1X0TA

Crystal structure of ribonuclease p protein ph1601p from pyrococcus horikoshii ot3
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
IVKRRDWEKKEKKKIAIERIDTLFTLAERVARYSPDLAKRYVELALEIQKKAKVKIPRKWKRRYCKRCHTFLIPGVNARVRLRTKRMPHVVITCLECGYIMRYPYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Ribonuclease P Protein Ph1601p from Pyrococcus horikoshii OT3: An Archaeal Homologue of Human Nuclear Ribonuclease P Protein Rpp21(,)
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 4
total genus 33
structure length 106
sequence length 106
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2005-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1x0tA01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1x0tA02
1EDIA 5EFWB 3RGUA 1LP1A 4GOEA 2I8DA 1U7JA 4NPFX 4IOIH 2M5AB 4JBZA 2KIKA 2B89A 1S3JA 2K3RA 2M5AA 1H0TA 2LR2A 4HJGH 4HKZH 2KI7B 1LP1B 4CPGA 1EDKA 2B87A 2B87B 4HB1A 4ASWA 3ZDMA 4BXLA 4GOFA 5K5GB 4EYYQ 2KZIA 1H0TB 1EDJA 1EC5A 2P58A 4ZMDA 4NPDA 3MZWB 1OVUA 5C39A 3PH0A 2M0BA 2QVAA 1X0TA 2Q1KA 2LXBA 2R44A 4WWIA 2KUBA 2RKLA 2ZAEB 5DJUB 3FXDA 1BDCA 1Q2NA 1Y47A 1SS1A 1U7MA 4MN4C 2LXCB 2OTKE 4KJMA 1ZXGA 1DEEG 1BDDA 1NVOA 5CBNA 2KS1B 1MFTA 1FC2C 2JWDA 1OVVA 3FXEA 1OVRA 3QWOC 1ZW0A 3S1KA 4ZNCA 2KZJA 1JMBA 2SPZA 1JM0A 2B88A 2HR3A 4GODA 1EDLA 4K35A 5CBOA 5DJTB 2WMMA 2QRXA 4ASVA 4K3AA 4NPEA 2UWJE 3MHVA 1LT1A
chains in the Genus database with same CATH superfamily
2QJKC 1LQLA 1L4AA 4WY4D 2JP3A 3CMA1 3BASA 1EZVD 1NTZJ 1VQ4P 2XV5A 4NBHA 1PGOA 1VQNP 1VQPP 1YIJ1 2K3RA 2V3VA 3LUSA 1YJ91 1PP9E 2WPVB 3V2RA 1FDOA 2WPQA 3L74D 2FYUE 2YMYA 2M3BA 2AKLA 1RF0C 3GTMS 2YKOA 2YXQB 3CC2P 1OFCX 3JAMf 2ZT9B 1OWAA 5T64A 3WMM0 3TNUA 3G6E1 4BWNA 3IR9A 1Q90D 3CPWZ 2FKWB 3G711 2IBZD 1N8RQ 1PGJA 1KD12 2Q1KA 3L70G 2JIRA 1LT9C 1RY3A 2FYNB 2KUBA 2RKLA 1DH3A 1KTMA 5TISE 5KLVK 1OMIA 4WBAA 3RL0C 4WB4A 1HUCA 1SQBG 3J81f 3J7A4 2Y0DA 1YJ9Z 1FBMA 3CX5E 3USSA 5FLMI 2W03A 5B5EH 4RESB 1AVYA 1Q16A 2Y0CA 3HUSC 5CCGA 2V8IA 3CXHH 1JY2P 4NBDA 4YPCA 1LTAC 2KLVA 3V4QA 1VQOP 1L0LK 4AUWA 1NU1D 2VPWA 1N7SB 2QRXA 4E30A 1S7MA 3K5BA 3CCM1 1JCCA 1JY3P 1KFNA 1NJIQ 4H44C 4ZKUA 2GU2A 1SFCC 3S15I 2WSSH 1YQ4C 1K9M2 5AVZB 3NXSA 2V7QH 3G4S1 2DE7A 1AQTA 4CPGA 1IFNA 4MONA 5AW4B 5AVYB 1USDA 1URQB 3CC71 2EGTA 5TISH 5CJ0A 1Q82Q 2C0XA 2VRSA 2QG4A 3S2DI 1PFIA 3CCEZ 2Q3IA 2R3CA 2LKMA 1AFOA 2IZ4A 2WITA 2ZYDA 1FDMA 1PGPA 4JQ0D 1R5SA 4N3YB 1N73A 2OOYB 2H7HA 3MD0A 4PV1D 3TYYA 2R93I 1GK6A 2AXCA 2R6MA 5AVVB 1AJYA 4EOTA 3BATA 5AVUB 1QL2A 1RE3A 2KP8A 2YADA 4H13D 1LTGC 3CCMZ 1BE3E 2JR6A 4DQYB 1SS1A 1GW4A 3R4YA 1SFCA 3QWUA 2G2KA 2V4HA 2N1TD 4Y52I 1PFTA 2GA1A 3CCQ1 2JWDA 3S17I 5BU5A 4WY4C 1IFIA 1NO4A 2YIUC 2ZXXA 1JTHA 2Y9YA 1LNQA 2KZJA 3B5ND 1NTMK 1N7SA 3BG1B 3JC22 2FYUD 1NTKJ 2QJYC 5AW8B 3LIDA 3SFEC 2WWWA 4EDFA 3D70A 1NOHA 3PO3I 1N2FA 2NZ2A 5EFWB 1NTKD 5E79E 5APTA 3H1HE 1JUNA 2R32A 5GTIE 2IV2X 5KTBA 3A0BE 4U7JA 1Q7Y1 1PP9D 3G3ZA 1ZN5A 2ZVOB 4HKZH 2ITAA 2KI7B 3NH8A 3HOWI 3S1RI 3CCLP 3TGUD 3CCQZ 1T2KD 3CC7Z 3CC7P 1VQN1 3JCUE 3CXHE 1K05A 2RMZA 2RHBA 4Z1MH 1ZP0C 4L74A 1ML8A 2H89C 2VF1A 1OX3A 1DEBA 3H1KD 2FBWC 2WAQA 1W2BZ 4IFDK 4A3II 1OVUA 1SQBE 1RH5B 2E74C 1YTZI 1K8AQ 2AEMA 3TF5A 3PTZA 1S9KE 4HH4A 3RK3D 2Z5HA 1I3QI 3H1LD 3FXDA 5BVZA 4Y99B 3TSIA 1TWCI 1NJI2 3CMEP 1VQ8Z 2WB1A 1M1K2 3CCVZ 1A02F 1U7MA 1GK4A 1FZGA 2KPIA 4RO0A 2LEXA 1VQ9P 3S4RA 1BCCJ 2DW3A 2FXMA 1KQSO 2NPSB 3A2AA 3D6WA 1RO0A 2NPSC 1I6HI 3WUVA 5D1OA 2HPCA 2YO3A 3CC4Z 4YXWH 3OW2Z 4I1LA 4BRYA 3GKQA 1FZEA 1UIXA 1G2CB 3B5NB 2R92I 2WSEJ 1WCMI 1AA6A 1NU1J 2B88A 3VYIA 3CCEP 3IAOA 3IX0A 1VQ7P 3GF7A 1ZOYC 2JIOA 1XTCC 1XTGB 2O1JA 2E5TA 3L75J 4QTTA 1SQQK 4LC1A 1RQFA 1R5LA 1K8A2 1P84D 4YTPC 3K7AI 1IFPA 1IZNB 5TJHA 1MUUA 3MIWA 1QVFZ 1HTLC 4A3EI 3L75E 3I4MI 3P7KA 3OAKA 3AEBC 2JS4A 1M1KQ 1OXZA 2HLOA 2K5RA 4WVZA 5KLIC 4NBGA 3HOUI 1KQGB 2M8RA 5AW5B 1GZLA 3FWNA 1LWUC 2HFED 3VTPC 2F4OA 2IDBA 1L0NG 2M48A 2Z5IA 1Y1WI 3RZOI 3M0AA 1JMMA 5CM2M 1M8OB 4JYBA 2OTL1 2W27A 1Q861 3GTKI 1USEA 2O01N 4A3GI 3WU2H 1L0NK 2ZAEB 1SQXG 3RK3E 2K9JA 1Y47A 1N8R2 1N86A 3H1JD 4L75A 2YIUB 1Q7Y2 3CPWY 3FGAD 3I5CA 1R9TI 4I2LC 2E43A 2J58A 3MZLB 2I1JA 3GHGB 2KOGA 1VQ5Z 3KZIH 1FS0E 1NH4A 1GDTA 3FXEA 1WJ2A 3L72J 2IZ3A 5CCHD 3H0GI 3JAMb 5GTHH 1JEKA 3JSVC 1NTMG 4BXXI 1NTZE 3TGUJ 5AN9F 3KPEA 3B71A 4A7PA 5CBOA 1T3UA 2E42A 3IFUA 2MKVA 1NHLA 1JY2N 1PP9J 1RQUA 1LTSC 1LT1A 3CCJ1 1JTHB 1H8AA 5CJ4A 3VP9A 1I50I 1S4XA 1W5CE 2JMOA 4IOIH 2JWAA 5GTHE 3FWLA 1R8EA 4HJGH 2IBZG 4PJ0H 2RBLA 2OYHA 3Q87A 1FJKA 1LP1B 1LWUA 3L73D 1ZLLA 1BGYG 4E32A 4IFMA 1EDKA 4R4MA 3L71E 2NVTI 1Y9BA 2E74D 3Q5PA 2E9HA 2PK7A 2W83C 3CCRZ 3NH5A 1JCDA 1SQPG 1L0LD 1WT6A 1FZBA 2H8PD 4H13C 2VUMI 4QTUA 2QRCB 2BASA 3TDKA 2CK3H 1M1JB 4ZMDA 1L1OC 3I551 1NTKG 3CXHD 1EQ7A 4H44B 1N73B 3MTUE 5FLXf 2Q3EA 3OJAB 3CCRP 3MUDC 1S9KD 2N1TC 2VPZA 4BBRI 2WSCJ 5AW2B 1RE3C 4RVHA 1RLYA 4IFFA 3M06A 1X22A 1WMKA 2QEXZ 3E1IA 1CI6A 