 3M3YI 1QVFY 1EC5A 1PFTA 2DE6A 2DE7A 2M48A 4NBDA 4MH4A 5A2Qf 4KJMA 4BBRI 1EDLA 1NJI1 1TWGI 2H85A 5IP7I 4ZNCA 2E2HI 3IX0A 2LFUA 1VQKZ 1VQN1 2QEXZ 1H0TA 3CCVZ 3ESWA 1K9M2 3MHVA 2B87B 1P9NA 3PH0A 3D9XA 5C3EI 1EDIA 3G6E1 2PM9A 2M5AB 3CD61 1Q822 2V8JA 2BJOA 5IP9I 3HOZI 1Q7Y2 2Y0SA 3IF8A 4MD7A 4S1TA 4BXXI 4TNUA 4NBAA 1YIT1 5K5GB 2WMMA 3IFUA 4NBGA 3KIHA 4E2YA 1VQ61 2HU9A 3HOUI 3I4MI 2VF1A 1L1OC 2QA41 3RZOI 1VQM1 3S15I 1RO0A 2GTIA 3FXEA 1YHQZ 2RT9A 2V8KA 2UWJE 2OTJZ 3CCE1 4K35A 3CQZI 2RHBA 1RQFA 2W03A 2LXBA 2JS4A 5DJUB 3CCSZ 1RLYA 5CM2M 2LR2A 1TWAI 2M5AA 4BXLA 2I3CA 1VQ51 4NPEA 3FQMA 2B88A 4MXUA 4NOZA 4QTUA 3TDHB 3G4S1 1ML8A 1EDJA 2KPIA 3VMIA 3GKQA 4A3EI 3CXCZ 1S7MA 1VQO1 3P5JB 3S17I 2RBLA 3CCM1 1S72Z 4EWCA 4RV9A 4A3CI 1M902 1LP1B 3CC71 2LIYA 4NB8A 3VTNA 3CMAZ 1K732 1OVUA 1Q821 1ZW0A 1Q7Y1 3GTMI 4JBZA 2E2JI 5C39A 2KS1B 3J7A4 3QWOC 4NPDA 4RVHA 1I3QI 1ZB9A 3CCJ1 2F4MA 2Q51A 2YADA 3GTMS 2OTL1 2R92I 2QLVB 4A3DI 1BDCA 1TWCI 3NH4A 3GTPI 2WAQA 2GU2A 3I07A 3HOYI 1LP1A 2KIKA 1YJWZ 2JNYA 2I8DA 1H0TB 2QREB 3HKZA 3QWUA 3I551 2P58A 1YI2Z 1NUIA 1JJ2Z 3CMEZ 3VMHA 3F3FC 3I4NI 1M901 1QYPA 2RIQA 1K731 3I561 4X6AI 1VQ91 4RVDA 1N2FA 3CCRZ 4NBCA 4MD8A 3BG0B 2QR1B 1OVVA 3NFZA 1VQ71 1YJ9Z 2K3RA 2JA5I 4RS4A 5D1OB 5C4JI 1YHQ1 2OTJ1 3LUSA 2M6NA 2JA6I 3MONA 2OZKA 2KUBA 3VB9A 1RNIA 2SPZA 3CC21 1U7JA 3H3VJ 1YIJ1 4E30A 3HOXI 3KIFA 4E2XA 3GTQI 1M1K1 2R6MA 4NBBA 4EYYQ 2NVQI 2WB1A 3CCQZ 3CC4Z 4MRIA 3S1NI 4A3JI 2JA7I 3GTLI 3CXCY 3S1MI 2KZIA 3S2HI 3CCLZ 1OVRA 5D1OA 1RO2A 3G71Z 5FLXb 2KI7B 4A3MI 5C44I 1KC82 2HR3A 3HOWI 2Q1KA 4AYBA 1I50I 3BG1B 4NB9A 4E33A 5T67A 1QF8A 2NVXI 1VQNZ 2NVTI 4DK1A 3GTGI 1USPA 3CCU1 4GOFA 1VQ41 5AN9F 2JWDA 2RPRA 4E2ZA 4ZMDA 2PK7A 3G6EZ 2YU9I 3CPWZ 1X3ZA 1KQSZ 4ASVA 3CD6Z 2R44A 3GTKI 4WWIA 2JUBA 1VLAA 1YITZ 3ZDMA 3S1KA 5LL6f 3NDJA 2DE5A 4E2WA 1VQ81 4A3BI 3FKII 2PMZA 1VQ6Z 4HKZH 5T64A 2JR6A 2QA4Z 1LT1A 1VQMZ 2IZ4A 1JJ2Y 3PO2I 1JMBA 4NBFA 5CBNA 2QKDA 2ZAEB 2QRXA 1RO4A 5FLXf 2V8IA 3CCEZ 3MZWB 1Z03A 5A2Qb 1Y1VI 1KC81 1VQK1 1M1K2 1I6HI 2QEX1 2VUGA 3JAMb 1MFTA 3J81b 3OW2Z 2IZ3A 3CCV1 3U50C 2F4OA 3G4SZ 2B63I 1WIIA 1Y1VS 4BY1I 1VQOZ 3K7AI 2RKLA 3GTOI 1U7MA 3RZDI 4MD9A 4A3LI 2E9HA 4NBEA 3CCMZ 3GTJI 4ASWA 2QRCB 3CC7Z 5IT9b 3HOVI 3FXDA 3GCFA 4NPFX 1VQPZ 2JMOA 4HGZA 3MZLB 1NVOA 2GTHA 1BDDA 1K8A2 2R7ZI 4HJGH 1X3WA 5C4XI 3CCL1 1KRLA 3TE5B 4Y52I 1JM0A 3RGUA 2OTLZ 1Z01A 1YJNZ 1W2BZ 4NH1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI7 B;  5CBO A;  2HR3 A;  2Q1K A;  1DEE G;  1ZW0 A;  2OTK E;  4JBZ A;  2B89 A;  1Y47 A;  5C39 A;  2KS1 B;  3QWO C;  4NPD A;  5DJT B;  4HB1 A;  1Q2N A;  4GOF A;  2JWD A;  1BDC A;  4K3A A;  4ZMD A;  1EC5 A;  5EFW B;  4ASV A;  2R44 A;  1LP1 A;  1X0T A;  2KIK A;  4GOD A;  1EDK A;  2KZJ A;  4KJM A;  4WWI A;  2I8D A;  1H0T B;  2M0B A;  1EDL A;  4ZNC A;  1S3J A;  2P58 A;  3S1K A;  3ZDM A;  1H0T A;  1FC2 C;  3MHV A;  4HKZ H;  2B87 B;  3PH0 A;  1LT1 A;  1ZXG A;  1EDI A;  1JMB A;  5CBN A;  2M5A B;  2ZAE B;  2QRX A;  2B87 A;  3MZW B;  2QVA A;  5K5G B;  2WMM A;  4GOE A;  1MFT A;  1OVV A;  4CPG A;  2K3R A;  2RKL A;  1U7M A;  3FXE A;  4ASW A;  2UWJ E;  1SS1 A;  4K35 A;  2LXB A;  2KUB A;  3FXD A;  5DJU B;  2SPZ A;  1U7J A;  4NPF X;  2LR2 A;  2M5A A;  4BXL A;  4NPE A;  2LXC B;  2B88 A;  1NVO A;  1BDD A;  1EDJ A;  4EYY Q;  4HJG H;  4MN4 C;  2KZI A;  1JM0 A;  1LP1 B;  3RGU A;  1OVR A;  4IOI H;  1OVU A; 
