1VQMZ

The structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
b'RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqmZ00
1YJW1 1YHQZ 3CCL1 1YIJ1 2OTLZ 3CCV1 1W2BZ 1Q7Y2 1M902 3CCM1 1S721 3CCJZ 3CD6Z 1VQ71 3CXCY 1Q822 1VQ51 1K9M2 3CMAZ 1K732 1NJI2 3CPWY 1VQK1 3OW2Y 1VQ91 1M901 1YJ91 2QEX1 1VQ8Z 3I56Z 3CCE1 1Q821 1VQPZ 1VQO1 1VQ61 1VQLZ 1KQSZ 2QA41 1QVFZ 1YI2Z 3CC4Z 1VQM1 3CCQZ 1YJN1 3CMEZ 3G4S1 1VQ9Z 3CCS1 3CCR1 1VQN1 3I551 3CC21 3G6EZ 1JJ2Z 3CCUZ 3CC7Z 2OTJ1 1W2BY 1VQ41 1YJWZ 3CCLZ 1YIJZ 3CCVZ 1K8A1 1QVGZ 1KD12 3CCMZ 1S72Z 1KC81 1VQNZ 3G711 1VQ7Z 1Q812 1VQ5Z 1YHQ1 1KD11 1KQSY 1VQKZ 1QVFY 1YJ9Z 2QEXZ 1K8A2 3CCEZ 1Q811 1VQOZ 1VQ6Z 3CCJ1 3CD61 1YIT1 1KC82 1JJ2Y 2QA4Z 3CMA1 1VQMZ 1YJNZ 1N8R1 3G4SZ 1VQ81 3I561 3CCSZ 3CCRZ 1Q862 3CXCZ 3I55Z 1VQP1 3CC2Z 1M1K2 1QVGY 1VQL1 2OTJZ 3CPWZ 3OW2Z 1YI21 3CC41 1VQ4Z 1YITZ 2OTL1 3CCQ1 3CME1 1Q861 1M1K1 1Q7Y1 1N8R2 3G6E1 3CCU1 3CC71 3G71Z 1K9M1 1NJI1 1K731
chains in the Genus database with same CATH superfamily
4A3DI 4QTTA 4MD7A 5FLXf 3NH8A 2JA5I 1Y1VI 1I3QI 1M902 1PFTA 1USPB 3JAMb 2JIPA 1VQ71 4NH1C 1K9M2 1NJI2 5T64A 2AKLA 1M901 1YJ91 1R9TI 2QEX1 2GTIA 3LUSA 3CCE1 1NUIA 2I3CA 2E7ZA 1VQLZ 1TWAI 1DL6A 3S1QI 1Z01A 3HOZI 3M3YI 2LIYA 2R93I 2M48A 2VUGA 2R6MA 1ML8A 2VPYA 1YI2Z 3NFZA 4MD8A 3VB9A 3NH5A 1K83I 2J6AA 4TNUA 3IR7A 3I551 5C4XI 1TWCI 3JAMf 4QTUA 1YUAA 4RVDA 3K7AI 1YJWZ 2V8KA 3CCLZ 1X3ZA 2YU9I 1K8A1 1SIWA 1S72Z 2QR1B 4BBRI 1VQ5Z 3S1MI 2DE6A 1VQKZ 1L1OC 1QYPA 3VTNA 4DQYB 4A3JI 1JWHC 1VQ6Z 2V8IA 3CCJ1 3CD61 3I4MI 1KC82 1JJ2Y 3TE5B 4E2XA 1VQMZ 4NFRA 2VPWA 1YJNZ 4MXUA 5C4JI 3GTQI 2K5RA 5CM2M 3I561 1WZNA 3CXCZ 1Q862 3CC2Z 3EEDA 2RIQA 1QVGY 4A3MI 2OTJZ 3CPWZ 4Y52I 3OW2Z 1KRLA 1SFOI 1TFIA 3CC41 1VQ4Z 1YITZ 2OTL1 4A3LI 1LQLA 3CCQ1 2JMOA 5A2Qb 1Q861 2NVTI 1N8R2 3ESWA 4A3CI 3CC71 3RZDI 3G71Z 1K731 3S2HI 4E2ZA 3MZLB 4BBSI 4BY7I 5T6BA 4A3BI 4RS4A 1Q7Y2 3CCM1 4RV9A 3GTKI 2VF1A 1S7MA 2KPIA 4NOZA 5A2Qf 4E33A 1N2FA 1VQ8Z 2KI7B 2HU9A 1VQPZ 2QA41 1QVFZ 3CMEZ 2NVXI 3GTMI 2JA8I 2F4MA 3CCR1 2JIRA 5LL6f 3G6EZ 2JNYA 2QRCB 3CCUZ 3S1NI 1W2BY 2RHBA 5D1OB 4NBFA 3S1RI 2VUMI 