2E76C 1N73C 3H1JG 3H1JE 1NVOA 1M1JC 3KXDA 1H88A 4DZOA 1EZVE 1S72Z 1OVVA 3AE2C 4BBSI 3L70E 2ZJSE 1SFOI 2XZRA 5L8RJ 2GTIA 2W6BA 3RBXA 3E7KA 2JJLA 2YO2A 1NTZD 3GTLI 4D6TG 1SQVD 3Q5RA 3CCSZ 1VDFA 2G3AA 5A2Qf 4ASVA 4K3AA 3BVHA 4OWFA 5CCHA 1SQPE 2OYOA 1JY2O 3VMXA 3H1KJ 4IL6E 1Y8AA 2I3CA 3H1HG 5KJ7C 3L74G 2QRDB 3H1LG 2KLUA 1KD1Q 2KIKA 1BCCG 2K1AA 1VQLZ 3G71P 2IBZE 2BEZF 2HF1A 1RF1B 5KAIE 4E2XA 2BCCD 3HOXI 3NDJA 1NTKK 1K9M1 1L0NE 1KILD 2B9BA 5AW7B 3SSUA 3G9RA 2OTJP 5APUA 1K732 2WPRA 1S5LX 2QREB 3I55Z 3KQGA 2IFMA 3CCS1 5KAIH 2W6JH 3PP5A 4PD4D 3GW6A 5KAFH 2YKPA 4OH8B 3KYQA 1K04A 1VF5B 3H6PA 3VMHA 1BDCA 2K9YA 4DOJA 2QA4P 4A3BI 3L4FA 2E5YA 3J80f 4NBAA 4RVFA 1K83I 1CSBA 1GTWA 3H1LE 2KK7A 2IPPA 2NPSA 1NU1K 3H1IE 1YIJZ 2A45I 2HU9A 1T6AA 1EZVI 1L4AB 4W7ZA 3GG2A 4A93I 1FOSF 1URQA 1LGHB 1RHZB 1ZRTE 2O01J 1VPCA 3L74J 2SPZA 2ZT9D 3H1HJ 1YHQ1 2P3YA 3L71D 2MJZA 1D7MA 1NU1G 4TNUA 3H1IJ 3QH9A 1JWHC 1QVGY 4W80A 2BEQD 2IYOA 1IJDB 2M6NA 1IO4A 1PPJD 2E75B 1YJN1 2I8DA 1KC8Q 1RF1A 1U7JA 1A02J 3TE5B 1BE3D 1NTKE 3S9OA 3CMEZ 1VLAA 3C1LA 3C8VA 2O53A 2JIMA 2E75C 3O6QA 1KZUB 1JOCA 2QEX1 3B8EB 3NMDA 3B5NC 3ITKA 4H0LD 2IBZI 2JR8A 3CCUP 3CCUZ 2R7ZI 2OYIA 1HJBA 2XKMA 1KILE 4JPZB 3CLQA 2FFDC 1JJ2Y 3AEEC 1AVOA 1YI2Z 3AEGC 1FJPA 1YJWP 1YJWZ 3H32A 2JA6I 1HGVA 3BCCD 3AECC 4QMAA 1KILA 4Y99C 1YUAA 2QVAA 4EIJA 4JF7A 3PO2I 1CW5A 1HJ0A 2R44A 2WVRA 5DJUB 3RZDI 3RK2D 5AVRB 1BGYE 4PD4E 5CCHC 1SQQG 4MN4C 1FDIA 4E2YA 1VF5C 2M3EA 1SQBJ 1T2KC 1QLED 1NU1E 3V5BA 3HD7C 3U1CA 1VQLP 2XU6A 2PMZA 1M1K1 3CCL1 3L73J 3H1ID 1KV4A 1Z03A 1X3WA 3L70D 4GODA 2VPYA 4PV1B 5AW9B 4RS4A 1NKZB 3AE4C 2WMMA 1X8YA 3VP8A 1NTME 5IT9b 5KLVG 3PO3S 3U59A 2P28A 1RF0A 3BCCJ 4ZKPA 4NBEA 3HOZI 3I56Z 3KHUA 1RF1C 3AE3C 1GU4A 1VQKZ 4A3KI 3MUDA 3C9IA 2XDJA 5AVSB 4E31A 2NPSD 2QJYB 2GUSA 3CME1 3L72G 2YMKA 3VMAA 3Q1MA 2H85A 1ZR2A 1S5LH 1KYOD 4N78D 1L0ND 4C7NB 5K5GB 4E2ZA 2KZIA 5D1OB 1GL2D 4U3FJ 2RIQA 3G4SZ 1GMJA 1Y8CA 4L73A 3KZIE 2V45A 2NRGA 2P2UA 1YI21 3MZWB 1YJW1 1G1IA 3FQMA 1AQ5A 4NFRA 1IC2A 1S72P 4RV9A 3CWBE 3CC2Z 3CWBD 1VQ5P 1QVGO 3FX0A 1QEXA 2DE6A 2BCCJ 1VQ71 2E76B 2N9YB 3TDHB 4UB6E 2OZKA 2JIPA 1SQQD 2V8KA 3CCSP 1UIIA 3PLNA 1VQ9Z 1BGYD 3CWBJ 4PD4I 1DX7A 2N1TB 1VQ8P 4DT0A 4EWCA 1Y1VI 1USPA 3M0DA 1KYOH 1ZRTD 3M9QA 5APYA 3CMAP 3S1NI 3N4XA 3L37A 5M1BA 3AE5C 1JMBA 5B66E 5B5EE 5CMZA 4N6JA 1L0LE 2JDIH 3MP7B 3RBZA 1HVVA 4H44D 1EDIA 5KLVJ 2YU9I 5AW1B 1KB9I 3GTPI 3L71J 1JJ2Z 4GOEA 2HG5D 5KJ7A 3VMYA 1SQVK 2Y0EA 3VMIA 1S3JA 2WTYA 2H88C 1JB0J 4C7NA 1FAVA 3TK1A 4H0LB 3S1MI 2AXTH 5IP9I 2PGDA 1VQ41 1VQKP 1OW7A 3HUSB 3CPWO 1LTJB 4I7ZB 4NB8A 3HOVI 1TWGI 3NDIA 1KFMA 3ABVC 2QA4Z 4D6TD 3HE5B 2QEXP 1WIIA 1CZQA 1M1JA 2W90A 1TWFI 1SQBK 4EI2A 2AYDA 1K73Q 5CHXA 2QR1B 3CC21 1LT9B 3M9BA 4WWIA 3VOPA 2JNYA 3D71A 3CD6P 4DCKA 1NTZK 1EZVG 1PGQA 2A45G 2O1KA 1YITZ 2ZT9C 2KYVA 1QX8A 4U3FD 2FXOA 4LGDE 1L2PA 1ZW0A 1WW9A 1NTZG 4MD9A 1BCCD 1VQ4Z 3CCMP 4AYBA 1M90Q 2FYZA 5CCGD 3VN0A 1YI2P 2YXRB 4A3CI 1SQXJ 2HODA 1LWUB 4NBFA 2OGUA 1PV3A 2AEFA 4A3FI 2K37A 3HUSA 5LL6f 2IZ1A 1VQ6P 4TLFA 1S2EA 1SQXE 2WT7A 3CX5I 4UB8E 3JCUH 3EERA 3U1AA 5FLXb 1L0NJ 1QGKB 2OYIB 1PZQA 3FKII 3T97A 1Q7YQ 3EQ2A 2ZYGA 3H1KE 1Y1VS 3HRNA 4R4LA 2J6AA 3EWKA 1M901 2A06D 4ASWA 3A0HE 4BXLA 4GOFA 1H0TB 1YQ3C 2O4HA 3A0HH 3I07A 1VQM1 1KQFB 2W6AA 1J2JB 1KQSZ 4RVDA 4NPDA 3GLMA 3HOYI 5AVWB 5KJ7D 2FFDB 2CPSA 2JO1A 2N1TA 3RK2B 1VF5D 2QLVB 3I56P 2WSEH 3D6YA 2L5GB 1BE3G 1NYHA 5A2Qb 4LLHA 1S1CX 2G8YA 1GW3A 3RL0D 1ZXGA 1DEEG 1MFTA 4YXDC 1RO2A 1FC2C 1BSNA 2E74B 1SQVG 2A06E 3QWOC 1OVRA 4U3FG 1E5WA 5GTIH 1ZV8A 1RO4A 4I6MC 1HBWA 3M3YI 4OGQB 1Q812 2QIWA 1SP4A 1SVFA 4D6TE 1P84E 3H1LJ 4IL6X 2PRRA 1VQMZ 2Q51A 3BRVB 3CX5H 3CC4P 2POHA 3MHVA 1Q862 2B63I 3LW5J 1L4AC 3S1QI 3H3VJ 1OW8A 3L74E 3GTMI 3SWKA 2FXPA 1WZNA 3EFGA 3T4NB 4NB9A 4KT0J 2PP6A 5C44I 3H1HD 1KB9H 4JYCA 2B87B 3IFMA 3VMZA 4C46A 5B66H 1P84I 4HYTB 3WUTA 4AYCA 3D9XA 3PRJA 3L73G 4HH2A 2D2CC 4UB8H 1LTBC 2ZVNB 5AVQB 3M4OI 5KAFE 4A3JI 3S2HI 3CCV1 2AEJA 1VQ61 4WY4B 2AXTE 3PH0A 2O3JA 3GTGI 1GD2E 3GHGA 4PD4H 1Q821 2JEEA 4DJGA 3CL3D 3L36A 2E75D 5KKZC 3SWYA 4RVGA 3R2PA 1FU1A 4GDOA 3H25A 3A5TA 1PPJE 1NAYA 2J5UA 3F89A 4GIFA 1KILB 3AEAC 2P67A 2KNCB 1BGYJ 3H32B 5KKZB 1VQMP 3HTKA 1X9VA 3P8MC 2E2HI 2PFXA 1KYOE 1Q86Q 3M9HA 1DIPA 2HYNA 1BCCE 1LJ2A 3L75D 1ZH1A 3NH4A 5AVXB 4HGYA 3Q3DA 1URQC 3L75G 3CC41 3L73E 1QVFO 1SIWA 2N9BA 4OVNF 3OW2O 2K88A 4UB6H 3IN6A 4XX2A 3MGNA 4WY4A 2KNCA 3EEDA 1J1EB 1QYPA 3F5HA 3SFDC 3CCE1 1KORA 2WSFJ 3A7OA 3KIHA 3CQZI 1FZFA 1SFCB 5APQA 2B87A 1JNMA 1KYOI 1N7SC 5BU8B 4EYYQ 3HD7A 1EC5A 1MKMA 2JA7I 2BCCE 3CXHI 3CCVP 2WZ7A 2IX7C 5T6BA 1VQ6Z 5C39A 4H13B 1ZB8A 1HF9A 1K9MQ 2YNYA 3P8CD 3RK3C 4X6AI 3B4SA 1IFMA 3BCCG 1YYCA 2E76D 5IT9f 5APVA 1KC82 2VUGA 5H2FE 5CCGC 2FYNC 1ZR4A 1M57D 3HE5A 3MZKB 1RNIA 2V7QJ 3BRTB 2IZ0A 1NP6A 4Y28J 1L0LJ 1GL2C 1EXJA 2YKQA 2FYUG 2Q9IA 4DGLA 3M0DC 2E2JI 5AW6B 1L4AD 3LIEA 1YTZT 5KLVE 3GTJI 3G6EP 