1VQMZ

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqmZ00
1Q862 1YIJZ 1YHQ1 1QVGY 2OTJ1 1K8A2 1Q7Y2 3CCJZ 1W2BZ 3CC4Z 1VQ61 1VQP1 1K9M2 3CPWY 1YJNZ 3CCS1 1VQLZ 2QA4Z 1VQ81 3CD61 1M1K2 1KQSZ 3I56Z 1NJI1 1QVFY 3CXCZ 1N8R1 1VQ41 1VQ71 1YI21 3CCEZ 1VQM1 3CCVZ 1VQ9Z 3CC7Z 3CCLZ 1K732 3G6EZ 1YIT1 3I551 2QEXZ 3CME1 3G711 1Q861 3CCU1 2OTLZ 1K8A1 1VQ5Z 2OTJZ 1YIJ1 1VQ6Z 1VQPZ 1KD11 1VQOZ 3CCJ1 1VQN1 1W2BY 1K9M1 1YJ91 3OW2Z 1S721 1KC82 1M1K1 1YJWZ 2QA41 3CCQZ 3CMAZ 3CC21 3CCMZ 1KQSY 1Q822 3I561 3CCRZ 3G4SZ 1VQKZ 3CXCY 1JJ2Z 1VQMZ 1Q812 1M902 1YHQZ 1QVGZ 1K731 3CCE1 1Q7Y1 3CCV1 1VQ91 3CC71 3CCL1 3CC41 2QEX1 3CPWZ 2OTL1 3CCSZ 1VQ8Z 3CD6Z 1VQ51 1YJN1 1VQL1 1VQNZ 1QVFZ 1YJ9Z 1VQO1 1KC81 1KD12 1S72Z 1VQ4Z 1NJI2 1VQ7Z 3OW2Y 1YI2Z 1N8R2 3CC2Z 1Q821 1YJW1 3CCQ1 3CCM1 3CMA1 1YITZ 3I55Z 3CMEZ 3G71Z 3CCUZ 3CCR1 3G4S1 3G6E1 1Q811 1M901 1VQK1 1JJ2Y
chains in the Genus database with same CATH superfamily
2VUGA 1YIJZ 2JIQA 4MRIA 1NUIA 1QVGY 2NVQI 1W2BZ 3CC4Z 2PM9A 1RLYA 1VQP1 1QF8A 5C4XI 3D9XA 2V8KA 2G2KA 4A3CI 3CPWY 3RZOI 2LFUA 3CCS1 1Z03A 1RQFA 5A2Qf 3I56Z 4DGLA 1LQLA 1K83I 1Y1VS 3Q87A 3I07A 1SFOI 4RVGA 2E9HA 3IX0A 3HOYI 1WZNA 3GCFA 3S16I 1K732 3G6EZ 1YIT1 3CME1 3J80b 2BJOA 5A2Qb 2QLVB 3NFZA 2JUBA 3NH4A 3HOXI 1VQ5Z 3IF8A 2RT9A 1VQ6Z 2PMZA 3F3PC 3S1RI 3CQZI 1VQN1 3KIHA 5AN9F 2F4MA 4NH1C 2GTHA 5T6BA 4E2WA 1X0TA 4A3II 4NBDA 3P5JB 2QA41 1L1OC 3CMAZ 3CC21 3GTOI 3J81f 4HH4A 1Q822 2QREB 3HOVI 3G4SZ 3CXCY 5C3EI 5T64A 1JJ2Z 3TDHB 1RO2A 3HKZA 2HU9A 1K731 3CCV1 2WAQA 3GKQA 2RBLA 4BXXI 3CC71 3CCL1 3CC41 3KIFA 2GU2A 2OTL1 3CCSZ 2M6NA 3J81b 4RVFA 2DE7A 3VMHA 1KD12 4NFRA 1S72Z 1NP6A 1NJI2 2VPXA 2KPIA 1TWCI 1ZB8A 3T4NB 1Q821 4MXUA 1YITZ 3F3FC 3CMEZ 4A93I 2E2HI 1YUKA 2AYDA 3G6E1 2R92I 2JIPA 2DE5A 2QRCB 4NBHA 1TFIA 1YHQ1 2E2JI 4A3DI 1TWFI 2R93I 2NVXI 1VQ61 1TWHI 4BY1I 3PO2I 1RO0A 5D1PA 4RS4A 4EWCA 3GTMI 2QA4Z 2JR6A 1KQSZ 4E2YA 1NJI1 4A3BI 1VQ41 2NVTI 2VPZA 5FLMI 4A3EI 5T67A 1YI21 5C44I 1Y8CA 3CCVZ 3EEDA 4NBFA 3CC7Z 3CCLZ 1X3WA 1FDOA 4MD9A 4MH4A 2OTLZ 2R6MA 2VF1A 2OTJZ 3NH5A 1VLAA 5IP7I 2JNYA 2KI7B 1Z01A 1Y1WI 