1VQMZ

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqmZ00
1S721 1VQOZ 1VQMZ 3CCE1 1YHQZ 2QEX1 1K732 1QVFY 3CCVZ 1YIJ1 3I551 3CCMZ 1Q811 3CC71 1QVGY 1VQNZ 1VQ5Z 3CPWY 3CCS1 1W2BY 1NJI1 3OW2Y 3CCJ1 3CD61 1K8A1 2OTLZ 1YJ9Z 1Q812 3CME1 3CXCY 1Q822 1YIT1 1KD12 3CCLZ 1VQK1 1NJI2 3CMA1 1YJW1 3CCU1 1K8A2 1Q861 1VQ71 1K9M1 1M1K1 1W2BZ 1M901 1KC81 1VQO1 1KQSZ 1VQM1 1VQ6Z 3CC2Z 1VQLZ 1VQ4Z 1YHQ1 3CCV1 3CCQZ 3CCM1 1K9M2 1Q7Y1 1M1K2 1VQ9Z 1M902 1VQN1 1KC82 3G71Z 1VQ51 1VQL1 1YI2Z 3I56Z 2OTL1 1QVFZ 3G6EZ 1VQ8Z 1YJ91 2QA4Z 2OTJZ 3G711 3CCRZ 1QVGZ 3G4SZ 3CCL1 1N8R1 3CC4Z 3CPWZ 3OW2Z 1YJNZ 2QA41 2OTJ1 1Q862 3CXCZ 1JJ2Y 1K731 1N8R2 2QEXZ 1YJN1 1YIJZ 1VQPZ 3I55Z 1VQ61 3CC21 1VQ41 3CC7Z 3CCQ1 3CD6Z 3CCSZ 3CCJZ 1VQ91 1Q7Y2 1VQP1 1Q821 3CMEZ 1YI21 1YITZ 1KD11 3I561 3G6E1 1JJ2Z 1S72Z 1VQ81 1VQKZ 3CMAZ 1YJWZ 3CCUZ 1KQSY 3CCR1 3G4S1 3CCEZ 3CC41 1VQ7Z
chains in the Genus database with same CATH superfamily
2H85A 1VQMZ 2R7ZI 4A3II 5T67A 4NBEA 1YIJ1 2IZ4A 3CCMZ 1NUIA 4NBCA 1VQNZ 3HOVI 1TWHI 2W03A 1NJI1 3CCJ1 3K7AI 1P9NA 3CME1 3S16I 5C44I 3CXCY 2DE7A 1Q822 4A3EI 1KD12 3U50C 3CCU1 4NB9A 1Z02A 2V3VA 1K8A2 3HOZI 3S1NI 1Y1WI 2LIYA 1Q861 3GTJI 2PMZA 1W2BZ 5IP7I 1LQLA 3KIHA 1KQSZ 2W04A 1VQ4Z 1Q16A 3CCV1 1Z03A 5FLXb 2OZKA 2HF1A 4RVDA 5FLMI 3CCQZ 4MH4A 3HKZA 1VQ9Z 3GTMI 3G71Z 1VQ51 2NVYI 3J80b 4X6AI 3I56Z 3G6EZ 1YJ91 4DK1A 1Y1VI 4RVFA 2RHBA 2JIOA 3CCL1 1N8R1 4A3MI 1I50I 2QA41 2OTJ1 4NFRA 3S17I 5FLXf 4HH4A 2O4HA 3CXCZ 4BBRI 3EEDA 1K731 2QRDB 2Y0SA 1SIWA 1QF8A 1X3WA 1VQ61 3CC7Z 3D6WA 2WAQA 3H0GI 1DL6A 3CD6Z 2IV2X 1Y8CA 1YUAA 3S1QI 2KI7B 3GCFA 1YITZ 4AYBA 4E2YA 2M6NA 4A3GI 3CC41 2JA7I 3MONA 5D1OA 3JAMb 2OOYB 3S2DI 3CCE1 1YUKA 3VMIA 3VMGA 2QEX1 1QVFY 2P3YA 4E2XA 1TWFI 5D1PA 1Q811 1TWAI 2BJOA 2Q4ZA 1QVGY 4A3JI 2F4OA 1TFIA 2IZ3A 3CPWY 1W2BY 3OW2Y 2E2JI 1N2FA 2QR1B 4A93I 2E7ZA 3IFUA 2J6AA 4E30A 1ZB8A 3JAMf 1VQK1 2RBLA 1NJI2 3CMA1 2LEXA 1YJW1 2E2HI 3PO2I 2JA8I 3S15I 3VMHA 4MD9A 1I6HI 1K9M1 3RZDI 1KC81 1VQO1 3CC2Z 1VQLZ 3M4OI 1Z01A 1YHQ1 1TWCI 2JMOA 1RQFA 3PO3S 2JIMA 2JA5I 2OTL1 2V8JA 1QXFA 1VQ8Z 1QVFZ 3I07A 3G711 3TDHB 