3V2QA 3ESWA 2C0WA 1EDLA 3Q2YA 1IK9A 1N2DC 2RN0A 1Z56A 2OYHC 1AA0A 2QJPC 5AW0B 3TGUE 2FYUJ 4NH1C 2I1KA 2R5BA 2M5AB 3H1KG 2J59M 3U50C 4JBZA 4GT1A 2CPBA 2M5AA 1YITP 2QSIA 3WUUA 1TWHI 3GHGC 2KXPB 1IK7A 3II6A 3CCJP 2OQQA 1DD4A 2QJKB 2K9JB 2NVXI 2R5DA 2ZXEB 2V8JA 1M56D 1KRLA 2OYIC 1USPB 4XE5B 1OW6A 2Z4EA 3L72D 3AE8C 4M3LA 4OGQD 3AE1C 4XA4A 3GMAA 1FZCC 1VQ81 1LTTC 2OTLP 3CMAZ 2NVYI 1QVFY 1RQVA 3KIFA 1MZ9A 1HH0A 3H1JJ 1NGMB 3CX5D 3G4SP 3CWBG 1FE6A 3E1RA 1IFJA 4NOZA 2QKDA 2WQYC 1SLQA 2Q7CA 1SQVJ 1CI6B 2FYUK 5KLIB 2BCCG 3O6QB 1SFCD 2OTKE 4KJMA 1VQNZ 1JY3O 4A3LI 3TNUB 1JY3N 1FZCB 1M7LA 2OTJZ 2F4MA 3F3FC 2QM7A 2FY8A 1SQVE 2A06G 3L35A 4HGZA 1SQPJ 4MD7A 5AW3B 1KMIZ 1JM0A 2GM4A 5KLVD 1YHQP 3PHLA 1KN7A 3D2LA 3L70J 1Q81Q 3S16I 3VMGA 4RKUJ 1MFZA 1G2CA 3B5NA 3CCLZ 2JA8I 1N7SD 1LP1A 1W2EA 1TU3F 3CI9A 4BRYB 2QJPB 1IFDA 2OYHB 3N7NA 1VQOZ 2O01H 1YBKA 3V2NA 3V4WA 3VTNA 1PP9G 1OZHA 2LR2A 3O8ZA 3RL0g 1GU5A 4A3MI 3GF3A 1W2BY 1LTJC 4I7ZC 2C9NY 1J1DB 4CL1A 2A45H 3J81b 4H0LC 2R3SA 4HB1A 4TT3H 3TGUG 3IR7A 1VQ91 1GL2B 4XFJA 1EDJA 3OA7A 1SQQE 3CD6Z 1FZCA 1S5LE 1FZAA 4MD8A 2Q6QA 3BG0B 4N78E 3FQQA 3RK3B 2GUVA 3NFZA 1SQQJ 3P32A 1NAFA 1HWTC 1ZMEC 1BSHA 1Q2NA 4IL6H 4W7YA 1VQPZ 3HTKB 1BDDA 3AE7C 1P9NA 2BJOA 1E79H 4D6TJ 4S1TA 1K8A1 1BE3J 5T67A 3CCJZ 4ZNCA 3I4NI 2RH0A 1VQ7Z 1URQD 1KB9D 1N8R1 2QM8A 2WSCH 2IFNA 3KDPB 2HR3A 3NFQA 3V6IA 2Y9ZA 3CD61 2ZYAA 2KSEA 3HKZA 1DL6A 3M91A 4GKGA 3AEDC 1WRGA 4PJ0E 1J1EC 3IF8A 3RGUA 2WT7B 1KQLA 2PAJA 1QXFA 5AVTB 4BY1I 1Z02A 3J80b 2WSFH 1KQSY 4NPFX 4Y7NI 3CCU1 3MONA 2RT9A 2L91A 3VB9A 1KD11 5C4XI 2W8ZA 2QE7H 1JO5A 1SQPD 2XNDH 4RJTA 2Q4ZA 3H1IG 1YJNP 1QVGZ 1SQBD 1H89A 3PJSK 2JIQA 2OTJ1 1KILC 1YIT1 1HGZA 2JKVA 2P58A 1TFIA 2KS1A 3HE4B 1RE4A 1RE4C 2GTHA 3D6ZA 4NBCA 3AE6C 1QF8A 4BY7I 1K731 5C3EI 1X0TA 1U57A 3NTNA 1S721 2LXBA 5APXA 1T3JA 2RPRA 1VQ51 4PV1C 2NVQI 2QA41 1PPJG 2KSJA 5E79H 1AV1A 2LXCB 1N7LA 1YUKA 4DK1A 1VQP1 1NTMD 3V2PA 4O9BA 3W68A 1VQO1 2KS1B 1YIJP 3HE4A 1Z01A 3P8CE 2D2CD 2DE5A 2FFDA 3HD7B 1P84H 2D2CB 2C9LY 3S1KA 2ZFCA 1NTMJ 2OOXB 3GCFA 3I561 1VQL1 1KB9E 1X79B 1LTIC 4NPEA 2W04A 3IF4A 2IYPA 2JUBA 5IP7I 5D1PA 5APWA 2P1JA 1J1DC 1T8ZA 1PIXA 3T97B 1KC81 4NBBA 2JA5I 3A0BH 3I55P 2E2II 1G1JA 3CCR1 2B89A 1YJ9P 1NKNA 1PL5A 1H0TA 1EXIA 1L0LG 2LIYA 1Q822 5APSA 5C4JI 4OGQC 2PM9A 4MRIA 3BCCE 2E7ZA 3Q5SA 3RL0B 2P7JA 4C7RA 3AE9C 1VQK1 2XNXA 2VPXA 1NWQA 3ZDMA 3W67A 3CXCZ 4AQRD 2KB7P 4A3DI 1W2BO 4E33A 2HODB 2Y0SA 2Q5UA 4L76A 3G6EZ 1TWAI 3A3YB 2P10A 4B86A 3GTOI 5H2FH 3P5JB 1NUIA 1Q811 1QL1A 2M0BA 4KHXA 3CCQP 1ZB9A 1GL2A 2WPSA 1MV8A 4U3FE 1VL2A 3CXCY 2H43A 3RK2C 3OW2Y 1YHQZ 4MH4A 1LT9A 5CBNA 1SQXD 2HPCB 1OIPA 4E2WA 3HD7D 3EFFK 1X3ZA 1NJI1 1SQXK 3L71G 2LFUA 3F3PC 3SWFA 1FOSE 1YJNZ 2OTLZ 2NAPA 3WU2E 4MXUA 3UIAA 3S14I 1SQPK 1M902 2OARA 3GTQI 4K35A 5DJTB 3G71Z 1DD3A 3L72E 1LTJA 3LW5H 2UWJE 3AEFC
chains in the Genus database with same CATH topology
3CCJ1 1LQLA 1EDIA 3CMA1 2YU9I 1I50I 3GTPI 4NH1C 1JJ2Z 4GOEA 2JMOA 4NBHA 4IOIH 2M5AB 3U50C 4JBZA 3VMIA 1S3JA 1YIJ1 2K3RA 2M5AA 4HJGH 1TWHI 3LUSA 2RBLA 1YJ91 3Q87A 1LP1B 4E32A 3S1MI 1EDKA 2NVTI 5IP9I 2NVXI 1VQ41 2AKLA 3GTMS 2E9HA 2PK7A 2V8JA 4NB8A 3CCRZ 3NH5A 3HOVI 1TWGI 1KRLA 3NDIA 1USPB 3JAMf 2QA4Z 2VUMI 4QTUA 2QRCB 1VQ81 1L1OC 4ZMDA 3I551 5T64A 3G6E1 3CMAZ 2NVYI 1QVFY 1WIIA 1TWFI 3KIFA 5FLXf 3CPWZ 3G711 4BBRI 1KD12 4NOZA 2Q1KA 2QKDA 2QR1B 4RVHA 3CC21 4WWIA 2KUBA 2RKLA 1RLYA 2JNYA 2QEXZ 2OTKE 4KJMA 1VQNZ 4A3LI 1NVOA 3J81f 3J7A4 1YITZ 1YJ9Z 2OTJZ 2F4MA 3F3FC 5FLMI 1S72Z 1OVVA 4BBSI 2W03A 1ZW0A 1WW9A 4MD9A 4HGZA 1VQ4Z 4AYBA 1SFOI 4MD7A 2V8IA 2GTIA 4NBDA 4A3CI 1JM0A 3GTLI 4NBFA 3CCSZ 4A3FI 5A2Qf 4ASVA 4K3AA 3S16I 2QRXA 4E30A 5LL6f 1S7MA 3VMGA 3CCM1 2GU2A 3CCLZ 2I3CA 2JA8I 1LP1A 3S15I 2QRDB 1VQOZ 1K9M2 3EERA 2KIKA 5FLXb 1VQLZ 3G4S1 3VTNA 2LR2A 4A3MI 2DE7A 2HF1A 4E2XA 1W2BY 4CPGA 3FKII 3HOXI 4MONA 3NDJA 1Y1VS 4CL1A 1K9M1 3J81b 3CC71 4HB1A 2J6AA 2EGTA 1M901 4ASWA 4BXLA 4GOFA 1VQ91 3S2DI 1H0TB 3CCEZ 1EDJA 2IZ4A 2O4HA 3I07A 1K732 1VQM1 3CD6Z 2OOYB 2QREB 1KQSZ 3I55Z 4RVDA 4NPDA 2R93I 4MD8A 3CCS1 3BG0B 3HOYI 2R6MA 2QLVB 3FQQA 2YADA 3CCMZ 3NFZA 2JR6A 3VMHA 1BDCA 5A2Qb 1Q2NA 4DQYB 1SS1A 4A3BI 3J80f 3QWUA 2G2KA 1VQPZ 4NBAA 4RVFA 1ZXGA 1DEEG 1BDDA 4Y52I 1PFTA 1K83I 1P9NA 2BJOA 3CCQ1 1MFTA 1RO2A 4S1TA 1K8A1 1FC2C 2JWDA 3QWOC 3S17I 1OVRA 1YIJZ 5T67A 3CCJZ 4ZNCA 3I4NI 1VQ7Z 2HU9A 2KZJA 1N8R1 4A93I 1RO4A 3BG1B 2SPZA 1YHQ1 1Q812 2HR3A 3M3YI 2P3YA 1VQMZ 3CD61 2Q51A 4TNUA 3HKZA 1JWHC 3MHVA 1DL6A 1Q862 1QVGY 3PO3I 1N2FA 2B63I 5EFWB 3IF8A 3RGUA 2M6NA 3S1QI 3H3VJ 4BY1I 1YJN1 2I8DA 3GTMI 1Z02A 1U7JA 3J80b 3TE5B 1KQSY 4NPFX 4Y7NI 3CCU1 3MONA 2RT9A 1Q7Y1 3T4NB 3VB9A 1KD11 5C4XI 4NB9A 3CMEZ 4HKZH 1VLAA 2O53A 2KI7B 3NH8A 3HOWI 5C44I 3S1RI 2Q4ZA 2QEX1 3CCQZ 1QVGZ 2B87B 3CC7Z 3CCUZ 3D9XA 1VQN1 2R7ZI 2OTJ1 2RHBA 1YIT1 2P58A 3M4OI 4A3JI 1TFIA 1JJ2Y 1ML8A 1YI2Z 2VF1A 3S2HI 3CCV1 1YJWZ 2JA6I 2GTHA 1VQ61 