1VQMZ

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqmZ00
3OW2Z 3CXCY 1K8A2 1M901 1VQP1 1VQ6Z 3CCS1 1VQ51 1VQK1 1S721 2OTLZ 1VQLZ 3CCSZ 1KC81 1NJI1 3CCR1 1K731 3CCJ1 3CPWZ 1YJN1 3CCVZ 1Q862 1YJ9Z 3CMAZ 3CC4Z 2OTL1 1Q7Y1 1VQ71 3CCE1 3G4SZ 3CMEZ 3CPWY 3CCUZ 1YIJ1 1QVFY 1VQNZ 1S72Z 1VQ91 1VQKZ 1M1K2 3CC7Z 3I551 1VQ4Z 1YIT1 3CCQZ 1VQ41 3CCMZ 1KD11 1YI2Z 3I561 1Q7Y2 3CCQ1 3G4S1 3CME1 1VQO1 1Q861 1KD12 3CCM1 1K732 1VQ9Z 1YJWZ 1NJI2 1KC82 1VQ81 3CMA1 1YHQ1 3CCL1 1QVFZ 1VQ61 1M1K1 3G6EZ 1KQSZ 3CCEZ 1K8A1 1VQL1 3G6E1 2QEXZ 1YIJZ 2QA41 1YJNZ 1QVGZ 3CCJZ 1YJ91 1Q811 1VQOZ 3CCV1 2OTJ1 1N8R2 1VQ7Z 1Q822 3CCLZ 3G711 3CCRZ 3I56Z 1JJ2Z 3CD6Z 3CXCZ 3CC41 3OW2Y 1M902 3CC2Z 3CCU1 1K9M2 1K9M1 1YHQZ 1YI21 1QVGY 1VQN1 1VQM1 1KQSY 3CC21 1W2BY 1VQPZ 1YITZ 1VQMZ 1VQ8Z 2QA4Z 1JJ2Y 3CD61 1W2BZ 1YJW1 1Q821 2OTJZ 1N8R1 3CC71 3G71Z 1Q812 2QEX1 3I55Z 1VQ5Z
chains in the Genus database with same CATH superfamily
2QRCB 4HH4A 4E2WA 1K8A2 1WCMI 2QR1B 3F3PC 1VQP1 1VQ6Z 2OZKA 4NBAA 1TWAI 3BG1B 3KIFA 2OTLZ 1ZB9A 3S14I 2HU9A 3H3VJ 4NB9A 1X3WA 3VB9A 1VQ71 3CQZI 3CCE1 2GTIA 3CPWY 3CCUZ 3NDJA 4QTTA 3HKZA 1S72Z 1VQ91 1VQKZ 4RVHA 3CC7Z 2R6MA 3VTNA 1P9NA 3F3FC 1YI2Z 5A2Qb 4MRIA 3J7A4 3CME1 4CL1A 5FLXf 3GKQA 3K7AI 2QRDB 1YJWZ 5C4XI 2VPZA 3GTMS 3CCEZ 1K8A1 2F4MA 2QREB 4A3MI 2QA41 4MD7A 4E2YA 3J81b 1KRLA 2OTJ1 2JA5I 3PO3I 2H85A 3HOXI 3GTPI 2LFUA 3HOUI 1Y1VI 3J81f 4E30A 2VPWA 3CC41 2JR6A 4RVDA 4E2ZA 1SFOI 2NVXI 4RV9A 1X0TA 3CC2Z 2Y0SA 1K9M2 1YHQZ 1YI21 1VQN1 3J80f 1I6HI 1VQPZ 2JNYA 2VUMI 1YITZ 4RS4A 3GTLI 4A3BI 2QA4Z 1JJ2Y 4DK1A 5T67A 1Q821 3P5JB 3TDHB 2OTJZ 1N8R1 1RQFA 2P28A 5T64A 3J80b 3GTKI 1VQ5Z 3T4NB 3D6WA 3CXCY 5D1OB 4A3EI 3M4OI 2VF1A 4NB8A 2GU2A 1VQK1 3U50C 2YU9I 2RT9A 1VQLZ 3BG0B 1Z02A 3GTMI 1YUKA 3FQMA 3CPWZ 3CCVZ 4RVFA 3GTJI 3CMAZ 3CC4Z 1WIIA 4NBHA 3S1MI 3S15I 1QYPA 3I4MI 2E7ZA 2PM9A 2YADA 3D2LA 2JUBA 3FQQA 3IR7A 5LL6f 1WW9A 1Y1VS 3CCMZ 1Y8CA 2RIQA 5IT9f 4A3FI 3HOVI 2IZ3A 1VQO1 1TWCI 2VUGA 1VQ9Z 2E2HI 1JWHC 1VQ81 1RNIA 3LUSA 2QKDA 3CMA1 5C3EI 1YHQ1 4BY1I 1QVFZ 3GTOI 2QEXZ 1QVGZ 3CCJZ 2PK7A 1Q811 2OOXB 3GTGI 3PO2I 