#chains in the Genus database with same CATH topology
 3OJA B;  1QL2 A;  1FDI A;  4A3I I;  1SFC C;  1KC8 Q;  3F3P C;  4A93 I;  1IFN A;  4HB1 A;  2YKQ A;  3H32 B;  1J1E B;  3ABV C;  3CWB G;  4KHX A;  2A06 D;  4QTT A;  1YUA A;  3O6Q A;  2BAS A;  5IT9 f;  3D71 A;  2WVR A;  3K5B A;  3CPW Y;  1X0T A;  2FXO A;  1N8R 2;  2KZJ A;  3I56 Z;  4DQY B;  2OOY B;  2QSI A;  1ZH1 A;  3L70 D;  1LT9 A;  3CC2 P;  3S1Q I;  2IZ0 A;  2Q4Z A;  3VN0 A;  3SWF A;  1GU4 A;  1R5L A;  1Z02 A;  4PV1 C;  3S14 I;  2RMZ A;  3II6 A;  1H88 A;  3RK2 B;  1PFI A;  3AE3 C;  3P8C E;  2GUV A;  2CK3 H;  4HH2 A;  1K83 I;  4E32 A;  3Q87 A;  4I7Z C;  5CCH A;  1YIJ Z;  4BBS I;  4U3F D;  1Y1W I;  2P28 A;  2G8Y A;  2QM7 A;  2AEF A;  3OW2 Y;  5AW1 B;  2JKV A;  2R3C A;  4LC1 A;  3KYQ A;  2W90 A;  4C46 A;  1SS1 A;  3CCU P;  4H44 B;  3HRN A;  3AE7 C;  3M0D C;  1X9V A;  1IFP A;  1IO4 A;  1N8R 1;  1BE3 D;  2B9B A;  1SLQ A;  3B71 A;  1PPJ G;  2OYH B;  2ZFC A;  4TLF A;  4RVF A;  1DH3 A;  3WU2 H;  2O53 A;  1LGH B;  1FZC A;  3MUD C;  4OGQ D;  2N9Y B;  1WW9 A;  2JDI H;  5AVX B;  1ZRT D;  2RN0 A;  5AVY B;  3EQ2 A;  3M9Q A;  1JOC A;  2GUS A;  1RF0 A;  3NH5 A;  3NXS A;  1EZV I;  3H0G I;  1VQ8 Z;  4AYC A;  4K3A A;  3NDI A;  5KKZ C;  4NBD A;  1L0L G;  1T3U A;  1TWG I;  1S1C X;  3GW6 A;  3H1H G;  1JCD A;  4D6T E;  5AVV B;  5C3E I;  1USD A;  3G6E 1;  1T6A A;  4PD4 H;  2P7J A;  3NTN A;  3FWN A;  1SQX J;  1KQG B;  4RKU J;  4H0L D;  2Y0D A;  1IZN B;  1WT6 A;  2W6J H;  3CCS P;  2ZYD A;  3VP8 A;  2POH A;  5KLI C;  3KIH A;  1FBM A;  2H88 C;  1SQX E;  1NHL A;  2D2C C;  1SQV G;  2KNC A;  2GTI A;  1FDM A;  3USS A;  3FXE A;  5GTI E;  1SIW A;  2V8K A;  1RLY A;  2E75 C;  5CM2 M;  1TWA I;  4BXL A;  2I3C A;  1VQ5 1;  2AXT E;  4NPE A;  2WT7 A;  4MXU A;  2WZ7 A;  3AE6 C;  1EDJ A;  3VMI A;  3AEF C;  4H13 C;  4GIF A;  2WIT A;  2H43 A;  1S72 Z;  3H1I G;  3GLM A;  3L74 D;  5BU5 A;  1LP1 B;  3CC7 1;  1PGQ A;  1L0L J;  1NTK E;  4NB8 A;  3CMA Z;  5AW8 B;  2BCC J;  3RK3 B;  4PD4 I;  4GKG A;  2KS1 B;  3J7A 4;  2V45 A;  2BCC E;  1LWU B;  1I3Q I;  1HTL C;  3B4S A;  5AW2 B;  1YI2 P;  1P84 H;  1JUN A;  2WSS H;  1BCC G;  2R92 I;  2O1K A;  1VF5 C;  2PFX A;  4DJG A;  3C1L A;  1TWC I;  1H89 A;  1N7S A;  3TGU D;  3RL0 C;  1RE4 A;  2GU2 A;  3I07 A;  2ZVO B;  1PZQ A;  1RE3 C;  2KIK A;  5CCH D;  2JNY A;  1H0T B;  1KQF B;  1KIL C;  2P2U A;  1YQ3 C;  1GL2 D;  2IBZ E;  3GHG A;  3CCR P;  2BEZ F;  4IFD K;  2BEQ D;  1NUI A;  4EDF A;  1QGK B;  3MGN A;  1K04 A;  3F3F C;  1QYP A;  1XTG B;  1S5L E;  2Y9Y A;  3H1J G;  3I56 1;  3B5N C;  2G3A A;  3L71 E;  3BG0 B;  1S9K E;  3NFZ A;  5APS A;  1YJ9 Z;  4IL6 X;  3BCC D;  1EQ7 A;  1P84 I;  1N7L A;  2OTJ 1;  3LUS A;  5AW0 B;  3CC4 P;  1QVG O;  3MON A;  1VL2 A;  1KOR A;  2A06 G;  2SPZ A;  3G71 P;  2NPS D;  3H3V J;  1YIJ 1;  1RQU A;  4E2X A;  1L4A A;  3FGA D;  1BCC J;  2Y9Z A;  3CWB D;  3GTQ I;  3BAS A;  1LTJ B;  1FZG A;  2R6M A;  4NBB A;  3TDK A;  4EYY