3CCJ1 2QR1B 3H0GI 2NVYI 4MONA 3OW2Z 1S721 3QWUA 4Y52I 3D6WA 2JA8I 2QKDA 1RO4A 3U50C 1Q16A 1YHQZ 1QVGZ 3CCE1 3GTLI 1VQ91 3VMGA 2B63I 2OOXB 3GTGI 2WB1A 2RIQA 3CPWZ 3S14I 2J6AA 3GTJI 3S2HI 3VB9A 4MD8A 3H3VJ 1WJ2A 2M48A 4BBRI 1YJ9Z 1VQO1 2AKLA 3S1NI 1VQ4Z 2GTIA 1ZH1A 3LUSA 2VUMI 1YI2Z 1N8R2 2P3YA 2H85A 1YJW1 3BG0B 3CCQ1 4QTUA 2JMOA 2V45A 3CCR1 1VQK1 5FLXf 3IR7A 2ZAEB 1Q862 3FQQA 1USPA 4NBGA 2LEXA 3I4MI 2OTJ1 2QRDB 1Q7Y2 3CCJZ 2OOYB 3RZDI 2JA5I 2JIOA 1K9M2 4QTTA 3D2LA 1YJNZ 1N2FA 1VQLZ 1VQ81 3CD61 1M1K2 4BY7I 5D1OA 2IV2X 1QVFY 3CXCZ 3GTMS 1N8R1 3HOWI 4A3KI 4HGZA 2V3VA 3CCEZ 1VQ9Z 1KRLA 1I50I 3VTNA 4NBCA 2RHBA 2F4OA 3I551 1Q861 3CCU1 2W04A 1R9TI 3IFUA 2NAPA 1KD11 1VQOZ 4DK1A 2JIMA 1W2BY 2K5RA 1K9M1 4NB8A 2E7ZA 1YJ91 4BBSI 1KC82 2YADA 2RPRA 2HF1A 1M1K1 1YJWZ 3HOZI 1QXFA 3CCQZ 3M3YI 2K3RA 1SIWA 3CCRZ 4RV9A 1VQKZ 3NH8A 2EGTA 5LL6f 4CL1A 1VQMZ 3ESWA 1Q812 3FKII 1I3QI 4NBBA 3FQMA 2PK7A 2QEX1 2P28A 4TNUA 1VQ8Z 3CD6Z 2JA6I 1YJN1 1YUAA 2V8IA 3MZKB 1TWGI 1VQL1 4NB9A 1KC81 2V8JA 4E33A 4E31A 5C4JI 3J80f 4S1TA 1QYPA 3PO3I 2W03A 3MONA 3CCM1 3S17I 4NOZA 3S1MI 3I55Z 3CCUZ 5CM2M 2IZ4A 1Q811 1DL6A 2JIRA 1JJ2Y 2O53A 1X3ZA 1K8A2 4A3FI 4AYBA 1ZB9A 4HGYA 3VMIA 1WIIA 3GTPI 4X6AI 1WW9A 1TWAI 4A3LI 3J7A4 4E2XA 1Y1VI 3JAMf 3GTKI 5IP9I 2VPYA 1S7MA 1VQ71 1VQM1 3K7AI 4RVHA 3HOUI 2OZKA 2R7ZI 2QEXZ 1WCMI 4Y7NI 3G711 4NBEA 3GTQI 1JWHC 2JA7I 3JAMb 1K8A1 4A3GI 1YIJ1 2O4HA 1VQPZ 3EERA 4XX2A 5FLXb 1USPB 5IT9f 1RNIA 4NBAA 1PFTA 2Q51A 4A3MI 2DE6A 3NDIA 3CCMZ 1KQSY 3I561 3S1QI 5D1OB 1M902 4RVDA 1Q7Y1 1FDIA 2E2II 3M4OI 4MD7A 5IT9b 3TE5B 4E32A 2IZ3A 4A3JI 3NDJA 3I4NI 3S2DI 2Q4ZA 2YU9I 4DQYB 3MZLB 1VQ51 1VQNZ 4E30A 1QVFZ 2VPWA 1P9NA 1I6HI 2I3CA 2JS4A 1VQ7Z 3OW2Y 1ML8A 3CC2Z 1AA6A 3S15I 2Y0SA 3CMA1 1Z02A 3BG1B 3G71Z 3G4S1 3PO3S 2LIYA 1M901 4E2ZA
chains in the Genus database with same CATH topology