3CCRZ 1QVGZ 4NOZA 2LFUA 3IX0A 3CPWZ 2P28A 3OW2Z 4QTUA 4RS4A 3VTNA 3RZOI 3Q87A 3NDIA 2PM9A 1USPB 4MXUA 4DGLA 3BG0B 1N8R2 1I3QI 1YIJZ 4A3DI 2VUMI 1ZH1A 4MONA 3HOXI 5A2Qf 2VPYA 3CCJZ 4QTTA 1L1OC 3S1RI 1Q7Y2 5IT9f 3F3PC 2JIQA 4E31A 1Q821 3CMEZ 1YI21 1KD11 2NVQI 1JJ2Z 1S72Z 2Q51A 3CCUZ 4Y52I 2GU2A 3G4S1 3J81b 4TNUA 1USPA 3HOWI 2VPXA 4NB8A 2ZAEB 4E33A 4MRIA 1AA6A 1K83I 3CCVZ 3BG1B 3I551 1JWHC 4E2WA 2R92I 4DQYB 2O53A 2JIPA 1S7MA 1VQ5Z 2KPIA 4MD7A 4HGYA 1ZB9A 3CCS1 2V8KA 1TWGI 1KRLA 1YJ9Z 3J81f 3HOYI 1Q812 3GTKI 2B63I 2R93I 3CCLZ 3CQZI 2V45A 4CL1A 4A3CI 3H3VJ 2YU9I 1VQ71 2PK7A 3IR7A 1M1K1 1RO0A 1M901 3T4NB 1VQM1 1VQ6Z 5C4JI 2RIQA 4EWCA 4NBDA 1WW9A 4NBHA 3CCM1 1K9M2 2GTIA 3NH5A 2WB1A 1VQN1 1KC82 1VQL1 2R6MA 2M48A 2K3RA 2JA6I 4BXXI 2E2II 2I3CA 1RO2A 4Y7NI 1RLYA 5T64A 1SFOI 2AYDA 4RV9A 4MD8A 3CC4Z 3FQQA 3I4NI 1YJNZ 4RVGA 1FDIA 4A3KI 2JIRA 1Q862 4BBSI 1JJ2Y 2VPZA 2QEXZ 4XX2A 4NH1C 3MZKB 1VQPZ 3GTOI 1VQ41 1FDOA 4E32A 2NVXI 2HU9A 1R9TI 2VPWA 3D2LA 3CCQ1 3GTMS 1RO4A 3J7A4 1VQ91 1ML8A 2NVTI 5A2Qb 3I4MI 5IT9b 2OOXB 3I561 1X0TA 3G6E1 1VQKZ 1Y1VS 1NP6A 3CMAZ 1YJWZ 5AN9F 2JNYA 3VB9A 4RVHA 1S721 2RPRA 5CM2M 1RNIA 3EERA 2JUBA 2RT9A 3NH8A 1VLAA 1VQOZ 1YHQZ 3FQMA 2QKDA 1K732 2VF1A 3HOUI 3CC71 2QRCB 3S2HI 2VUGA 3MZLB 3GTGI 4S1TA 3CD61 3PO3I 2QLVB 3ESWA 4HGZA 1K8A1 2OTLZ 2K5RA 4A3FI 1WCMI 3S14I 1YIT1 4NBAA 5IP9I 5T6BA 5LL6f 3KIFA 2EGTA 1QYPA 1WIIA 3GTLI 3GTQI 3S1MI 3NDJA 3J80f 3GTPI 1WJ2A 1Q7Y1 5D1OB 1M1K2 4NBFA 1M902 1YI2Z 2V8IA 3F3FC 3D9XA 1PFTA 2DE5A 2QA4Z 2OTJZ 4E2ZA 3QWUA 3G4SZ 4NBBA 2F4MA 5C4XI 1WZNA 4A3LI 2G2KA 1YJN1 3P5JB 3I55Z 3NH4A 3CC21 2YADA 3GKQA 3TE5B 2NAPA 2DE6A 3CCSZ 3NFZA 2JR6A 2JS4A 1VQP1 1X3ZA 2AKLA 4NBGA 1VQ81 2GTHA 3LUSA 2QREB 5C3EI 4BY7I 1KQSY 3IF8A 3CCR1 3CCEZ 4BY1I 4A3BI 1VQ7Z 3M3YI 2E9HA 3FKII
chains in the Genus database with same CATH topology