4NBCA 2WAQA 1W2BZ 1QF8A 4A3II 1OVUA 3PH0A 1YUAA 2QVAA 3GTGI 4BY7I 1K731 5C3EI 1X0TA 3PO2I 1S721 4HH4A 2LXBA 1I3QI 2R44A 2RPRA 1VQ51 5DJUB 3RZDI 1Q821 3FXDA 2NVQI 2QA41 1TWCI 1NJI2 1VQ8Z 2WB1A 1M1K2 3CCVZ 1U7MA 4MN4C 2LXCB 2KPIA 4E2YA 4RVGA 1YUKA 4DK1A 1VQP1 1VQO1 2KS1B 1Z01A 3D6WA 1RO0A 2DE5A 1I6HI 2PMZA 5D1OA 1M1K1 3S1KA 3CC4Z 2OOXB 3CCL1 3GKQA 3OW2Z 2R92I 1WCMI 3GCFA 2E2HI 3I561 1Z03A 1X3WA 2B88A 4GODA 1VQL1 4RS4A 2WMMA 3IX0A 1ZH1A 3NH4A 4NPEA 2W04A 4HGYA 5IT9b 2JUBA 5IP7I 3CC41 5D1PA 3PO3S 2P28A 4XX2A 1KC81 4NBBA 2JA5I 4NBEA 2E2II 3HOZI 3EEDA 4QTTA 3I56Z 1QYPA 1VQKZ 4A3KI 1RQFA 3CCE1 1K8A2 3CCR1 2B89A 4E31A 1H0TA 3K7AI 3KIHA 3CQZI 3CME1 2LIYA 1Q822 5C4JI 1QVFZ 2PM9A 4MRIA 4A3EI 3I4MI 2B87A 2H85A 2JS4A 2K5RA 4NBGA 3HOUI 1VQK1 3ZDMA 5K5GB 3CXCZ 4E2ZA 4EYYQ 2KZIA 5D1OB 4A3DI 1EC5A 2RIQA 3G4SZ 2F4OA 4E33A 2Y0SA 2JA7I 2M48A 3G6EZ 3RZOI 1Y1WI 1TWAI 5CM2M 1YI21 2OTL1 3MZWB 1YJW1 1Q861 5T6BA 3GTOI 1VQ6Z 3P5JB 1NUIA 3FQMA 5C39A 4NFRA 3GTKI 1Q811 2M0BA 1ZB8A 1ZB9A 4RV9A 3CC2Z 4A3GI 2ZAEB 3CXCY 4X6AI 2DE6A 1VQ71 1Y47A 3TDHB 1N8R2 2OZKA 5IT9f 3OW2Y 2VUGA 1Q7Y2 1KC82 3CPWY 2V8KA 1YHQZ 4MH4A 1R9TI 1VQ9Z 5CBNA 3MZLB 3MZKB 1RNIA 1VQ5Z 4E2WA 1NP6A 1X3ZA 1NJI1 3FXEA 2IZ3A 4EWCA 1Y1VI 1USPA 3H0GI 4DGLA 3JAMb 2LFUA 2E2JI 3F3PC 1YJNZ 3S1NI 4BXXI 3GTJI 2OTLZ 4MXUA 3S14I 3ESWA 1JMBA 1M902 5AN9F 1EDLA 4K35A 3GTQI 5CBOA 5DJTB 3G71Z 3IFUA 2UWJE 1LT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EDI A;  5EFW B;  3RGU A;  1LP1 A;  4GOE A;  2I8D A;  1U7J A;  4NPF X;  4IOI H;  2M5A B;  4JBZ A;  2KIK A;  2B89 A;  1S3J A;  2K3R A;  2M5A A;  1H0T A;  2LR2 A;  4HJG H;  4HKZ H;  2KI7 B;  1LP1 B;  4CPG A;  1EDK A;  2B87 A;  2B87 B;  4HB1 A;  4ASW A;  3ZDM A;  4BXL A;  4GOF A;  5K5G B;  4EYY Q;  2KZI A;  1H0T B;  1EDJ A;  1EC5 A;  2P58 A;  4ZMD A;  4NPD A;  3MZW B;  1OVU A;  5C39 A;  3PH0 A;  2M0B A;  2QVA A;  1X0T A;  2Q1K A;  2LXB A;  2R44 A;  4WWI A;  2KUB A;  2RKL A;  2ZAE B;  5DJU B;  3FXD A;  1BDC A;  1Q2N A;  1Y47 A;  1SS1 A;  1U7M A;  4MN4 C;  2LXC B;  2OTK E;  4KJM A;  1ZXG A;  1DEE G;  1BDD A;  1NVO A;  5CBN A;  2KS1 B;  1MFT A;  1FC2 C;  2JWD A;  1OVV A;  3FXE A;  1OVR A;  3QWO C;  1ZW0 A;  3S1K A;  4ZNC A;  2KZJ A;  1JMB A;  2SPZ A;  1JM0 A;  2B88 A;  2HR3 A;  4GOD A;  1EDL A;  4K35 A;  5CBO A;  5DJT B;  2WMM A;  2QRX A;  4ASV A;  4K3A A;  4NPE A;  2UWJ E;  3MHV A;  1LT1 A; 
#chains in the Genus database with same CATH topology
 2QJK C;  1LQL A;  1L4A A;  4WY4 D;  2JP3 A;  3CMA 1;  3BAS A;  1EZV D;  1NTZ J;  1VQ4 P;  2XV5 A;  4NBH A;  1PGO A;  1VQN P;  1VQP P;  1YIJ 1;  2K3R A;  2V3V A;  3LUS A;  1YJ9 1;  1PP9 E;  2WPV B;  3V2R A;  1FDO A;  2WPQ A;  3L74 D;  2FYU E;  2YMY A;  2M3B A;  2AKL A;  1RF0 C;  3GTM S;  2YKO A;  2YXQ B;  3CC2 P;  1OFC X;  3JAM f;  2ZT9 B;  1OWA A;  5T64 A;  3WMM 0;  3TNU A;  3G6E 1;  4BWN A;  3IR9 A;  1Q90 D;  3CPW Z;  2FKW B;  3G71 1;  2IBZ D;  1N8R Q;  1PGJ A;  1KD1 2;  2Q1K A;  3L70 G;  2JIR A;  1LT9 C;  1RY3 A;  2FYN B;  2KUB A;  2RKL A;  1DH3 A;  1KTM A;  5TIS E;  5KLV K;  1OMI A;  4WBA A;  3RL0 C;  4WB4 A;  1HUC A;  1SQB G;  3J81 f;  3J7A 4;  2Y0D A;  1YJ9 Z;  1FBM A;  3CX5 E;  3USS A;  5FLM I;  2W03 A;  5B5E H;  4RES B;  1AVY A;  1Q16 A;  2Y0C A;  3HUS C;  5CCG A;  2V8I A;  3CXH H;  1JY2 P;  4NBD A;  4YPC A;  1LTA C;  2KLV A;  3V4Q A;  1VQO P;  1L0L K;  4AUW A;  1NU1 D;  2VPW A;  1N7S B;  2QRX A;  4E30 A;  1S7M A;  3K5B A;  3CCM 1;  1JCC A;  1JY3 P;  1KFN A;  1NJI Q;  4H44 C;  4ZKU A;  2GU2 A;  1SFC C;  3S15 I;  2WSS H;  1YQ4 C;  1K9M 2;  5AVZ B;  3NXS A;  2V7Q H;  3G4S 1;  2DE7 A;  1AQT A;  4CPG A;  1IFN A;  4MON A;  5AW4 B;  5AVY B;  1USD A;  1URQ B;  3CC7 1;  2EGT A;  5TIS H;  5CJ0 A;  1Q82 Q;  2C0X A;  2VRS A;  2QG4 A;  3S2D I;  1PFI A;  3CCE Z;  2Q3I A;  2R3C A;  2LKM A;  1AFO A;  2IZ4 A;  2WIT A;  2ZYD A;  1FDM A;  1PGP A;  4JQ0 D;  1R5S A;  4N3Y B;  1N73 A;  2OOY B;  2H7H A;  3MD0 A;  4PV1 D;  3TYY A;  2R93 I;  1GK6 A;  2AXC A;  2R6M A;  5AVV B;  1AJY A;  4EOT A;  3BAT A;  5AVU B;  1QL2 A;  1RE3 A;  2KP8 A;  2YAD A;  4H13 D;  1LTG C;  3CCM Z;  1BE3 E;  2JR6 A;  4DQY B;  1SS1 A;  1GW4 A;  3R4Y A;  1SFC A;  3QWU A;  2G2K A;  2V4H A;  2N1T D;  4Y52 I;  1PFT A;  2GA1 A;  3CCQ 1;  2JWD A;  3S17 I;  5BU5 A;  4WY4 C;  1IFI A;  1NO4 A;  2YIU C;  2ZXX A;  1JTH A;  2Y9Y A;  1LNQ A;  2KZJ A;  3B5N D;  1NTM K;  1N7S A;  3BG1 B;  3JC2 2;  2FYU D;  1NTK J;  2QJY C;  5AW8 B;  3LID A;  3SFE C;  2WWW A;  4EDF A;  3D70 A;  1NOH A;  3PO3 I;  1N2F A;  2NZ2 A;  5EFW B;  1NTK D;  5E79 E;  5APT A;  3H1H E;  1JUN A;  2R32 A;  5GTI E;  2IV2 X;  5KTB A;  3A0B E;  4U7J A;  1Q7Y 1;  1PP9 D;  3G3Z A;  1ZN5 A;  2ZVO B;  4HKZ H;  2ITA A;  2KI7 B;  3NH8 A;  3HOW I;  3S1R I;  3CCL P;  3TGU D;  3CCQ Z;  1T2K D;  3CC7 Z;  3CC7 P;  1VQN 1;  3JCU E;  3CXH E;  1K05 A;  2RMZ A;  2RHB A;  4Z1M H;  