2VUGA 1YIJZ 4MRIA 1NUIA 1QVGY 2NVQI 1W2BZ 3CC4Z 2PM9A 1RLYA 1VQP1 1QF8A 5C4XI 3D9XA 2V8KA 2G2KA 4A3CI 3CPWY 3RZOI 2LFUA 3CCS1 1Z03A 1RQFA 5A2Qf 3I56Z 4DGLA 1LQLA 1K83I 1Y1VS 3Q87A 3I07A 1SFOI 4RVGA 2E9HA 3IX0A 3HOYI 3GCFA 3S16I 1K732 3G6EZ 1YIT1 3CME1 3J80b 2BJOA 5A2Qb 2QLVB 3NFZA 2JUBA 3NH4A 3HOXI 1VQ5Z 3IF8A 2RT9A 1VQ6Z 2PMZA 3F3PC 3S1RI 3CQZI 1VQN1 3KIHA 5AN9F 2F4MA 4NH1C 2GTHA 5T6BA 4E2WA 1X0TA 4A3II 4NBDA 3P5JB 2QA41 1L1OC 3CMAZ 3CC21 3GTOI 3J81f 4HH4A 1Q822 2QREB 3HOVI 3G4SZ 3CXCY 5C3EI 5T64A 1JJ2Z 3TDHB 1RO2A 3HKZA 2HU9A 1K731 3CCV1 2WAQA 3GKQA 2RBLA 4BXXI 3CC71 3CCL1 3CC41 3KIFA 2GU2A 2OTL1 3CCSZ 2M6NA 3J81b 4RVFA 2DE7A 3VMHA 1KD12 4NFRA 1S72Z 1NP6A 1NJI2 2KPIA 1TWCI 1ZB8A 3T4NB 1Q821 4MXUA 1YITZ 3F3FC 3CMEZ 4A93I 2E2HI 1YUKA 3G6E1 2R92I 2DE5A 2QRCB 4NBHA 1TFIA 1YHQ1 2E2JI 4A3DI 1TWFI 2R93I 2NVXI 1VQ61 1TWHI 4BY1I 3PO2I 1RO0A 5D1PA 4RS4A 4EWCA 3GTMI 2QA4Z 2JR6A 1KQSZ 4E2YA 1NJI1 4A3BI 1VQ41 2NVTI 5FLMI 4A3EI 5T67A 1YI21 5C44I 3CCVZ 3EEDA 4NBFA 3CC7Z 3CCLZ 1X3WA 4MD9A 4MH4A 2OTLZ 2R6MA 2VF1A 2OTJZ 3NH5A 1VLAA 5IP7I 2JNYA 2KI7B 1Z01A 1Y1WI 3CCJ1 2QR1B 3H0GI 2NVYI 4MONA 3OW2Z 1S721 3QWUA 4Y52I 3D6WA 2JA8I 2QKDA 1RO4A 3U50C 1YHQZ 1QVGZ 3CCE1 3GTLI 1VQ91 3VMGA 2B63I 2OOXB 3GTGI 2WB1A 2RIQA 3CPWZ 3S14I 2J6AA 3GTJI 3S2HI 3VB9A 4MD8A 3H3VJ 2M48A 4BBRI 1YJ9Z 1VQO1 2AKLA 3S1NI 1VQ4Z 2GTIA 1ZH1A 3LUSA 2VUMI 1YI2Z 1N8R2 2P3YA 2H85A 1YJW1 3BG0B 3CCQ1 4QTUA 2JMOA 3CCR1 1VQK1 5FLXf 2ZAEB 1Q862 3FQQA 1USPA 4NBGA 3I4MI 2OTJ1 2QRDB 1Q7Y2 3CCJZ 2OOYB 3RZDI 2JA5I 1K9M2 4QTTA 1YJNZ 1N2FA 1VQLZ 1VQ81 3CD61 1M1K2 4BY7I 5D1OA 1QVFY 3CXCZ 3GTMS 1N8R1 3HOWI 4A3KI 4HGZA 3CCEZ 1VQ9Z 1KRLA 1I50I 3VTNA 4NBCA 2RHBA 2F4OA 3I551 1Q861 3CCU1 2W04A 1R9TI 3IFUA 1KD11 1VQOZ 4DK1A 1W2BY 2K5RA 1K9M1 4NB8A 1YJ91 4BBSI 1KC82 2YADA 2RPRA 2HF1A 1M1K1 1YJWZ 3HOZI 3CCQZ 3M3YI 2K3RA 3CCRZ 4RV9A 1VQKZ 3NH8A 2EGTA 5LL6f 4CL1A 1VQMZ 3ESWA 1Q812 3FKII 1I3QI 4NBBA 3FQMA 2PK7A 2QEX1 2P28A 4TNUA 1VQ8Z 3CD6Z 2JA6I 1YJN1 1YUAA 2V8IA 3MZKB 1TWGI 1VQL1 4NB9A 1KC81 2V8JA 4E33A 4E31A 5C4JI 3J80f 4S1TA 1QYPA 3PO3I 2W03A 3MONA 3CCM1 3S17I 4NOZA 3S1MI 3I55Z 5CM2M 3CCUZ 2IZ4A 1Q811 1DL6A 1JJ2Y 2O53A 1X3ZA 1K8A2 4A3FI 4AYBA 1ZB9A 4HGYA 3VMIA 1WIIA 3GTPI 4X6AI 1WW9A 1TWAI 4A3LI 3J7A4 4E2XA 1Y1VI 3JAMf 3GTKI 5IP9I 1S7MA 1VQ71 1VQM1 3K7AI 4RVHA 3HOUI 2OZKA 2R7ZI 2QEXZ 