1VQMZ

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqmZ00
3OW2Z 1JJ2Z 1Q822 2QEX1 3CMA1 3I551 3CCS1 1VQN1 1K9M2 1Q821 1JJ2Y 1Q7Y2 1K8A2 2OTLZ 3CCSZ 1VQK1 1KC82 1K9M1 3CC71 1YJWZ 1VQ5Z 1Q7Y1 1K8A1 3I561 3CD6Z 1M902 3CCJZ 1KC81 3CCU1 1YI2Z 1M901 1VQ81 1K732 3CCE1 2QA41 3CME1 3CCVZ 1VQMZ 2OTJ1 3CCM1 1K731 2QEXZ 3OW2Y 3CXCZ 1KQSZ 1VQ41 1VQ71 3CMAZ 1VQL1 3I55Z 1VQNZ 1W2BZ 3CCR1 1VQP1 3CC41 3CXCY 1VQ61 1VQKZ 3CCQ1 1YIJ1 1YJ91 1N8R2 3CC7Z 1W2BY 3G6E1 3I56Z 1YIT1 1QVFZ 1N8R1 1VQ91 3CCUZ 1YHQ1 3G711 1VQ8Z 1QVFY 3CCEZ 2QA4Z 3CMEZ 1S721 3CC21 2OTJZ 1YJN1 3CCMZ 3CCL1 3CPWZ 1VQ4Z 1VQ7Z 3G4S1 1VQLZ 1KQSY 3CCRZ 1VQPZ 3CC4Z 1M1K2 1VQ6Z 3CCQZ 1YIJZ 1YJ9Z 1Q812 3G6EZ 1Q862 1VQO1 2OTL1 1YITZ 1M1K1 1QVGZ 1Q811 1VQ9Z 1VQOZ 1YJW1 1VQ51 1Q861 3CD61 1YHQZ 3G71Z 3CCJ1 1QVGY 1NJI2 1KD12 1YI21 1S72Z 3CC2Z 1NJI1 1KD11 1YJNZ 3CCLZ 3CPWY 3CCV1 1VQM1 3G4SZ
chains in the Genus database with same CATH superfamily
2E7ZA 1L1OC 1JJ2Z 2DE7A 2GU2A 2PM9A 3CCS1 1K9M2 2E2II 5LL6f 2RBLA 2JIQA 2JA5I 1VQK1 1KC82 3I4NI 2QRCB 3GCFA 1TWGI 1K8A1 2NVQI 2NVXI 1TWAI 3JAMf 2NAPA 3NH8A 2E2HI 1YI2Z 3U50C 4A3LI 1VQ81 3VB9A 2NVTI 1DL6A 1R9TI 1K732 3CCE1 3S16I 2R93I 2F4OA 3CME1 1FDIA 2Q4ZA 1AA6A 1I3QI 3F3FC 3OW2Y 3CXCZ 2P28A 2R7ZI 1VQ71 1VQL1 2PK7A 3NDIA 4NH1C 1VQP1 2V8KA 1VQ61 2OOYB 5A2Qf 1VQKZ 1YIJ1 1YJ91 4NB8A 1W2BY 2AKLA 4RV9A 3G6E1 3S1QI 3KIFA 1QVFZ 2JNYA 1VQ91 4S1TA 1ZB9A 1VQ8Z 3D6WA 3FQMA 1RO2A 3CCEZ 3J81f 3CMEZ 2Q51A 4X6AI 1S721 2RPRA 1VQ7Z 3G4S1 1VQLZ 4EWCA 1I6HI 1VQPZ 5IT9b 1QXFA 1VQ6Z 2JIRA 1YIJZ 1YJ9Z 3GTPI 2WB1A 3G6EZ 1VQO1 4E2WA 2OTL1 2JUBA 1M1K1 2WAQA 1QVGZ 3NH5A 1Q811 1VQ9Z 1VQ51 2LEXA 4XX2A 1TFIA 3D9XA 1RLYA 2E9HA 1NJI2 1Q16A 3K7AI 3PO2I 1S72Z 2HU9A 2VPWA 3MZKB 4NOZA 3IX0A 3CPWY 3G4SZ 2QR1B 3P5JB 4NBHA 4A3II 2H85A 3S1MI 1QF8A 3S2HI 1Q821 1JJ2Y 2HF1A 2QLVB 3FKII 1K8A2 2OTLZ 1WW9A 4A3JI 4AYBA 4HGZA 1VQ5Z 3GTQI 3S17I 2KPIA 1RO4A 3J7A4 1SIWA 4A3KI 2K5RA 1M901 3NDJA 2YU9I 3S1NI 3I07A 3T4NB 1WJ2A 4A3BI 2JA8I 4NB9A 4RVFA 1NUIA 3HOXI 2RT9A 1WCMI 3PO3I 2VF1A 4DGLA 1KQSZ 1VQ41 1K83I 2ZAEB 2OZKA 3CXCY 5FLXf 3HOUI 3CCQ1 1Y8CA 