1Y1VS 1YIJZ 2JIMA 3CCVZ 1KD12 4NBDA 3GTOI 3HOYI 1NP6A 5FLMI 1RO0A 1KD11 1KQSY 4NB9A 2RBLA 3GKQA 4E30A 2E2II 2JIQA 3KIHA 2QRDB 3J7A4 2IZ3A 2W03A 1K8A2 2G2KA 3NH4A 1Y1WI 1VQOZ 1TWFI 3GTJI 1ZB9A 2AYDA 2OOXB 3G4SZ 2WAQA 3MONA 3CCSZ 2IV2X 4Y7NI 5IP9I 4MD9A 1M1K2 3P5JB 4DGLA 1VQL1 4E32A 1YI21 4BXXI 5D1PA 2P28A 4A3FI 3S14I 1M1K1 4HH4A 2NVYI 2B63I 3VMGA 3FKII 4RVHA 5C44I 2E9HA 1YJW1 1YHQZ 3H3VJ 3CCL1 3J80b 3TDHB 2OTLZ 3GTLI 2VPXA 1TWGI 1YUKA 1S721 3F3FC 1VLAA 1Q822 1ZH1A 3NDIA 1VQ51 1Y8CA 3CMAZ 1K732 1X3WA 4E2WA 1VQK1 3HKZA 2R92I 2R7ZI 3S2DI 1VQ91 1RNIA 4BY1I 3EERA 3FQQA 2LFUA 2WB1A 4HGZA 3HOVI 1WW9A 3MZKB 1Q821 1VQ61 3CQZI 1Z03A 1RQFA 1Q16A 3F3PC 2RT9A 4EWCA 3J80f 1VQM1 1YJN1 1ZB8A 2GU2A 2PMZA 1RO2A 3M4OI 3HOXI 4A3GI 1VQN1 3CC21 1JJ2Z 2P3YA 2OTJ1 4NBGA 2O4HA 4MRIA 1VQ41 2V8JA 2M6NA 3D2LA 5D1OA 1RO4A 1AA6A 3D9XA 1QVGZ 2IZ4A 1QF8A 3HOUI 3G711 2QLVB 1VQ7Z 3IX0A 3IF8A 1Q812 2HF1A 5IT9b 3IFUA 4RVFA 2DE5A 4RVGA 2JA7I 4S1TA 3GTGI 4MONA 1YJ9Z 3J81f 2QEXZ 3CCEZ 1Q811 2QREB 3GTMS 2NAPA 3VMIA 4E2YA 3HOWI 1VQ81 3I55Z 1VQP1 5IP7I 3VMHA 2OZKA 3QWUA 4XX2A 5IT9f 4E31A 3CME1 5C3EI 2JA6I 5T67A 3G6E1 3Q87A 2E2JI 3CCU1 1K9M1 1NJI1 2E2HI 2RPRA 4NBCA 3BG0B 2Q4ZA 1X0TA 1FDIA 1WIIA 1YIJ1 3CCV1 3KIFA 1W2BZ 1P9NA 3PO3I 2PM9A 3D6WA 2JUBA 2YADA 3FQMA 3CCJZ 3CD6Z 3CXCY 4NB8A 3CPWY 3I07A 2NVQI 2PK7A 4MH4A 3OW2Y 4NBAA 4A3EI 3PO3S 3I56Z 2ZAEB 1VQO1 3GCFA 3T4NB 2OOYB 1KQSZ 2JR6A 2V3VA 2V45A 3CC4Z 3CCQZ 1FDOA 2EGTA 3G4S1 3U50C 1VQ9Z 3CCS1 3CC7Z 3I4NI 3BG1B 4AYBA 2Q51A 4NBEA 1I6HI 4NBHA 4DK1A 3S15I 2QKDA 4A3KI 3CCMZ 1KC81 1VQNZ 2GTHA 2O53A 2JIOA 1YHQ1 3RZOI 3H0GI 4HGYA 4CL1A 3J81b 1QVFY 2H85A 4X6AI 1WJ2A 4A3II 2JS4A 3S16I 1YIT1 2QA4Z 2F4OA 3S17I 1QXFA 3CMA1 1N8R1 5FLXb 3NDJA 2LEXA 1Z02A 3CCRZ 2Y0SA 3PO2I 5AN9F 1WCMI 4A93I 2W04A 2VPZA 2DE7A 1RLYA 2K3RA 3GTPI 1USPA 1I50I 1Q7Y1 4NBBA 1TWHI 2BJOA
chains in the Genus database with same CATH topology
