2RBLA

High resolution design of a protein loop
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
89
structure length
89
Chain Sequence
LDAPSQIEVKDVTDTTALITWSMQLSQLEGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tenascin
publication title High-resolution design of a protein loop.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 8
structure length 89
sequence length 89
chains with identical sequence B, M
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2rblA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2rblA02
4N5ED 5JOPE 3BSZH 3QXWA 5CLWA 5EC2B 3MYJA 2HLAA 5JPMA 1AXSB 3HMXL 1L1OC 2CK0H 5ESAA 3U0PB 3PUCA 2H45A 1WFNA 2CUIA 2E7LA 3UBXI 2EC9T 2DQGL 4OCRL 3PP3K 4P5TA 5D7JC 2FH6A 5HSFA 4OB5L 1BEYL 4XCNB 4PRPA 5KVGL 3SCMB 3X12A 1S5HB 5IJVB 2VLJE 5ADPL 4PGJA 2FX7L 3FFCA 3EOTL 5GRWA 5HHXH 1KCKA 5GGUA 5E1HB 5DHYA 4QGTA 4HGKC 3O6ML 1NL0H 2VDNH 4PD4J 2GTWA 4X99B 1KG0B 4GAGH 4YHYC 4KUCF 5GRJL 2GITB 1DP0A 3H3VJ 4I3GA 2AXFB 4G9FD 4MJ6B 4ZUTA 2DWDA 1U58B 5EC1A 5MERB 1J1XH 3Q3GA 3C5JA 3LEXA 5DVMA 3L7EA 4ZUWA 1S9XB 2D4FA 2X5PA 4K7PX 3C60D 1XGTB 1UM6L 3B8YA 4FQHA 5C09E 3WKML 5DJ6B 1RI8A 1TITA 3G6JA 4OAWA 3TP4A 3PO3S 5SWZB 1FFOB 2UZYB 2VDRL 5EU6B 1IAIL 3L9RB 1OTUC 4QOKA 3SDXA 4PRHA 5EOCJ 4P9HH 3WNOA 3CSBA 1X3ZA 1VENA 3BPCA 4G6MH 1CK0L 5E00B 2VLJD 3HS0B 3K8MA 1MWAL 1U8PB 4XPBH 2ICWA 4H88L 1OAKL 4HFWA 1BZ9A 25C8H 4AQOA 5EIIA 1Z9MA 1JJUA 1JNJA 2NY0D 1L9NA 3GSUA 2P45B 5JW4R 4RX4A 4PJDF 5F9AC 4LOUD 5EB9A 5EBWA 4IRSA 1I3GL 5GGTH 4QRPB 5E1AA 5K9QI 1XGQA 3DX6B 4ZTOL 2ZOKB 4BQ9A 1A6AB 1UH3A 5C09D 2YD2A 5HGBA 4EI6A 4LQFL 4G8FB 5BO1L 3U36B 4HJ0C 3LKOA 4NZJA 4G9FA 2I60H 4QYOA 3BN3B 4NNPH 2FZ3B 5IQ9A 3JWDL 3QDHA 1IGYA 4BZ2L 1CFBA 1SVZA 5F70A 4P4KD 3I50L 4MWFA 4V2BA 1R3KB 2P8PA 3EOAB 3HPJA 4YIQA 5T3XD 4ZTPL 3HR5A 1T5WB 2XTJE 3QR2A 5E2JA 1G6RB 3C60A 4YDKH 3OL2A 4Z7VF 1P1ZA 4HWZB 2IADB 3UPCA 3GM0A 5LQBH 4JO3L 4QTIH 3VXRB 3MJGX 4JRYD 1FBIH 1K3IA 4UAOC 1BVZA 5SV4A 4YDVA 4I77H 4YDIH 5I9QB 1DLHB 3WO3B 3ZYJA 3F58H 4JHZA 4C56E 2IPUG 3JV0A 3P30L 4S1SL 3QUKA 4OSUL 4PYHA 3E2HC 4QT5B 2N7AA 1RJYB 4LLYB 4AT6A 3RWGA 1LP9B 1N7ML 1MJJB 1JFQH 1VEMA 5EORH 4CU8A 1OAXH 4NC1E 5HGHB 4ZOCA 5IUSA 2QSQA 4RRPG 1NFKA 4NOZA 3ZYZA 5EBLB 1MCPH 4K7FB 1DQML 2COQA 3QUML 1DEEB 1MF2L 5E5UB 1MSPA 1JF1B 1BZ7B 4GBXD 3O3DA 2LVEA 4UT9H 4Q6YA 2P42B 1T1YA 1TJIL 1T6WA 2XTJD 3HUJE 2IF7A 4OI7A 4EUPA 5GS3A 3FO1B 4HGWB 2HVJA 3TVMB 1I7UB 5CKAA 1BVKB 3UTOA 4L8SA 2A6JB 4YUEH 1USPB 2DWEB 5I71B 4CN1A 4JFZL 4XNMA 5IESL 3MUZ1 4P4KA 3ARFD 4O51B 4XVTL 2X70B 4L4JA 5C0IA 1KTLA 4QHLB 4C56D 3SPVB 1A7OH 2H32B 4LNRB 4Q9RL 3MZTA 4MXVE 3SE9L 4CU7A 4Y4FC 5INDA 4JFDB 3PP3H 1KJVB 1HCVA 3D9AL 