2H85A 1VQMZ 2R7ZI 4A3II 5T67A 4NBEA 1YIJ1 2IZ4A 3CCMZ 1NUIA 4NBCA 1VQNZ 3HOVI 1TWHI 2W03A 1NJI1 3CCJ1 3K7AI 1P9NA 3CME1 3S16I 5C44I 3CXCY 2DE7A 1Q822 4A3EI 1KD12 3U50C 3CCU1 4NB9A 1Z02A 1K8A2 3HOZI 3S1NI 1Y1WI 2LIYA 1Q861 3GTJI 2PMZA 1W2BZ 5IP7I 1LQLA 3KIHA 1KQSZ 2W04A 1VQ4Z 3CCV1 1Z03A 5FLXb 2OZKA 2HF1A 4RVDA 5FLMI 3CCQZ 4MH4A 3HKZA 1VQ9Z 3GTMI 3G71Z 1VQ51 2NVYI 3J80b 4X6AI 3I56Z 3G6EZ 1YJ91 4DK1A 1Y1VI 4RVFA 2RHBA 3CCL1 1N8R1 4A3MI 1I50I 2QA41 2OTJ1 4NFRA 3S17I 5FLXf 4HH4A 2O4HA 3CXCZ 4BBRI 3EEDA 1K731 2QRDB 2Y0SA 1QF8A 1X3WA 1VQ61 3CC7Z 3D6WA 2WAQA 3H0GI 1DL6A 3CD6Z 1YUAA 3S1QI 2KI7B 3GCFA 1YITZ 4AYBA 4E2YA 2M6NA 4A3GI 3CC41 2JA7I 3MONA 5D1OA 3JAMb 2OOYB 3S2DI 3CCE1 1YUKA 3VMIA 3VMGA 2QEX1 1QVFY 2P3YA 4E2XA 1TWFI 5D1PA 1Q811 1TWAI 2BJOA 2Q4ZA 1QVGY 4A3JI 2F4OA 1TFIA 2IZ3A 3CPWY 1W2BY 3OW2Y 2E2JI 1N2FA 2QR1B 4A93I 3IFUA 2J6AA 4E30A 1ZB8A 3JAMf 1VQK1 2RBLA 1NJI2 3CMA1 1YJW1 2E2HI 3PO2I 2JA8I 3S15I 3VMHA 4MD9A 1I6HI 1K9M1 3RZDI 1KC81 1VQO1 3CC2Z 1VQLZ 3M4OI 1Z01A 1YHQ1 1TWCI 2JMOA 1RQFA 3PO3S 2JA5I 2OTL1 2V8JA 1VQ8Z 1QVFZ 3I07A 3G711 3TDHB 3CCRZ 1QVGZ 4NOZA 2LFUA 3IX0A 3CPWZ 2P28A 3OW2Z 4QTUA 4RS4A 3VTNA 3RZOI 3Q87A 3NDIA 2PM9A 1USPB 4MXUA 4DGLA 3BG0B 1N8R2 1I3QI 1YIJZ 4A3DI 2VUMI 1ZH1A 4MONA 3HOXI 5A2Qf 3CCJZ 4QTTA 1L1OC 3S1RI 1Q7Y2 5IT9f 3F3PC 4E31A 1Q821 3CMEZ 1YI21 1KD11 2NVQI 1JJ2Z 1S72Z 2Q51A 3CCUZ 4Y52I 2GU2A 3G4S1 3J81b 4TNUA 1USPA 3HOWI 4NB8A 2ZAEB 4E33A 4MRIA 1K83I 3CCVZ 3BG1B 3I551 1JWHC 4E2WA 2R92I 4DQYB 2O53A 1VQ5Z 1S7MA 2KPIA 4MD7A 4HGYA 1ZB9A 3CCS1 2V8KA 1TWGI 1KRLA 1YJ9Z 3J81f 3HOYI 1Q812 3GTKI 2B63I 2R93I 3CCLZ 3CQZI 4CL1A 4A3CI 3H3VJ 2YU9I 1VQ71 2PK7A 1M1K1 1RO0A 1M901 3T4NB 1VQM1 1VQ6Z 5C4JI 2RIQA 4EWCA 4NBDA 1WW9A 4NBHA 3CCM1 1K9M2 2GTIA 3NH5A 2WB1A 1VQN1 1KC82 1VQL1 2R6MA 2M48A 2K3RA 2JA6I 4BXXI 2E2II 2I3CA 1RO2A 4Y7NI 1RLYA 5T64A 1SFOI 4RV9A 4MD8A 3CC4Z 3FQQA 3I4NI 1YJNZ 4RVGA 4A3KI 1Q862 4BBSI 1JJ2Y 2QEXZ 4XX2A 4NH1C 3MZKB 1VQPZ 3GTOI 1VQ41 4E32A 2NVXI 2HU9A 1R9TI 3CCQ1 3GTMS 1RO4A 3J7A4 1VQ91 1ML8A 2NVTI 5A2Qb 3I4MI 5IT9b 2OOXB 3I561 1X0TA 3G6E1 1VQKZ 1Y1VS 1NP6A 3CMAZ 1YJWZ 5AN9F 2JNYA 3VB9A 4RVHA 1S721 2RPRA 5CM2M 1RNIA 3EERA 2JUBA 2RT9A 3NH8A 1VLAA 1VQOZ 1YHQZ 3FQMA 2QKDA 1K732 2VF1A 3HOUI 3CC71 2QRCB 3S2HI 2VUGA 3MZLB 3GTGI 4S1TA 3CD61 3PO3I 2QLVB 3ESWA 4HGZA 1K8A1 2OTLZ 2K5RA 4A3FI 