1WCMI 4Y7NI 3G711 4NBEA 3GTQI 1JWHC 2JA7I 3JAMb 1K8A1 4A3GI 1YIJ1 2O4HA 1VQPZ 3EERA 4XX2A 5FLXb 1USPB 5IT9f 1RNIA 4NBAA 1PFTA 2Q51A 4A3MI 2DE6A 3NDIA 3CCMZ 1KQSY 3I561 3S1QI 5D1OB 1M902 4RVDA 1Q7Y1 2E2II 3M4OI 4MD7A 5IT9b 3TE5B 4E32A 2IZ3A 4A3JI 3NDJA 3I4NI 3S2DI 2Q4ZA 2YU9I 4DQYB 3MZLB 1VQ51 1VQNZ 4E30A 1QVFZ 1P9NA 1I6HI 2I3CA 2JS4A 1VQ7Z 3OW2Y 1ML8A 3CC2Z 3S15I 2Y0SA 3CMA1 1Z02A 3BG1B 3G71Z 3G4S1 3PO3S 2LIYA 1M901 4E2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 2;  1YIJ Z;  1YHQ 1;  1QVG Y;  2OTJ 1;  1K8A 2;  1Q7Y 2;  3CCJ Z;  1W2B Z;  3CC4 Z;  1VQ6 1;  1VQP 1;  1K9M 2;  3CPW Y;  1YJN Z;  3CCS 1;  1VQL Z;  2QA4 Z;  1VQ8 1;  3CD6 1;  1M1K 2;  1KQS Z;  3I56 Z;  1NJI 1;  1QVF Y;  3CXC Z;  1N8R 1;  1VQ4 1;  1VQ7 1;  1YI2 1;  3CCE Z;  1VQM 1;  3CCV Z;  1VQ9 Z;  3CC7 Z;  3CCL Z;  1K73 2;  3G6E Z;  1YIT 1;  3I55 1;  2QEX Z;  3CME 1;  3G71 1;  1Q86 1;  3CCU 1;  2OTL Z;  1K8A 1;  1VQ5 Z;  2OTJ Z;  1YIJ 1;  1VQ6 Z;  1VQP Z;  1KD1 1;  1VQO Z;  3CCJ 1;  1VQN 1;  1W2B Y;  1K9M 1;  1YJ9 1;  3OW2 Z;  1S72 1;  1KC8 2;  1M1K 1;  1YJW Z;  2QA4 1;  3CCQ Z;  3CMA Z;  3CC2 1;  3CCM Z;  1KQS Y;  1Q82 2;  3I56 1;  3CCR Z;  3G4S Z;  1VQK Z;  3CXC Y;  1JJ2 Z;  1VQM Z;  1Q81 2;  1M90 2;  1YHQ Z;  1QVG Z;  1K73 1;  3CCE 1;  1Q7Y 1;  3CCV 1;  1VQ9 1;  3CC7 1;  3CCL 1;  3CC4 1;  2QEX 1;  3CPW Z;  2OTL 1;  3CCS Z;  1VQ8 Z;  3CD6 Z;  1VQ5 1;  1YJN 1;  1VQL 1;  1VQN Z;  1QVF Z;  1YJ9 Z;  1VQO 1;  1KC8 1;  1KD1 2;  1S72 Z;  1VQ4 Z;  1NJI 2;  1VQ7 Z;  3OW2 Y;  1YI2 Z;  1N8R 2;  3CC2 Z;  1Q82 1;  1YJW 1;  3CCQ 1;  3CCM 1;  3CMA 1;  1YIT Z;  3I55 Z;  3CME Z;  3G71 Z;  3CCU Z;  3CCR 1;  3G4S 1;  3G6E 1;  1Q81 1;  1M90 1;  1VQK 1;  1JJ2 Y; 
#chains in the Genus database with same CATH topology
 2VUG A;  1YIJ Z;  2JIQ A;  4MRI A;  1NUI A;  1QVG Y;  2NVQ I;  1W2B Z;  3CC4 Z;  2PM9 A;  1RLY A;  1VQP 1;  1QF8 A;  5C4X I;  3D9X A;  2V8K A;  2G2K A;  4A3C I;  3CPW Y;  3RZO I;  2LFU A;  3CCS 1;  1Z03 A;  1RQF A;  5A2Q f;  3I56 Z;  4DGL A;  1LQL A;  1K83 I;  1Y1V S;  3Q87 A;  3I07 A;  1SFO I;  4RVG A;  2E9H A;  3IX0 