1YIT1 4RVDA 2O53A 2QREB 3TDHB 1Z03A 3JAMb 1YHQ1 3G711 3H0GI 1QVFY 2K3RA 4BY7I 3TE5B 5T64A 3M3YI 1Y1VI 1YUAA 4MRIA 1WIIA 2VPZA 3GKQA 1YJN1 2IZ3A 3NFZA 1PFTA 1VQ4Z 2M6NA 1SFOI 1M1K2 1TWHI 3CCQZ 1Q812 4MD8A 2B63I 1YITZ 4DQYB 5A2Qb 4RVGA 2EGTA 2O4HA 4BXXI 1RNIA 2V45A 4E2YA 3HKZA 1YJW1 3GTMI 2AYDA 4CL1A 1YHQZ 3G71Z 1QVGY 1Y1WI 3HOYI 3J80f 1LQLA 1WZNA 3EEDA 1YJNZ 1X0TA 5C4XI 3J81b 3CCV1 4Y52I 4E2XA 2E2JI 4NBGA 3OW2Z 3J80b 1Q822 4RS4A 1Z02A 2QEX1 4NBDA 5CM2M 2V8JA 2PMZA 2F4MA 3GTJI 3ESWA 3I4MI 1I50I 3VTNA 5T6BA 3F3PC 1TWFI 4MXUA 1YJWZ 1Q7Y1 1M902 3RZDI 1ML8A 4A3DI 3FQQA 2NVYI 2VUGA 4E33A 4Y7NI 2JIOA 4A3CI 2VPXA 2P3YA 3CCVZ 2LFUA 1JWHC 5T67A 3BG0B 4NBAA 2KI7B 2W03A 4BBSI 2QEXZ 3GTLI 5IP9I 3IFUA 3NH4A 2G2KA 1TWCI 1Z01A 2JMOA 3MZLB 3S14I 1N8R1 4E32A 4A93I 3BG1B 1YUKA 1QYPA 2JR6A 4MH4A 3CCL1 3CPWZ 2GTHA 2V8IA 3KIHA 3IF8A 3QWUA 2BJOA 1VLAA 4A3MI 2RIQA 2W04A 3LUSA 3HOZI 2JA6I 5FLXb 2YADA 2I3CA 2QKDA 4MD7A 2J6AA 1Q861 3CD61 4MONA 3CCJ1 3S15I 2JS4A 3S2DI 2IV2X 1KD11 4NBFA 3CCLZ 5IP7I 1N2FA 1VQM1 2JIMA 5C44I 3HOWI 5D1PA 3IR7A 2DE6A 2JIPA 2IZ4A 3CMA1 3I551 1VQN1 3M4OI 1Q7Y2 5FLMI 3CCSZ 1K9M1 2VPYA 4NFRA 3CC71 1ZB8A 4BBRI 3I561 3CD6Z 2V3VA 3GTKI 4HH4A 3H3VJ 3CCJZ 1KC81 2R6MA 3CCU1 3GTOI 4A3GI 2OOXB 3PO3S 1USPB 4NBBA 2QA41 4BY1I 1USPA 1VQMZ 2OTJ1 1RQFA 2LIYA 3CCM1 1K731 4NBCA 5IT9f 4QTTA 3CMAZ 3I55Z 3CQZI 1W2BZ 1VQNZ 1X3ZA 1P9NA 3CCR1 3CC41 3VMHA 3D2LA 1N8R2 3VMGA 3CC7Z 2JA7I 3I56Z 4NBEA 2Y0SA 1Y1VS 1RO0A 3CCUZ 3MONA 1ZH1A 2VUMI 5AN9F 1FDOA 4HGYA 2QA4Z 1KRLA 3CC21 2OTJZ 3CCMZ 2R92I 4MD9A 4DK1A 4QTUA 1KQSY 4E2ZA 4RVHA 3S1RI 2RHBA 3CCRZ 3CC4Z 4A3EI 4E31A 3GTMS 3VMIA 2M48A 1Q862 3EERA 3GTGI 2GTIA 1S7MA 5C4JI 5D1OB 1NP6A 2QRDB 1X3WA 5D1OA 1VQOZ 4TNUA 4A3FI 4E30A 2DE5A 3RZOI 1KD12 1YI21 3Q87A 3CC2Z 1NJI1 3HOVI 5C3EI
chains in the Genus database with same CATH topology