1WCMI 3S14I 1YIT1 4NBAA 5IP9I 5T6BA 5LL6f 3KIFA 2EGTA 1QYPA 1WIIA 3GTLI 3GTQI 3S1MI 3NDJA 3J80f 3GTPI 1Q7Y1 5D1OB 1M1K2 4NBFA 1M902 1YI2Z 2V8IA 3F3FC 3D9XA 1PFTA 2DE5A 2QA4Z 2OTJZ 4E2ZA 3QWUA 3G4SZ 4NBBA 2F4MA 5C4XI 4A3LI 2G2KA 1YJN1 3P5JB 3I55Z 3NH4A 3CC21 2YADA 3GKQA 3TE5B 2DE6A 3CCSZ 3NFZA 2JR6A 2JS4A 1VQP1 1X3ZA 2AKLA 4NBGA 1VQ81 2GTHA 3LUSA 2QREB 5C3EI 4BY7I 1KQSY 3IF8A 3CCR1 3CCEZ 4BY1I 4A3BI 1VQ7Z 3M3YI 2E9HA 3FKII
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 1;  1VQO Z;  1VQM Z;  3CCE 1;  1YHQ Z;  2QEX 1;  1K73 2;  1QVF Y;  3CCV Z;  1YIJ 1;  3I55 1;  3CCM Z;  1Q81 1;  3CC7 1;  1QVG Y;  1VQN Z;  1VQ5 Z;  3CPW Y;  3CCS 1;  1W2B Y;  1NJI 1;  3OW2 Y;  3CCJ 1;  3CD6 1;  1K8A 1;  2OTL Z;  1YJ9 Z;  1Q81 2;  3CME 1;  3CXC Y;  1Q82 2;  1YIT 1;  1KD1 2;  3CCL Z;  1VQK 1;  1NJI 2;  3CMA 1;  1YJW 1;  3CCU 1;  1K8A 2;  1Q86 1;  1VQ7 1;  1K9M 1;  1M1K 1;  1W2B Z;  1M90 1;  1KC8 1;  1VQO 1;  1KQS Z;  1VQM 1;  1VQ6 Z;  3CC2 Z;  1VQL Z;  1VQ4 Z;  1YHQ 1;  3CCV 1;  3CCQ Z;  3CCM 1;  1K9M 2;  1Q7Y 1;  1M1K 2;  1VQ9 Z;  1M90 2;  1VQN 1;  1KC8 2;  3G71 Z;  1VQ5 1;  1VQL 1;  1YI2 Z;  3I56 Z;  2OTL 1;  1QVF Z;  3G6E Z;  1VQ8 Z;  1YJ9 1;  2QA4 Z;  2OTJ Z;  3G71 1;  3CCR Z;  1QVG Z;  3G4S Z;  3CCL 1;  1N8R 1;  3CC4 Z;  3CPW Z;  3OW2 Z;  1YJN Z;  2QA4 1;  2OTJ 1;  1Q86 2;  3CXC Z;  1JJ2 Y;  1K73 1;  1N8R 2;  2QEX Z;  1YJN 1;  1YIJ Z;  1VQP Z;  3I55 Z;  1VQ6 1;  3CC2 1;  1VQ4 1;  3CC7 Z;  3CCQ 1;  3CD6 Z;  3CCS Z;  3CCJ Z;  1VQ9 1;  1Q7Y 2;  1VQP 1;  1Q82 1;  3CME Z;  1YI2 1;  1YIT Z;  1KD1 1;  3I56 1;  3G6E 1;  1JJ2 Z;  1S72 Z;  1VQ8 1;  1VQK Z;  3CMA Z;  1YJW Z;  3CCU Z;  1KQS Y;  3CCR 1;  3G4S 1;  3CCE Z;  3CC4 1;  1VQ7 Z; 
#chains in the Genus database with same CATH topology
 2H85 A;  1VQM Z;  2R7Z I;  4A3I I;  5T67 A;  4NBE A;  1YIJ 1;  2IZ4 A;  3CCM Z;  1NUI A;  4NBC A;  1VQN Z;  3HOV I;  1TWH I;  2W03 A;  1NJI 1;  3CCJ 1;  3K7A I;  1P9N A;  3CME 1;  3S16 I;  5C44 I;  3CXC Y;  2DE7 A;  1Q82 2;  4A3E I;  1KD1 2;  3U50 C;  3CCU 1;  4NB9 A;  1Z02 A;  2V3V A;  1K8A 2;  3HOZ I;  3S1N I;  1Y1W