4A3DI 4QTTA 4MD7A 5FLXf 3NH8A 2JA5I 1Y1VI 1I3QI 1M902 1PFTA 1USPB 3JAMb 1VQ71 4NH1C 1K9M2 1NJI2 5T64A 2AKLA 1M901 1YJ91 1R9TI 2QEX1 2GTIA 3LUSA 3CCE1 1NUIA 2I3CA 1VQLZ 1TWAI 1DL6A 3S1QI 1Z01A 3HOZI 3M3YI 2LIYA 2R93I 2M48A 2VUGA 2R6MA 1ML8A 1YI2Z 3NFZA 4MD8A 3VB9A 3NH5A 1K83I 2J6AA 4TNUA 3I551 5C4XI 1TWCI 3JAMf 4QTUA 1YUAA 4RVDA 3K7AI 1YJWZ 2V8KA 3CCLZ 1X3ZA 2YU9I 1K8A1 1S72Z 2QR1B 4BBRI 1VQ5Z 3S1MI 2DE6A 1VQKZ 1L1OC 1QYPA 4DQYB 3VTNA 4A3JI 1JWHC 1VQ6Z 2V8IA 3CCJ1 3CD61 3I4MI 1KC82 1JJ2Y 3TE5B 4E2XA 1VQMZ 4NFRA 1YJNZ 4MXUA 5C4JI 3GTQI 2K5RA 5CM2M 3I561 1Q862 3CXCZ 3CC2Z 3EEDA 2RIQA 1QVGY 4A3MI 2OTJZ 3CPWZ 4Y52I 3OW2Z 1KRLA 1SFOI 1TFIA 3CC41 1VQ4Z 1YITZ 2OTL1 4A3LI 1LQLA 3CCQ1 2JMOA 5A2Qb 1Q861 2NVTI 1N8R2 3ESWA 4A3CI 3CC71 3RZDI 3G71Z 1K731 3S2HI 4E2ZA 3MZLB 4BBSI 4BY7I 5T6BA 4A3BI 4RS4A 1Q7Y2 3CCM1 4RV9A 3GTKI 2VF1A 1S7MA 2KPIA 4NOZA 5A2Qf 4E33A 1N2FA 1VQ8Z 2KI7B 2HU9A 1VQPZ 2QA41 1QVFZ 3CMEZ 2NVXI 3GTMI 2JA8I 2F4MA 3CCR1 5LL6f 3G6EZ 2JNYA 2QRCB 3CCUZ 3S1NI 1W2BY 2RHBA 5D1OB 4NBFA 3S1RI 2VUMI 1Y1VS 1YIJZ 3CCVZ 1KD12 4NBDA 3GTOI 3HOYI 1NP6A 5FLMI 1RO0A 1KD11 1KQSY 4NB9A 2RBLA 3GKQA 4E30A 2E2II 3KIHA 2QRDB 3J7A4 2IZ3A 2W03A 1K8A2 2G2KA 3NH4A 1Y1WI 1VQOZ 1TWFI 3GTJI 1ZB9A 2OOXB 3G4SZ 2WAQA 3MONA 3CCSZ 4Y7NI 5IP9I 4MD9A 1M1K2 3P5JB 4DGLA 1VQL1 4E32A 1YI21 4BXXI 5D1PA 2P28A 4A3FI 3S14I 1M1K1 4HH4A 2NVYI 2B63I 3VMGA 3FKII 4RVHA 5C44I 2E9HA 1YJW1 1YHQZ 3H3VJ 3CCL1 3J80b 3TDHB 2OTLZ 3GTLI 1TWGI 1YUKA 1S721 3F3FC 1VLAA 1Q822 1ZH1A 3NDIA 1VQ51 3CMAZ 1K732 1X3WA 4E2WA 1VQK1 3HKZA 2R92I 2R7ZI 3S2DI 1VQ91 1RNIA 4BY1I 3EERA 3FQQA 2LFUA 2WB1A 4HGZA 3HOVI 1WW9A 3MZKB 1Q821 1VQ61 3CQZI 1Z03A 1RQFA 3F3PC 2RT9A 4EWCA 3J80f 1VQM1 1YJN1 1ZB8A 2GU2A 2PMZA 1RO2A 3M4OI 3HOXI 4A3GI 1VQN1 3CC21 1JJ2Z 2P3YA 2OTJ1 4NBGA 2O4HA 4MRIA 1VQ41 2V8JA 2M6NA 5D1OA 1RO4A 3D9XA 1QVGZ 2IZ4A 1QF8A 3HOUI 3G711 2QLVB 1VQ7Z 3IX0A 3IF8A 1Q812 2HF1A 5IT9b 3IFUA 4RVFA 2DE5A 4RVGA 2JA7I 4S1TA 3GTGI 4MONA 1YJ9Z 3J81f 2QEXZ 3CCEZ 1Q811 2QREB 3GTMS 3VMIA 4E2YA 3HOWI 1VQ81 3I55Z 1VQP1 5IP7I 3VMHA 2OZKA 3QWUA 4XX2A 5IT9f 4E31A 3CME1 5C3EI 2JA6I 5T67A 3G6E1 3Q87A 2E2JI 3CCU1 1K9M1 1NJI1 2E2HI 2RPRA 4NBCA 3BG0B 2Q4ZA 1X0TA 1WIIA 1YIJ1 3CCV1 3KIFA 1W2BZ 1P9NA 3PO3I 2PM9A 3D6WA 2JUBA 2YADA 3FQMA 3CCJZ 3CD6Z 3CXCY 4NB8A 3CPWY 