3NCCB 2VDQL 4X6EB 4XVSH 4KTDL 3ZE1F 5BCAA 1E27B 1XH3A 4KV5F 3SDDD 5IWLA 1EEYB 2GTZB 3GSXA 1MUJA 2DOCA 4HUXA 4JRYA 2NX5D 2OCFD 4J3VA 3MBXL 1KB9J 5D7SL 3CCHB 4BK5A 1T4KB 3HAEA 1A6VH 4RGNB 2NTFB 2AJSL 2HH0H 3QH3B 1YY9D 2HKHH 2OTPA 5FGCB 2VABA 4QRTB 3O2DH 2XWTA 2X05A 4FP8H 1UYWH 4R96A 2DM2A 5GRXG 2XXCB 3MXVH 4QNPE 2G60H 4TVPE 1OM3H 3PHQB 4GG6F 3QZWG 3X3GL 1PD6A 3U9PH 4GBXA 3B9KD 1WZLA 4Z8FH 3PE9A 4JAMB 3CFEA 3MLVL 1TIUA 2YD4A 2ZNXA 2ATKB 2BNRB 3RDTC 4XAWH 3LHPL 3T4YA 3HG1B 2YWZA 1A6ZB 5AZEH 4NWTL 5CJQH 5HYIA 1LO0H 1KSRA 32C2A 4MNGB 1Q8MA 1D6EA 1JK8A 5F44A 4KKBC 1FN4A 3ZL4L 4M6MH 1J1PL 5BXFA 1YN7A 1R5IB 3ZTNL 1YEDA 2AXGB 4PJ5E 3ARFA 3G5VA 3CSYA 5C0DB 2P5WB 3RAJL 1HZHL 3JV4B 4XWOC 5FM5M 3DVGB 5IK3A 2DBLH 4PRAA 4Y5YA 3QFJE 2EE6A 1FYHB 5DDHA 2AJYH 2NTSP 4MCZB 1T2XA 4GT7A 4NCC1 5HDLA 2HP4A 1WZKA 3SGJC 3SDDA 3P9LA 2AEQH 3HI6H 3HOZI 4GRWH 1Z0MA 3GTOI 3TNMA 3I6GA 1U8JA 4HKXA 1QFWI 2NX5A 4PV9B 1WITA 3FQTB 5DJDB 1KC5H 3CIQA 4R2GC 3IDXL 3E0GA 4M6NL 3RA7H 1SYSB 4X6DA 3V8CA 5KG9B 3CK0L 5IMLB 4F15B 5C7XH 3U7YH 4OCXH 1NC4D 4EXPX 4J8RA 3QHFH 4R7NA 5I1KH 4RISL 4ZUVA 4L8DB 1MEXH 5IKCB 3V0WH 1OCWH 4MQ7A 2D31B 4UU9B 4YNYA 3HUJA 1RUKH 2BOCA 2EICA 2DLFH 3OKNA 4ZXBB 3L5WB 4LSRL 4Z76B 2V2TA 3FB6A 4BSVB 1KJ2B 5IW1A 2WWKO 1JPTL 1JGLH 1HHGB 1XF1A 1UJ3B 4N0FB 4F33A 4DN4H 5HY9B 1B88A 4JZJB 1N8ZB 2AEWA 3DX8B 5E4EC 4O2EA 1SYVA 3LQAC 1ES0A 3CLFH 3GSOA 3Q6FB 3NTCH 2C3XA 3EJZC 3QFJD 1WWBX 1TNMA 1L7IL 4C4KO 1JUFB 3SN6N 5D2LA 3JV5A 3IFNH 4Z78B 4WI5A 2W07A 5EO1A 4FFZL 1R5WA 1RURH 2VQ1B 1LO2L 3DHMA 3RHWK 1E4XI 1NJ9A 2CRZA 1FZMA 5E70A 1AGBA 1MJ8H 2YZ1A 2YZ8A 5I6XB 2HN7B 1YEIH 3GMLA 2GIYA 1EK3A 4OLUH 3AC0A 4TPRL 1X5YA 5EN2B 4OZFB 2BRQA 3IETA 4Z7UE 4PJBB 3CDFA 3H0GI 3BH9A 4PLNC 3QNZB 5ID0B 5CS7A 2F9BT 5E9DB 5I1JL 3LQMA 1ZTXL 5HHMB 4TQEH 1D5XB 1JF6A 1LQSR 3FQUA 1YEGH 15C8L 1ZT1A 5DRZB 2AGJL 2L4OA 4H0HB 1INQA 4OZ4A 1EA9C 1B9ZA 1G7HB 4YHKH 4X9FA 2WSKA 5ISZB 3D1MC 3W39A 4UV7L 3T3PE 5I8OH 4URTB 4TOYL 4RWYL 2W9DL 1NC4A 3NCEB 4UQ2B 1Q9LB 1G7PB 2BNUA 1W0WA 4UNVA 2FATL 3RWFA 2YD1A 4NQDB 4I0PD 1A7QL 1YEFH 3ULUD 1OTTD 4G42A 3NN8A 2GFBB 2AJXL 1DUZA 1MCOH 4HUKB 1TQBB 4KVNL 4GSDH 3U6RB 5FKPB 1CXEA 1CIUA 1NGZB 2JKXA 2YSSB 5ERWB 4N8VG 3HI5L 4OZHE 5ICZB 3FO9A 1M05A 5JLZB 1QLEL 3V4UH 4TNVK 5GS1C 1XCQB 3BWAA 3P9WB 2VUOA 4QGYA 4L9LB 1ZGLA 2F53D 1WJ3A 4NKOB 4PJ8B 4R3SA 5ESQA 1QLRA 4JPVL 4KRPB 1T89A 1S7SA 3NCFB 2HJFA 4OZGB 4M4RA 4UBDC 5FYKU 2UWEF 1DBBH 1CIDA 3Q5TA 4JG1L 1NMBL 3OGOE 4LVNB 4O00A 1DSFL 1R3LB 2R23B 2X4OB 3DYMA 5E2WH 1PG7X 1FRGL 3PDDA 1N5AA 1IGIH 4M61A 3ESWA 4ZO7A 4Y8AA 4O58L 4OKDA 1KN2H 4TSBH 5IROA 4U6HB 2BOBA 4Z0BH 1IM3B 3CH1B 2YD7A 1OAQL 3QI9C 1JV5B 3ES6A 1S7VB 4QWWC 3BHBB 