I;  2LIY A;  1Q86 1;  3GTJ I;  2PMZ A;  1W2B Z;  5IP7 I;  1LQL A;  3KIH A;  1KQS Z;  2W04 A;  1VQ4 Z;  1Q16 A;  3CCV 1;  1Z03 A;  5FLX b;  2OZK A;  2HF1 A;  4RVD A;  5FLM I;  3CCQ Z;  4MH4 A;  3HKZ A;  1VQ9 Z;  3GTM I;  3G71 Z;  1VQ5 1;  2NVY I;  3J80 b;  4X6A I;  3I56 Z;  3G6E Z;  1YJ9 1;  4DK1 A;  1Y1V I;  4RVF A;  2RHB A;  2JIO A;  3CCL 1;  1N8R 1;  4A3M I;  1I50 I;  2QA4 1;  2OTJ 1;  4NFR A;  3S17 I;  5FLX f;  4HH4 A;  2O4H A;  3CXC Z;  4BBR I;  3EED A;  1K73 1;  2QRD B;  2Y0S A;  1SIW A;  1QF8 A;  1X3W A;  1VQ6 1;  3CC7 Z;  3D6W A;  2WAQ A;  3H0G I;  1DL6 A;  3CD6 Z;  2IV2 X;  1Y8C A;  1YUA A;  3S1Q I;  2KI7 B;  3GCF A;  1YIT Z;  4AYB A;  4E2Y A;  2M6N A;  4A3G I;  3CC4 1;  2JA7 I;  3MON A;  5D1O A;  3JAM b;  2OOY B;  3S2D I;  3CCE 1;  1YUK A;  3VMI A;  3VMG A;  2QEX 1;  1QVF Y;  2P3Y A;  4E2X A;  1TWF I;  5D1P A;  1Q81 1;  1TWA I;  2BJO A;  2Q4Z A;  1QVG Y;  4A3J I;  2F4O A;  1TFI A;  2IZ3 A;  3CPW Y;  1W2B Y;  3OW2 Y;  2E2J I;  1N2F A;  2QR1 B;  4A93 I;  2E7Z A;  3IFU A;  2J6A A;  4E30 A;  1ZB8 A;  3JAM f;  1VQK 1;  2RBL A;  1NJI 2;  3CMA 1;  2LEX A;  1YJW 1;  2E2H I;  3PO2 I;  2JA8 I;  3S15 I;  3VMH A;  4MD9 A;  1I6H I;  1K9M 1;  3RZD I;  1KC8 1;  1VQO 1;  3CC2 Z;  1VQL Z;  3M4O I;  1Z01 A;  1YHQ 1;  1TWC I;  2JMO A;  1RQF A;  3PO3 S;  2JIM A;  2JA5 I;  2OTL 1;  2V8J A;  1QXF A;  1VQ8 Z;  1QVF Z;  3I07 A;  3G71 1;  3TDH B;  3CCR Z;  1QVG Z;  4NOZ A;  2LFU A;  3IX0 A;  3CPW Z;  2P28 A;  3OW2 Z;  4QTU A;  4RS4 A;  3VTN A;  3RZO I;  3Q87 A;  3NDI A;  2PM9 A;  1USP B;  4MXU A;  4DGL A;  3BG0 B;  1N8R 2;  1I3Q I;  1YIJ Z;  4A3D I;  2VUM I;  1ZH1 A;  4MON A;  3HOX I;  5A2Q f;  2VPY A;  3CCJ Z;  4QTT A;  1L1O C;  3S1R I;  1Q7Y 2;  5IT9 f;  3F3P C;  2JIQ A;  4E31 A;  1Q82 1;  3CME Z;  1YI2 1;  1KD1 1;  2NVQ I;  1JJ2 Z;  1S72 Z;  2Q51 A;  3CCU Z;  4Y52 I;  2GU2 A;  3G4S 1;  3J81 b;  4TNU A;  1USP A;  3HOW I;  2VPX A;  4NB8 A;  2ZAE B;  4E33 A;  4MRI A;  1AA6 A;  1K83 I;  3CCV Z;  3BG1 B;  3I55 1;  1JWH C;  4E2W A;  2R92 I;  4DQY B;  2O53 A;  2JIP A;  1S7M A;  1VQ5 Z;  2KPI A;  