3I07A 2NVQI 2PK7A 4MH4A 3OW2Y 4NBAA 4A3EI 3PO3S 3I56Z 2ZAEB 1VQO1 3GCFA 3T4NB 2OOYB 1KQSZ 2JR6A 3CC4Z 3CCQZ 2EGTA 3G4S1 3U50C 1VQ9Z 3CCS1 3CC7Z 3I4NI 3BG1B 4AYBA 2Q51A 4NBEA 1I6HI 4NBHA 4DK1A 3S15I 2QKDA 4A3KI 3CCMZ 1KC81 1VQNZ 2GTHA 2O53A 1YHQ1 3RZOI 3H0GI 4HGYA 4CL1A 3J81b 1QVFY 2H85A 4X6AI 4A3II 2JS4A 3S16I 1YIT1 2QA4Z 2F4OA 3S17I 3CMA1 1N8R1 5FLXb 3NDJA 1Z02A 3CCRZ 2Y0SA 3PO2I 5AN9F 1WCMI 4A93I 2W04A 2DE7A 1RLYA 2K3RA 3GTPI 1USPA 1I50I 1Q7Y1 4NBBA 1TWHI 2BJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW 1;  1YHQ Z;  3CCL 1;  1YIJ 1;  2OTL Z;  3CCV 1;  1W2B Z;  1Q7Y 2;  1M90 2;  3CCM 1;  1S72 1;  3CCJ Z;  3CD6 Z;  1VQ7 1;  3CXC Y;  1Q82 2;  1VQ5 1;  1K9M 2;  3CMA Z;  1K73 2;  1NJI 2;  3CPW Y;  1VQK 1;  3OW2 Y;  1VQ9 1;  1M90 1;  1YJ9 1;  2QEX 1;  1VQ8 Z;  3I56 Z;  3CCE 1;  1Q82 1;  1VQP Z;  1VQO 1;  1VQ6 1;  1VQL Z;  1KQS Z;  2QA4 1;  1QVF Z;  1YI2 Z;  3CC4 Z;  1VQM 1;  3CCQ Z;  1YJN 1;  3CME Z;  3G4S 1;  1VQ9 Z;  3CCS 1;  3CCR 1;  1VQN 1;  3I55 1;  3CC2 1;  3G6E Z;  1JJ2 Z;  3CCU Z;  3CC7 Z;  2OTJ 1;  1W2B Y;  1VQ4 1;  1YJW Z;  3CCL Z;  1YIJ Z;  3CCV Z;  1K8A 1;  1QVG Z;  1KD1 2;  3CCM Z;  1S72 Z;  1KC8 1;  1VQN Z;  3G71 1;  1VQ7 Z;  1Q81 2;  1VQ5 Z;  1YHQ 1;  1KD1 1;  1KQS Y;  1VQK Z;  1QVF Y;  1YJ9 Z;  2QEX Z;  1K8A 2;  3CCE Z;  1Q81 1;  1VQO Z;  1VQ6 Z;  3CCJ 1;  3CD6 1;  1YIT 1;  1KC8 2;  1JJ2 Y;  2QA4 Z;  3CMA 1;  1VQM Z;  1YJN Z;  1N8R 1;  3G4S Z;  1VQ8 1;  3I56 1;  3CCS Z;  3CCR Z;  1Q86 2;  3CXC Z;  3I55 Z;  1VQP 1;  3CC2 Z;  1M1K 2;  1QVG Y;  1VQL 1;  2OTJ Z;  3CPW Z;  3OW2 Z;  1YI2 1;  3CC4 1;  1VQ4 Z;  1YIT Z;  2OTL 1;  3CCQ 1;  3CME 1;  1Q86 1;  1M1K 1;  1Q7Y 1;  1N8R 2;  3G6E 1;  3CCU 1;  3CC7 1;  3G71 Z;  1K9M 1;  1NJI 1;  1K73 1; 
#chains in the Genus database with same CATH topology