5CZXD 4XPFL 4RA3A 4OCNC 4LCUB 1UCBL 2UUDK 5GS0C 4I0PA 4YHIB 3MRHB 3EO0B 4OFYD 4HK0B 1GIGL 2BNQD 1INDH 1NEZG 5KVFH 1ADQL 1BQLH 4MGXA 2E7CA 4BFIA 1KFAL 3E6HA 4Q9CA 3WE6B 4MD4A 4EZMA 4PJEB 3I07A 2MQCA 5HPMB 3GKWH 2VDLL 4HWBH 1ZWIB 4AEIH 3OR6B 4XX1G 5I16A 3MJ9L 4HH9A 1YNTA 1DQJA 1DBKL 1MCDA 5FA3B 1CR9L 1PEWA 2F53A 5IFAL 1RZ7L 5MEOA 5CEZE 4GAJH 4FABH 3HHRB 1T2QH 3WFZA 5DXWA 2ADFH 5TH2A 2AQ2A 4UILH 4QRSB 3GI8H 1LQLA 3T65B 1T66D 3TT3H 4CVUA 4AL8H 5HYJB 4KJPC 4I4WB 4PJ7E 4XHJC 2BSRB 4XCFL 2ZUVA 3WXVL 4MJ5A 3M07A 1HCFX 1O7SA 3EAKA 1JGDA 5E0QA 2YPVH 4MD0B 5IOPA 1S7WB 2CIIA 2VISB 2Y07L 3BFOA 4HBQA 1LD9B 4AJ0A 3KPQB 3GMMA 3H3KA 4P49A 4D8PB 5F72S 1NCAL 4FS0A 1MFCL 3ZKXC 1LO3H 4JN2A 4A2MA 3LH2L 4HUWA 3VXOB 1GXEA 3VWJD 3OAUH 2EKSB 2MWCA 5GZOC 4OZHA 3H0TB 3NGBB 1TCMA 3FT2A 3PV6B 2M2DA 5GJTH 3MLYL 2W0KA 3KPNB 1A9BA 5DURB 5JW4N 1OB1A 3SBWC 1FLRH 3DUHA 4RGMB 2ZSVA 2BNQA 3TJHC 2X9XA 1FZJA 1FDLH 4HSQA 3IKKA 3P73B 3RUGF 3JTTB 3FMGL 2OQJB 7FABL 3G5XB 1AE6H 3JXAA 4D0CA 3T2NH 1RZFL 2J4WL 1WFOA 5JW5A 1JPGB 4P2OC 3G6DL 4JCMA 2X7LA 2NXYD 2XZQL 1EAJA 3H7BB 4BY1I 3MRBB 2BDNL 4QTHA 1A9EA 3C08H 5GSVA 5D1QC 4NKMB 2GJZB 4OV6F 4O2CA 4ZPTA 3VW3H 2WIIB 2HRLA 5SWZE 4UB0L 4I5BB 1X3WA 4U6XA 4ELMF 1ZHNB 2VDPH 4FXGA 1KNOB 5EU6E 5ILTL 2D0FA 3GTJI 3ILQC 5LWYL 2G9HA 1U3HD 3MV8B 4I2XB 5D1ZD 4PBVC 5ID1B 3GBNH 2UZIL 3SCMD 2V5SA 4HXBL 3OJ2C 2R8SL 4N9OB 4WV1B 1L7TL 4XNXH 1H8SA 1RFDL 2VE6A 4WU5A 4PJCF 1NAMA 3BQUB 3BSZL 1PW3A 2JE8A 4Y1AB 5LGHH 4LP5A 1AC6A 2BVOA 3CFJB 5F7DA 2P24A 2DI7A 2EDJA 3K4DA 1D5BA 1JIBA 4JB9H 4XCEB 2LTQB 2VLKA 1OSZB 4POZD 1IEAA 4NJAH 3EO9L 3I4NI 4MJID 4NQEB 5JDJA 2P43B 5DR5L 4PJIE 2DQCL 1BD2D 1KXVC 2A77H 4QRPE 1I9JH 1A7NH 1H5BB 5HHXL 4EQ2A 4WFFD 2RFXA 4KGLA 3RY6C 1MPAL 2GAZA 2PYEA 4U1NB 3OZ9H 3DO7B 5IB2B 3MR9B 4LCIL 1Y0LA 4CVXB 5EU6D 1YEKL 3S6CA 5I1CH 2AERT 2BC4B 4JREB 3P40A 4O02H 2CGRH 2AKLA 4D0BA 2OK0L 3UYRL 5IBUG 4JFEA 3ULSA 2ESVB 3UTPE 2ZUXA 4UTAH 1XGYL 4N9GA 5IBTH 1LDPH 5L2KB 3PO3I 4PJ7A 1F8TH 3IAGC 1U91A 1KCUH 5D72L 2VITA 5D71H 4U6TA 1U8IB 2OXHA 4KK8C 4BSWB 4LRNL 2VLLA 4GUPA 4H5SA 4WO4B 3VXRE 1U3HA 5D1ZA 3IXTA 2G5BA 4FQ1L 3KYKL 4WHDA 4HJJL 4LLVB 3U7WL 5F7NC 3U1SH 5HPOA 3OXRB 5DJ0A 3FL7A 2RQ8A 4Q7DA 1JWMA 5LG1A 4YX2L 4F7TA 1Q94A 4P9HL 2VQTA 4GRWB 2A83B 4Y4HB 5IJKA 5EZOL 3DGGB 4AENB 4XI5C 4FFWC 2VC2H 3TWCH 4P3CH 2YEZA 3UTQA 3MGOA 2VZ3A 1NLBL 2X4UB 1FGVH 4HWEH 2KL6A 4I13B 5J56B 4U1JB 2PNDA 1ZHBA 1NFDF 4DGIH 5JW4Q 1R3IL 2FHBA 1D5MB 4M6OH 3DURA 3EDEA 1Q72H 2PETA 3IXAB 3T77B 5FECB 1WAAF 4MJIA 2XPGA 3UTPD 2W38A 4CMHB 3QP3A 9CGTA 4DK6A 1BD2A 4I48B 3V7AG 4LASH 5JR1L 5EU4A 5A3IC 3RVVC 2FB4H 1LEGB 4GRLC 2R1XA 5F9WC 3VFRA 5LXGL 1W8NA 4UDTA 2CUHA 4NO3B 