Q;  4TT3 H;  4YPC A;  4MRI A;  3L72 D;  2JA7 I;  3GF3 A;  1VQN P;  1NTM D;  3L70 G;  1KYO E;  3S2H I;  3CCL Z;  1PV3 A;  1FOS E;  4YXD C;  2J5U A;  4WBA A;  2P67 A;  3WUU A;  1RHZ B;  3C8V A;  1TU3 F;  2NVT I;  4IL6 E;  1KFM A;  3GTG I;  3TNU A;  4GOF A;  4U3F G;  5AN9 F;  2RPR A;  3H32 A;  1VQ6 P;  1AA0 A;  3V2Q A;  1KV4 A;  3PJS K;  3VMA A;  1HBW A;  2JUB A;  4EOT A;  2QIW A;  1X8Y A;  1Y8A A;  3ZDM A;  5L8R J;  4E2W A;  1VQ8 1;  4A3B I;  2PMZ A;  3QH9 A;  2JIO A;  2QA4 Z;  2L5G B;  1BE3 G;  1LTG C;  5APX A;  3PO2 I;  4NBF A;  1GD2 E;  2QRX A;  1NTZ D;  1ZP0 C;  1RO4 A;  2V8I A;  1E5W A;  2KB7 P;  1HGV A;  3R2P A;  3CCE Z;  4PV1 B;  1DEB A;  4I6M C;  3AE9 C;  1VQP P;  3Q5P A;  1IFJ A;  3IFM A;  2J59 M;  4C7R A;  4I7Z B;  1L0N G;  3HD7 A;  1VQO Z;  3JCU H;  1U57 A;  2K88 A;  4NBE A;  2R32 A;  5KLV J;  2QRC B;  2ZXE B;  2YO3 A;  2YIU C;  1OWA A;  2OTL P;  3RBX A;  3HOV I;  2R3S A;  4OGQ C;  4U3F J;  3VOP A;  5KLV E;  2FY8 A;  1NVO A;  2N1T D;  5GTI H;  3Q5S A;  3I55 P;  2OYH A;  4N3Y B;  4Y99 C;  2H7H A;  1RF1 C;  4WY4 B;  1NWQ A;  5APU A;  4A3F I;  1NP6 A;  3VMG A;  3L73 E;  3EFF K;  2IV2 X;  3NMD A;  1BE3 J;  1VQ9 P;  2WPQ A;  3J80 b;  1WCM I;  3BAT A;  4WB4 A;  1S72 1;  1URQ A;  1QVG Z;  4L74 A;  2VPZ A;  3CMA 1;  3PP5 A;  5EFW B;  5CJ4 A;  5B66 H;  1PIX A;  1VPC A;  4UB6 H;  1KN7 A;  4HH4 A;  5KKZ B;  1SQV D;  1S3J A;  3R4Y A;  2O01 N;  1KB9 H;  3PRJ A;  2IX7 C;  3SSU A;  1EXJ A;  4H0L C;  1VQ7 Z;  1KQL A;  3C9I A;  2JR8 A;  1YUK A;  2G2K A;  3KHU A;  1SQX K;  3SWY A;  3S2D I;  2RH0 A;  3CL3 D;  2A45 I;  5AVQ B;  3L74 G;  5CMZ A;  1J2J B;  1SQB G;  1L4A D;  3A5T A;  2AYD A;  3SFD C;  2QJK C;  3AEE C;  1Q81 2;  3S1R I;  3H1I D;  4CL1 A;  1TWH I;  2VUM I;  1PL5 A;  1PP9 E;  3BRT B;  5T6B A;  3J80 f;  2W04 A;  3HE5 B;  1GK6 A;  3NH8 A;  3D6W A;  5KLI B;  2E2I I;  1AQ5 A;  2OOX B;  1X22 A;  2D2C B;  1A02 F;  1NJI 2;  3RL0 g;  1M1J C;  2IYO A;  2LXC B;  3TGU G;  1VQ5 Z;  1YJ9 1;  2KOG A;  1QEX A;  1SQQ E;  2E75 B;  1TWF I;  1L0L K;  1GU5 A;  4DGL A;  4MN4 C;  1VQ4 Z;  4IOI H;  4H13 B;  2JO1 A;  2VPW A;  4RVG A;  2HOD B;  4QMA A;  4Y28 J;  3Q3D A;  2IBZ I;  5CHX A;  1AFO A;  1Q81 1;  5B5E E;  1FJP A;  5CCH C;  2KS1 A;  4EI2 A;  1Q2N A;  2K5R A;  2E5T A;  1LWU A;  4MON A;  4DZO A;  3CCV P;  3L74 J;  3IN6 A;  2J6A A;  1GL2 C;  1QVG Y;  1JO5 A;  3M3Y I;  1P84 E;  1PFT A;  1BGY J;  3V5B A;  1W2B O;  1JB0 J;  3KDP B;  2DE6 A;  2DE7 A;  1Q82 Q;  3H1K D;  3OAK A;  1NJI 1;  4XFJ A;  2H85 A;  2E2H I;  1WRG A;  1GTW A;  4IL6 H;  5KTB A;  3IX0 A;  1VQK Z;  1BGY E;  2QEX Z;  1FZB A;  1H0T A;  3HD7 D;  3VYI A;  3ESW A;  1FZA A;  3MHV A;  2QJY C;  2B87 B;  1N73 C;  1JY3 N;  3A2A A;  3CCL P;  3HOZ I;  3TGU J;  3L72 G;  1NTM G;  4MD7 A;  1RQV A;  4S1T A;  4BXX I;  4H44 D;  4NBA A;  3AE4 C;  3RBZ A;  1T3J A;  3CX5 E;  3HOU I;  3B5N B;  2NPS C;  1Q81 Q;  2VF1 A;  2QA4 1;  4DT0 A;  4JF7 A;  3RZO I;  1KYO I;  1FJK A;  1RO0 A;  4LGD E;  2JIM A;  2UWJ E;  2WTY A;  2OTJ Z;  3CCE 1;  1HGZ A;  3H25 A;  2W03 A;  1RQF A;  5DJU B;  1KQS O;  2M5A A;  1SQP J;  2B88 A;  2E7Z A;  4QTU A;  4PJ0 E;  1NJI Q;  1JY2 N;  