 4A3D I;  4QTT A;  4MD7 A;  5FLX f;  3NH8 A;  2JA5 I;  1Y1V I;  1I3Q I;  1M90 2;  1PFT A;  1USP B;  3JAM b;  2JIP A;  1VQ7 1;  4NH1 C;  1K9M 2;  1NJI 2;  5T64 A;  2AKL A;  1M90 1;  1YJ9 1;  1R9T I;  2QEX 1;  2GTI A;  3LUS A;  3CCE 1;  1NUI A;  2I3C A;  2E7Z A;  1VQL Z;  1TWA I;  1DL6 A;  3S1Q I;  1Z01 A;  3HOZ I;  3M3Y I;  2LIY A;  2R93 I;  2M48 A;  2VUG A;  2R6M A;  1ML8 A;  2VPY A;  1YI2 Z;  3NFZ A;  4MD8 A;  3VB9 A;  3NH5 A;  1K83 I;  2J6A A;  4TNU A;  3IR7 A;  3I55 1;  5C4X I;  1TWC I;  3JAM f;  4QTU A;  1YUA A;  4RVD A;  3K7A I;  1YJW Z;  2V8K A;  3CCL Z;  1X3Z A;  2YU9 I;  1K8A 1;  1SIW A;  1S72 Z;  2QR1 B;  4BBR I;  1VQ5 Z;  3S1M I;  2DE6 A;  1VQK Z;  1L1O C;  1QYP A;  3VTN A;  4DQY B;  4A3J I;  1JWH C;  1VQ6 Z;  2V8I A;  3CCJ 1;  3CD6 1;  3I4M I;  1KC8 2;  1JJ2 Y;  3TE5 B;  4E2X A;  1VQM Z;  4NFR A;  2VPW A;  1YJN Z;  4MXU A;  5C4J I;  3GTQ I;  2K5R A;  5CM2 M;  3I56 1;  1WZN A;  3CXC Z;  1Q86 2;  3CC2 Z;  3EED A;  2RIQ A;  1QVG Y;  4A3M I;  2OTJ Z;  3CPW Z;  4Y52 I;  3OW2 Z;  1KRL A;  1SFO I;  1TFI A;  3CC4 1;  1VQ4 Z;  1YIT Z;  2OTL 1;  4A3L I;  1LQL A;  3CCQ 1;  2JMO A;  5A2Q b;  1Q86 1;  2NVT I;  1N8R 2;  3ESW A;  4A3C I;  3CC7 1;  3RZD I;  3G71 Z;  1K73 1;  3S2H I;  4E2Z A;  3MZL B;  4BBS I;  4BY7 I;  5T6B A;  4A3B I;  4RS4 A;  1Q7Y 2;  3CCM 1;  4RV9 A;  3GTK I;  2VF1 A;  1S7M A;  2KPI A;  4NOZ A;  5A2Q f;  4E33 A;  1N2F A;  1VQ8 Z;  2KI7 B;  2HU9 A;  1VQP Z;  2QA4 1;  1QVF Z;  3CME Z;  2NVX I;  3GTM I;  2JA8 I;  2F4M A;  3CCR 1;  2JIR A;  5LL6 f;  3G6E Z;  2JNY A;  2QRC B;  3CCU Z;  3S1N I;  1W2B Y;  2RHB A;  5D1O B;  4NBF A;  3S1R I;  2VUM I;  1Y1V S;  1YIJ Z;  2JIM A;  3CCV Z;  1KD1 2;  4NBD A;  3GTO I;  3HOY I;  1NP6 A;  5FLM I;  1RO0 A;  1KD1 1;  1KQS Y;  4NB9 A;  2RBL A;  3GKQ A;  4E30 A;  2E2I I;  2JIQ A;  3KIH A;  2QRD B;  3J7A 4;  2IZ3 A;  2W03 A;  1K8A 2;  2G2K A;  3NH4 A;  1Y1W I;  1VQO Z;  1TWF I;  3GTJ I;  1ZB9 A;  2AYD A;  2OOX B;  3G4S Z;  2WAQ A;  3MON A;  3CCS Z;  2IV2 X;  4Y7N I;  5IP9 I;  4MD9 A;  1M1K 2;  3P5J B;  4DGL A;  1VQL 1;  4E32 A;  1YI2 1;  4BXX I;  5D1P A;  2P28 A;  4A3F I;  3S14 I;  1M1K 1;  4HH4 A;  2NVY I;  2B63 I;  3VMG A;  3FKI I;  4RVH A;  5C44 I;  2E9H A;  1YJW 1;  1YHQ Z;  3H3V J;  3CCL 1;  3J80 b;  3TDH B;  2OTL Z;  3GTL I;  2VPX A;  1TWG I;  1YUK A;  1S72 1;  3F3F C;  1VLA A;  1Q82 2;  1ZH1 A;  3NDI A;  1VQ5 1;  1Y8C