4NQCB 4A3FI 3BMWA 5D4QA 5F1KC 1T1ZB 2UYLA 3HCVA 4LPTA 5FUOL 3VXRD 2A74A 3O6LH 5AZ2H 4GQ9L 1DL7L 2BERA 1JGEA 4V1DB 5E8DH 2HKFH 4N1CA 5I18H 3TNNB 3QUXD 4UI2A 4HIEA 4NKIH 1A6WL 4ZFZA 4L8CA 4JFDE 3TYGL 1RD6A 4FQ2L 3ZDYF 1F90H 4KUZL 4YHNA 3ARGD 4G8GB 1ZA3A 5L8LB 4J4PD 2CIKB 1LK3L 4WY7L 4BQBA 3MNZA 3GHBH 1FL3A 1B90A 4PRNB 2XWBA 2FJHA 2EO9A 2YA2A 4MAYA 1VFAB 3ET9F 4RGNE 3BIBX 4DCQB 1KYOK 4JM4H 3PGCB 1BBJA 4PJIA 5IBLD 1FE8H 1KEMH 5FGCE 3QJFB 5BVPL 2LAGB 1HHKA 1KIUA 1KUMA 4JQXC 3WD5L 4A6YL 2EEBA 4RDQG 1YJDL 1RIHL 5T5FH 1NCBH 3D39D 2VSDA 4XVUD 2WLZA 4ZSOA 4YWGL 3SGDH 4DKEH 1JWSB 3BW9A 3DARA 4Z7QF 3STLA 5D70L 3B2VH 1DQLH 1N6QL 3HNSL 1SBSH 2MCPH 3N1QC 5JORB 3O9WC 5CJOH 5ENWB 1UEMA 1I1YB 2BNRE 2W60B 4LSPH 2VAAA 3HG1E 4B7IA 4PV8A 3FB5A 1IAII 5IT2H 4ODWB 2FO4A 4IMLA 4CW1A 4MNGE 2VLRB 4RDQF 4M7KH 1J12A 4XNUH 4MYWB 3CVHA 4IMKC 1FL5A 4QRQB 3L7FA 1YA5A 3VJ6B 2P5WE 2D9QB 5J12B 1CE6A 3RL1B 1R3HA 3OKYA 3KLHC 3QUXA 2IG2H 2Y5EA 2VDML 3A6BL 2X4TB 3FRUB 1MCWW 2NQCA 1U8HA 4QTUA 2A9NL 3ARGA 1GVIA 4OLXH 4YH6A 4J4PA 2W0FA 4JO1H 1A02N 5DZLA 1YYLL 1D9KD 1WCMI 5DD1L 1BPVA 3CVIL 1QBML 4BFBD 3DO3A 1JPFB 1MELA 1VFOA 1TZGL 3GDBA 1IKNC 4XNYL 3TBWB 5DEZA 3G6AB 2R56L 2EDOA 3PWPB 4HEPG 3QEGH 3SKOA 1QO3B 2VN7A 43C9A 3PDGA 4KK9D 4LCCC 3HG1D 5ITFA 2FBJL 1BIHA 1W72H 4E9LA 1V3MA 3D39A 4WNQA 5F6IB 4U1GB 2AV1B 4X6CF 3TN0B 1T3FB 3TC9A 1HE7A 2P5WD 2OTWB 4Y8DC 1NGPL 3OKKB 1OF2B 5E8NB 4GLRH 2Z35A 3HZMB 4M7LH 4LSUL 4DGVH 3F7QA 2CLZA 4P2QD 1LP9F 1FPTH 3GKQA 4JFQA 3DMMD 3RJDA 5KSUA 4NJ9H 4JFPB 4OLWH 3P0VL 2JIXD 1A6TB 1S7RB 1IT9H 2HG5B 4ORZC 5JHLL 5FOJA 5GSRA 1ZV5A 4QHNB 3QFDA 3RJQB 3BKYH 2LU3A 4K9EH 1PG7W 3PF2A 3L5JA 1MH5A 3BZ4A 4PJBE 3VE0B 3QT2A 1JNHA 1BX2A 1T7ZA 3FFDB 5T1DL 4POYA 1K3ZA 3BMVA 3DROB 1A8JH 2F54D 4Y88A 3KYAA 1NDGB 5E9DE 1I8KB 2E7HA 1H3TA 1EPFA 5HHME 4ZXBD 4LL9A 1OTUD 2ZUQB 1D9KA 1RK0A 1X5FA 4YK4B 5D96C 5I66B 4CNIA 1T04A 2XQBH 5ACLA 4LSTH 5C6WH 1P4LB 2LAAA 4X0KB 3AFLA 3TVMC 5ISZE 2FJFA 4LGSB 3I6LD 4BZYA 5AD0B 1KC5L 1XIWB 3ALWA 5E8OB 1TETL 4JJHA 4X5XA 2R2BB 3MCLH 5E8PA 1P7QB 5GRZA 1SJXA 3RFZC 2MPAH 4GG8A 4NQDE 5I1KL 1VFMA 3WLWD 2BVPB 1KELH 2OSLA 3PNWA 5D7JA 2V7NB 1DE4B 2DLFL 5DTFA 5E08H 4JQIL 3RWJA 3C9NB 1MAJA 5KW9H 4U1LB 4M1DL 4CUCA 5IB3A 2QJDA 3FN0H 3L3OA 4OCLC 1SBBA 3MGAA 4P2QA 3RP1A 2I07B 4RGNC 5F3HA 3DMMA 5E9DD 5C0GA 1C12A 4D9RE 4Q97A 2JIXA 4Y4KC 1HSBA 1JPSL 1MCCA 1Q0YH 2CDGB 4OZGE 5L8JB 2GY5A 5HHQB 4OLYL 2NY2D 1QA9A 3G9AB 1CFQA 3IFOB 2F74A 4S0TD 4R97B 3VFTA 5ISZD 5J1AB 5GGQH 2AEIT 1CF8H 2XN9B 4K7PL 4M1CD 2XZCL 1MCHA 3S37X 1JN6A 4HHAB 4LEOA 2EXWC 2F54A 4QHKI 3E3QE 2IAMB 5J3HD 1AJ7H 3P4OA 4ZXBA 4Z77B 3B9AA 4Y5XB 3NPSB 2Z91A 3FN3A 1S7UB 3O3EB 5DJCB 5DFWH 