2Q3E A;  1CI6 A;  5CCG C;  1DIP A;  3BCC J;  1URQ D;  1FAV A;  4A3E I;  1VQO 1;  3P5J B;  2QE7 H;  2RBL A;  2KSJ A;  1LTJ A;  1NU1 G;  1SQP E;  1M90 2;  1IFI A;  1K73 2;  1GDT A;  3BCC E;  2K9Y A;  5APY A;  1W2E A;  1ZW0 A;  5AVR B;  3V6I A;  3GTM I;  1GW3 A;  5C39 A;  1NTZ G;  3CWB J;  2M3B A;  1GW4 A;  2YMY A;  3HE4 B;  3CCJ 1;  2FKW B;  2M3E A;  2JJL A;  3L72 J;  2YAD A;  3GTM S;  2IYP A;  1NTM J;  2OYI A;  1BDC A;  3G3Z A;  3CWB E;  1YQ4 C;  4L75 A;  2FFD C;  3HOY I;  2KLU A;  1YJW Z;  3U1C A;  3HUS A;  1L0N D;  3JSV C;  1HF9 A;  2JEE A;  2FYU D;  3Q5R A;  1JTH B;  5APQ A;  1JJ2 Z;  3CME Z;  1E79 H;  1M90 1;  5AVT B;  2RIQ A;  3CXH D;  1K73 1;  2HYN A;  5KAI E;  4RVD A;  2FYN B;  1OIP A;  4NBC A;  4N6J A;  2N9B A;  3MTU E;  1VQ7 1;  2K3R A;  1BSH A;  5KLV K;  1YHQ 1;  4OVN F;  1M8O B;  3I5C A;  3L37 A;  1HJ0 A;  4N78 D;  2N1T C;  2Y0E A;  3JCU E;  2W83 C;  3VMY A;  4JPZ B;  2AEM A;  3RK3 D;  3VB9 A;  5APT A;  1MKM A;  2QG4 A;  3HOX I;  2YIU B;  1M1K 1;  2WB1 A;  3H1L D;  4OGQ B;  3CCQ Z;  5AW6 B;  3S1N I;  1PPJ E;  2KYV A;  2HPC A;  1IFM A;  1RO2 A;  3T97 B;  5D1O A;  1M90 Q;  3IR7 A;  1T2K D;  2HR3 A;  3E7K A;  2XND H;  2Q1K A;  1OFC X;  3G6E P;  1K73 Q;  4C7N B;  2WWW A;  4AYB A;  4Y99 B;  1KTM A;  4WY4 A;  4NB9 A;  4E33 A;  2MJZ A;  3P7K A;  1QF8 A;  4DK1 A;  3WUV A;  2HG5 D;  1VQ4 1;  4L76 A;  4GT1 A;  1SQB D;  2C0X A;  1KQS Z;  3CD6 Z;  3L4F A;  4I2L C;  2R44 A;  4WVZ A;  3GTK I;  4HYT B;  3H1H J;  1NKN A;  3A3Y B;  1OXZ A;  5B66 E;  2O01 J;  4UB6 E;  5B5E H;  1VLA A;  1YIT Z;  1L0L E;  2Z5I A;  3SWK A;  5LL6 f;  1M1K Q;  2DE5 A;  1L4A C;  2W6B A;  1LT1 A;  3H1H E;  1KB9 E;  4KT0 J;  1VQM Z;  2IZ4 A;  1JJ2 Y;  2QKD A;  2ZAE B;  4H0L B;  3MZW B;  3CC7 P;  5A2Q b;  2WPR A;  1VQK 1;  1SQV J;  2QEX 1;  1MFT A;  3J81 b;  2IZ3 A;  2XDJ A;  4OWF A;  2Q7C A;  3A0B E;  3U50 C;  2PRR A;  2F4O A;  3G4S Z;  1WII A;  1OMI A;  3VMZ A;  1SQQ K;  3CCM Z;  1SQV E;  2NRG A;  3FWL A;  3U1A A;  2WPS A;  3FXD A;  4NPF X;  2Q6Q A;  1JNM A;  3UIA A;  2JMO A;  3CX5 H;  1PGP A;  3H1I J;  2GTH A;  1BDD A;  3P8C D;  1K8A 2;  2R7Z I;  1X3W A;  3H1K G;  2K9J B;  1M1J B;  3O6Q B;  5CJ0 A;  3TE5 B;  3B8E B;  1Z01 A;  3L75 G;  1LTB C;  3H1I E;  2FXP A;  2C9L Y;  3PTZ A;  3D2L A;  3F89 A;  4A7P A;  2E74 D;  3T4N B;  1JY3 P;  3CLQ A;  4PJ0 H;  2P10 A;  1SP4 A;  2E42 A;  3I56 P;  4JQ0 D;  3J81 f;  1Q86 2;  1KIL E;  2R5D A;  1KD1 Q;  2Q5U A;  3PHL A;  5KJ7 A;  4NBH A;  4BRY B;  3MZK B;  5D1P A;  3V2N A;  1R9T I;  1BCC E;  2O3J A;  3HD7 C;  2OTJ P;  4RES B;  1KQS Y;  4GOD A;  1GL2 B;  1X79 B;  2M0B A;  4PV1 D;  4Y7N I;  1T8Z A;  1D7M A;  3CX5 I;  2FBW C;  1EZV G;  1YIJ P;  1FC2 C;  3A7O A;  1SFC B;  4H44 C;  1JY2 P;  4RO0 A;  2ZYG A;  1JWH C;  1K8A 1;  3EER A;  3H1J J;  3GG2 A;  2P3Y A;  2EGT A;  2B87 A;  1R5S A;  2C9N Y;  1YJW 1;  2QVA A;  3CPW O;  2LEX A;  5AW3 B;  1ZB8 A;  1N73 B;  3H1K J;  3CC2 Z;  3H1J E;  2FYZ A;  4GOE A;  1NU1 D;  2K1A A;  4CPG A;  1LTT C;  3CME 1;  1Q86 1;  2E76 D;  1K9M 1;  5APW A;  4DOJ A;  1K05 A;  2CPB A;  2NPS B;  1URQ C;  4E31 A;  5FLM I;  1VQP 1;  1SQP K;  5KAI H;  4D6T D;  1KZU