A;  3HOY I;  1WZN A;  3GCF A;  3S16 I;  1K73 2;  3G6E Z;  1YIT 1;  3CME 1;  3J80 b;  2BJO A;  5A2Q b;  2QLV B;  3NFZ A;  2JUB A;  3NH4 A;  3HOX I;  1VQ5 Z;  3IF8 A;  2RT9 A;  1VQ6 Z;  2PMZ A;  3F3P C;  3S1R I;  3CQZ I;  1VQN 1;  3KIH A;  5AN9 F;  2F4M A;  4NH1 C;  2GTH A;  5T6B A;  4E2W A;  1X0T A;  4A3I I;  4NBD A;  3P5J B;  2QA4 1;  1L1O C;  3CMA Z;  3CC2 1;  3GTO I;  3J81 f;  4HH4 A;  1Q82 2;  2QRE B;  3HOV I;  3G4S Z;  3CXC Y;  5C3E I;  5T64 A;  1JJ2 Z;  3TDH B;  1RO2 A;  3HKZ A;  2HU9 A;  1K73 1;  3CCV 1;  2WAQ A;  3GKQ A;  2RBL A;  4BXX I;  3CC7 1;  3CCL 1;  3CC4 1;  3KIF A;  2GU2 A;  2OTL 1;  3CCS Z;  2M6N A;  3J81 b;  4RVF A;  2DE7 A;  3VMH A;  1KD1 2;  4NFR A;  1S72 Z;  1NP6 A;  1NJI 2;  2VPX A;  2KPI A;  1TWC I;  1ZB8 A;  3T4N B;  1Q82 1;  4MXU A;  1YIT Z;  3F3F C;  3CME Z;  4A93 I;  2E2H I;  1YUK A;  2AYD A;  3G6E 1;  2R92 I;  2JIP A;  2DE5 A;  2QRC B;  4NBH A;  1TFI A;  1YHQ 1;  2E2J I;  4A3D I;  1TWF I;  2R93 I;  2NVX I;  1VQ6 1;  1TWH I;  4BY1 I;  3PO2 I;  1RO0 A;  5D1P A;  4RS4 A;  4EWC A;  3GTM I;  2QA4 Z;  2JR6 A;  1KQS Z;  4E2Y A;  1NJI 1;  4A3B I;  1VQ4 1;  2NVT I;  2VPZ A;  5FLM I;  4A3E I;  5T67 A;  1YI2 1;  5C44 I;  1Y8C A;  3CCV Z;  3EED A;  4NBF A;  3CC7 Z;  3CCL Z;  1X3W A;  1FDO A;  4MD9 A;  4MH4 A;  2OTL Z;  2R6M A;  2VF1 A;  2OTJ Z;  3NH5 A;  1VLA A;  5IP7 I;  2JNY A;  2KI7 B;  1Z01 A;  1Y1W I;  3CCJ 1;  2QR1 B;  3H0G I;  2NVY I;  4MON A;  3OW2 Z;  1S72 1;  3QWU A;  4Y52 I;  3D6W A;  2JA8 I;  2QKD A;  1RO4 A;  3U50 C;  1Q16 A;  1YHQ Z;  1QVG Z;  3CCE 1;  3GTL I;  1VQ9 1;  3VMG A;  2B63 I;  2OOX B;  3GTG I;  2WB1 A;  2RIQ A;  3CPW Z;  3S14 I;  2J6A A;  3GTJ I;  3S2H I;  3VB9 A;  4MD8 A;  3H3V J;  1WJ2 A;  2M48 A;  4BBR I;  1YJ9 Z;  1VQO 1;  2AKL A;  3S1N I;  1VQ4 Z;  2GTI A;  1ZH1 A;  3LUS A;  2VUM I;  1YI2 Z;  1N8R 2;  2P3Y A;  2H85 A;  1YJW 1;  3BG0 B;  3CCQ 1;  4QTU A;  2JMO A;  2V45 A;  3CCR 1;  1VQK 1;  5FLX f;  3IR7 A;  2ZAE B;  1Q86 2;  3FQQ A;  1USP A;  4NBG A;  2LEX A;  3I4M I;  2OTJ 1;  2QRD B;  1Q7Y 2;  3CCJ Z;  2OOY B;  3RZD I;  2JA5 I;  