1L1OC 1JJ2Z 2DE7A 2GU2A 2PM9A 3CCS1 1K9M2 2E2II 5LL6f 2RBLA 2JA5I 1VQK1 1KC82 3I4NI 2QRCB 3GCFA 1TWGI 1K8A1 2NVQI 2NVXI 1TWAI 3JAMf 3NH8A 2E2HI 1YI2Z 3U50C 4A3LI 1VQ81 3VB9A 2NVTI 1DL6A 1R9TI 1K732 3CCE1 3S16I 2R93I 2F4OA 3CME1 2Q4ZA 1I3QI 3F3FC 3OW2Y 3CXCZ 2P28A 2R7ZI 1VQ71 1VQL1 2PK7A 3NDIA 4NH1C 1VQP1 2V8KA 1VQ61 2OOYB 5A2Qf 1VQKZ 1YIJ1 1YJ91 4NB8A 1W2BY 2AKLA 4RV9A 3G6E1 3S1QI 3KIFA 1QVFZ 2JNYA 1VQ91 4S1TA 1ZB9A 1VQ8Z 3D6WA 3FQMA 1RO2A 3CCEZ 3J81f 3CMEZ 2Q51A 4X6AI 1S721 2RPRA 1VQ7Z 3G4S1 1VQLZ 4EWCA 1I6HI 1VQPZ 5IT9b 1VQ6Z 1YIJZ 1YJ9Z 3GTPI 2WB1A 3G6EZ 1VQO1 4E2WA 2OTL1 2JUBA 1M1K1 2WAQA 1QVGZ 3NH5A 1Q811 1VQ9Z 1VQ51 4XX2A 1TFIA 3D9XA 1RLYA 2E9HA 1NJI2 3K7AI 3PO2I 1S72Z 2HU9A 3MZKB 4NOZA 3IX0A 3CPWY 3G4SZ 2QR1B 3P5JB 4NBHA 4A3II 2H85A 3S1MI 1QF8A 3S2HI 1Q821 1JJ2Y 2HF1A 2QLVB 3FKII 1K8A2 2OTLZ 1WW9A 4A3JI 4AYBA 4HGZA 1VQ5Z 3GTQI 3S17I 2KPIA 1RO4A 3J7A4 4A3KI 2K5RA 1M901 3NDJA 2YU9I 3S1NI 3I07A 3T4NB 4A3BI 2JA8I 4NB9A 4RVFA 1NUIA 3HOXI 2RT9A 1WCMI 3PO3I 2VF1A 4DGLA 1KQSZ 1VQ41 1K83I 2ZAEB 2OZKA 3CXCY 5FLXf 3HOUI 3CCQ1 1YIT1 4RVDA 2O53A 2QREB 3TDHB 1Z03A 3JAMb 1YHQ1 3G711 3H0GI 1QVFY 2K3RA 4BY7I 3TE5B 5T64A 3M3YI 1Y1VI 1YUAA 4MRIA 1WIIA 3GKQA 1YJN1 2IZ3A 3NFZA 1PFTA 1VQ4Z 2M6NA 1SFOI 1M1K2 1TWHI 3CCQZ 1Q812 4MD8A 2B63I 1YITZ 4DQYB 5A2Qb 4RVGA 2EGTA 2O4HA 4BXXI 1RNIA 4E2YA 3HKZA 1YJW1 3GTMI 4CL1A 1YHQZ 3G71Z 1QVGY 1Y1WI 3HOYI 3J80f 1LQLA 3EEDA 1YJNZ 1X0TA 5C4XI 3J81b 3CCV1 4Y52I 4E2XA 2E2JI 4NBGA 3OW2Z 3J80b 1Q822 4RS4A 1Z02A 2QEX1 4NBDA 5CM2M 2V8JA 2PMZA 2F4MA 3GTJI 3ESWA 3I4MI 1I50I 3VTNA 5T6BA 3F3PC 1TWFI 4MXUA 1YJWZ 1Q7Y1 1M902 3RZDI 1ML8A 4A3DI 3FQQA 2NVYI 2VUGA 4E33A 4Y7NI 4A3CI 2P3YA 3CCVZ 2LFUA 1JWHC 5T67A 3BG0B 4NBAA 2KI7B 2W03A 4BBSI 2QEXZ 3GTLI 5IP9I 3IFUA 3NH4A 2G2KA 1TWCI 1Z01A 2JMOA 3MZLB 3S14I 1N8R1 4E32A 4A93I 3BG1B 1YUKA 1QYPA 2JR6A 4MH4A 3CCL1 3CPWZ 2GTHA 2V8IA 3KIHA 3IF8A 3QWUA 2BJOA 1VLAA 4A3MI 2RIQA 2W04A 3LUSA 3HOZI 2JA6I 5FLXb 2YADA 2I3CA 2QKDA 4MD7A 2J6AA 1Q861 3CD61 4MONA 3CCJ1 3S15I 2JS4A 3S2DI 1KD11 4NBFA 3CCLZ 5IP7I 1VQM1 1N2FA 5C44I 3HOWI 5D1PA 2DE6A 2IZ4A 3CMA1 3I551 1VQN1 3M4OI 1Q7Y2 5FLMI 3CCSZ 1K9M1 4NFRA 3CC71 1ZB8A 4BBRI 3I561 3CD6Z 3GTKI 4HH4A 3H3VJ 3CCJZ 1KC81 2R6MA 3CCU1 3GTOI 4A3GI 2OOXB 3PO3S 1USPB 4NBBA 2QA41 4BY1I 1USPA 1VQMZ 2OTJ1 1RQFA 2LIYA 3CCM1 1K731 4NBCA 5IT9f 