B;  1AQT A;  4WY4 D;  5M1B A;  2YMK A;  3M06 A;  2IPP A;  2A06 E;  1FZF A;  3N4X A;  2OGU A;  4XX2 A;  2V4H A;  3L70 J;  3S16 I;  3GF7 A;  1SFO I;  3OW2 O;  2QRD B;  3N7N A;  1LTI C;  1YJN 1;  1K8A Q;  2DW3 A;  3CCU Z;  1VQ8 P;  2FYU G;  3AEB C;  4EIJ A;  1TFI A;  3L70 E;  1VQL 1;  4W7Z A;  5APV A;  1Y47 A;  2E5Y A;  3LW5 J;  5DJT B;  2XKM A;  4A3K I;  1NTM K;  3CCQ 1;  2O4H A;  2L91 A;  5AVZ B;  1Q86 Q;  3CCJ Z;  1K9M Q;  3HE4 A;  4NFR A;  1MV8 A;  1N7S D;  4U3F E;  3AEG C;  2H8P D;  5H2F E;  1Y9B A;  4MH4 A;  1NH4 A;  1NTK D;  4I1L A;  1UIX A;  2FFD B;  2LFU A;  4O9B A;  3V4W A;  1S4X A;  4R4L A;  1USE A;  5GTH E;  2ZT9 D;  1P9N A;  3D9X A;  2PM9 A;  1CSB A;  1JTH A;  2BCC D;  2K37 A;  3H1L G;  3SFE C;  3CD6 1;  1Q82 2;  1BE3 E;  1Q7Y 2;  2NAP A;  1WZN A;  3AE5 C;  1S2E A;  3HTK B;  4TNU A;  1YIT 1;  5K5G B;  1L0N J;  2WMM A;  2JIR A;  3IFU A;  4NBG A;  1ZOY C;  1QLE D;  1WMK A;  2FYU J;  1L1O C;  2O01 H;  1VQM 1;  1ZRT E;  3S15 I;  1YHQ Z;  1L0N E;  2IFM A;  2IBZ D;  1S72 P;  4K35 A;  2KP8 A;  3CQZ I;  3CCS Z;  1CZQ A;  5AW4 B;  3W67 A;  1PGO A;  3CMA P;  4YXW H;  2N1T B;  3FQM A;  3A0B H;  4NOZ A;  4W80 A;  3TDH B;  1T2K C;  3G4S 1;  4ZKP A;  3GKQ A;  3CXH E;  3CXC Z;  1YBK A;  5E79 E;  5KJ7 D;  3P8M C;  3S17 I;  3CCM 1;  1FU1 A;  4EWC A;  4A3C I;  3L71 D;  2WQY C;  1OX3 A;  4JYB A;  1Q82 1;  1Q7Y 1;  1ZN5 A;  2E2J I;  2YKP A;  4NPD A;  4C7N A;  2ZXX A;  3Q1M A;  4R4M A;  3H1L J;  2F4M A;  2Q51 A;  1FZE A;  1KB9 I;  1DX7 A;  2KXP B;  1LT9 C;  4IFF A;  1OW7 A;  3NH4 A;  2PGD A;  1LP1 A;  1LTA C;  5AVS B;  1KYO D;  1IK9 A;  2I8D A;  1NGM B;  2QRE B;  3GMA A;  2VRS A;  2P58 A;  1YI2 Z;  3EFG A;  2NZ2 A;  4L73 A;  2YNY A;  1YJ9 P;  1Q16 A;  1PGJ A;  1SQB J;  1QX8 A;  2QJP C;  3I4N I;  5AW5 B;  3AE1 C;  3M91 A;  1SQV K;  4X6A I;  1BSN A;  3RK2 D;  1VF5 B;  1Q7Y Q;  1R8E A;  3CCR Z;  4MD8 A;  1AVO A;  3H6P A;  3L74 E;  3IAO A;  3RL0 B;  1FOS F;  3L75 D;  2JA5 I;  4RS4 A;  1KIL B;  1J1D C;  1M57 D;  3AE2 C;  4AUW A;  2M6N A;  1QVF O;  5AW7 B;  2I1J A;  1GMJ A;  2OYI C;  2OZK A;  1FZC C;  3CC2 1;  1U7J A;  1QXF A;  3TNU B;  2E74 C;  2NVQ I;  3TGU E;  3D6Z A;  1EXI A;  3HUS C;  3CC4 Z;  4A3J I;  3GTL I;  2JIP A;  3CXC Y;  3S1M I;  1MFZ A;  1RF0 C;  2I1K A;  4W7Y A;  2K9J A;  1M1J A;  1OVR A;  1MUU A;  3G71 Z;  2KI7 B;  5C44 I;  3M9H A;  3HOW I;  1EZV D;  2H89 C;  4AQR D;  1NO4 A;  1VQN Z;  2JWA A;  2Z5H A;  3CCU 1;  1OZH A;  1AVY A;  3MP7 B;  5KLV D;  4E2Z A;  2QA4 P;  1VDF A;  2PK7 A;  2YU9 I;  1X3Z A;  4ASV A;  4BRY A;  1IJD B;  2MKV A;  4DCK A;  3E1R A;  4IFM A;  4WWI A;  3CCE P;  3HD7 B;  1M56 D;  2V7Q J;  3AEC C;  4D6T G;  1GL2 A;  3FKI I;  1VQ6 Z;  5T64 A;  2JR6 A;  3LW5 H;  3L73 D;  5H2F H;  1SFC A;  2Z4E A;  1LJ2 A;  5CBN A;  1VQO P;  2CPS A;  2E76 C;  1Z03 A;  1Y1V I;  2PP6 A;  3L72 E;  3KZI E;  1NTM E;  3A0H H;  1M1K 2;  1I6H I;  3G9R A;  3JAM b;  1SQX G;  1UII A;  5GTH H;  1N73 A;  5TIS H;  4WY4 C;  1Y1V S;  2O1J A;  4OH8 B;  4BY1 I;  3NFQ A;  3KQG A;  3K7A I;  1U7M A;  1MZ9 A;  4MD9 A;  4A3L I;  2E9H A;  3L35 A;  3GTJ I;  3CCJ P;  4UB8 H;  1JMM A;  2A45 G;  1JCC A;  3Q2Y A;  