2JIO A;  1K9M 2;  4QTT A;  3D2L A;  1YJN Z;  1N2F A;  1VQL Z;  1VQ8 1;  3CD6 1;  1M1K 2;  4BY7 I;  5D1O A;  2IV2 X;  1QVF Y;  3CXC Z;  3GTM S;  1N8R 1;  3HOW I;  4A3K I;  4HGZ A;  2V3V A;  3CCE Z;  1VQ9 Z;  1KRL A;  1I50 I;  3VTN A;  4NBC A;  2RHB A;  2F4O A;  3I55 1;  1Q86 1;  3CCU 1;  2W04 A;  1R9T I;  3IFU A;  2NAP A;  1KD1 1;  1VQO Z;  4DK1 A;  2JIM A;  1W2B Y;  2K5R A;  1K9M 1;  4NB8 A;  2E7Z A;  1YJ9 1;  4BBS I;  1KC8 2;  2YAD A;  2RPR A;  2HF1 A;  1M1K 1;  1YJW Z;  3HOZ I;  1QXF A;  3CCQ Z;  3M3Y I;  2K3R A;  1SIW A;  3CCR Z;  4RV9 A;  1VQK Z;  3NH8 A;  2EGT A;  5LL6 f;  4CL1 A;  1VQM Z;  3ESW A;  1Q81 2;  3FKI I;  1I3Q I;  4NBB A;  3FQM A;  2PK7 A;  2QEX 1;  2P28 A;  4TNU A;  1VQ8 Z;  3CD6 Z;  2JA6 I;  1YJN 1;  1YUA A;  2V8I A;  3MZK B;  1TWG I;  1VQL 1;  4NB9 A;  1KC8 1;  2V8J A;  4E33 A;  4E31 A;  5C4J I;  3J80 f;  4S1T A;  1QYP A;  3PO3 I;  2W03 A;  3MON A;  3CCM 1;  3S17 I;  4NOZ A;  3S1M I;  3I55 Z;  3CCU Z;  5CM2 M;  2IZ4 A;  1Q81 1;  1DL6 A;  2JIR A;  1JJ2 Y;  2O53 A;  1X3Z A;  1K8A 2;  4A3F I;  4AYB A;  1ZB9 A;  4HGY A;  3VMI A;  1WII A;  3GTP I;  4X6A I;  1WW9 A;  1TWA I;  4A3L I;  3J7A 4;  4E2X A;  1Y1V I;  3JAM f;  3GTK I;  5IP9 I;  2VPY A;  1S7M A;  1VQ7 1;  1VQM 1;  3K7A I;  4RVH A;  3HOU I;  2OZK A;  2R7Z I;  2QEX Z;  1WCM I;  4Y7N I;  3G71 1;  4NBE A;  3GTQ I;  1JWH C;  2JA7 I;  3JAM b;  1K8A 1;  4A3G I;  1YIJ 1;  2O4H A;  1VQP Z;  3EER A;  4XX2 A;  5FLX b;  1USP B;  5IT9 f;  1RNI A;  4NBA A;  1PFT A;  2Q51 A;  4A3M I;  2DE6 A;  3NDI A;  3CCM Z;  1KQS Y;  3I56 1;  3S1Q I;  5D1O B;  1M90 2;  4RVD A;  1Q7Y 1;  1FDI A;  2E2I I;  3M4O I;  4MD7 A;  5IT9 b;  3TE5 B;  4E32 A;  2IZ3 A;  4A3J I;  3NDJ A;  3I4N I;  3S2D I;  2Q4Z A;  2YU9 I;  4DQY B;  3MZL B;  1VQ5 1;  1VQN Z;  4E30 A;  1QVF Z;  2VPW A;  1P9N A;  1I6H I;  2I3C A;  2JS4 A;  1VQ7 Z;  3OW2 Y;  1ML8 A;  3CC2 Z;  1AA6 A;  3S15 I;  2Y0S A;  3CMA 1;  1Z02 A;  3BG1 B;  3G71 Z;  3G4S 1;  3PO3 S;  2LIY A;  1M90 1;  4E2Z A; 
#chains in the Genus database with same CATH homology