4QTTA 3CMAZ 3I55Z 3CQZI 1W2BZ 1VQNZ 1X3ZA 1P9NA 3CCR1 3CC41 3VMHA 1N8R2 3VMGA 3CC7Z 2JA7I 3I56Z 4NBEA 2Y0SA 1Y1VS 1RO0A 3CCUZ 3MONA 1ZH1A 2VUMI 5AN9F 4HGYA 2QA4Z 1KRLA 3CC21 2OTJZ 3CCMZ 2R92I 4MD9A 4DK1A 4QTUA 1KQSY 4E2ZA 4RVHA 3S1RI 2RHBA 3CCRZ 3CC4Z 4A3EI 4E31A 3GTMS 3VMIA 2M48A 1Q862 3EERA 3GTGI 2GTIA 1S7MA 5C4JI 5D1OB 1NP6A 2QRDB 1X3WA 5D1OA 1VQOZ 4TNUA 4A3FI 4E30A 2DE5A 3RZOI 1KD12 1YI21 3Q87A 3CC2Z 1NJI1 3HOVI 5C3EI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 Z;  1JJ2 Z;  1Q82 2;  2QEX 1;  3CMA 1;  3I55 1;  3CCS 1;  1VQN 1;  1K9M 2;  1Q82 1;  1JJ2 Y;  1Q7Y 2;  1K8A 2;  2OTL Z;  3CCS Z;  1VQK 1;  1KC8 2;  1K9M 1;  3CC7 1;  1YJW Z;  1VQ5 Z;  1Q7Y 1;  1K8A 1;  3I56 1;  3CD6 Z;  1M90 2;  3CCJ Z;  1KC8 1;  3CCU 1;  1YI2 Z;  1M90 1;  1VQ8 1;  1K73 2;  3CCE 1;  2QA4 1;  3CME 1;  3CCV Z;  1VQM Z;  2OTJ 1;  3CCM 1;  1K73 1;  2QEX Z;  3OW2 Y;  3CXC Z;  1KQS Z;  1VQ4 1;  1VQ7 1;  3CMA Z;  1VQL 1;  3I55 Z;  1VQN Z;  1W2B Z;  3CCR 1;  1VQP 1;  3CC4 1;  3CXC Y;  1VQ6 1;  1VQK Z;  3CCQ 1;  1YIJ 1;  1YJ9 1;  1N8R 2;  3CC7 Z;  1W2B Y;  3G6E 1;  3I56 Z;  1YIT 1;  1QVF Z;  1N8R 1;  1VQ9 1;  3CCU Z;  1YHQ 1;  3G71 1;  1VQ8 Z;  1QVF Y;  3CCE Z;  2QA4 Z;  3CME Z;  1S72 1;  3CC2 1;  2OTJ Z;  1YJN 1;  3CCM Z;  3CCL 1;  3CPW Z;  1VQ4 Z;  1VQ7 Z;  3G4S 1;  1VQL Z;  1KQS Y;  3CCR Z;  1VQP Z;  3CC4 Z;  1M1K 2;  1VQ6 Z;  3CCQ Z;  1YIJ Z;  1YJ9 Z;  1Q81 2;  3G6E Z;  1Q86 2;  1VQO 1;  2OTL 1;  1YIT Z;  1M1K 1;  1QVG Z;  1Q81 1;  1VQ9 Z;  1VQO Z;  1YJW 1;  1VQ5 1;  1Q86 1;  3CD6 1;  1YHQ Z;  3G71 Z;  3CCJ 1;  1QVG Y;  1NJI 2;  1KD1 2;  1YI2 1;  1S72 Z;  3CC2 Z;  1NJI 1;  1KD1 1;  1YJN Z;  3CCL Z;  3CPW Y;  3CCV 1;  1VQM 1;  3G4S Z; 
#chains in the Genus database with same CATH topology
 2E7Z A;  1L1O C;  1JJ2 Z;  2DE7 A;  2GU2 A;  2PM9 A;  3CCS 1;  1K9M 2;  2E2I I;  5LL6 f;  2RBL A;  2JIQ A;  2JA5 I;  1VQK 1;  1KC8 2;  3I4N I;  2QRC B;  3GCF A;  1TWG I;  1K8A 1;  2NVQ I;  2NVX I;  1TWA I;  3JAM f;  2NAP A;  3NH8 A;  2E2H I;  1YI2 Z;  3U50 C;  4A3L I;  1VQ8 1;  3VB9 A;  2NVT I;  1DL6 A;  1R9T I;  1K73 