1ZP0 C;  4L74 A;  1ML8 A;  2H89 C;  2VF1 A;  1OX3 A;  1DEB A;  3H1K D;  2FBW C;  2WAQ A;  1W2B Z;  4IFD K;  4A3I I;  1OVU A;  1SQB E;  1RH5 B;  2E74 C;  1YTZ I;  1K8A Q;  2AEM A;  3TF5 A;  3PTZ A;  1S9K E;  4HH4 A;  3RK3 D;  2Z5H A;  1I3Q I;  3H1L D;  3FXD A;  5BVZ A;  4Y99 B;  3TSI A;  1TWC I;  1NJI 2;  3CME P;  1VQ8 Z;  2WB1 A;  1M1K 2;  3CCV Z;  1A02 F;  1U7M A;  1GK4 A;  1FZG A;  2KPI A;  4RO0 A;  2LEX A;  1VQ9 P;  3S4R A;  1BCC J;  2DW3 A;  2FXM A;  1KQS O;  2NPS B;  3A2A A;  3D6W A;  1RO0 A;  2NPS C;  1I6H I;  3WUV A;  5D1O A;  2HPC A;  2YO3 A;  3CC4 Z;  4YXW H;  3OW2 Z;  4I1L A;  4BRY A;  3GKQ A;  1FZE A;  1UIX A;  1G2C B;  3B5N B;  2R92 I;  2WSE J;  1WCM I;  1AA6 A;  1NU1 J;  2B88 A;  3VYI A;  3CCE P;  3IAO A;  3IX0 A;  1VQ7 P;  3GF7 A;  1ZOY C;  2JIO A;  1XTC C;  1XTG B;  2O1J A;  2E5T A;  3L75 J;  4QTT A;  1SQQ K;  4LC1 A;  1RQF A;  1R5L A;  1K8A 2;  1P84 D;  4YTP C;  3K7A I;  1IFP A;  1IZN B;  5TJH A;  1MUU A;  3MIW A;  1QVF Z;  1HTL C;  4A3E I;  3L75 E;  3I4M I;  3P7K A;  3OAK A;  3AEB C;  2JS4 A;  1M1K Q;  1OXZ A;  2HLO A;  2K5R A;  4WVZ A;  5KLI C;  4NBG A;  3HOU I;  1KQG B;  2M8R A;  5AW5 B;  1GZL A;  3FWN A;  1LWU C;  2HFE D;  3VTP C;  2F4O A;  2IDB A;  1L0N G;  2M48 A;  2Z5I A;  1Y1W I;  3RZO I;  3M0A A;  1JMM A;  5CM2 M;  1M8O B;  4JYB A;  2OTL 1;  2W27 A;  1Q86 1;  3GTK I;  1USE A;  2O01 N;  4A3G I;  3WU2 H;  1L0N K;  2ZAE B;  1SQX G;  3RK3 E;  2K9J A;  1Y47 A;  1N8R 2;  1N86 A;  3H1J D;  4L75 A;  2YIU B;  1Q7Y 2;  3CPW Y;  3FGA D;  3I5C A;  1R9T I;  4I2L C;  2E43 A;  2J58 A;  3MZL B;  2I1J A;  3GHG B;  2KOG A;  1VQ5 Z;  3KZI H;  1FS0 E;  1NH4 A;  1GDT A;  3FXE A;  1WJ2 A;  3L72 J;  2IZ3 A;  5CCH D;  3H0G I;  3JAM b;  5GTH H;  1JEK A;  3JSV C;  1NTM G;  4BXX I;  1NTZ E;  3TGU J;  5AN9 F;  3KPE A;  3B71 A;  4A7P A;  5CBO A;  1T3U A;  2E42 A;  3IFU A;  2MKV A;  1NHL A;  1JY2 N;  1PP9 J;  1RQU A;  1LTS C;  1LT1 A;  3CCJ 1;  1JTH B;  1H8A A;  5CJ4 A;  3VP9 A;  1I50 I;  1S4X A;  1W5C E;  2JMO A;  4IOI H;  2JWA A;  5GTH E;  3FWL A;  1R8E A;  4HJG H;  2IBZ G;  4PJ0 H;  2RBL A;  2OYH A;  3Q87 A;  1FJK A;  1LP1 B;  1LWU A;  3L73 D;  1ZLL A;  1BGY G;  4E32 A;  4IFM A;  1EDK A;  4R4M A;  3L71 E;  2NVT I;  1Y9B A;  2E74 D;  3Q5P A;  2E9H A;  2PK7 A;  2W83 C;  3CCR Z;  3NH5 A;  1JCD A;  1SQP G;  1L0L D;  1WT6 A;  1FZB A;  2H8P D;  4H13 C;  2VUM I;  4QTU A;  2QRC B;  2BAS A;  3TDK A;  2CK3 H;  1M1J B;  4ZMD A;  1L1O C;  3I55 1;  1NTK G;  3CXH D;  1EQ7 A;  4H44 B;  1N73 B;  3MTU E;  5FLX f;  2Q3E A;  3OJA B;  3CCR P;  3MUD C;  1S9K D;  2N1T C;  2VPZ A;  4BBR I;  2WSC J;  5AW2 B;  1RE3 C;  4RVH A;  1RLY A;  4IFF A;  3M06 A;  1X22 A;  1WMK A;  2QEX Z;  3E1I A;  1CI6 A;  2E76 C;  1N73 C;  3H1J G;  3H1J E;  1NVO A;  1M1J C;  3KXD A;  1H88 A;  4DZO A;  1EZV E;  1S72 Z;  1OVV A;  3AE2 C;  4BBS I;  3L70 E;  2ZJS E;  1SFO I;  2XZR A;  5L8R J;  2GTI A;  2W6B A;  3RBX A;  3E7K A;  2JJL A;  2YO2 A;  1NTZ D;  3GTL I;  4D6T G;  1SQV D;  3Q5R A;  3CCS Z;  1VDF A;  2G3A A;  5A2Q f;  4ASV A;  4K3A A;  3BVH A;  4OWF A;  5CCH A;  1SQP E;  2OYO A;  1JY2 O;  3VMX A;  3H1K J;  4IL6 E;  1Y8A A;  2I3C A;  3H1H G;  5KJ7 C;  3L74 G;  2QRD B;  3H1L G;  2KLU A;  1KD1 Q;  2KIK A;  1BCC G;  2K1A A;  1VQL Z;  3G71 P;  2IBZ E;  2BEZ F;  2HF1 A;  1RF1 B;  5KAI E;  4E2X A;  2BCC D;  3HOX I;  3NDJ A;  1NTK K;  1K9M 1;  1L0N E;  1KIL D;  2B9B A;  5AW7 B;  3SSU A;  3G9R A;  2OTJ P;  5APU A;  1K73 2;  2WPR A;  1S5L X;  2QRE B;  3I55 Z;  3KQG A;  2IFM A;  3CCS 1;  5KAI H;  2W6J H;  3PP5 A;  4PD4 D;  3GW6 A;  5KAF H;  2YKP A;  4OH8 B;  3KYQ A;  1K04 A;  1VF5 B;  3H6P A;  3VMH A;  1BDC A;  2K9Y A;  4DOJ A;  2QA4 P;  4A3B I;  3L4F A;  2E5Y A;  3J80 f;  4NBA A;  4RVF A;  1K83 I;  1CSB A;  1GTW A;  3H1L E;  2KK7 A;  2IPP A;  2NPS A;  1NU1 K;  3H1I E;  1YIJ Z;  2A45 I;  2HU9 A;  1T6A A;  1EZV I;  1L4A B;  4W7Z A;  3GG2 A;  4A93 I;  1FOS F;  1URQ A;  1LGH B;  1RHZ B;  1ZRT E;  2O01 J;  1VPC A;  3L74 J;  2SPZ A;  2ZT9 D;  3H1H J;  1YHQ 1;  2P3Y A;  3L71 D;  2MJZ A;  1D7M A;  1NU1 G;  4TNU A;  3H1I J;  3QH9 A;  1JWH C;  1QVG Y;  4W80 A;  2BEQ D;  2IYO A;  1IJD B;  2M6N A;  1IO4 A;  1PPJ D;  2E75 B;  1YJN 1;  2I8D A;  1KC8 Q;  1RF1 A;  1U7J A;  1A02 J;  3TE5 B;  1BE3 D;  1NTK E;  3S9O A;  3CME Z;  1VLA A;  3C1L A;  3C8V A;  2O53 A;  2JIM A;  2E75 C;  3O6Q A;  1KZU B;  1JOC A;  2QEX 1;  3B8E B;  3NMD A;  3B5N C;  3ITK A;  4H0L D;  2IBZ I;  2JR8 A;  3CCU P;  3CCU Z;  2R7Z I;  2OYI A;  1HJB A;  2XKM A;  1KIL E;  4JPZ B;  3CLQ A;  2FFD C;  1JJ2 Y;  3AEE C;  1AVO A;  1YI2 Z;  3AEG C;  1FJP A;  1YJW P;  1YJW Z;  3H32 A;  2JA6 I;  1HGV A;  3BCC D;  3AEC C;  4QMA A;  1KIL A;  4Y99 C;  1YUA A;  2QVA A;  4EIJ A;  4JF7 A;  3PO2 I;  1CW5 A;  1HJ0 A;  2R44 A;  2WVR A;  5DJU B;  3RZD I;  3RK2 D;  5AVR B;  1BGY E;  4PD4 E;  5CCH C;  1SQQ G;  4MN4 