 2VUG A;  1YIJ Z;  4MRI A;  1NUI A;  1QVG Y;  2NVQ I;  1W2B Z;  3CC4 Z;  2PM9 A;  1RLY A;  1VQP 1;  1QF8 A;  5C4X I;  3D9X A;  2V8K A;  2G2K A;  4A3C I;  3CPW Y;  3RZO I;  2LFU A;  3CCS 1;  1Z03 A;  1RQF A;  5A2Q f;  3I56 Z;  4DGL A;  1LQL A;  1K83 I;  1Y1V S;  3Q87 A;  3I07 A;  1SFO I;  4RVG A;  2E9H A;  3IX0 A;  3HOY I;  3GCF A;  3S16 I;  1K73 2;  3G6E Z;  1YIT 1;  3CME 1;  3J80 b;  2BJO A;  5A2Q b;  2QLV B;  3NFZ A;  2JUB A;  3NH4 A;  3HOX I;  1VQ5 Z;  3IF8 A;  2RT9 A;  1VQ6 Z;  2PMZ A;  3F3P C;  3S1R I;  3CQZ I;  1VQN 1;  3KIH A;  5AN9 F;  2F4M A;  4NH1 C;  2GTH A;  5T6B A;  4E2W A;  1X0T A;  4A3I I;  4NBD A;  3P5J B;  2QA4 1;  1L1O C;  3CMA Z;  3CC2 1;  3GTO I;  3J81 f;  4HH4 A;  1Q82 2;  2QRE B;  3HOV I;  3G4S Z;  3CXC Y;  5C3E I;  5T64 A;  1JJ2 Z;  3TDH B;  1RO2 A;  3HKZ A;  2HU9 A;  1K73 1;  3CCV 1;  2WAQ A;  3GKQ A;  2RBL A;  4BXX I;  3CC7 1;  3CCL 1;  3CC4 1;  3KIF A;  2GU2 A;  2OTL 1;  3CCS Z;  2M6N A;  3J81 b;  4RVF A;  2DE7 A;  3VMH A;  1KD1 2;  4NFR A;  1S72 Z;  1NP6 A;  1NJI 2;  2KPI A;  1TWC I;  1ZB8 A;  3T4N B;  1Q82 1;  4MXU A;  1YIT Z;  3F3F C;  3CME Z;  4A93 I;  2E2H I;  1YUK A;  3G6E 1;  2R92 I;  2DE5 A;  2QRC B;  4NBH A;  1TFI A;  1YHQ 1;  2E2J I;  4A3D I;  1TWF I;  2R93 I;  2NVX I;  1VQ6 1;  1TWH I;  4BY1 I;  3PO2 I;  1RO0 A;  5D1P A;  4RS4 A;  4EWC A;  3GTM I;  2QA4 Z;  2JR6 A;  1KQS Z;  4E2Y A;  1NJI 1;  4A3B I;  1VQ4 1;  2NVT I;  5FLM I;  4A3E I;  5T67 A;  1YI2 1;  5C44 I;  3CCV Z;  3EED A;  4NBF A;  3CC7 Z;  3CCL Z;  1X3W A;  4MD9 A;  4MH4 A;  2OTL Z;  2R6M A;  2VF1 A;  2OTJ Z;  3NH5 A;  1VLA A;  5IP7 I;  2JNY A;  2KI7 B;  1Z01 A;  1Y1W I;  3CCJ 1;  2QR1 B;  3H0G I;  2NVY I;  4MON A;  3OW2 Z;  1S72 1;  3QWU A;  4Y52 I;  3D6W A;  2JA8 I;  2QKD A;  1RO4 A;  3U50 C;  1YHQ Z;  1QVG Z;  3CCE 1;  3GTL I;  1VQ9 1;  3VMG A;  2B63 I;  2OOX B;  3GTG I;  2WB1 A;  2RIQ A;  3CPW Z;  3S14 I;  2J6A A;  3GTJ I;  3S2H I;  3VB9 A;  4MD8 A;  3H3V J;  2M48 A;  4BBR I;  1YJ9 Z;  1VQO 1;  2AKL A;  3S1N I;  1VQ4 Z;  2GTI A;  1ZH1 A;  3LUS A;  2VUM I;  1YI2 Z;  1N8R 2;  2P3Y A;  2H85 A;  1YJW 1;  3BG0 B;  3CCQ 