2;  3CCE 1;  3S16 I;  2R93 I;  2F4O A;  3CME 1;  1FDI A;  2Q4Z A;  1AA6 A;  1I3Q I;  3F3F C;  3OW2 Y;  3CXC Z;  2P28 A;  2R7Z I;  1VQ7 1;  1VQL 1;  2PK7 A;  3NDI A;  4NH1 C;  1VQP 1;  2V8K A;  1VQ6 1;  2OOY B;  5A2Q f;  1VQK Z;  1YIJ 1;  1YJ9 1;  4NB8 A;  1W2B Y;  2AKL A;  4RV9 A;  3G6E 1;  3S1Q I;  3KIF A;  1QVF Z;  2JNY A;  1VQ9 1;  4S1T A;  1ZB9 A;  1VQ8 Z;  3D6W A;  3FQM A;  1RO2 A;  3CCE Z;  3J81 f;  3CME Z;  2Q51 A;  4X6A I;  1S72 1;  2RPR A;  1VQ7 Z;  3G4S 1;  1VQL Z;  4EWC A;  1I6H I;  1VQP Z;  5IT9 b;  1QXF A;  1VQ6 Z;  2JIR A;  1YIJ Z;  1YJ9 Z;  3GTP I;  2WB1 A;  3G6E Z;  1VQO 1;  4E2W A;  2OTL 1;  2JUB A;  1M1K 1;  2WAQ A;  1QVG Z;  3NH5 A;  1Q81 1;  1VQ9 Z;  1VQ5 1;  2LEX A;  4XX2 A;  1TFI A;  3D9X A;  1RLY A;  2E9H A;  1NJI 2;  1Q16 A;  3K7A I;  3PO2 I;  1S72 Z;  2HU9 A;  2VPW A;  3MZK B;  4NOZ A;  3IX0 A;  3CPW Y;  3G4S Z;  2QR1 B;  3P5J B;  4NBH A;  4A3I I;  2H85 A;  3S1M I;  1QF8 A;  3S2H I;  1Q82 1;  1JJ2 Y;  2HF1 A;  2QLV B;  3FKI I;  1K8A 2;  2OTL Z;  1WW9 A;  4A3J I;  4AYB A;  4HGZ A;  1VQ5 Z;  3GTQ I;  3S17 I;  2KPI A;  1RO4 A;  3J7A 4;  1SIW A;  4A3K I;  2K5R A;  1M90 1;  3NDJ A;  2YU9 I;  3S1N I;  3I07 A;  3T4N B;  1WJ2 A;  4A3B I;  2JA8 I;  4NB9 A;  4RVF A;  1NUI A;  3HOX I;  2RT9 A;  1WCM I;  3PO3 I;  2VF1 A;  4DGL A;  1KQS Z;  1VQ4 1;  1K83 I;  2ZAE B;  2OZK A;  3CXC Y;  5FLX f;  3HOU I;  3CCQ 1;  1Y8C A;  1YIT 1;  4RVD A;  2O53 A;  2QRE B;  3TDH B;  1Z03 A;  3JAM b;  1YHQ 1;  3G71 1;  3H0G I;  1QVF Y;  2K3R A;  4BY7 I;  3TE5 B;  5T64 A;  3M3Y I;  1Y1V I;  1YUA A;  4MRI A;  1WII A;  2VPZ A;  3GKQ A;  1YJN 1;  2IZ3 A;  3NFZ A;  1PFT A;  1VQ4 Z;  2M6N A;  1SFO I;  1M1K 2;  1TWH I;  3CCQ Z;  1Q81 2;  4MD8 A;  2B63 I;  1YIT Z;  4DQY B;  5A2Q b;  4RVG A;  2EGT A;  2O4H A;  4BXX I;  1RNI A;  2V45 A;  4E2Y A;  3HKZ A;  1YJW 1;  3GTM I;  2AYD A;  4CL1 A;  1YHQ Z;  3G71 Z;  1QVG Y;  1Y1W I;  3HOY I;  3J80 f;  1LQL A;  1WZN A;  3EED A;  1YJN Z;  1X0T A;  5C4X I;  3J81 b;  3CCV 1;  4Y52 I;  4E2X A;  2E2J I;  4NBG A;  3OW2 Z;  3J80 b;  1Q82 2;  4RS4 A;  1Z02 A;  2QEX 