2EGTA 4NBFA 4A3II 2AYDA 3OW2Y 5AN9F 4NBEA 2JIOA 2BJOA 4A3GI 2LEXA 3CCU1 1K9M1 5A2Qf 2V8JA 2JA6I 1TWGI 4BBRI 1W2BY 3S2DI 3HOYI 3EEDA 4DGLA 3RZDI 2E2JI 1VQ8Z 4A3LI 2JMOA 3MZLB 1L1OC 1Z03A 3QWUA 4NBCA 4NBGA 4E2XA 2QEX1 2Q4ZA 2V8IA 3MZKB 4E31A 4EWCA 4Y52I 1VLAA 1M901 1AA6A 3S1RI 3CCS1 2K5RA 3CCSZ 3VMHA 3GCFA 2JS4A 3I07A 1K731 4A93I 3JAMb 2QLVB 1YJN1 2NVTI 1Q862 1YJ9Z 1QF8A 2I3CA 2OTL1 3S1QI 4E33A 4BBSI 3G4SZ 2RBLA 2DE5A 2KPIA 1YIJ1 4HGYA 1Z01A 4NH1C 2DE7A 3NH4A 3I551 1VQ4Z 3S16I 1ZB8A 2JA7I 3IF8A 1NP6A 2Q51A 5T6BA 1RLYA 3TE5B 3Q87A 1VQ41 3I561 2VPXA 4E32A 1Q7Y2 1NJI2 1KC82 2O4HA 3CCL1 1VQ61 1M1K1 3G6EZ 2GTHA 1N2FA 1KQSZ 1USPB 4BXXI 2RPRA 2ZAEB 4MH4A 3G6E1 1YIJZ 3MONA 1YJNZ 1YJ91 1VQOZ 2WAQA 5IP9I 1VQ7Z 3NFZA 1PFTA 1Q822 4AYBA 3NH5A 3CCRZ 3RZOI 1LQLA 3I56Z 3S1NI 3CD6Z 3S2HI 2DE6A 4Y7NI 5IT9b 3PO3S 4X6AI 1R9TI 5C44I 2V45A 2K3RA 1KQSY 3CC21 4XX2A 4MONA 3NDIA 4RVGA 3GTQI 1I50I 2R93I 1W2BZ 1YJW1 4S1TA 3VMIA 4NFRA 3KIHA 1Q16A 2G2KA 1TFIA 3G71Z 3S17I 2JA8I 3I55Z 3OW2Z 5FLXb 4HGZA 1SIWA 1X3ZA 1VQ51 2NVQI 3NH8A 2M48A 1S721 2W04A 2LIYA 1KC81 1NJI1 3CCR1 4NOZA 1RO4A 5D1OA 1NUIA 3CCJ1 4NBBA 2B63I 4NBDA 1RO2A 1Q7Y1 2V8KA 4A3JI 5IP7I 1RO0A 5C4JI 2O53A 3CMEZ 1QVFY 1QXFA 1VQNZ 2E2II 1M1K2 2OOYB 4A3CI 1YIT1 3M3YI 5CM2M 3CCQZ 1KD11 4DQYB 3FKII 2IZ4A 3CCQ1 3G4S1 2HF1A 2R7ZI 1Q861 3I4NI 1KD12 3CCM1 1K732 1Y1WI 1YUAA 4MD8A 4TNUA 4A3KI 2RHBA 2NVYI 2R92I 2PMZA 2E9HA 1VQL1 2VPYA 3EERA 3IFUA 2WB1A 5D1PA 3CCV1 2KI7B 2V3VA 2IV2X 3VMGA 1N8R2 2P3YA 1USPA 1WJ2A 3CCLZ 3G711 1ML8A 2F4OA 1K83I 1JJ2Z 1S7MA 3CXCZ 1M902 2JIPA 2JIRA 3HOWI 3IX0A 1TWFI 4BY7I 5FLMI 1ZH1A 2M6NA 1QVGY 2JIMA 1I3QI 3JAMf 1FDOA 1WZNA 1VQM1 3H0GI 1FDIA 2JIQA 4MD9A 1VQMZ 1TWHI 3CD61 2W03A 2J6AA 3ESWA 2NAPA 3D9XA 3HOZI 2AKLA 4MXUA 3CC71 1Q812 4QTUA 1DL6A 4A3DI
chains in the Genus database with same CATH topology