C;  1FDI A;  4E2Y A;  1VF5 C;  2M3E A;  1SQB J;  1T2K C;  1QLE D;  1NU1 E;  3V5B A;  3HD7 C;  3U1C A;  1VQL P;  2XU6 A;  2PMZ A;  1M1K 1;  3CCL 1;  3L73 J;  3H1I D;  1KV4 A;  1Z03 A;  1X3W A;  3L70 D;  4GOD A;  2VPY A;  4PV1 B;  5AW9 B;  4RS4 A;  1NKZ B;  3AE4 C;  2WMM A;  1X8Y A;  3VP8 A;  1NTM E;  5IT9 b;  5KLV G;  3PO3 S;  3U59 A;  2P28 A;  1RF0 A;  3BCC J;  4ZKP A;  4NBE A;  3HOZ I;  3I56 Z;  3KHU A;  1RF1 C;  3AE3 C;  1GU4 A;  1VQK Z;  4A3K I;  3MUD A;  3C9I A;  2XDJ A;  5AVS B;  4E31 A;  2NPS D;  2QJY B;  2GUS A;  3CME 1;  3L72 G;  2YMK A;  3VMA A;  3Q1M A;  2H85 A;  1ZR2 A;  1S5L H;  1KYO D;  4N78 D;  1L0N D;  4C7N B;  5K5G B;  4E2Z A;  2KZI A;  5D1O B;  1GL2 D;  4U3F J;  2RIQ A;  3G4S Z;  1GMJ A;  1Y8C A;  4L73 A;  3KZI E;  2V45 A;  2NRG A;  2P2U A;  1YI2 1;  3MZW B;  1YJW 1;  1G1I A;  3FQM A;  1AQ5 A;  4NFR A;  1IC2 A;  1S72 P;  4RV9 A;  3CWB E;  3CC2 Z;  3CWB D;  1VQ5 P;  1QVG O;  3FX0 A;  1QEX A;  2DE6 A;  2BCC J;  1VQ7 1;  2E76 B;  2N9Y B;  3TDH B;  4UB6 E;  2OZK A;  2JIP A;  1SQQ D;  2V8K A;  3CCS P;  1UII A;  3PLN A;  1VQ9 Z;  1BGY D;  3CWB J;  4PD4 I;  1DX7 A;  2N1T B;  1VQ8 P;  4DT0 A;  4EWC A;  1Y1V I;  1USP A;  3M0D A;  1KYO H;  1ZRT D;  3M9Q A;  5APY A;  3CMA P;  3S1N I;  3N4X A;  3L37 A;  5M1B A;  3AE5 C;  1JMB A;  5B66 E;  5B5E E;  5CMZ A;  4N6J A;  1L0L E;  2JDI H;  3MP7 B;  3RBZ A;  1HVV A;  4H44 D;  1EDI A;  5KLV J;  2YU9 I;  5AW1 B;  1KB9 I;  3GTP I;  3L71 J;  1JJ2 Z;  4GOE A;  2HG5 D;  5KJ7 A;  3VMY A;  1SQV K;  2Y0E A;  3VMI A;  1S3J A;  2WTY A;  2H88 C;  1JB0 J;  4C7N A;  1FAV A;  3TK1 A;  4H0L B;  3S1M I;  2AXT H;  5IP9 I;  2PGD A;  1VQ4 1;  1VQK P;  1OW7 A;  3HUS B;  3CPW O;  1LTJ B;  4I7Z B;  4NB8 A;  3HOV I;  1TWG I;  3NDI A;  1KFM A;  3ABV C;  2QA4 Z;  4D6T D;  3HE5 B;  2QEX P;  1WII A;  1CZQ A;  1M1J A;  2W90 A;  1TWF I;  1SQB K;  4EI2 A;  2AYD A;  1K73 Q;  5CHX A;  2QR1 B;  3CC2 1;  1LT9 B;  3M9B A;  4WWI A;  3VOP A;  2JNY A;  3D71 A;  3CD6 P;  4DCK A;  1NTZ K;  1EZV G;  1PGQ A;  2A45 G;  2O1K A;  1YIT Z;  2ZT9 C;  2KYV A;  1QX8 A;  4U3F D;  2FXO A;  4LGD E;  1L2P A;  1ZW0 A;  1WW9 A;  1NTZ G;  4MD9 A;  1BCC D;  1VQ4 Z;  3CCM P;  4AYB A;  1M90 Q;  2FYZ A;  5CCG D;  3VN0 A;  1YI2 P;  2YXR B;  4A3C I;  1SQX J;  2HOD A;  1LWU B;  4NBF A;  2OGU A;  1PV3 A;  2AEF A;  4A3F I;  2K37 A;  3HUS A;  5LL6 f;  2IZ1 A;  1VQ6 P;  4TLF A;  1S2E A;  1SQX E;  2WT7 A;  3CX5 I;  4UB8 E;  3JCU H;  3EER A;  3U1A A;  5FLX b;  1L0N J;  1QGK B;  2OYI B;  1PZQ A;  3FKI I;  3T97 A;  1Q7Y Q;  3EQ2 A;  2ZYG A;  3H1K E;  1Y1V S;  3HRN A;  4R4L A;  2J6A A;  3EWK A;  1M90 1;  2A06 D;  4ASW A;  3A0H E;  4BXL A;  4GOF A;  1H0T B;  1YQ3 C;  2O4H A;  3A0H H;  3I07 A;  1VQM 1;  1KQF B;  2W6A A;  1J2J B;  1KQS Z;  4RVD A;  4NPD A;  3GLM A;  3HOY I;  5AVW B;  5KJ7 D;  2FFD B;  2CPS A;  2JO1 A;  2N1T A;  3RK2 B;  1VF5 D;  2QLV B;  3I56 P;  2WSE H;  3D6Y A;  2L5G B;  1BE3 G;  1NYH A;  5A2Q b;  4LLH A;  1S1C X;  2G8Y A;  1GW3 A;  3RL0 D;  1ZXG A;  1DEE G;  1MFT A;  4YXD C;  1RO2 A;  1FC2 C;  1BSN A;  2E74 B;  1SQV G;  2A06 E;  3QWO C;  1OVR A;  4U3F G;  1E5W A;  5GTI H;  1ZV8 A;  1RO4 A;  4I6M C;  1HBW A;  3M3Y I;  4OGQ B;  1Q81 2;  2QIW A;  1SP4 A;  1SVF A;  4D6T E;  1P84 E;  3H1L J;  4IL6 X;  2PRR A;  1VQM Z;  2Q51 A;  3BRV B;  3CX5 H;  3CC4 P;  2POH A;  3MHV A;  1Q86 2;  2B63 I;  3LW5 J;  1L4A C;  3S1Q I;  3H3V J;  1OW8 A;  3L74 E;  3GTM I;  3SWK A;  2FXP A;  1WZN A;  3EFG A;  3T4N B;  4NB9 A;  4KT0 J;  2PP6 A;  5C44 I;  3H1H D;  1KB9 H;  4JYC A;  2B87 B;  3IFM A;  3VMZ A;  4C46 A;  5B66 H;  1P84 I;  4HYT B;  3WUT A;  4AYC A;  3D9X A;  3PRJ A;  3L73 G;  4HH2 A;  2D2C C;  4UB8 H;  1LTB C;  2ZVN B;  5AVQ B;  3M4O I;  5KAF E;  4A3J I;  3S2H I;  3CCV 1;  2AEJ A;  1VQ6 1;  4WY4 B;  2AXT E;  3PH0 A;  2O3J A;  3GTG I;  1GD2 E;  3GHG A;  4PD4 H;  1Q82 1;  2JEE A;  4DJG A;  3CL3 D;  3L36 A;  2E75 D;  5KKZ C;  3SWY A;  4RVG A;  3R2P A;  1FU1 A;  4GDO A;  3H25 A;  3A5T A;  1PPJ E;  1NAY A;  2J5U A;  3F89 A;  4GIF A;  1KIL B;  3AEA C;  2P67 A;  2KNC B;  1BGY J;  3H32 B;  5KKZ B;  1VQM P;  3HTK A;  1X9V A;  3P8M C;  2E2H I;  2PFX A;  1KYO E;  1Q86 Q;  3M9H A;  1DIP A;  2HYN A;  1BCC E;  1LJ2 A;  3L75 D;  1ZH1 A;  3NH4 A;  5AVX B;  4HGY A;  3Q3D A;  1URQ C;  3L75 G;  3CC4 1;  3L73 E;  1QVF O;  1SIW A;  2N9B A;  4OVN F;  3OW2 O;  2K88 A;  4UB6 H;  3IN6 A;  4XX2 A;  3MGN A;  4WY4 A;  2KNC A;  3EED A;  1J1E B;  1QYP A;  3F5H A;  3SFD C;  3CCE 1;  1KOR A;  2WSF J;  3A7O A;  3KIH A;  3CQZ I;  1FZF A;  1SFC B;  5APQ A;  2B87 A;  1JNM A;  1KYO I;  1N7S C;  5BU8 B;  4EYY Q;  3HD7 A;  1EC5 A;  1MKM A;  2JA7 I;  2BCC E;  3CXH I;  3CCV P;  2WZ7 A;  2IX7 C;  5T6B A;  1VQ6 Z;  5C39 A;  4H13 B;  1ZB8 A;  1HF9 A;  1K9M Q;  2YNY A;  3P8C D;  3RK3 C;  4X6A I;  3B4S A;  1IFM A;  3BCC G;  1YYC A;  2E76 D;  5IT9 f;  5APV