1FE6 A;  2Q3I A;  1VQP Z;  2NPS A;  2W27 A;  3IR9 A;  4HGZ A;  4LLH A;  3MZL B;  1URQ B;  1NU1 J;  1OW6 A;  4Z1M H;  2VPX A;  5TJH A;  4PD4 D;  5C4X I;  1NTK G;  4YTP C;  3RGU A;  2OTL Z;  1YJN Z;  1W2B Z;  5AVW B;  1PP9 D;  1NU1 E;  1NTZ J;  2JA8 I;  1LQL A;  3CCS 1;  4D6T J;  2NVY I;  5CCG A;  2R93 I;  5KAF H;  2B89 A;  2BCC G;  1VQL Z;  2HFE D;  1N7S C;  1N8R Q;  2IZ1 A;  3F5H A;  1USP B;  1RE4 C;  3CXH H;  3JAM f;  5E79 H;  3I55 Z;  1NTZ E;  3VP9 A;  1NAF A;  1DL6 A;  1QVF Z;  1VQ7 P;  3TF5 A;  3GHG C;  4HGY A;  2HF1 A;  1YHQ P;  1SQQ D;  3IF4 A;  3M0D A;  2ZT9 C;  1ZR2 A;  1EDK A;  2KSE A;  2IBZ G;  1OW8 A;  1HJB A;  1VQ9 Z;  1RF1 B;  1KD1 2;  3MUD A;  3PO3 I;  3AEA C;  2M8R A;  2FFD A;  3WMM 0;  1ZXG A;  2LKM A;  1NKZ B;  2JP3 A;  2AXC A;  3PO3 S;  1HH0 A;  1L0N K;  2GA1 A;  3L71 G;  1ZME C;  2FYU K;  1NTK J;  1P84 D;  3P32 A;  1YI2 1;  2WSE J;  3HTK A;  3OA7 A;  5AW9 B;  1JEK A;  3ITK A;  4A3G I;  3CXH I;  1VQ5 P;  3JC2 2;  4ZKU A;  3VTP C;  1BGY D;  2AKL A;  1S5L X;  1DD4 A;  1VQ4 P;  4BY7 I;  2HLO A;  5KJ7 C;  1H8A A;  3CCR 1;  1N86 A;  5BVZ A;  3O8Z A;  3VMX A;  1G2C B;  2ITA A;  2N1T A;  3FQQ A;  4RJT A;  1KD1 1;  3TYY A;  2QJK B;  1A02 J;  3PLN A;  3CX5 D;  1HVV A;  1W2B Y;  1AV1 A;  3M4O I;  1Z56 A;  3HE5 A;  5CBO A;  1DEE G;  3AE8 C;  1J1E C;  1NOH A;  3EED A;  2OTK E;  2WSF H;  1NYH A;  2JIQ A;  2XZR A;  3CC4 1;  1VQK P;  2QEX P;  1SFC D;  3L71 J;  1M7L A;  3G71 1;  1QVF Y;  1EC5 A;  1YTZ T;  2M48 A;  1LT9 B;  1GZL A;  5A2Q f;  2OAR A;  4KJM A;  4BBR I;  1SQP D;  1EDL A;  5IP7 I;  4ZNC A;  3TK1 A;  3BRV B;  2Y0C A;  1LNQ A;  1VQN 1;  2HOD A;  2GM4 A;  1NAY A;  1ZR4 A;  3CCV Z;  3RK2 C;  1K9M 2;  1Q90 D;  1SQB K;  1QL1 A;  3PH0 A;  3WUT A;  1EDI A;  3KXD A;  2M5A B;  1IFD A;  2V8J A;  2BJO A;  5IP9 I;  1FS0 E;  2WSC J;  3FX0 A;  3L36 A;  2Y0S A;  1CI6 B;  3IF8 A;  2QJP B;  4B86 A;  2P1J A;  2IDB A;  4E2Y A;  1VQ6 1;  2HU9 A;  1FDO A;  3I4M I;  4XE5 B;  1WJ2 A;  2V7Q H;  4U7J A;  2RT9 A;  1RE3 A;  1KIL A;  5CCG D;  2RHB A;  3KZI H;  2OYH C;  2LXB A;  2QJY B;  3KPE A;  2JS4 A;  2IFN A;  1J1D B;  2LR2 A;  5KLV G;  3E1I A;  3D6Y A;  2VPY A;  2R5B A;  2XU6 A;  3AED C;  2OYI B;  1FZC B;  4GDO A;  1ML8 A;  2KPI A;  1W5C E;  3L75 J;  4JYC A;  2KK7 A;  1S7M A;  5BU8 B;  3H1K E;  4RV9 A;  3B5N A;  2LIY A;  2E74 B;  3VTN A;  1OVU A;  3HUS B;  3L75 E;  1LTS C;  3L73 G;  1HWT C;  3MD0 A;  4JBZ A;  1IC2 A;  2J58 A;  1YJW P;  3QWO C;  4RVH A;  1ZB9 A;  2XV5 A;  2ZJS E;  2OTL 1;  1AJY A;  2QLV B;  4A3D I;  2FYN C;  4M3L A;  3CME P;  3M0A A;  2YKO A;  3GTP I;  2WAQ A;  1PPJ D;  1SQX D;  2OQQ A;  3HKZ A;  3QWU A;  3I55 1;  2XNX A;  2ZVN B;  2WPV B;  1IK7 A;  1EZV E;  2ZYA A;  3VMH A;  1RH5 B;  1YJN P;  3BVH A;  2YO2 A;  1VQ9 1;  1N2F A;  1PP9 G;  3S4R A;  2KNC B;  2QR1 B;  2E76 B;  1VQL P;  1OVV A;  2HPC B;  1Y8C A;  3A0H E;  5D1O B;  5C4J I;  3W68 A;  3L73 J;  5TIS E;  3WU2 E;  1GK4 A;  3CCQ P;  1CW5 A;  1L0L D;  2A45 H;  2JA6 I;  2AXT H;  2WT7 B;  1JY3 O;  2KUB A;  4UB8 E;  1RNI A;  4XA4 A;  3H1H D;  3MIW A;  1KB9 D;  4E30 A;  1NU1 K;  2D2C D;  3KIF A;  1SQQ G;  2E43 A;  3RK3 C;  4BWN