2QRCB 4HH4A 4E2WA 1K8A2 1WCMI 2QR1B 3F3PC 1VQP1 1VQ6Z 2OZKA 4NBAA 1TWAI 3BG1B 3KIFA 2OTLZ 1ZB9A 3S14I 2HU9A 3H3VJ 4NB9A 1X3WA 3VB9A 1VQ71 3CQZI 3CCE1 2GTIA 3CPWY 3CCUZ 3NDJA 4QTTA 3HKZA 1S72Z 1VQ91 1VQKZ 4RVHA 3CC7Z 2R6MA 3VTNA 1P9NA 3F3FC 1YI2Z 5A2Qb 4MRIA 3J7A4 3CME1 4CL1A 5FLXf 3GKQA 3K7AI 2QRDB 1YJWZ 5C4XI 3GTMS 3CCEZ 1K8A1 2F4MA 2QREB 4A3MI 2QA41 4MD7A 4E2YA 3J81b 1KRLA 2OTJ1 2JA5I 3PO3I 2H85A 3HOXI 3GTPI 2LFUA 3HOUI 1Y1VI 3J81f 4E30A 3CC41 2JR6A 4RVDA 4E2ZA 1SFOI 2NVXI 4RV9A 1X0TA 3CC2Z 2Y0SA 1K9M2 1YHQZ 1YI21 1VQN1 3J80f 1I6HI 1VQPZ 2JNYA 2VUMI 1YITZ 4RS4A 3GTLI 4A3BI 2QA4Z 1JJ2Y 4DK1A 5T67A 1Q821 3P5JB 3TDHB 2OTJZ 1N8R1 1RQFA 2P28A 5T64A 3J80b 3GTKI 1VQ5Z 3T4NB 3D6WA 3CXCY 5D1OB 4A3EI 3M4OI 2VF1A 4NB8A 2GU2A 1VQK1 3U50C 2YU9I 2RT9A 1VQLZ 3BG0B 1Z02A 3GTMI 1YUKA 3FQMA 3CPWZ 3CCVZ 4RVFA 3GTJI 3CMAZ 3CC4Z 1WIIA 4NBHA 3S1MI 3S15I 1QYPA 3I4MI 2PM9A 2YADA 2JUBA 3FQQA 5LL6f 1WW9A 1Y1VS 3CCMZ 2RIQA 5IT9f 4A3FI 3HOVI 2IZ3A 1VQO1 1TWCI 2VUGA 1VQ9Z 2E2HI 1JWHC 1VQ81 1RNIA 3LUSA 2QKDA 3CMA1 5C3EI 1YHQ1 4BY1I 1QVFZ 3GTOI 2QEXZ 1QVGZ 3CCJZ 2PK7A 1Q811 2OOXB 3GTGI 3PO2I 2EGTA 4NBFA 4A3II 3OW2Y 5AN9F 4NBEA 2BJOA 4A3GI 3CCU1 1K9M1 5A2Qf 2V8JA 2JA6I 1TWGI 4BBRI 1W2BY 3S2DI 3HOYI 3EEDA 4DGLA 3RZDI 2E2JI 1VQ8Z 4A3LI 2JMOA 3MZLB 1L1OC 1Z03A 3QWUA 4NBCA 4NBGA 4E2XA 2QEX1 2Q4ZA 2V8IA 3MZKB 4E31A 4EWCA 4Y52I 1VLAA 1M901 3S1RI 3CCS1 2K5RA 3CCSZ 3VMHA 3GCFA 2JS4A 3I07A 1K731 4A93I 3JAMb 2QLVB 1YJN1 2NVTI 1Q862 1YJ9Z 1QF8A 2I3CA 2OTL1 3S1QI 4E33A 4BBSI 3G4SZ 2RBLA 2DE5A 2KPIA 1YIJ1 4HGYA 1Z01A 4NH1C 2DE7A 3NH4A 3I551 1VQ4Z 3S16I 1ZB8A 2JA7I 3IF8A 1NP6A 2Q51A 5T6BA 1RLYA 3TE5B 3Q87A 1VQ41 3I561 4E32A 1Q7Y2 1NJI2 1KC82 2O4HA 3CCL1 1VQ61 1M1K1 3G6EZ 2GTHA 1N2FA 1KQSZ 1USPB 4BXXI 2RPRA 2ZAEB 4MH4A 3G6E1 1YIJZ 3MONA 1YJNZ 1YJ91 5IP9I 2WAQA 1VQOZ 1VQ7Z 3NFZA 1PFTA 1Q822 4AYBA 3NH5A 3CCRZ 3RZOI 1LQLA 3I56Z 3S1NI 3CD6Z 3S2HI 2DE6A 4Y7NI 5IT9b 3PO3S 4X6AI 1R9TI 5C44I 2K3RA 1KQSY 3CC21 4XX2A 4MONA 3NDIA 4RVGA 3GTQI 1I50I 2R93I 1W2BZ 1YJW1 4S1TA 3VMIA 4NFRA 3KIHA 2G2KA 1TFIA 3G71Z 3S17I 2JA8I 3I55Z 3OW2Z 5FLXb 4HGZA 1X3ZA 1VQ51 2NVQI 3NH8A 2M48A 1S721 2W04A 2LIYA 1KC81 1NJI1 3CCR1 4NOZA 1RO4A 5D1OA 1NUIA 3CCJ1 4NBBA 2B63I 4NBDA 1RO2A 1Q7Y1 2V8KA 4A3JI 5IP7I 1RO0A 5C4JI 2O53A 3CMEZ 1QVFY 1VQNZ 2E2II 1M1K2 2OOYB 4A3CI 1YIT1 3M3YI 5CM2M 3CCQZ 