1;  4NBD A;  5CM2 M;  2V8J A;  2PMZ A;  2F4M A;  3GTJ I;  3ESW A;  3I4M I;  1I50 I;  3VTN A;  5T6B A;  3F3P C;  1TWF I;  4MXU A;  1YJW Z;  1Q7Y 1;  1M90 2;  3RZD I;  1ML8 A;  4A3D I;  3FQQ A;  2NVY I;  2VUG A;  4E33 A;  4Y7N I;  2JIO A;  4A3C I;  2VPX A;  2P3Y A;  3CCV Z;  2LFU A;  1JWH C;  5T67 A;  3BG0 B;  4NBA A;  2KI7 B;  2W03 A;  4BBS I;  2QEX Z;  3GTL I;  5IP9 I;  3IFU A;  3NH4 A;  2G2K A;  1TWC I;  1Z01 A;  2JMO A;  3MZL B;  3S14 I;  1N8R 1;  4E32 A;  4A93 I;  3BG1 B;  1YUK A;  1QYP A;  2JR6 A;  4MH4 A;  3CCL 1;  3CPW Z;  2GTH A;  2V8I A;  3KIH A;  3IF8 A;  3QWU A;  2BJO A;  1VLA A;  4A3M I;  2RIQ A;  2W04 A;  3LUS A;  3HOZ I;  2JA6 I;  5FLX b;  2YAD A;  2I3C A;  2QKD A;  4MD7 A;  2J6A A;  1Q86 1;  3CD6 1;  4MON A;  3CCJ 1;  3S15 I;  2JS4 A;  3S2D I;  2IV2 X;  1KD1 1;  4NBF A;  3CCL Z;  5IP7 I;  1N2F A;  1VQM 1;  2JIM A;  5C44 I;  3HOW I;  5D1P A;  3IR7 A;  2DE6 A;  2JIP A;  2IZ4 A;  3CMA 1;  3I55 1;  1VQN 1;  3M4O I;  1Q7Y 2;  5FLM I;  3CCS Z;  1K9M 1;  2VPY A;  4NFR A;  3CC7 1;  1ZB8 A;  4BBR I;  3I56 1;  3CD6 Z;  2V3V A;  3GTK I;  4HH4 A;  3H3V J;  3CCJ Z;  1KC8 1;  2R6M A;  3CCU 1;  3GTO I;  4A3G I;  2OOX B;  3PO3 S;  1USP B;  4NBB A;  2QA4 1;  4BY1 I;  1USP A;  1VQM Z;  2OTJ 1;  1RQF A;  2LIY A;  3CCM 1;  1K73 1;  4NBC A;  5IT9 f;  4QTT A;  3CMA Z;  3I55 Z;  3CQZ I;  1W2B Z;  1VQN Z;  1X3Z A;  1P9N A;  3CCR 1;  3CC4 1;  3VMH A;  3D2L A;  1N8R 2;  3VMG A;  3CC7 Z;  2JA7 I;  3I56 Z;  4NBE A;  2Y0S A;  1Y1V S;  1RO0 A;  3CCU Z;  3MON A;  1ZH1 A;  2VUM I;  5AN9 F;  1FDO A;  4HGY A;  2QA4 Z;  1KRL A;  3CC2 1;  2OTJ Z;  3CCM Z;  2R92 I;  4MD9 A;  4DK1 A;  4QTU A;  1KQS Y;  4E2Z A;  4RVH A;  3S1R I;  2RHB A;  3CCR Z;  3CC4 Z;  4A3E I;  4E31 A;  3GTM S;  3VMI A;  2M48 A;  1Q86 2;  3EER A;  3GTG I;  2GTI A;  1S7M A;  5C4J I;  5D1O B;  1NP6 A;  2QRD B;  1X3W A;  5D1O A;  1VQO Z;  4TNU A;  4A3F I;  4E30 A;  2DE5 A;  3RZO I;  1KD1 2;  1YI2 1;  3Q87 A;  3CC2 Z;  1NJI 1;  3HOV I;  5C3E I; 
#chains in the Genus database with same CATH homology