4MD7 A;  4HGY A;  1ZB9 A;  3CCS 1;  2V8K A;  1TWG I;  1KRL A;  1YJ9 Z;  3J81 f;  3HOY I;  1Q81 2;  3GTK I;  2B63 I;  2R93 I;  3CCL Z;  3CQZ I;  2V45 A;  4CL1 A;  4A3C I;  3H3V J;  2YU9 I;  1VQ7 1;  2PK7 A;  3IR7 A;  1M1K 1;  1RO0 A;  1M90 1;  3T4N B;  1VQM 1;  1VQ6 Z;  5C4J I;  2RIQ A;  4EWC A;  4NBD A;  1WW9 A;  4NBH A;  3CCM 1;  1K9M 2;  2GTI A;  3NH5 A;  2WB1 A;  1VQN 1;  1KC8 2;  1VQL 1;  2R6M A;  2M48 A;  2K3R A;  2JA6 I;  4BXX I;  2E2I I;  2I3C A;  1RO2 A;  4Y7N I;  1RLY A;  5T64 A;  1SFO I;  2AYD A;  4RV9 A;  4MD8 A;  3CC4 Z;  3FQQ A;  3I4N I;  1YJN Z;  4RVG A;  1FDI A;  4A3K I;  2JIR A;  1Q86 2;  4BBS I;  1JJ2 Y;  2VPZ A;  2QEX Z;  4XX2 A;  4NH1 C;  3MZK B;  1VQP Z;  3GTO I;  1VQ4 1;  1FDO A;  4E32 A;  2NVX I;  2HU9 A;  1R9T I;  2VPW A;  3D2L A;  3CCQ 1;  3GTM S;  1RO4 A;  3J7A 4;  1VQ9 1;  1ML8 A;  2NVT I;  5A2Q b;  3I4M I;  5IT9 b;  2OOX B;  3I56 1;  1X0T A;  3G6E 1;  1VQK Z;  1Y1V S;  1NP6 A;  3CMA Z;  1YJW Z;  5AN9 F;  2JNY A;  3VB9 A;  4RVH A;  1S72 1;  2RPR A;  5CM2 M;  1RNI A;  3EER A;  2JUB A;  2RT9 A;  3NH8 A;  1VLA A;  1VQO Z;  1YHQ Z;  3FQM A;  2QKD A;  1K73 2;  2VF1 A;  3HOU I;  3CC7 1;  2QRC B;  3S2H I;  2VUG A;  3MZL B;  3GTG I;  4S1T A;  3CD6 1;  3PO3 I;  2QLV B;  3ESW A;  4HGZ A;  1K8A 1;  2OTL Z;  2K5R A;  4A3F I;  1WCM I;  3S14 I;  1YIT 1;  4NBA A;  5IP9 I;  5T6B A;  5LL6 f;  3KIF A;  2EGT A;  1QYP A;  1WII A;  3GTL I;  3GTQ I;  3S1M I;  3NDJ A;  3J80 f;  3GTP I;  1WJ2 A;  1Q7Y 1;  5D1O B;  1M1K 2;  4NBF A;  1M90 2;  1YI2 Z;  2V8I A;  3F3F C;  3D9X A;  1PFT A;  2DE5 A;  2QA4 Z;  2OTJ Z;  4E2Z A;  3QWU A;  3G4S Z;  4NBB A;  2F4M A;  5C4X I;  1WZN A;  4A3L I;  2G2K A;  1YJN 1;  3P5J B;  3I55 Z;  3NH4 A;  3CC2 1;  2YAD A;  3GKQ A;  3TE5 B;  2NAP A;  2DE6 A;  3CCS Z;  3NFZ A;  2JR6 A;  2JS4 A;  1VQP 1;  1X3Z A;  2AKL A;  4NBG A;  1VQ8 1;  2GTH A;  3LUS A;  2QRE B;  5C3E I;  4BY7 I;  1KQS Y;  3IF8 A;  3CCR 1;  3CCE Z;  4BY1 I;  4A3B I;  1VQ7 Z;  3M3Y I;  2E9H A;  3FKI I; 
#chains in the Genus database with same CATH homology