1KD11 4DQYB 3FKII 2IZ4A 3CCQ1 3G4S1 2HF1A 2R7ZI 1Q861 3I4NI 1KD12 3CCM1 1K732 1Y1WI 1YUAA 4MD8A 4TNUA 4A3KI 2RHBA 2NVYI 2R92I 2PMZA 2E9HA 1VQL1 3IFUA 3EERA 2WB1A 5D1PA 3CCV1 2KI7B 3VMGA 1N8R2 2P3YA 1USPA 3CCLZ 3G711 1ML8A 2F4OA 1K83I 1JJ2Z 1S7MA 3CXCZ 1M902 3HOWI 3IX0A 1TWFI 4BY7I 5FLMI 1ZH1A 2M6NA 1QVGY 1I3QI 3JAMf 1VQM1 3H0GI 4MD9A 1VQMZ 1TWHI 3CD61 2W03A 2J6AA 3ESWA 3D9XA 3HOZI 2AKLA 4MXUA 3CC71 1Q812 4QTUA 1DL6A 4A3DI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 Z;  3CXC Y;  1K8A 2;  1M90 1;  1VQP 1;  1VQ6 Z;  3CCS 1;  1VQ5 1;  1VQK 1;  1S72 1;  2OTL Z;  1VQL Z;  3CCS Z;  1KC8 1;  1NJI 1;  3CCR 1;  1K73 1;  3CCJ 1;  3CPW Z;  1YJN 1;  3CCV Z;  1Q86 2;  1YJ9 Z;  3CMA Z;  3CC4 Z;  2OTL 1;  1Q7Y 1;  1VQ7 1;  3CCE 1;  3G4S Z;  3CME Z;  3CPW Y;  3CCU Z;  1YIJ 1;  1QVF Y;  1VQN Z;  1S72 Z;  1VQ9 1;  1VQK Z;  1M1K 2;  3CC7 Z;  3I55 1;  1VQ4 Z;  1YIT 1;  3CCQ Z;  1VQ4 1;  3CCM Z;  1KD1 1;  1YI2 Z;  3I56 1;  1Q7Y 2;  3CCQ 1;  3G4S 1;  3CME 1;  1VQO 1;  1Q86 1;  1KD1 2;  3CCM 1;  1K73 2;  1VQ9 Z;  1YJW Z;  1NJI 2;  1KC8 2;  1VQ8 1;  3CMA 1;  1YHQ 1;  3CCL 1;  1QVF Z;  1VQ6 1;  1M1K 1;  3G6E Z;  1KQS Z;  3CCE Z;  1K8A 1;  1VQL 1;  3G6E 1;  2QEX Z;  1YIJ Z;  2QA4 1;  1YJN Z;  1QVG Z;  3CCJ Z;  1YJ9 1;  1Q81 1;  1VQO Z;  3CCV 1;  2OTJ 1;  1N8R 2;  1VQ7 Z;  1Q82 2;  3CCL Z;  3G71 1;  3CCR Z;  3I56 Z;  1JJ2 Z;  3CD6 Z;  3CXC Z;  3CC4 1;  3OW2 Y;  1M90 2;  3CC2 Z;  3CCU 1;  1K9M 2;  1K9M 1;  1YHQ Z;  1YI2 1;  1QVG Y;  1VQN 1;  1VQM 1;  1KQS Y;  3CC2 1;  1W2B Y;  1VQP Z;  1YIT Z;  1VQM Z;  1VQ8 Z;  2QA4 Z;  1JJ2 Y;  3CD6 1;  1W2B Z;  1YJW 1;  1Q82 1;  2OTJ Z;  1N8R 1;  3CC7 1;  3G71 Z;  1Q81 2;  2QEX 1;  3I55 Z;  1VQ5 Z; 
#chains in the Genus database with same CATH topology
 2QRC B;  4HH4 A;  4E2W A;  1K8A 2;  1WCM I;  2QR1 B;  3F3P C;  1VQP 1;  1VQ6 Z;  2OZK A;  4NBA A;  1TWA I;  3BG1 B;  3KIF A;  2OTL Z;  1ZB9 A;  3S14 I;  2HU9 A;  3H3V J;  4NB9 A;  1X3W A;  3VB9 A;  1VQ7 1;  3CQZ I;  3CCE 1;  2GTI A;  3CPW Y;  3CCU Z;  3NDJ A;  4QTT A;  3HKZ A;  1S72 Z;  1VQ9 1;  1VQK Z;  4RVH A;  3CC7 