A;  3CMA Z;  1K73 2;  1X3W A;  4E2W A;  1VQK 1;  3HKZ A;  2R92 I;  2R7Z I;  3S2D I;  1VQ9 1;  1RNI A;  4BY1 I;  3EER A;  3FQQ A;  2LFU A;  2WB1 A;  4HGZ A;  3HOV I;  1WW9 A;  3MZK B;  1Q82 1;  1VQ6 1;  3CQZ I;  1Z03 A;  1RQF A;  1Q16 A;  3F3P C;  2RT9 A;  4EWC A;  3J80 f;  1VQM 1;  1YJN 1;  1ZB8 A;  2GU2 A;  2PMZ A;  1RO2 A;  3M4O I;  3HOX I;  4A3G I;  1VQN 1;  3CC2 1;  1JJ2 Z;  2P3Y A;  2OTJ 1;  4NBG A;  2O4H A;  4MRI A;  1VQ4 1;  2V8J A;  2M6N A;  3D2L A;  5D1O A;  1RO4 A;  1AA6 A;  3D9X A;  1QVG Z;  2IZ4 A;  1QF8 A;  3HOU I;  3G71 1;  2QLV B;  1VQ7 Z;  3IX0 A;  3IF8 A;  1Q81 2;  2HF1 A;  5IT9 b;  3IFU A;  4RVF A;  2DE5 A;  4RVG A;  2JA7 I;  4S1T A;  3GTG I;  4MON A;  1YJ9 Z;  3J81 f;  2QEX Z;  3CCE Z;  1Q81 1;  2QRE B;  3GTM S;  2NAP A;  3VMI A;  4E2Y A;  3HOW I;  1VQ8 1;  3I55 Z;  1VQP 1;  5IP7 I;  3VMH A;  2OZK A;  3QWU A;  4XX2 A;  5IT9 f;  4E31 A;  3CME 1;  5C3E I;  2JA6 I;  5T67 A;  3G6E 1;  3Q87 A;  2E2J I;  3CCU 1;  1K9M 1;  1NJI 1;  2E2H I;  2RPR A;  4NBC A;  3BG0 B;  2Q4Z A;  1X0T A;  1FDI A;  1WII A;  1YIJ 1;  3CCV 1;  3KIF A;  1W2B Z;  1P9N A;  3PO3 I;  2PM9 A;  3D6W A;  2JUB A;  2YAD A;  3FQM A;  3CCJ Z;  3CD6 Z;  3CXC Y;  4NB8 A;  3CPW Y;  3I07 A;  2NVQ I;  2PK7 A;  4MH4 A;  3OW2 Y;  4NBA A;  4A3E I;  3PO3 S;  3I56 Z;  2ZAE B;  1VQO 1;  3GCF A;  3T4N B;  2OOY B;  1KQS Z;  2JR6 A;  2V3V A;  2V45 A;  3CC4 Z;  3CCQ Z;  1FDO A;  2EGT A;  3G4S 1;  3U50 C;  1VQ9 Z;  3CCS 1;  3CC7 Z;  3I4N I;  3BG1 B;  4AYB A;  2Q51 A;  4NBE A;  1I6H I;  4NBH A;  4DK1 A;  3S15 I;  2QKD A;  4A3K I;  3CCM Z;  1KC8 1;  1VQN Z;  2GTH A;  2O53 A;  2JIO A;  1YHQ 1;  3RZO I;  3H0G I;  4HGY A;  4CL1 A;  3J81 b;  1QVF Y;  2H85 A;  4X6A I;  1WJ2 A;  4A3I I;  2JS4 A;  3S16 I;  1YIT 1;  2QA4 Z;  2F4O A;  3S17 I;  1QXF A;  3CMA 1;  1N8R 1;  5FLX b;  3NDJ A;  2LEX A;  1Z02 A;  3CCR Z;  2Y0S A;  3PO2 I;  5AN9 F;  1WCM I;  4A93 I;  2W04 A;  2VPZ A;  2DE7 A;  1RLY A;  2K3R A;  3GTP I;  1USP A;  1I50 I;  1Q7Y 1;  4NBB A;  1TWH I;  2BJO A; 
#chains in the Genus database with same CATH homology