1ZKAA 1IQWH 4Y89A 4HT1L 5IF0B 3GSNA 1MHHB 3FCTB 4PG9A 1CGWA 1Z3GH 2YXMA 2J8OA 5E2UL 1UG9A 4N5UA 1AKJD 2VZVA 3WN5B 4HD9A 4FQJH 3BOVA 5K93A 4WTXA 3WXWH 1K4CA 4KJYB 3VFWA 5EU5B 3KPRD 2HJLA 4PB9H 1GGBH 4L29B 1LO4H 4CN6A 5EUOB 3DBXB 1QSFD 5DGQA 3UPRB 5HHOD 4D9RD 3VMGA 4EBQH 3WSQL 3MCKB 4PJEE 3O2WL 5F7LB 1C16A 5LCVH 3F65A 4Y5VB 1XR9B 1H3PL 4D9LL 2QEJA 4XC1H 3HNTH 4HBCL 1B0GA 1HKLH 4DQOL 3T0EC 3UTSA 2IFFH 1S7QA 1LEKB 1Z5LA 2JK5B 4F15C 1GC1C 5GZNC 3LAFA 5JIIA 3RVTD 2EDHA 3QHZL 2VMFA 5HGAB 5EZJA 1RUMH 2X4SA 1CDBA 3VMNA 1NBZA 4XP4L 3VRJA 3O0RL 3UJTH 4KZDH 5FA4B 3S9DB 4RNRB 5HYJE 3MRKA 1PGRB 4L8BA 1WV7T 5D7LD 1UJ3C 5K9OA 3MRQA 1N5YL 2BX5A 4JZJC 1EGJA 4XCYB 1GAFH 2DDQH 5F9JB 3V4PH 4DUXA 3FAWA 4XVJH 2WIMA 1XF4A 1CT8A 4M7JH 2ADGB 4AM0B 5JZ7C 4MDJA 4D9QE 3S7GA 5SX5K 4LDEB 5DRXA 3FHAA 3ELAT 4DW2L 4M43H 4JZNA 4ODSL 1AKJA 1QFUH 3EW3B 4HLZG 4H26A 2AV7B 4K3DH 2R0LH 3VFMB 4HH8A 4U1SB 3VXTA 1MFDH 3M45A 4U7SA 3KPRA 4MA8L 3HI1B 5I6XC 5FHBH 1EHLL 2GSIB 5A16A 2D7QA 2ZSWA 1ZK9A 5I15H 1A21A 1QSFA 3D25B 2YBRB 2PUQT 1TCRB 2DI9A 2PCPB 3K1DA 4MA1C 2NW3B 5HHOA 1PKOA 2FWOB 2VZ1A 3OPZL 3DTXB 4YFLF 2DQUL 3VD3A 2VN4A 3BIAX 3EYUH 5I19H 1C5BH 5C6TH 4LSSH 1PFTA 2B2XL 1KCSL 3QCTL 3T04D 4HWBL 3CX5K 3RVWD 2BSED 4S1RH 4L5FH 3B6SB 7CGTA 1RUAH 2BVQA 4P5MB 4F7CB 4LMQE 2AQ1A 4XNQA 3MV8E 4GAJL 4I2XE 4RFNB 3ULVL 4D9QD 3K81A 3RL2B 2NR6C 4HS3B 4NZTH 4RRPA 5DLML 4M00A 4HIXH 5D7IB 2YUZA 3FT3B 3GI8L 5D7LA 2CUMA 3AGVA 2NXZB 2XNAB 5JW3H 3CH8A 5BJTB 3TBSB 5HDQL 1RV6X 2M1KA 4UTBH 1KLFA 4NPYB 5HHPA 4IOIA 4J3OC 4OCSH 1G9ML 4Y1AE 3OGCB 1F97A 4HC1A 4JO2H 5B4MD 1KPRB 3MREB 1IRAY 3Q0HA 2Q76A 3WJJC 4U0RC 2F5AH 1CS6A 4Q6IC 4PBXA 5IB5A 4L9LC 4L3CA 2QADB 4YXHH 3BRGC 2ARJB 3JV6A 4PJ8C 4PJEA 5EPMA 3U0WL 4GKOA 5I76B 4IRZL 1LO3L 3TJEL 1IC4L 1U93A 4NQEE 2ZCKL 3K2UH 2BMKA 4MXWL 3BZEB 2EDQA 1P5VA 1JRHH 4J6RH 3B4NA 5FGRA 3RIFF 5L88L 3JTSA 5E5RB 4JPKH 3MOAH 2F4OA 1ZLSH 2LV4A 2Y06H 1SM3H 1KTKE 3R1GL 4QHUA 4X4XA 3QG7H 4QF1B 2PW1B 4P9HC 1U8NA 4C54A 1RUQL 2VLME 3TBYA 2ESVE 1GPOL 4GW1B 4LFHD 5L2KE 3O81A 4GG6A 2DMBA 3X3FH 2Z9TA 1E28B 3LPGA 4BFEA 3C08L 1AO7D 1VFUA 1MFEL 4OD1H 2YK1L 1HXMB 4WFHE 4JJ5A 4L4TB 2VXUH 3VW3L 1CDGA 3F7YB 3WLBA 1CFTA 2EDLA 2VDKH 2JCCB 4XH2B 1M6OA 3WNNA 2E27H 6FABL 1TQCB 3GNMH 3O3AB 3MRJA 4XZUA 4Y2DC 3EYOA 1A2YA 3L1OL 1CTNA 3BH8B 4DVBB 5DEFB 2X4PA 3QZWA 4GRWE 4NQED 3RZCD 1CGSH 1AC0A 4RMRA 3QDGD 4EOWL 1Z9LA 2BY1A 3H6JA 5C0NC 4G6KH 1BLNB 4PUBH 5IW3A 3MJ7A 4DJMA 3JSSA 3DXAB 3U30B 1BAFL 5FKAB 3MRNB 3GUTB 3EO1A 3L3GB 3GJFK 2R15A 4UT7L 5HI3D 1KOAA 2M26A 1V7ML 1CU4H 4GQPH 1QTYT 2VLMD 5DT1L 1AGDA 2ESVD 2CH8A 3KNBB 4NN5B 5FHAL 1J8HB 5L2KD 4WFGE 1G7MB 5EO9B 1RU9L 3B43A 1CL7I 4NO2B 3MOBL 4YFEA 