Z;  2R6M A;  3VTN A;  1P9N A;  3F3F C;  1YI2 Z;  5A2Q b;  4MRI A;  3J7A 4;  3CME 1;  4CL1 A;  5FLX f;  3GKQ A;  3K7A I;  2QRD B;  1YJW Z;  5C4X I;  2VPZ A;  3GTM S;  3CCE Z;  1K8A 1;  2F4M A;  2QRE B;  4A3M I;  2QA4 1;  4MD7 A;  4E2Y A;  3J81 b;  1KRL A;  2OTJ 1;  2JA5 I;  3PO3 I;  2H85 A;  3HOX I;  3GTP I;  2LFU A;  3HOU I;  1Y1V I;  3J81 f;  4E30 A;  2VPW A;  3CC4 1;  2JR6 A;  4RVD A;  4E2Z A;  1SFO I;  2NVX I;  4RV9 A;  1X0T A;  3CC2 Z;  2Y0S A;  1K9M 2;  1YHQ Z;  1YI2 1;  1VQN 1;  3J80 f;  1I6H I;  1VQP Z;  2JNY A;  2VUM I;  1YIT Z;  4RS4 A;  3GTL I;  4A3B I;  2QA4 Z;  1JJ2 Y;  4DK1 A;  5T67 A;  1Q82 1;  3P5J B;  3TDH B;  2OTJ Z;  1N8R 1;  1RQF A;  2P28 A;  5T64 A;  3J80 b;  3GTK I;  1VQ5 Z;  3T4N B;  3D6W A;  3CXC Y;  5D1O B;  4A3E I;  3M4O I;  2VF1 A;  4NB8 A;  2GU2 A;  1VQK 1;  3U50 C;  2YU9 I;  2RT9 A;  1VQL Z;  3BG0 B;  1Z02 A;  3GTM I;  1YUK A;  3FQM A;  3CPW Z;  3CCV Z;  4RVF A;  3GTJ I;  3CMA Z;  3CC4 Z;  1WII A;  4NBH A;  3S1M I;  3S15 I;  1QYP A;  3I4M I;  2E7Z A;  2PM9 A;  2YAD A;  3D2L A;  2JUB A;  3FQQ A;  3IR7 A;  5LL6 f;  1WW9 A;  1Y1V S;  3CCM Z;  1Y8C A;  2RIQ A;  5IT9 f;  4A3F I;  3HOV I;  2IZ3 A;  1VQO 1;  1TWC I;  2VUG A;  1VQ9 Z;  2E2H I;  1JWH C;  1VQ8 1;  1RNI A;  3LUS A;  2QKD A;  3CMA 1;  5C3E I;  1YHQ 1;  4BY1 I;  1QVF Z;  3GTO I;  2QEX Z;  1QVG Z;  3CCJ Z;  2PK7 A;  1Q81 1;  2OOX B;  3GTG I;  3PO2 I;  2EGT A;  4NBF A;  4A3I I;  2AYD A;  3OW2 Y;  5AN9 F;  4NBE A;  2JIO A;  2BJO A;  4A3G I;  2LEX A;  3CCU 1;  1K9M 1;  5A2Q f;  2V8J A;  2JA6 I;  1TWG I;  4BBR I;  1W2B Y;  3S2D I;  3HOY I;  3EED A;  4DGL A;  3RZD I;  2E2J I;  1VQ8 Z;  4A3L I;  2JMO A;  3MZL B;  1L1O C;  1Z03 A;  3QWU A;  4NBC A;  4NBG A;  4E2X A;  2QEX 1;  2Q4Z A;  2V8I A;  3MZK B;  4E31 A;  4EWC A;  4Y52 I;  1VLA A;  1M90 1;  1AA6 A;  3S1R I;  3CCS 1;  2K5R A;  3CCS Z;  3VMH A;  3GCF A;  2JS4 A;  3I07 A;  1K73 1;  4A93 I;  3JAM b;  2QLV B;  1YJN 1;  2NVT I;  1Q86 2;  1YJ9 Z;  1QF8 A;  2I3C A;  2OTL 1;  3S1Q I;  4E33 A;  4BBS I;  3G4S Z;  2RBL A;  2DE5 A;  2KPI A;  1YIJ 1;  4HGY A;  1Z01 