A;  1KC8 2;  2VUG A;  5H2F E;  5CCG C;  2FYN C;  1ZR4 A;  1M57 D;  3HE5 A;  3MZK B;  1RNI A;  2V7Q J;  3BRT B;  2IZ0 A;  1NP6 A;  4Y28 J;  1L0L J;  1GL2 C;  1EXJ A;  2YKQ A;  2FYU G;  2Q9I A;  4DGL A;  3M0D C;  2E2J I;  5AW6 B;  1L4A D;  3LIE A;  1YTZ T;  5KLV E;  3GTJ I;  3G6E P;  3V2Q A;  3ESW A;  2C0W A;  1EDL A;  3Q2Y A;  1IK9 A;  1N2D C;  2RN0 A;  1Z56 A;  2OYH C;  1AA0 A;  2QJP C;  5AW0 B;  3TGU E;  2FYU J;  4NH1 C;  2I1K A;  2R5B A;  2M5A B;  3H1K G;  2J59 M;  3U50 C;  4JBZ A;  4GT1 A;  2CPB A;  2M5A A;  1YIT P;  2QSI A;  3WUU A;  1TWH I;  3GHG C;  2KXP B;  1IK7 A;  3II6 A;  3CCJ P;  2OQQ A;  1DD4 A;  2QJK B;  2K9J B;  2NVX I;  2R5D A;  2ZXE B;  2V8J A;  1M56 D;  1KRL A;  2OYI C;  1USP B;  4XE5 B;  1OW6 A;  2Z4E A;  3L72 D;  3AE8 C;  4M3L A;  4OGQ D;  3AE1 C;  4XA4 A;  3GMA A;  1FZC C;  1VQ8 1;  1LTT C;  2OTL P;  3CMA Z;  2NVY I;  1QVF Y;  1RQV A;  3KIF A;  1MZ9 A;  1HH0 A;  3H1J J;  1NGM B;  3CX5 D;  3G4S P;  3CWB G;  1FE6 A;  3E1R A;  1IFJ A;  4NOZ A;  2QKD A;  2WQY C;  1SLQ A;  2Q7C A;  1SQV J;  1CI6 B;  2FYU K;  5KLI B;  2BCC G;  3O6Q B;  1SFC D;  2OTK E;  4KJM A;  1VQN Z;  1JY3 O;  4A3L I;  3TNU B;  1JY3 N;  1FZC B;  1M7L A;  2OTJ Z;  2F4M A;  3F3F C;  2QM7 A;  2FY8 A;  1SQV E;  2A06 G;  3L35 A;  4HGZ A;  1SQP J;  4MD7 A;  5AW3 B;  1KMI Z;  1JM0 A;  2GM4 A;  5KLV D;  1YHQ P;  3PHL A;  1KN7 A;  3D2L A;  3L70 J;  1Q81 Q;  3S16 I;  3VMG A;  4RKU J;  1MFZ A;  1G2C A;  3B5N A;  3CCL Z;  2JA8 I;  1N7S D;  1LP1 A;  1W2E A;  1TU3 F;  3CI9 A;  4BRY B;  2QJP B;  1IFD A;  2OYH B;  3N7N A;  1VQO Z;  2O01 H;  1YBK A;  3V2N A;  3V4W A;  3VTN A;  1PP9 G;  1OZH A;  2LR2 A;  3O8Z A;  3RL0 g;  1GU5 A;  4A3M I;  3GF3 A;  1W2B Y;  1LTJ C;  4I7Z C;  2C9N Y;  1J1D B;  4CL1 A;  2A45 H;  3J81 b;  4H0L C;  2R3S A;  4HB1 A;  4TT3 H;  3TGU G;  3IR7 A;  1VQ9 1;  1GL2 B;  4XFJ A;  1EDJ A;  3OA7 A;  1SQQ E;  3CD6 Z;  1FZC A;  1S5L E;  1FZA A;  4MD8 A;  2Q6Q A;  3BG0 B;  4N78 E;  3FQQ A;  3RK3 B;  2GUV A;  3NFZ A;  1SQQ J;  3P32 A;  1NAF A;  1HWT C;  1ZME C;  1BSH A;  1Q2N A;  4IL6 H;  4W7Y A;  1VQP Z;  3HTK B;  1BDD A;  3AE7 C;  1P9N A;  2BJO A;  1E79 H;  4D6T J;  4S1T A;  1K8A 1;  1BE3 J;  5T67 A;  3CCJ Z;  4ZNC A;  3I4N I;  2RH0 A;  1VQ7 Z;  1URQ D;  1KB9 D;  1N8R 1;  2QM8 A;  2WSC H;  2IFN A;  3KDP B;  2HR3 A;  3NFQ A;  3V6I A;  2Y9Z A;  3CD6 1;  2ZYA A;  2KSE A;  3HKZ A;  1DL6 A;  3M91 A;  4GKG A;  3AED C;  1WRG A;  4PJ0 E;  1J1E C;  3IF8 A;  3RGU A;  2WT7 B;  1KQL A;  2PAJ A;  1QXF A;  5AVT B;  4BY1 I;  1Z02 A;  3J80 b;  2WSF H;  1KQS Y;  4NPF X;  4Y7N I;  3CCU 1;  3MON A;  2RT9 A;  2L91 A;  3VB9 A;  1KD1 1;  5C4X I;  2W8Z A;  2QE7 H;  1JO5 A;  1SQP D;  2XND H;  4RJT A;  2Q4Z A;  3H1I G;  1YJN P;  1QVG Z;  1SQB D;  1H89 A;  3PJS K;  2JIQ A;  2OTJ 1;  1KIL C;  1YIT 1;  1HGZ A;  2JKV A;  2P58 A;  1TFI A;  2KS1 A;  3HE4 B;  1RE4 A;  1RE4 C;  2GTH A;  3D6Z A;  4NBC A;  3AE6 C;  1QF8 A;  4BY7 I;  1K73 1;  5C3E I;  1X0T A;  1U57 A;  3NTN A;  1S72 1;  2LXB A;  5APX A;  1T3J A;  2RPR A;  1VQ5 1;  4PV1 C;  2NVQ I;  2QA4 1;  1PPJ G;  2KSJ A;  5E79 H;  1AV1 A;  2LXC B;  1N7L A;  1YUK A;  4DK1 A;  1VQP 1;  1NTM D;  3V2P A;  4O9B A;  3W68 A;  1VQO 1;  2KS1 B;  1YIJ P;  3HE4 A;  1Z01 A;  3P8C E;  2D2C D;  2DE5 A;  2FFD A;  3HD7 B;  1P84 H;  2D2C B;  2C9L Y;  3S1K A;  2ZFC A;  1NTM J;  2OOX B;  3GCF A;  3I56 1;  1VQL 1;  1KB9 E;  1X79 B;  1LTI C;  4NPE A;  2W04 A;  3IF4 A;  2IYP A;  2JUB A;  5IP7 I;  5D1P A;  5APW A;  2P1J A;  1J1D C;  1T8Z A;  1PIX A;  3T97 B;  1KC8 1;  4NBB A;  2JA5 I;  3A0B H;  3I55 P;  2E2I I;  1G1J A;  3CCR 1;  2B89 A;  1YJ9 P;  1NKN A;  1PL5 A;  1H0T A;  1EXI A;  1L0L G;  2LIY A;  1Q82 2;  5APS A;  5C4J I;  4OGQ C;  2PM9 A;  4MRI A;  3BCC E;  2E7Z A;  3Q5S A;  3RL0 B;  2P7J A;  4C7R A;  3AE9 C;  1VQK 1;  2XNX A;  2VPX A;  1NWQ A;  3ZDM A;  3W67 A;  3CXC Z;  4AQR D;  2KB7 P;  4A3D I;  1W2B O;  4E33 A;  2HOD B;  2Y0S A;  2Q5U A;  4L76 A;  3G6E Z;  1TWA I;  3A3Y B;  2P10 A;  4B86 A;  3GTO I;  5H2F H;  3P5J B;  1NUI A;  1Q81 1;  1QL1 A;  2M0B A;  4KHX A;  3CCQ P;  1ZB9 A;  1GL2 A;  2WPS A;  1MV8 A;  4U3F E;  1VL2 A;  3CXC Y;  2H43 A;  3RK2 C;  3OW2 Y;  1YHQ Z;  4MH4 A;  1LT9 A;  5CBN A;  1SQX D;  2HPC B;  1OIP A;  4E2W A;  3HD7 D;  3EFF K;  1X3Z A;  1NJI 1;  1SQX K;  3L71 G;  2LFU A;  3F3P C;  3SWF A;  1FOS E;  1YJN Z;  2OTL Z;  2NAP A;  3WU2 E;  4MXU A;  3UIA A;  3S14 I;  1SQP K;  1M90 2;  2OAR A;  3GTQ I;  4K35 A;  5DJT B;  3G71 Z;  1DD3 A;  3L72 E;  1LTJ A;  3LW5 H;  2UWJ E;  3AEF C; 
#chains in the Genus database with same CATH homology