3ROOB 3FB7B 4H8WL 4HKZB 3LSOA 1KB5H 4WFHD 1F4YH 4NQCE 4WO4D 1IFHL 3RX8A 5JHDA 3MO1B 4G5ZL 4JDTH 4NQSA 4V1DE 3GSVA 5DD3H 5JO5B 5I1CL 2R29H 2CGRL 1BFOA 4M62H 2J6EA 4HUVA 1Q9WB 2FGZA 5DJ2B 3L95B 1WVZA 3MTRA 2Z4QB 1AO7A 5TE7L 4G8GE 3WUWB 1CI5A 5JIKA 1YJDC 5C0BE 5FM8A 2MQ3A 5AG9A 4IDJL 4TUOB 5L0QC 3MLSL 1EMTH 2VUMI 3NIFF 5FYKL 1JNLL 4KHTH 3GJEB 1YUHB 1N59A 3N9GL 3O2DA 5E6ID 1K5NA 1RZGA 5HGGS 2E9IA 3RZCA 2OTUB 4Z0XB 5DRNB 5HI4C 1V5JA 1XR8B 4M1GL 3G5ZB 4NM4L 3QDGA 4DKDC 1I9EA 5GRVL 4EIGB 3CFKA 5DGRA 4IOFD 4KHXH 4WFGD 3VI3E 3S3JA 3MLRH 1R5VA 5JMRA 3BEVA 3MXWL 4YC2C 4GKSB 2VC2L 4ALAH 2HFGH 1UB6A 5CZVH 1QVOA 5L2JA 4PJ9B 2C5DC 3MRRA 5B21A 1I3RA 4C55A 4W6WB 3DVNA 4BK4A 1T20B 1YPZB 3NFPB 4PGEB 3QB7C 4MD5A 1REIA 4UNTA 5ICXB 2B1AH 3BGMB 2F5BL 5F1IA 3W0WD 1ULVA 3OQ3B 3T8XB 4KWUA 4MNQB 3DIFA 4OV5A 1B2WL 5C0BD 1IVLA 3HNVL 3K46A 3MSPA 3R4DA 1R9TI 3OAZK 3P0YL 2HTLD 1DZBA 3GIVB 4C83B 5IHBA 1YQVH 3QQ9D 4PG2C 2XQYK 2VR5A 4YR6B 2D7MA 5FDYA 3VXQA 3ZT7A 1FFPA 3HC4L 4OUOA 2LTQC 4K94L 5DSCA 1MIEH 2QBWA 4N0CD 4KJWC 1KCVH 4YDLB 1ETZA 1JP5A 4HMCA 4PGDA 1YEJL 2X4NA 2R0ZH 5BZWB 1ONQB 4PJGB 4QRRD 1H5BC 1MVUB 1EBAA 1HNFA 4ZFFB 1VACA 4W4OA 4Q2ZB 2J8UB 3D18A 3N85H 5H94A 3SY0B 1G0YR 5HI5C 5C08B 5E2TL 1BF8A 5E6IA 4K2UH 4N8VA 4D0DA 4NRXA 1PG7L 4G3YL 1FV1B 3P4NB 5E94B 3IFPB 4OLVL 5C0JB 4JREC 4PRDB 3WFDL 3PWPE 4OFKA 4JM4L 1SY6A 3CPLB 2DD8H 3EERA 2EDEA 5BOPA 1URLA 4ZUSB 2FX8L 3DV6A 1T21B 5I74B 4FQIH 3GMPB 1KIPA 5CD5C 4M8QA 1IMHC 1LHZA 1VGKB 2N56A 4KK5D 4JG0H 3QPXH 4H0IA 3BPLB 1H3UA 3S4SB 3TA3C 3HC3L 1C7TA 4PJAB 1A3LL 3W0WA 1F3DH 3BAEH 4GXVH 2H2SD 5C0BA 4KKAC 4Y4HC 2B4CH 1U6AL 2NZ9C 5DRWB 4F9PA 1EUTA 5I8EB 2HVKA 4JDVB 4ZQKB 5CBAB 1M1SA 3C6LB 1P9MC 1S7XB 3BUYA 1JYVA 5CZKA 4S2SB 3HMXA 4HIHA 2BSTA 4JPIA 3HMWH 2E2II 3CUPB 4HKBB 4JHBA 3A67L 3DSNA 2PYFB 3TO4C 1TPXB 5BVJB 3HLAA 1BVLB 2AW2A 4APQB 5EULV 4HIJB 4X4ZA 2C4XA 1UT9A 5K59E 3GJFH 3U46A 4CMHC 1RO4A 4EIZC 4QRRA 1UFUA 4OCYL 1S3KL 4P23D 3FONA 3V6ZB 1D3CA 3ZE0E 5KANG 5C4XI 1WBXB 2NNAB 2XOTA 3EOBA 1JHLL 1XCTB 3DLQR 4XGZA 5T33H 4NBEA 2AJVL 3FHQA 3CFCL 2BVEA 3DVIA 3QUZB 4CL7A 3BZFB 3C09B 1A1NB 1IAKB 4LVEA 2XA3A 2DL9A 3LS4H 1OQOA 4GRMA 4KROC 4P3DB 5IEHB 2OZ4L 4NN6B 4UNUA 5J9PB 1LE9A 1CG9B 2DQFB 3FZUD 4EDWL 2O61B 3N06B 2IMMA 1A1OB 1LK2B 4X98A 1NDMA 2X9WA 3V5DB 2D9CA 1PLGH 1HQRB 1WC7B 5F9WB 1EEZA 5C92A 4MS8D 2DYPA 2Z31B 3BRFA 1IAMA 1ZVYA 5BS0B 3M8OH 2FD6L 3KYOA 1I1AB 2ZCLL 4W81A 5T3ZH 5B39G 2FYYA 3VXUB 1MWAA 5CJXA 3EFFB 2FNBA 3MRCA 4AH2B 4ONGL 4DAGL 5TDPA 4RA0C 2QQKL 3UMTA 1G0DA 3TIEA 2WW8A 3OSKA 2CMRL 5L8KB 2X10A 4PBWD 2XN9E 3ARDD 4QRUB 3IAQA 2A0LD 4UUJB 4TULH 1F13A 4JFXB 5T1KB 3FQNA 5DUBB 1QFWM 3FB8A 3RKDD 5FO7A 3GTPI 