1;  4QTU A;  2JMO A;  3CCR 1;  1VQK 1;  5FLX f;  2ZAE B;  1Q86 2;  3FQQ A;  1USP A;  4NBG A;  3I4M I;  2OTJ 1;  2QRD B;  1Q7Y 2;  3CCJ Z;  2OOY B;  3RZD I;  2JA5 I;  1K9M 2;  4QTT A;  1YJN Z;  1N2F A;  1VQL Z;  1VQ8 1;  3CD6 1;  1M1K 2;  4BY7 I;  5D1O A;  1QVF Y;  3CXC Z;  3GTM S;  1N8R 1;  3HOW I;  4A3K I;  4HGZ A;  3CCE Z;  1VQ9 Z;  1KRL A;  1I50 I;  3VTN A;  4NBC A;  2RHB A;  2F4O A;  3I55 1;  1Q86 1;  3CCU 1;  2W04 A;  1R9T I;  3IFU A;  1KD1 1;  1VQO Z;  4DK1 A;  1W2B Y;  2K5R A;  1K9M 1;  4NB8 A;  1YJ9 1;  4BBS I;  1KC8 2;  2YAD A;  2RPR A;  2HF1 A;  1M1K 1;  1YJW Z;  3HOZ I;  3CCQ Z;  3M3Y I;  2K3R A;  3CCR Z;  4RV9 A;  1VQK Z;  3NH8 A;  2EGT A;  5LL6 f;  4CL1 A;  1VQM Z;  3ESW A;  1Q81 2;  3FKI I;  1I3Q I;  4NBB A;  3FQM A;  2PK7 A;  2QEX 1;  2P28 A;  4TNU A;  1VQ8 Z;  3CD6 Z;  2JA6 I;  1YJN 1;  1YUA A;  2V8I A;  3MZK B;  1TWG I;  1VQL 1;  4NB9 A;  1KC8 1;  2V8J A;  4E33 A;  4E31 A;  5C4J I;  3J80 f;  4S1T A;  1QYP A;  3PO3 I;  2W03 A;  3MON A;  3CCM 1;  3S17 I;  4NOZ A;  3S1M I;  3I55 Z;  5CM2 M;  3CCU Z;  2IZ4 A;  1Q81 1;  1DL6 A;  1JJ2 Y;  2O53 A;  1X3Z A;  1K8A 2;  4A3F I;  4AYB A;  1ZB9 A;  4HGY A;  3VMI A;  1WII A;  3GTP I;  4X6A I;  1WW9 A;  1TWA I;  4A3L I;  3J7A 4;  4E2X A;  1Y1V I;  3JAM f;  3GTK I;  5IP9 I;  1S7M A;  1VQ7 1;  1VQM 1;  3K7A I;  4RVH A;  3HOU I;  2OZK A;  2R7Z I;  2QEX Z;  1WCM I;  4Y7N I;  3G71 1;  4NBE A;  3GTQ I;  1JWH C;  2JA7 I;  3JAM b;  1K8A 1;  4A3G I;  1YIJ 1;  2O4H A;  1VQP Z;  3EER A;  4XX2 A;  5FLX b;  1USP B;  5IT9 f;  1RNI A;  4NBA A;  1PFT A;  2Q51 A;  4A3M I;  2DE6 A;  3NDI A;  3CCM Z;  1KQS Y;  3I56 1;  3S1Q I;  5D1O B;  1M90 2;  4RVD A;  1Q7Y 1;  2E2I I;  3M4O I;  4MD7 A;  5IT9 b;  3TE5 B;  4E32 A;  2IZ3 A;  4A3J I;  3NDJ A;  3I4N I;  3S2D I;  2Q4Z A;  2YU9 I;  4DQY B;  3MZL B;  1VQ5 1;  1VQN Z;  4E30 A;  1QVF Z;  1P9N A;  1I6H I;  2I3C A;  2JS4 A;  1VQ7 Z;  3OW2 Y;  1ML8 A;  3CC2 Z;  3S15 I;  2Y0S A;  3CMA 1;  1Z02 A;  3BG1 B;  3G71 Z;  3G4S 1;  3PO3 S;  2LIY A;  1M90 1;  4E2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...