A;  4NH1 C;  2DE7 A;  3NH4 A;  3I55 1;  1VQ4 Z;  3S16 I;  1ZB8 A;  2JA7 I;  3IF8 A;  1NP6 A;  2Q51 A;  5T6B A;  1RLY A;  3TE5 B;  3Q87 A;  1VQ4 1;  3I56 1;  2VPX A;  4E32 A;  1Q7Y 2;  1NJI 2;  1KC8 2;  2O4H A;  3CCL 1;  1VQ6 1;  1M1K 1;  3G6E Z;  2GTH A;  1N2F A;  1KQS Z;  1USP B;  4BXX I;  2RPR A;  2ZAE B;  4MH4 A;  3G6E 1;  1YIJ Z;  3MON A;  1YJN Z;  1YJ9 1;  1VQO Z;  2WAQ A;  5IP9 I;  1VQ7 Z;  3NFZ A;  1PFT A;  1Q82 2;  4AYB A;  3NH5 A;  3CCR Z;  3RZO I;  1LQL A;  3I56 Z;  3S1N I;  3CD6 Z;  3S2H I;  2DE6 A;  4Y7N I;  5IT9 b;  3PO3 S;  4X6A I;  1R9T I;  5C44 I;  2V45 A;  2K3R A;  1KQS Y;  3CC2 1;  4XX2 A;  4MON A;  3NDI A;  4RVG A;  3GTQ I;  1I50 I;  2R93 I;  1W2B Z;  1YJW 1;  4S1T A;  3VMI A;  4NFR A;  3KIH A;  1Q16 A;  2G2K A;  1TFI A;  3G71 Z;  3S17 I;  2JA8 I;  3I55 Z;  3OW2 Z;  5FLX b;  4HGZ A;  1SIW A;  1X3Z A;  1VQ5 1;  2NVQ I;  3NH8 A;  2M48 A;  1S72 1;  2W04 A;  2LIY A;  1KC8 1;  1NJI 1;  3CCR 1;  4NOZ A;  1RO4 A;  5D1O A;  1NUI A;  3CCJ 1;  4NBB A;  2B63 I;  4NBD A;  1RO2 A;  1Q7Y 1;  2V8K A;  4A3J I;  5IP7 I;  1RO0 A;  5C4J I;  2O53 A;  3CME Z;  1QVF Y;  1QXF A;  1VQN Z;  2E2I I;  1M1K 2;  2OOY B;  4A3C I;  1YIT 1;  3M3Y I;  5CM2 M;  3CCQ Z;  1KD1 1;  4DQY B;  3FKI I;  2IZ4 A;  3CCQ 1;  3G4S 1;  2HF1 A;  2R7Z I;  1Q86 1;  3I4N I;  1KD1 2;  3CCM 1;  1K73 2;  1Y1W I;  1YUA A;  4MD8 A;  4TNU A;  4A3K I;  2RHB A;  2NVY I;  2R92 I;  2PMZ A;  2E9H A;  1VQL 1;  2VPY A;  3EER A;  3IFU A;  2WB1 A;  5D1P A;  3CCV 1;  2KI7 B;  2V3V A;  2IV2 X;  3VMG A;  1N8R 2;  2P3Y A;  1USP A;  1WJ2 A;  3CCL Z;  3G71 1;  1ML8 A;  2F4O A;  1K83 I;  1JJ2 Z;  1S7M A;  3CXC Z;  1M90 2;  2JIP A;  2JIR A;  3HOW I;  3IX0 A;  1TWF I;  4BY7 I;  5FLM I;  1ZH1 A;  2M6N A;  1QVG Y;  2JIM A;  1I3Q I;  3JAM f;  1FDO A;  1WZN A;  1VQM 1;  3H0G I;  1FDI A;  2JIQ A;  4MD9 A;  1VQM Z;  1TWH I;  3CD6 1;  2W03 A;  2J6A A;  3ESW A;  2NAP A;  3D9X A;  3HOZ I;  2AKL A;  4MXU A;  3CC7 1;  1Q81 2;  4QTU A;  1DL6 A;  4A3D I; 
#chains in the Genus database with same CATH homology