2HLFC 2F58H 4LLAA 3GSRB 1LO5B 3OKLB 5DK2A 2IMNA 3SE4C 3WHXA 3ZT5A 3PV7A 2EDTA 1AGCB 1EAPB 4P23A 4MQXD 1MJ7L 3VFNA 4HXAH 5A1AA 4Z95L 3LZFL 4MJ4A 4NZDA 5DK0B 3TBVA 4NQXA 4ELKB 2ZWLT 2CSPA 3PWUB 4RWHA 5TQ2H 1T3FA 5C8JA 1ZS8A 4K8RH 4XI5D 1IBGH 4NQUA 3CFDA 3MMEA 5HVWA 3I9GH 4FA8A 3OAZH 4LKXB 1J1OL 4PJCA 1BP3B 2BCKB 3IAPA 2AJZA 3EKCA 4AIOA 4M3KB 4U1MB 1NGYA 1NCDL 3HC0B 1VESA 3CFBA 4J2XA 5DD0H 2CKBA 2BFVL 2P49B 4NOBA 1TDQA 4LMQI 2WNGA 2ADIA 1HHHA 4NRYB 3RVVD 1MQKL 4KQ4H 3QXDA 4GRLD 5KW9L 3TO2B 3U4BL 4Y19B 1A7BA 3IJYA 1F45A 3BRDA 2ZG2A 2ATPA 1G7IA 1MI5A 2ZCHH 4A3MI 3IDJA 3NOIA 2JELH 1PSKL 4Z6AT 3WFEH 5IHZB 1Q9OA 3OV6A 4OFPA 2LQRA 4PRIE 2ERJB 2XTLA 3BKJH 3MNVB 1AD0A 4XXDA 1YDPA 1CDUA 1YNLL 3ARDA 4OJFH 4R90H 2EIZB 5D5MF 3NIDE 4AG4H 5IHUH 3VWKB 4U1GC 4WENB 3MRIA 4J1UB 3TN0C 1Y18A 4ZD3L 1H3VA 3QUMA 5E2VH 1N64H 3RTQB 3SO3B 4PJXB 3DSFH 5DJYB 1II4E 2AKRA 5ABDE 4XMPL 2C1PB 3ZKMC 1ORSB 3ZTJH 1B0RB 1JNNH 5DD5H 1N2RA 5DUPL 3W11C 3KPLB 3S35X 4KI5E 1I7TB 1QUNA 4NZUH 3V52H 4MMXC 3VFOA 1CZ8L 3ULVF 1KIRA 4PP2B 3UJJH 1NMAL 3DECA 4NO5A 1HH9A 3MV01 2B1HH 5LAXA 4UIKL 2EE2A 3I02B 3S5LB 1N4XH 4PB9L 3ULVC 5SWQA 3QDJE 2OR9H 1C08B 4F7PA 1FNLA 4KQ3H 4I9WD 4OIAA 3MLUL 5DQDL 2Y9RT 1S9WB 4DVRL 4PRID 2YRLA 4JVUA 1WIUA 1IJ9A 1NFDA 2ZUQC 3AVEA 4JKWA 5CEYB 2GY7B 1RJZA 4EUPH 3RI5F 4YK4C 4LPYA 2CJUH 5M95B 1OGAB 1I7RA 4GRLA 1G9MC 4ZO8A 4HCRL 4RQQB 2VH5H 4I8DA 2ZJSH 1P4IH 1UEYA 3RNKB 3LDBB 2P5EE 4ODTL 1FSKC 1XIWC 4BH7A 4YPJA 4IDLA 3F5WA 3IDGB 2PTUA 5T1LB 3FTGB 5T3XH 4NNXA 4LARL 5JXED 5D7IE 2DQDH 1PBYA 1S78C 3O2VL 4KI5D 1GGIH 3MUGB 4TVSa 3W5NA 4KZDL 1X4YA 3PABB 3SGEH 2Q8BL 1OAUH 5EG6C 3BP5A 3VXNB 2WAHA 3KLDA 1A3RL 5L6YH 3A0OA 1M7IA 5LVEA 1E4WH 3I6KA 4OD3H 3PHOB 3VA6A 1T5XB 4XMKH 4FFYH 4PY7B 1YMMB 2CDFA 1DL6A 3QDJD 4ZUUB 3TYFB 2HT4C 4F7MA 1T6VN 3T1WA 2E6QA 3HAEH 3AMKA 1UZ6E 4XPGH 4M7JL 2OXGA 2JJSA 2B63I 1DBAL 2DB8A 2C1OB 4UDUA 3LKSB 3REVB 1F4XH 3HZYB 1AD9B 3LKNA 3CXHK 4JQXA 2Y4SA 3QEUB 4G43A 1MCQA 4ORGA 1XGRB 4WW2F 5D2NC 4OLEA 4R97C 4NHUA 2V2XB 4FQXD 3Q6GL 2CDEB 4MAUH 5AG8A 2P5ED 4JO4H 5EOTB 4P57B 1EVTC 4TTDC 4TYUA 1BJ1H 4LCWB 2E5EA 1TWGI 3HZKA 3O6KH 3VG0H 2BP3A 4WWKB 4LRIC 4WDIB 5F1NA 4WW2C 5KSBF 1RZ8B 2IAMC 4PRIA 4OTXL 5F7HA 4Y5XC 4M5ZH 1A0QH 1DBJL 5J89A 3O9WA 3EYUL 5C6TL 1NKRA 4RIRA 1NPUA 3A6OA 1WWCA 3IDMB 1MLBB 3JZ7A 3HRZA 4MB3A 4ZAKB 1AI1L 2I27N 3GMNA 3GSWB 3NBNA 4X9BA 5EUOF 3KPSB 3OJDA 4IMKA 4L4TE 4X7TA 1SQ2N 4NUGL 2V2WB 2XKNB 1I1FA 2JCCE 2Y7QB 3PGFH 3QUYB 2BRRH 4MCYA 2HMID 3QSKB 1CE1L 3KJ6H 3FQXA 3KDMB 3U9UA 3HE6B 2FLBT 4TUJA 1QRND 5JXEA 1A3QA 2IH3A 4ONFH 3ARXA 4JRWA 1H15A 2R2EA 1UKQA 3AY4A 4ETYA 3ALXA 5JXAH 3TGXA 1OLZA 4WUUB 2IAND 3I85A 2FIKA 3KPOA 4X80H 5GGVL 