A;  2C0W A;  2W8Z A;  2E75 D;  2W6A A;  1NTZ K;  2KZI A;  2WSE H;  5AVU B;  5FLX b;  2YXR B;  1YTZ I;  1KC8 2;  4A3M I;  2FYU E;  3TSI A;  2Q9I A;  1LWU C;  2QM8 A;  1ZV8 A;  1SVF A;  3CD6 P;  4H13 D;  1I50 I;  3BG1 B;  1DD3 A;  3D70 A;  3V4Q A;  1KFN A;  5KAF E;  5T67 A;  3CI9 A;  2NVX I;  1YIT P;  1JY2 O;  1USP A;  1N7S B;  1L2P A;  2JWD A;  2V3V A;  4ZMD A;  1S9K D;  1PP9 J;  1VQM P;  3G6E Z;  3CPW Z;  3LIE A;  4PD4 E;  1G1J A;  3LID A;  2AEJ A;  3GHG B;  1BGY G;  3S9O A;  3T97 A;  2OYO A;  1VF5 D;  1HUC A;  2ZT9 B;  4N78 E;  3S1K A;  3NDJ A;  1G1I A;  1RF1 A;  3RL0 D;  4HKZ H;  1XTC C;  3RK3 E;  3G4S P;  3M9B A;  1S5L H;  1JMB A;  1RY3 A;  1KIL D;  1SQQ J;  5FLX f;  3CCM P;  1NTK K;  3H1L E;  1KC8 1;  3EWK A;  1BCC D;  2VUG A;  3OW2 Z;  3U59 A;  3CCV 1;  2B63 I;  1YYC A;  3GTO I;  2RKL A;  1KMI Z;  3RZD I;  3B5N D;  2KLV A;  1N2D C;  3V2R A;  4ASW A;  3CC7 Z;  1ZLL A;  1AA6 A;  5IT9 b;  1L4A B;  1LTJ C;  3GCF A;  2WSC H;  1SQB E;  1KYO H;  4HJG H;  3V2P A;  2FXM A;  1SQP G;  3CCL 1;  1G2C A;  3H1J D;  2YXQ B;  1KRL A;  4Y52 I;  1JM0 A;  3BCC G;  4NH1 C;  2PAJ A;  2WSF J; 
#chains in the Genus database with same CATH homology
 2JA8 I;  1LQL A;  3CCS 1;  4A3F I;  2NVY I;  3T4N B;  4A3I I;  1NP6 A;  2R93 I;  3F3P C;  2B89 A;  1VQL Z;  3VMG A;  4A93 I;  1USP B;  3JAM f;  4HB1 A;  3J81 f;  1Q86 2;  3I55 Z;  3J80 b;  1WCM I;  1S72 1;  1QVG Z;  1DL6 A;  1QVF Z;  4NBH A;  3MZK B;  4QTT A;  5D1P A;  3CMA 1;  4HGY A;  2HF1 A;  1YUA A;  5EFW B;  1R9T I;  5IT9 f;  1KQS Y;  1X0T A;  3CPW Y;  4GOD A;  4HH4 A;  1EDK A;  1N8R 2;  2KZJ A;  3I56 Z;  4DQY B;  2M0B A;  2OOY B;  1ZH1 A;  1VQ9 Z;  4Y7N I;  1S3J A;  1KD1 2;  3S1Q I;  1FC2 C;  2Q4Z A;  3PO3 I;  1VQ7 Z;  1JWH C;  1K8A 1;  1Z02 A;  3EER A;  1ZXG A;  1YUK A;  3S14 I;  2G2K A;  2P3Y A;  3S2D I;  2EGT A;  2B87 A;  3PO3 S;  1YJW 1;  2QVA A;  1ZB8 A;  1K83 I;  4E32 A;  3CC2 Z;  3Q87 A;  1YIJ Z;  4BBS I;  1Q81 2;  1YI2 1;  1Y1W I;  3S1R I;  4GOE A;  4CL1 A;  2P28 A;  1TWH I;  4A3G I;  2VUM I;  4CPG A;  3OW2 Y;  5T6B A;  3J80 f;  3CME 1;  1Q86 1;  2W04 A;  1K9M 1;  3NH8 A;  3D6W A;  2E2I I;  2OOX B;  2AKL A;  1SS1 A;  4E31 A;  5FLM I;  1VQP 1;  4BY7 I;  1NJI 2;  3CCR 1;  2LXC B;  1N8R 1;  4XX2 A;  1VQ5 Z;  1YJ9 1;  3S16 I;  4RVF A;  1SFO I;  3FQQ A;  1TWF I;  1KD1 1;  2O53 A;  2QRD B;  4DGL A;  1YJN 1;  4MN4 C;  3CCU Z;  1VQ4 Z;  1WW9 A;  4IOI H;  1TFI A;  1W2B Y;  3M4O I;  5CBO A;  4RVG A;  1DEE G;  1VQL 1;  3EED A;  2OTK E;  1Y47 A;  5DJT B;  3NH5 A;  4A3K I;  1Q81 1;  3CCQ 1;  3CC4 1;  2K5R A;  2O4H A;  1Q2N A;  3H0G I;  1VQ8 Z;  3CCJ Z;  4MON A;  2J6A A;  4NFR A;  4K3A A;  1QVG Y;  3NDI A;  3G71 1;  3M3Y I;  1QVF Y;  1EC5 A;  1PFT A;  2DE6 A;  2DE7 A;  2M48 A;  4NBD A;  4MH4 A;  5A2Q f;  4KJM A;  4BBR I;  1EDL A;  1NJI 1;  1TWG I;  2H85 A;  5IP7 I;  4ZNC A;  2E2H I;  3IX0 A;  2LFU A;  1VQK Z;  1VQN 1;  2QEX Z;  1H0T A;  3CCV Z;  3ESW A;  1K9M 2;  3MHV A;  2B87 B;  1P9N A;  3PH0 A;  3D9X A;  5C3E I;  1EDI A;  3G6E 1;  2PM9 A;  2M5A B;  3CD6 1;  1Q82 2;  2V8J A;  2BJO A;  5IP9 I;  3HOZ I;  1Q7Y 2;  2Y0S A;  3IF8 A;  4MD7 A;  4S1T A;  4BXX I;  