 1L1O C;  1JJ2 Z;  2DE7 A;  2GU2 A;  2PM9 A;  3CCS 1;  1K9M 2;  2E2I I;  5LL6 f;  2RBL A;  2JA5 I;  1VQK 1;  1KC8 2;  3I4N I;  2QRC B;  3GCF A;  1TWG I;  1K8A 1;  2NVQ I;  2NVX I;  1TWA I;  3JAM f;  3NH8 A;  2E2H I;  1YI2 Z;  3U50 C;  4A3L I;  1VQ8 1;  3VB9 A;  2NVT I;  1DL6 A;  1R9T I;  1K73 2;  3CCE 1;  3S16 I;  2R93 I;  2F4O A;  3CME 1;  2Q4Z A;  1I3Q I;  3F3F C;  3OW2 Y;  3CXC Z;  2P28 A;  2R7Z I;  1VQ7 1;  1VQL 1;  2PK7 A;  3NDI A;  4NH1 C;  1VQP 1;  2V8K A;  1VQ6 1;  2OOY B;  5A2Q f;  1VQK Z;  1YIJ 1;  1YJ9 1;  4NB8 A;  1W2B Y;  2AKL A;  4RV9 A;  3G6E 1;  3S1Q I;  3KIF A;  1QVF Z;  2JNY A;  1VQ9 1;  4S1T A;  1ZB9 A;  1VQ8 Z;  3D6W A;  3FQM A;  1RO2 A;  3CCE Z;  3J81 f;  3CME Z;  2Q51 A;  4X6A I;  1S72 1;  2RPR A;  1VQ7 Z;  3G4S 1;  1VQL Z;  4EWC A;  1I6H I;  1VQP Z;  5IT9 b;  1VQ6 Z;  1YIJ Z;  1YJ9 Z;  3GTP I;  2WB1 A;  3G6E Z;  1VQO 1;  4E2W A;  2OTL 1;  2JUB A;  1M1K 1;  2WAQ A;  1QVG Z;  3NH5 A;  1Q81 1;  1VQ9 Z;  1VQ5 1;  4XX2 A;  1TFI A;  3D9X A;  1RLY A;  2E9H A;  1NJI 2;  3K7A I;  3PO2 I;  1S72 Z;  2HU9 A;  3MZK B;  4NOZ A;  3IX0 A;  3CPW Y;  3G4S Z;  2QR1 B;  3P5J B;  4NBH A;  4A3I I;  2H85 A;  3S1M I;  1QF8 A;  3S2H I;  1Q82 1;  1JJ2 Y;  2HF1 A;  2QLV B;  3FKI I;  1K8A 2;  2OTL Z;  1WW9 A;  4A3J I;  4AYB A;  4HGZ A;  1VQ5 Z;  3GTQ I;  3S17 I;  2KPI A;  1RO4 A;  3J7A 4;  4A3K I;  2K5R A;  1M90 1;  3NDJ A;  2YU9 I;  3S1N I;  3I07 A;  3T4N B;  4A3B I;  2JA8 I;  4NB9 A;  4RVF A;  1NUI A;  3HOX I;  2RT9 A;  1WCM I;  3PO3 I;  2VF1 A;  4DGL A;  1KQS Z;  1VQ4 1;  1K83 I;  2ZAE B;  2OZK A;  3CXC Y;  5FLX f;  3HOU I;  3CCQ 1;  1YIT 1;  4RVD A;  2O53 A;  2QRE B;  3TDH B;  1Z03 A;  3JAM b;  1YHQ 1;  3G71 1;  3H0G I;  1QVF Y;  2K3R A;  4BY7 I;  3TE5 B;  5T64 A;  3M3Y I;  1Y1V I;  1YUA A;  4MRI A;  1WII A;  3GKQ A;  1YJN 1;  2IZ3 A;  3NFZ A;  1PFT A;  1VQ4 Z;  2M6N A;  1SFO I;  1M1K 2;  1TWH I;  3CCQ Z;  1Q81 2;  4MD8 A;  2B63 I;  1YIT Z;  4DQY B;  5A2Q b;  4RVG A;  2EGT A;  2O4H A;  4BXX I;  1RNI A;  4E2Y A;  3HKZ A;  1YJW 1;  3GTM I;  4CL1 A;  1YHQ Z;  3G71 Z;  1QVG Y;  1Y1W I;  3HOY I;  3J80 f;  1LQL A;  3EED A;  