 2QRC B;  4HH4 A;  4E2W A;  1K8A 2;  1WCM I;  2QR1 B;  3F3P C;  1VQP 1;  1VQ6 Z;  2OZK A;  4NBA A;  1TWA I;  3BG1 B;  3KIF A;  2OTL Z;  1ZB9 A;  3S14 I;  2HU9 A;  3H3V J;  4NB9 A;  1X3W A;  3VB9 A;  1VQ7 1;  3CQZ I;  3CCE 1;  2GTI A;  3CPW Y;  3CCU Z;  3NDJ A;  4QTT A;  3HKZ A;  1S72 Z;  1VQ9 1;  1VQK Z;  4RVH A;  3CC7 Z;  2R6M A;  3VTN A;  1P9N A;  3F3F C;  1YI2 Z;  5A2Q b;  4MRI A;  3J7A 4;  3CME 1;  4CL1 A;  5FLX f;  3GKQ A;  3K7A I;  2QRD B;  1YJW Z;  5C4X I;  3GTM S;  3CCE Z;  1K8A 1;  2F4M A;  2QRE B;  4A3M I;  2QA4 1;  4MD7 A;  4E2Y A;  3J81 b;  1KRL A;  2OTJ 1;  2JA5 I;  3PO3 I;  2H85 A;  3HOX I;  3GTP I;  2LFU A;  3HOU I;  1Y1V I;  3J81 f;  4E30 A;  3CC4 1;  2JR6 A;  4RVD A;  4E2Z A;  1SFO I;  2NVX I;  4RV9 A;  1X0T A;  3CC2 Z;  2Y0S A;  1K9M 2;  1YHQ Z;  1YI2 1;  1VQN 1;  3J80 f;  1I6H I;  1VQP Z;  2JNY A;  2VUM I;  1YIT Z;  4RS4 A;  3GTL I;  4A3B I;  2QA4 Z;  1JJ2 Y;  4DK1 A;  5T67 A;  1Q82 1;  3P5J B;  3TDH B;  2OTJ Z;  1N8R 1;  1RQF A;  2P28 A;  5T64 A;  3J80 b;  3GTK I;  1VQ5 Z;  3T4N B;  3D6W A;  3CXC Y;  5D1O B;  4A3E I;  3M4O I;  2VF1 A;  4NB8 A;  2GU2 A;  1VQK 1;  3U50 C;  2YU9 I;  2RT9 A;  1VQL Z;  3BG0 B;  1Z02 A;  3GTM I;  1YUK A;  3FQM A;  3CPW Z;  3CCV Z;  4RVF A;  3GTJ I;  3CMA Z;  3CC4 Z;  1WII A;  4NBH A;  3S1M I;  3S15 I;  1QYP A;  3I4M I;  2PM9 A;  2YAD A;  2JUB A;  3FQQ A;  5LL6 f;  1WW9 A;  1Y1V S;  3CCM Z;  2RIQ A;  5IT9 f;  4A3F I;  3HOV I;  2IZ3 A;  1VQO 1;  1TWC I;  2VUG A;  1VQ9 Z;  2E2H I;  1JWH C;  1VQ8 1;  1RNI A;  3LUS A;  2QKD A;  3CMA 1;  5C3E I;  1YHQ 1;  4BY1 I;  1QVF Z;  3GTO I;  2QEX Z;  1QVG Z;  3CCJ Z;  2PK7 A;  1Q81 1;  2OOX B;  3GTG I;  3PO2 I;  2EGT A;  4NBF A;  4A3I I;  3OW2 Y;  5AN9 F;  4NBE A;  2BJO A;  4A3G I;  3CCU 1;  1K9M 1;  5A2Q f;  2V8J A;  2JA6 I;  1TWG I;  4BBR I;  1W2B Y;  3S2D I;  3HOY I;  3EED A;  4DGL A;  3RZD I;  2E2J I;  1VQ8 Z;  4A3L I;  2JMO A;  3MZL B;  1L1O C;  1Z03 A;  3QWU A;  4NBC A;  4NBG A;  4E2X A;  2QEX 1;  2Q4Z A;  2V8I A;  3MZK B;  4E31 A;  4EWC A;  4Y52 I;  1VLA A;  1M90 1;  3S1R I;  3CCS 1;  2K5R A;  3CCS Z;  3VMH A;  3GCF A;  2JS4 A;  