 3CCJ 1;  1LQL A;  1EDI A;  3CMA 1;  2YU9 I;  1I50 I;  3GTP I;  4NH1 C;  1JJ2 Z;  4GOE A;  2JMO A;  4NBH A;  4IOI H;  2M5A B;  3U50 C;  4JBZ A;  3VMI A;  1S3J A;  1YIJ 1;  2K3R A;  2M5A A;  4HJG H;  1TWH I;  3LUS A;  2RBL A;  1YJ9 1;  3Q87 A;  1LP1 B;  4E32 A;  3S1M I;  1EDK A;  2NVT I;  5IP9 I;  2NVX I;  1VQ4 1;  2AKL A;  3GTM S;  2E9H A;  2PK7 A;  2V8J A;  4NB8 A;  3CCR Z;  3NH5 A;  3HOV I;  1TWG I;  1KRL A;  3NDI A;  1USP B;  3JAM f;  2QA4 Z;  2VUM I;  4QTU A;  2QRC B;  1VQ8 1;  1L1O C;  4ZMD A;  3I55 1;  5T64 A;  3G6E 1;  3CMA Z;  2NVY I;  1QVF Y;  1WII A;  1TWF I;  3KIF A;  5FLX f;  3CPW Z;  3G71 1;  4BBR I;  1KD1 2;  4NOZ A;  2Q1K A;  2QKD A;  2QR1 B;  4RVH A;  3CC2 1;  4WWI A;  2KUB A;  2RKL A;  1RLY A;  2JNY A;  2QEX Z;  2OTK E;  4KJM A;  1VQN Z;  4A3L I;  1NVO A;  3J81 f;  3J7A 4;  1YIT Z;  1YJ9 Z;  2OTJ Z;  2F4M A;  3F3F C;  5FLM I;  1S72 Z;  1OVV A;  4BBS I;  2W03 A;  1ZW0 A;  1WW9 A;  4MD9 A;  4HGZ A;  1VQ4 Z;  4AYB A;  1SFO I;  4MD7 A;  2V8I A;  2GTI A;  4NBD A;  4A3C I;  1JM0 A;  3GTL I;  4NBF A;  3CCS Z;  4A3F I;  5A2Q f;  4ASV A;  4K3A A;  3S16 I;  2QRX A;  4E30 A;  5LL6 f;  1S7M A;  3VMG A;  3CCM 1;  2GU2 A;  3CCL Z;  2I3C A;  2JA8 I;  1LP1 A;  3S15 I;  2QRD B;  1VQO Z;  1K9M 2;  3EER A;  2KIK A;  5FLX b;  1VQL Z;  3G4S 1;  3VTN A;  2LR2 A;  4A3M I;  2DE7 A;  2HF1 A;  4E2X A;  1W2B Y;  4CPG A;  3FKI I;  3HOX I;  4MON A;  3NDJ A;  1Y1V S;  4CL1 A;  1K9M 1;  3J81 b;  3CC7 1;  4HB1 A;  2J6A A;  2EGT A;  1M90 1;  4ASW A;  4BXL A;  4GOF A;  1VQ9 1;  3S2D I;  1H0T B;  3CCE Z;  1EDJ A;  2IZ4 A;  2O4H A;  3I07 A;  1K73 2;  1VQM 1;  3CD6 Z;  2OOY B;  2QRE B;  1KQS Z;  3I55 Z;  4RVD A;  4NPD A;  2R93 I;  4MD8 A;  3CCS 1;  3BG0 B;  3HOY I;  2R6M A;  2QLV B;  3FQQ A;  2YAD A;  3CCM Z;  3NFZ A;  2JR6 A;  3VMH A;  1BDC A;  5A2Q b;  1Q2N A;  4DQY B;  1SS1 A;  4A3B I;  3J80 f;  3QWU A;  2G2K A;  1VQP Z;  4NBA A;  4RVF A;  1ZXG A;  1DEE G;  1BDD A;  4Y52 I;  1PFT A;  1K83 I;  1P9N A;  2BJO A;  3CCQ 1;  1MFT A;  1RO2 A;  4S1T A;  1K8A 1;  1FC2 C;  2JWD A;  3QWO C;  3S17 I;  1OVR A;  1YIJ Z;  5T67 A;  3CCJ Z;  4ZNC A;  3I4N I;  1VQ7 Z;  2HU9 A;  2KZJ A;  1N8R 1;  4A93 I;  1RO4 A;  3BG1 B;  2SPZ A;  1YHQ 1;  1Q81 2;  2HR3 A;  3M3Y I;  2P3Y A;  1VQM Z;  3CD6 1;  2Q51 A;  4TNU A;  3HKZ A;  1JWH C;  3MHV A;  1DL6 A;  1Q86 2;  1QVG Y;  3PO3 I;  1N2F A;  2B63 I;  5EFW B;  3IF8 A;  3RGU A;  2M6N A;  3S1Q I;  3H3V J;  4BY1 I;  1YJN 1;  2I8D A;  3GTM I;  1Z02 A;  1U7J A;  3J80 b;  3TE5 B;  1KQS Y;  4NPF X;  4Y7N I;  3CCU 1;  3MON A;  2RT9 A;  1Q7Y 1;  3T4N B;  3VB9 A;  1KD1 1;  5C4X I;  4NB9 A;  3CME Z;  4HKZ H;  1VLA A;  2O53 A;  2KI7 B;  3NH8 A;  3HOW I;  5C44 I;  3S1R I;  2Q4Z A;  2QEX 1;  3CCQ Z;  1QVG Z;  2B87 B;  3CC7 Z;  3CCU Z;  3D9X A;  1VQN 1;  2R7Z I;  2OTJ 1;  2RHB A;  1YIT 1;  2P58 A;  3M4O I;  4A3J I;  1TFI A;  1JJ2 Y;  1ML8 A;  1YI2 Z;  2VF1 A;  3S2H I;  3CCV 1;  1YJW Z;  2JA6 I;  2GTH A;  1VQ6 1;  4NBC A;  2WAQ A;  1W2B Z;  1QF8 A;  4A3I I;  1OVU A;  3PH0 A;  1YUA A;  2QVA A;  3GTG I;  4BY7 I;  1K73 1;  5C3E I;  1X0T A;  3PO2 I;  1S72 1;  4HH4 A;  2LXB A;  1I3Q I;  2R44 A;  2RPR A;  1VQ5 1;  5DJU B;  3RZD I;  1Q82 1;  3FXD A;  2NVQ I;  2QA4 1;  1TWC I;  1NJI 2;  1VQ8 Z;  2WB1 A;  1M1K 2;  3CCV Z;  1U7M A;  4MN4 C;  2LXC B;  2KPI A;  4E2Y A;  4RVG A;  1YUK A;  4DK1 A;  1VQP 1;  1VQO 1;  2KS1 B;  1Z01 A;  3D6W A;  1RO0 A;  2DE5 A;  1I6H I;  2PMZ A;  5D1O A;  1M1K 1;  3S1K A;  3CC4 Z;  2OOX B;  3CCL 1;  3GKQ A;  3OW2 Z;  2R92 I;  1WCM I;  3GCF A;  2E2H I;  3I56 1;  1Z03 A;  1X3W A;  2B88 A;  4GOD A;  1VQL 1;  4RS4 A;  2WMM A;  3IX0 A;  1ZH1 A;  3NH4 A;  4NPE A;  2W04 A;  4HGY A;  5IT9 b;  2JUB A;  5IP7 I;  3CC4 1;  5D1P A;  3PO3 S;  2P28 A;  4XX2 A;  1KC8 1;  4NBB A;  2JA5 I;  4NBE A;  2E2I I;  3HOZ I;  3EED A;  4QTT A;  3I56 Z;  1QYP A;  1VQK Z;  4A3K I;  1RQF A;  3CCE 1;  1K8A 2;  3CCR 1;  2B89 A;  4E31 A;  1H0T A;  3K7A I;  3KIH A;  3CQZ I;  3CME 1;  2LIY A;  1Q82 2;  5C4J I;  1QVF Z;  2PM9 A;  4MRI A;  4A3E I;  3I4M I;  2B87 A;  2H85 A;  2JS4 A;  2K5R A;  4NBG A;  3HOU I;  1VQK 1;  3ZDM A;  5K5G B;  3CXC Z;  4E2Z A;  4EYY Q;  2KZI A;  5D1O B;  4A3D I;  1EC5 A;  2RIQ A;  3G4S Z;  2F4O A;  4E33 A;  2Y0S A;  2JA7 I;  2M48 A;  3G6E Z;  3RZO I;  1Y1W I;  1TWA I;  5CM2 M;  1YI2 1;  2OTL 1;  3MZW B;  1YJW 1;  1Q86 1;  5T6B A;  3GTO I;  1VQ6 Z;  3P5J B;  1NUI A;  3FQM A;  5C39 A;  4NFR A;  3GTK I;  1Q81 1;  2M0B A;  1ZB8 A;  1ZB9 A;  4RV9 A;  3CC2 Z;  4A3G I;  2ZAE B;  3CXC Y;  4X6A I;  2DE6 A;  1VQ7 1;  1Y47 A;  3TDH B;  1N8R 2;  2OZK A;  5IT9 f;  3OW2 Y;  2VUG A;  1Q7Y 2;  1KC8 2;  3CPW Y;  2V8K A;  1YHQ Z;  4MH4 A;  1R9T I;  1VQ9 Z;  5CBN A;  3MZL B;  3MZK B;  1RNI A;  1VQ5 Z;  4E2W A;  1NP6 A;  1X3Z A;  1NJI 1;  3FXE A;  2IZ3 A;  4EWC A;  1Y1V I;  1USP A;  3H0G I;  4DGL A;  3JAM b;  2LFU A;  2E2J I;  3F3P C;  1YJN Z;  3S1N I;  4BXX I;  3GTJ I;  2OTL Z;  4MXU A;  3S14 I;  3ESW A;  1JMB A;  1M90 2;  5AN9 F;  1EDL A;  4K35 A;  3GTQ I;  5CBO A;  5DJT B;  3G71 Z;  3IFU A;  2UWJ E;  1LT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...