1YJN Z;  1X0T A;  5C4X I;  3J81 b;  3CCV 1;  4Y52 I;  4E2X A;  2E2J I;  4NBG A;  3OW2 Z;  3J80 b;  1Q82 2;  4RS4 A;  1Z02 A;  2QEX 1;  4NBD A;  5CM2 M;  2V8J A;  2PMZ A;  2F4M A;  3GTJ I;  3ESW A;  3I4M I;  1I50 I;  3VTN A;  5T6B A;  3F3P C;  1TWF I;  4MXU A;  1YJW Z;  1Q7Y 1;  1M90 2;  3RZD I;  1ML8 A;  4A3D I;  3FQQ A;  2NVY I;  2VUG A;  4E33 A;  4Y7N I;  4A3C I;  2P3Y A;  3CCV Z;  2LFU A;  1JWH C;  5T67 A;  3BG0 B;  4NBA A;  2KI7 B;  2W03 A;  4BBS I;  2QEX Z;  3GTL I;  5IP9 I;  3IFU A;  3NH4 A;  2G2K A;  1TWC I;  1Z01 A;  2JMO A;  3MZL B;  3S14 I;  1N8R 1;  4E32 A;  4A93 I;  3BG1 B;  1YUK A;  1QYP A;  2JR6 A;  4MH4 A;  3CCL 1;  3CPW Z;  2GTH A;  2V8I A;  3KIH A;  3IF8 A;  3QWU A;  2BJO A;  1VLA A;  4A3M I;  2RIQ A;  2W04 A;  3LUS A;  3HOZ I;  2JA6 I;  5FLX b;  2YAD A;  2I3C A;  2QKD A;  4MD7 A;  2J6A A;  1Q86 1;  3CD6 1;  4MON A;  3CCJ 1;  3S15 I;  2JS4 A;  3S2D I;  1KD1 1;  4NBF A;  3CCL Z;  5IP7 I;  1VQM 1;  1N2F A;  5C44 I;  3HOW I;  5D1P A;  2DE6 A;  2IZ4 A;  3CMA 1;  3I55 1;  1VQN 1;  3M4O I;  1Q7Y 2;  5FLM I;  3CCS Z;  1K9M 1;  4NFR A;  3CC7 1;  1ZB8 A;  4BBR I;  3I56 1;  3CD6 Z;  3GTK I;  4HH4 A;  3H3V J;  3CCJ Z;  1KC8 1;  2R6M A;  3CCU 1;  3GTO I;  4A3G I;  2OOX B;  3PO3 S;  1USP B;  4NBB A;  2QA4 1;  4BY1 I;  1USP A;  1VQM Z;  2OTJ 1;  1RQF A;  2LIY A;  3CCM 1;  1K73 1;  4NBC A;  5IT9 f;  4QTT A;  3CMA Z;  3I55 Z;  3CQZ I;  1W2B Z;  1VQN Z;  1X3Z A;  1P9N A;  3CCR 1;  3CC4 1;  3VMH A;  1N8R 2;  3VMG A;  3CC7 Z;  2JA7 I;  3I56 Z;  4NBE A;  2Y0S A;  1Y1V S;  1RO0 A;  3CCU Z;  3MON A;  1ZH1 A;  2VUM I;  5AN9 F;  4HGY A;  2QA4 Z;  1KRL A;  3CC2 1;  2OTJ Z;  3CCM Z;  2R92 I;  4MD9 A;  4DK1 A;  4QTU A;  1KQS Y;  4E2Z A;  4RVH A;  3S1R I;  2RHB A;  3CCR Z;  3CC4 Z;  4A3E I;  4E31 A;  3GTM S;  3VMI A;  2M48 A;  1Q86 2;  3EER A;  3GTG I;  2GTI A;  1S7M A;  5C4J I;  5D1O B;  1NP6 A;  2QRD B;  1X3W A;  5D1O A;  1VQO Z;  4TNU A;  4A3F I;  4E30 A;  2DE5 A;  3RZO I;  1KD1 2;  1YI2 1;  3Q87 A;  3CC2 Z;  1NJI 1;  3HOV I;  5C3E I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...