 4A3D I;  4QTT A;  4MD7 A;  5FLX f;  3NH8 A;  2JA5 I;  1Y1V I;  1I3Q I;  1M90 2;  1PFT A;  1USP B;  3JAM b;  1VQ7 1;  4NH1 C;  1K9M 2;  1NJI 2;  5T64 A;  2AKL A;  1M90 1;  1YJ9 1;  1R9T I;  2QEX 1;  2GTI A;  3LUS A;  3CCE 1;  1NUI A;  2I3C A;  1VQL Z;  1TWA I;  1DL6 A;  3S1Q I;  1Z01 A;  3HOZ I;  3M3Y I;  2LIY A;  2R93 I;  2M48 A;  2VUG A;  2R6M A;  1ML8 A;  1YI2 Z;  3NFZ A;  4MD8 A;  3VB9 A;  3NH5 A;  1K83 I;  2J6A A;  4TNU A;  3I55 1;  5C4X I;  1TWC I;  3JAM f;  4QTU A;  1YUA A;  4RVD A;  3K7A I;  1YJW Z;  2V8K A;  3CCL Z;  1X3Z A;  2YU9 I;  1K8A 1;  1S72 Z;  2QR1 B;  4BBR I;  1VQ5 Z;  3S1M I;  2DE6 A;  1VQK Z;  1L1O C;  1QYP A;  4DQY B;  3VTN A;  4A3J I;  1JWH C;  1VQ6 Z;  2V8I A;  3CCJ 1;  3CD6 1;  3I4M I;  1KC8 2;  1JJ2 Y;  3TE5 B;  4E2X A;  1VQM Z;  4NFR A;  1YJN Z;  4MXU A;  5C4J I;  3GTQ I;  2K5R A;  5CM2 M;  3I56 1;  1Q86 2;  3CXC Z;  3CC2 Z;  3EED A;  2RIQ A;  1QVG Y;  4A3M I;  2OTJ Z;  3CPW Z;  4Y52 I;  3OW2 Z;  1KRL A;  1SFO I;  1TFI A;  3CC4 1;  1VQ4 Z;  1YIT Z;  2OTL 1;  4A3L I;  1LQL A;  3CCQ 1;  2JMO A;  5A2Q b;  1Q86 1;  2NVT I;  1N8R 2;  3ESW A;  4A3C I;  3CC7 1;  3RZD I;  3G71 Z;  1K73 1;  3S2H I;  4E2Z A;  3MZL B;  4BBS I;  4BY7 I;  5T6B A;  4A3B I;  4RS4 A;  1Q7Y 2;  3CCM 1;  4RV9 A;  3GTK I;  2VF1 A;  1S7M A;  2KPI A;  4NOZ A;  5A2Q f;  4E33 A;  1N2F A;  1VQ8 Z;  2KI7 B;  2HU9 A;  1VQP Z;  2QA4 1;  1QVF Z;  3CME Z;  2NVX I;  3GTM I;  2JA8 I;  2F4M A;  3CCR 1;  5LL6 f;  3G6E Z;  2JNY A;  2QRC B;  3CCU Z;  3S1N I;  1W2B Y;  2RHB A;  5D1O B;  4NBF A;  3S1R I;  2VUM I;  1Y1V S;  1YIJ Z;  3CCV Z;  1KD1 2;  4NBD A;  3GTO I;  3HOY I;  1NP6 A;  5FLM I;  1RO0 A;  1KD1 1;  1KQS Y;  4NB9 A;  2RBL A;  3GKQ A;  4E30 A;  2E2I I;  3KIH A;  2QRD B;  3J7A 4;  2IZ3 A;  2W03 A;  1K8A 2;  2G2K A;  3NH4 A;  1Y1W I;  1VQO Z;  1TWF I;  3GTJ I;  1ZB9 A;  2OOX B;  3G4S Z;  2WAQ A;  3MON A;  3CCS Z;  4Y7N I;  5IP9 I;  4MD9 A;  1M1K 2;  3P5J B;  4DGL A;  1VQL 1;  4E32 A;  1YI2 1;  4BXX I;  5D1P A;  2P28 A;  4A3F I;  3S14 I;  1M1K 1;  4HH4 A;  2NVY I;  2B63 I;  3VMG A;  3FKI I;  4RVH A;  5C44 I;  2E9H A;  1YJW 