 2H85 A;  1VQM Z;  2R7Z I;  4A3I I;  5T67 A;  4NBE A;  1YIJ 1;  2IZ4 A;  3CCM Z;  1NUI A;  4NBC A;  1VQN Z;  3HOV I;  1TWH I;  2W03 A;  1NJI 1;  3CCJ 1;  3K7A I;  1P9N A;  3CME 1;  3S16 I;  5C44 I;  3CXC Y;  2DE7 A;  1Q82 2;  4A3E I;  1KD1 2;  3U50 C;  3CCU 1;  4NB9 A;  1Z02 A;  1K8A 2;  3HOZ I;  3S1N I;  1Y1W I;  2LIY A;  1Q86 1;  3GTJ I;  2PMZ A;  1W2B Z;  5IP7 I;  1LQL A;  3KIH A;  1KQS Z;  2W04 A;  1VQ4 Z;  3CCV 1;  1Z03 A;  5FLX b;  2OZK A;  2HF1 A;  4RVD A;  5FLM I;  3CCQ Z;  4MH4 A;  3HKZ A;  1VQ9 Z;  3GTM I;  3G71 Z;  1VQ5 1;  2NVY I;  3J80 b;  4X6A I;  3I56 Z;  3G6E Z;  1YJ9 1;  4DK1 A;  1Y1V I;  4RVF A;  2RHB A;  3CCL 1;  1N8R 1;  4A3M I;  1I50 I;  2QA4 1;  2OTJ 1;  4NFR A;  3S17 I;  5FLX f;  4HH4 A;  2O4H A;  3CXC Z;  4BBR I;  3EED A;  1K73 1;  2QRD B;  2Y0S A;  1QF8 A;  1X3W A;  1VQ6 1;  3CC7 Z;  3D6W A;  2WAQ A;  3H0G I;  1DL6 A;  3CD6 Z;  1YUA A;  3S1Q I;  2KI7 B;  3GCF A;  1YIT Z;  4AYB A;  4E2Y A;  2M6N A;  4A3G I;  3CC4 1;  2JA7 I;  3MON A;  5D1O A;  3JAM b;  2OOY B;  3S2D I;  3CCE 1;  1YUK A;  3VMI A;  3VMG A;  2QEX 1;  1QVF Y;  2P3Y A;  4E2X A;  1TWF I;  5D1P A;  1Q81 1;  1TWA I;  2BJO A;  2Q4Z A;  1QVG Y;  4A3J I;  2F4O A;  1TFI A;  2IZ3 A;  3CPW Y;  1W2B Y;  3OW2 Y;  2E2J I;  1N2F A;  2QR1 B;  4A93 I;  3IFU A;  2J6A A;  4E30 A;  1ZB8 A;  3JAM f;  1VQK 1;  2RBL A;  1NJI 2;  3CMA 1;  1YJW 1;  2E2H I;  3PO2 I;  2JA8 I;  3S15 I;  3VMH A;  4MD9 A;  1I6H I;  1K9M 1;  3RZD I;  1KC8 1;  1VQO 1;  3CC2 Z;  1VQL Z;  3M4O I;  1Z01 A;  1YHQ 1;  1TWC I;  2JMO A;  1RQF A;  3PO3 S;  2JA5 I;  2OTL 1;  2V8J A;  1VQ8 Z;  1QVF Z;  3I07 A;  3G71 1;  3TDH B;  3CCR Z;  1QVG Z;  4NOZ A;  2LFU A;  3IX0 A;  3CPW Z;  2P28 A;  3OW2 Z;  4QTU A;  4RS4 A;  3VTN A;  3RZO I;  3Q87 A;  3NDI A;  2PM9 A;  1USP B;  4MXU A;  4DGL A;  3BG0 B;  1N8R 2;  1I3Q I;  1YIJ Z;  4A3D I;  2VUM I;  1ZH1 A;  4MON A;  3HOX I;  5A2Q f;  3CCJ Z;  4QTT A;  1L1O C;  3S1R I;  1Q7Y 2;  5IT9 f;  3F3P C;  4E31 A;  1Q82 1;  3CME Z;  1YI2 1;  1KD1 1;  2NVQ I;  1JJ2 Z;  1S72 Z;  2Q51 A;  3CCU Z;  4Y52 I;  2GU2 A;  3G4S 1;  3J81 b;  4TNU A;  1USP A;  3HOW I;  