3I07 A;  1K73 1;  4A93 I;  3JAM b;  2QLV B;  1YJN 1;  2NVT I;  1Q86 2;  1YJ9 Z;  1QF8 A;  2I3C A;  2OTL 1;  3S1Q I;  4E33 A;  4BBS I;  3G4S Z;  2RBL A;  2DE5 A;  2KPI A;  1YIJ 1;  4HGY A;  1Z01 A;  4NH1 C;  2DE7 A;  3NH4 A;  3I55 1;  1VQ4 Z;  3S16 I;  1ZB8 A;  2JA7 I;  3IF8 A;  1NP6 A;  2Q51 A;  5T6B A;  1RLY A;  3TE5 B;  3Q87 A;  1VQ4 1;  3I56 1;  4E32 A;  1Q7Y 2;  1NJI 2;  1KC8 2;  2O4H A;  3CCL 1;  1VQ6 1;  1M1K 1;  3G6E Z;  2GTH A;  1N2F A;  1KQS Z;  1USP B;  4BXX I;  2RPR A;  2ZAE B;  4MH4 A;  3G6E 1;  1YIJ Z;  3MON A;  1YJN Z;  1YJ9 1;  5IP9 I;  2WAQ A;  1VQO Z;  1VQ7 Z;  3NFZ A;  1PFT A;  1Q82 2;  4AYB A;  3NH5 A;  3CCR Z;  3RZO I;  1LQL A;  3I56 Z;  3S1N I;  3CD6 Z;  3S2H I;  2DE6 A;  4Y7N I;  5IT9 b;  3PO3 S;  4X6A I;  1R9T I;  5C44 I;  2K3R A;  1KQS Y;  3CC2 1;  4XX2 A;  4MON A;  3NDI A;  4RVG A;  3GTQ I;  1I50 I;  2R93 I;  1W2B Z;  1YJW 1;  4S1T A;  3VMI A;  4NFR A;  3KIH A;  2G2K A;  1TFI A;  3G71 Z;  3S17 I;  2JA8 I;  3I55 Z;  3OW2 Z;  5FLX b;  4HGZ A;  1X3Z A;  1VQ5 1;  2NVQ I;  3NH8 A;  2M48 A;  1S72 1;  2W04 A;  2LIY A;  1KC8 1;  1NJI 1;  3CCR 1;  4NOZ A;  1RO4 A;  5D1O A;  1NUI A;  3CCJ 1;  4NBB A;  2B63 I;  4NBD A;  1RO2 A;  1Q7Y 1;  2V8K A;  4A3J I;  5IP7 I;  1RO0 A;  5C4J I;  2O53 A;  3CME Z;  1QVF Y;  1VQN Z;  2E2I I;  1M1K 2;  2OOY B;  4A3C I;  1YIT 1;  3M3Y I;  5CM2 M;  3CCQ Z;  1KD1 1;  4DQY B;  3FKI I;  2IZ4 A;  3CCQ 1;  3G4S 1;  2HF1 A;  2R7Z I;  1Q86 1;  3I4N I;  1KD1 2;  3CCM 1;  1K73 2;  1Y1W I;  1YUA A;  4MD8 A;  4TNU A;  4A3K I;  2RHB A;  2NVY I;  2R92 I;  2PMZ A;  2E9H A;  1VQL 1;  3IFU A;  3EER A;  2WB1 A;  5D1P A;  3CCV 1;  2KI7 B;  3VMG A;  1N8R 2;  2P3Y A;  1USP A;  3CCL Z;  3G71 1;  1ML8 A;  2F4O A;  1K83 I;  1JJ2 Z;  1S7M A;  3CXC Z;  1M90 2;  3HOW I;  3IX0 A;  1TWF I;  4BY7 I;  5FLM I;  1ZH1 A;  2M6N A;  1QVG Y;  1I3Q I;  3JAM f;  1VQM 1;  3H0G I;  4MD9 A;  1VQM Z;  1TWH I;  3CD6 1;  2W03 A;  2J6A A;  3ESW A;  3D9X A;  3HOZ I;  2AKL A;  4MXU A;  3CC7 1;  1Q81 2;  4QTU A;  1DL6 A;  4A3D I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...