1;  1YHQ Z;  3H3V J;  3CCL 1;  3J80 b;  3TDH B;  2OTL Z;  3GTL I;  1TWG I;  1YUK A;  1S72 1;  3F3F C;  1VLA A;  1Q82 2;  1ZH1 A;  3NDI A;  1VQ5 1;  3CMA Z;  1K73 2;  1X3W A;  4E2W A;  1VQK 1;  3HKZ A;  2R92 I;  2R7Z I;  3S2D I;  1VQ9 1;  1RNI A;  4BY1 I;  3EER A;  3FQQ A;  2LFU A;  2WB1 A;  4HGZ A;  3HOV I;  1WW9 A;  3MZK B;  1Q82 1;  1VQ6 1;  3CQZ I;  1Z03 A;  1RQF A;  3F3P C;  2RT9 A;  4EWC A;  3J80 f;  1VQM 1;  1YJN 1;  1ZB8 A;  2GU2 A;  2PMZ A;  1RO2 A;  3M4O I;  3HOX I;  4A3G I;  1VQN 1;  3CC2 1;  1JJ2 Z;  2P3Y A;  2OTJ 1;  4NBG A;  2O4H A;  4MRI A;  1VQ4 1;  2V8J A;  2M6N A;  5D1O A;  1RO4 A;  3D9X A;  1QVG Z;  2IZ4 A;  1QF8 A;  3HOU I;  3G71 1;  2QLV B;  1VQ7 Z;  3IX0 A;  3IF8 A;  1Q81 2;  2HF1 A;  5IT9 b;  3IFU A;  4RVF A;  2DE5 A;  4RVG A;  2JA7 I;  4S1T A;  3GTG I;  4MON A;  1YJ9 Z;  3J81 f;  2QEX Z;  3CCE Z;  1Q81 1;  2QRE B;  3GTM S;  3VMI A;  4E2Y A;  3HOW I;  1VQ8 1;  3I55 Z;  1VQP 1;  5IP7 I;  3VMH A;  2OZK A;  3QWU A;  4XX2 A;  5IT9 f;  4E31 A;  3CME 1;  5C3E I;  2JA6 I;  5T67 A;  3G6E 1;  3Q87 A;  2E2J I;  3CCU 1;  1K9M 1;  1NJI 1;  2E2H I;  2RPR A;  4NBC A;  3BG0 B;  2Q4Z A;  1X0T A;  1WII A;  1YIJ 1;  3CCV 1;  3KIF A;  1W2B Z;  1P9N A;  3PO3 I;  2PM9 A;  3D6W A;  2JUB A;  2YAD A;  3FQM A;  3CCJ Z;  3CD6 Z;  3CXC Y;  4NB8 A;  3CPW Y;  3I07 A;  2NVQ I;  2PK7 A;  4MH4 A;  3OW2 Y;  4NBA A;  4A3E I;  3PO3 S;  3I56 Z;  2ZAE B;  1VQO 1;  3GCF A;  3T4N B;  2OOY B;  1KQS Z;  2JR6 A;  3CC4 Z;  3CCQ Z;  2EGT A;  3G4S 1;  3U50 C;  1VQ9 Z;  3CCS 1;  3CC7 Z;  3I4N I;  3BG1 B;  4AYB A;  2Q51 A;  4NBE A;  1I6H I;  4NBH A;  4DK1 A;  3S15 I;  2QKD A;  4A3K I;  3CCM Z;  1KC8 1;  1VQN Z;  2GTH A;  2O53 A;  1YHQ 1;  3RZO I;  3H0G I;  4HGY A;  4CL1 A;  3J81 b;  1QVF Y;  2H85 A;  4X6A I;  4A3I I;  2JS4 A;  3S16 I;  1YIT 1;  2QA4 Z;  2F4O A;  3S17 I;  3CMA 1;  1N8R 1;  5FLX b;  3NDJ A;  1Z02 A;  3CCR Z;  2Y0S A;  3PO2 I;  5AN9 F;  1WCM I;  4A93 I;  2W04 A;  2DE7 A;  1RLY A;  2K3R A;  3GTP I;  1USP A;  1I50 I;  1Q7Y 1;  4NBB A;  1TWH I;  2BJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...