4TNU A;  4NBA A;  1YIT 1;  5K5G B;  2WMM A;  3IFU A;  4NBG A;  3KIH A;  4E2Y A;  1VQ6 1;  2HU9 A;  3HOU I;  3I4M I;  2VF1 A;  1L1O C;  2QA4 1;  3RZO I;  1VQM 1;  3S15 I;  1RO0 A;  2GTI A;  3FXE A;  1YHQ Z;  2RT9 A;  2V8K A;  2UWJ E;  2OTJ Z;  3CCE 1;  4K35 A;  3CQZ I;  2RHB A;  1RQF A;  2W03 A;  2LXB A;  2JS4 A;  5DJU B;  3CCS Z;  1RLY A;  5CM2 M;  2LR2 A;  1TWA I;  2M5A A;  4BXL A;  2I3C A;  1VQ5 1;  4NPE A;  3FQM A;  2B88 A;  4MXU A;  4NOZ A;  4QTU A;  3TDH B;  3G4S 1;  1ML8 A;  1EDJ A;  2KPI A;  3VMI A;  3GKQ A;  4A3E I;  3CXC Z;  1S7M A;  1VQO 1;  3P5J B;  3S17 I;  2RBL A;  3CCM 1;  1S72 Z;  4EWC A;  4RV9 A;  4A3C I;  1M90 2;  1LP1 B;  3CC7 1;  2LIY A;  4NB8 A;  3VTN A;  3CMA Z;  1K73 2;  1OVU A;  1Q82 1;  1ZW0 A;  1Q7Y 1;  3GTM I;  4JBZ A;  2E2J I;  5C39 A;  2KS1 B;  3J7A 4;  3QWO C;  4NPD A;  4RVH A;  1I3Q I;  1ZB9 A;  3CCJ 1;  2F4M A;  2Q51 A;  2YAD A;  3GTM S;  2OTL 1;  2R92 I;  2QLV B;  4A3D I;  1BDC A;  1TWC I;  3NH4 A;  3GTP I;  2WAQ A;  2GU2 A;  3I07 A;  3HOY I;  1LP1 A;  2KIK A;  1YJW Z;  2JNY A;  2I8D A;  1H0T B;  2QRE B;  3HKZ A;  3QWU A;  3I55 1;  2P58 A;  1YI2 Z;  1NUI A;  1JJ2 Z;  3CME Z;  3VMH A;  3F3F C;  3I4N I;  1M90 1;  1QYP A;  2RIQ A;  1K73 1;  3I56 1;  4X6A I;  1VQ9 1;  4RVD A;  1N2F A;  3CCR Z;  4NBC A;  4MD8 A;  3BG0 B;  2QR1 B;  1OVV A;  3NFZ A;  1VQ7 1;  1YJ9 Z;  2K3R A;  2JA5 I;  4RS4 A;  5D1O B;  5C4J I;  1YHQ 1;  2OTJ 1;  3LUS A;  2M6N A;  2JA6 I;  3MON A;  2OZK A;  2KUB A;  3VB9 A;  1RNI A;  2SPZ A;  3CC2 1;  1U7J A;  3H3V J;  1YIJ 1;  4E30 A;  3HOX I;  3KIF A;  4E2X A;  3GTQ I;  1M1K 1;  2R6M A;  4NBB A;  4EYY Q;  2NVQ I;  2WB1 A;  3CCQ Z;  3CC4 Z;  4MRI A;  3S1N I;  4A3J I;  2JA7 I;  3GTL I;  3CXC Y;  3S1M I;  2KZI A;  3S2H I;  3CCL Z;  1OVR A;  5D1O A;  1RO2 A;  3G71 Z;  5FLX b;  2KI7 B;  4A3M I;  5C44 I;  1KC8 2;  2HR3 A;  3HOW I;  2Q1K A;  4AYB A;  1I50 I;  3BG1 B;  4NB9 A;  4E33 A;  5T67 A;  1QF8 A;  2NVX I;  1VQN Z;  2NVT I;  4DK1 A;  3GTG I;  1USP A;  3CCU 1;  4GOF A;  1VQ4 1;  5AN9 F;  2JWD A;  2RPR A;  4E2Z A;  4ZMD A;  2PK7 A;  3G6E Z;  2YU9 I;  3CPW Z;  1X3Z A;  1KQS Z;  4ASV A;  3CD6 Z;  2R44 A;  3GTK I;  4WWI A;  2JUB A;  1VLA A;  1YIT Z;  3ZDM A;  3S1K A;  5LL6 f;  3NDJ A;  2DE5 A;  4E2W A;  1VQ8 1;  4A3B I;  3FKI I;  2PMZ A;  1VQ6 Z;  4HKZ H;  5T64 A;  2JR6 A;  2QA4 Z;  1LT1 A;  1VQM Z;  2IZ4 A;  1JJ2 Y;  3PO2 I;  1JMB A;  4NBF A;  5CBN A;  2QKD A;  2ZAE B;  2QRX A;  1RO4 A;  5FLX f;  2V8I A;  3CCE Z;  3MZW B;  1Z03 A;  5A2Q b;  1Y1V I;  1KC8 1;  1VQK 1;  1M1K 2;  1I6H I;  2QEX 1;  2VUG A;  3JAM b;  1MFT A;  3J81 b;  3OW2 Z;  2IZ3 A;  3CCV 1;  3U50 C;  2F4O A;  3G4S Z;  2B63 I;  1WII A;  1Y1V S;  4BY1 I;  1VQO Z;  3K7A I;  2RKL A;  3GTO I;  1U7M A;  3RZD I;  4MD9 A;  4A3L I;  2E9H A;  4NBE A;  3CCM Z;  3GTJ I;  4ASW A;  2QRC B;  3CC7 Z;  5IT9 b;  3HOV I;  3FXD A;  3GCF A;  4NPF X;  1VQP Z;  2JMO A;  4HGZ A;  3MZL B;  1NVO A;  2GTH A;  1BDD A;  1K8A 2;  2R7Z I;  4HJG H;  1X3W A;  5C4X I;  3CCL 1;  1KRL A;  3TE5 B;  4Y52 I;  1JM0 A;  3RGU A;  2OTL Z;  1Z01 A;  1YJN Z;  1W2B Z;  4NH1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...