4NB8 A;  2ZAE B;  4E33 A;  4MRI A;  1K83 I;  3CCV Z;  3BG1 B;  3I55 1;  1JWH C;  4E2W A;  2R92 I;  4DQY B;  2O53 A;  1VQ5 Z;  1S7M A;  2KPI A;  4MD7 A;  4HGY A;  1ZB9 A;  3CCS 1;  2V8K A;  1TWG I;  1KRL A;  1YJ9 Z;  3J81 f;  3HOY I;  1Q81 2;  3GTK I;  2B63 I;  2R93 I;  3CCL Z;  3CQZ I;  4CL1 A;  4A3C I;  3H3V J;  2YU9 I;  1VQ7 1;  2PK7 A;  1M1K 1;  1RO0 A;  1M90 1;  3T4N B;  1VQM 1;  1VQ6 Z;  5C4J I;  2RIQ A;  4EWC A;  4NBD A;  1WW9 A;  4NBH A;  3CCM 1;  1K9M 2;  2GTI A;  3NH5 A;  2WB1 A;  1VQN 1;  1KC8 2;  1VQL 1;  2R6M A;  2M48 A;  2K3R A;  2JA6 I;  4BXX I;  2E2I I;  2I3C A;  1RO2 A;  4Y7N I;  1RLY A;  5T64 A;  1SFO I;  4RV9 A;  4MD8 A;  3CC4 Z;  3FQQ A;  3I4N I;  1YJN Z;  4RVG A;  4A3K I;  1Q86 2;  4BBS I;  1JJ2 Y;  2QEX Z;  4XX2 A;  4NH1 C;  3MZK B;  1VQP Z;  3GTO I;  1VQ4 1;  4E32 A;  2NVX I;  2HU9 A;  1R9T I;  3CCQ 1;  3GTM S;  1RO4 A;  3J7A 4;  1VQ9 1;  1ML8 A;  2NVT I;  5A2Q b;  3I4M I;  5IT9 b;  2OOX B;  3I56 1;  1X0T A;  3G6E 1;  1VQK Z;  1Y1V S;  1NP6 A;  3CMA Z;  1YJW Z;  5AN9 F;  2JNY A;  3VB9 A;  4RVH A;  1S72 1;  2RPR A;  5CM2 M;  1RNI A;  3EER A;  2JUB A;  2RT9 A;  3NH8 A;  1VLA A;  1VQO Z;  1YHQ Z;  3FQM A;  2QKD A;  1K73 2;  2VF1 A;  3HOU I;  3CC7 1;  2QRC B;  3S2H I;  2VUG A;  3MZL B;  3GTG I;  4S1T A;  3CD6 1;  3PO3 I;  2QLV B;  3ESW A;  4HGZ A;  1K8A 1;  2OTL Z;  2K5R A;  4A3F I;  1WCM I;  3S14 I;  1YIT 1;  4NBA A;  5IP9 I;  5T6B A;  5LL6 f;  3KIF A;  2EGT A;  1QYP A;  1WII A;  3GTL I;  3GTQ I;  3S1M I;  3NDJ A;  3J80 f;  3GTP I;  1Q7Y 1;  5D1O B;  1M1K 2;  4NBF A;  1M90 2;  1YI2 Z;  2V8I A;  3F3F C;  3D9X A;  1PFT A;  2DE5 A;  2QA4 Z;  2OTJ Z;  4E2Z A;  3QWU A;  3G4S Z;  4NBB A;  2F4M A;  5C4X I;  4A3L I;  2G2K A;  1YJN 1;  3P5J B;  3I55 Z;  3NH4 A;  3CC2 1;  2YAD A;  3GKQ A;  3TE5 B;  2DE6 A;  3CCS Z;  3NFZ A;  2JR6 A;  2JS4 A;  1VQP 1;  1X3Z A;  2AKL A;  4NBG A;  1VQ8 1;  2GTH A;  3LUS A;  2QRE B;  5C3E I;  4BY7 I;  1KQS Y;  3IF8 A;  3CCR 1;  3CCE Z;  4BY1 I;  4A3B I;  1VQ7 Z;  3M3Y I;  2E9H A;  3FKI I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...