3TPKA 4EI5D 1B4JH 1FAIH 5HD8D 1RQ5A 4H8WC 5KZCD 4CADA 1OWRM 2DM7A 5H2BB 4ERSL 1UWEL 3DXAE 3QCUH 5EDXA 4IS6A 4BZ1H 1UGNA 3QDJA 4LLWB 3VGAB 1IKNA 2ZUWA 1OP3K 4G80A 1IKFH 4QCIA 3H2WA 3PJSA 4XX2A 4ETQB 3NVQA 4QXGL 3KPMB 1XF5A 2ENSA 1P7KA 1J8HE 4NQVB 2JA8I 4L3ED 4WJ5B 1A7PL 3MGTB 4LCCA 3EJYC 3RNQB 4NKQB 5JUEH 1MFAH 3LIZH 4LAQH 1DFBH 4FQXA 4S1QH 3SDCD 4FMFA 5KSAB 2P5EA 5F88B 3P11H 3RWHA 4Q0XL 4YHLL 4WCYH 4X6FA 1DANT 1QEWB 4J6RL 2R4SH 3O4LA 3LRSA 1WEJL 1PZ5B 5IB4B 3NFSL 5B8CC 3A6CH 3ABZA 4X6CA 1AFVL 3D3VB 3LEVH 4BFGA 5BRZA 4Z9KB 2DMCA 4K3JL 3O45B 4Z7NE 3EGSB 2EDDA 4HV8A 3BP6A 1F6AA 1XMWA 5HYQA 5J6GB 5CCKH 1OQXA 3WKNA 2AXJA 4AMKH 3PO2I 1TVBB 4LDLB 1G7JB 2DQIL 2NY5H 1A47A 5EO0B 5ACZB 3DXAD 1QSEA 2VXUL 3BKMH 1QRNA 2VDKL 3MBED 5FYJH 2VWEE 5FYLL 1X5XA 5DMKB 2I9LB 2YPLB 1CDIA 4XP6L 3GJFB 4PRBB 1XGUA 5F7MC 3RGVB 4OFVA 1J0ZA 4HJGA 2IANA 8FABA 3UAJD 4EN3D 1U8MB 3EYQC 4XP1H 4EI5A 5JDSB 1EXUA 2EC9U 3IU4H 4G6JH 3S36H 5J13C 1W0VA 4YJZL 2B0SL 1C1EL 3MYJB 5JPMB 2NY4C 2OJEA 4PLKD 5IMMA 2MHAA 4LLDA 1RZKH 1JGUH 5ESAB 3PWJA 1QKZL 3MV9E 1BBDH 3QQNA 1OTSC 4AEHL 3DETC 5KVDL 1NBVL 3MLWL 4P5TB 4IHOA 2F19L 3TV3H 1YPZE 1FP5A 4PRPB 4JY6A 4MX7A 1CU4L 3X12B 4L3EA 4MVBC 1UADC 3B2UC 1IGJA 3FFCB 2H26A 1D6VH 4L4VD 2WZPD 3B3IA 5GGUB 3SDCA 4RMUA 5DHYB 2GTWB 2R0WH 4JGJA 2NY6B 5ALCH 1CXIA 5ANMA 1K2DA 2MKLC 1B0WA 3T0BA 2A73A 4ZUTB 3T0ED 1IGFL 2DWDB 3O8XD 3JVGC 5EC1B 2QADC 3Q3GB 3REWA 3C5JB 2DQEH 3O4OB 3LEXB 3L7EB 4ZUWB 4NQTA 3E1F1 3N1PC 5FCUH 3MODH 4Y4KA 4WI4A 3RU8L 3H9HA 1MNUH 1OARH 4HZLA 4FQHB 3SKNA 4PJGE 1D5ZA 1NUIA 3G6JB 1CICD 4OAWB 1KJ3H 3X13A 2V5TA 3SKJH 2J8UE 2FGWH 2A1WL 3QRGH 3MBEA 2H2PC 4GH7B 5C08E 3U83A 3MV9D 4ZOEA 4QOKB 3SDXB 4ZYKA 2P8LA 3CMOH 5GISH 4PRHB 1ADQA 1N26A 1MCIA 3S37L 4EN3A 1W72A 3BPCB 5C44I 2NYYC 4WIQA 1BIIA 2VAJA 1T1WA 4P2RD 2ICWB 4KKLC 3TZVD 1J88A 1R0AH 2H6PA 3X14A 2Q87A 4HFWB 1BZ9B 1FNSL 3HZVA 5I1HH 3MJ9A 3MLRL 1ACYH 2WK2A 5EIIB 3IDIA 3K1KC 5DQJA 1MFBH 3U7AA 4HAGA 4UINH 3GSUB 1PEZA 1NLDL 4PTTA 4JDZA 3ULUH 1FORH 4R9HA 1TQCC 1UH2A 4PJAE 5C4JI 5EBWB 3KS0H 4IRSB 1ZGLM 1A5FH 4FQLL 4L4VA 1P2CA 3PP4L 5DFVC 3FT4A 5E1AB 2F8OA 1XGQB 5JQ6L 2CRIA 3IFLH 4TTGA 5HGBB 3GTGI 4EI6B 5IB1A 4XP9H 2DIAA 3LKOB 4G9FB 5TQ0L 4KU1A 1MQ8A 3TPUA 4OCWH 4QYOB 2V7HA 4R4FH 5BV7H 1YEEH 2QHLA 5IQ9B 3T0EA 3S1RI 1IGYB 2XZAL 3O8XA 3NAAL 1TFIA 5I1GH 4MWFB 4YIQB 3VD5A 2P8PB 4GMTL 4E42A 3HPJB 3RVXD 4FG6D 4JPWH 3RPIA 5C9JA 1OP3H 3HR5B 2ED8A 4KRNA 4AK1A 4PJHF 5CIPA 4PY8I 3C60B 1HEZA 3BPNC 3CU1A 1CICA 3LKRA 1RPQA 5HGDA 1P1ZB 2ZKHH 1K85A 5KSVA 1QBBA 3ESVF 1G9NH 2UVEA 2VXVH 5FGSA 4OI9A 1J0JA 1UWGH 1QNZL 3MV9A 3TT1H 4YDVB 5B38G 4ZS6D 4G6FB 4ODHL 1HINL 4YBHA 2FR4A 1CGTA 2WWMD 2YKLL 2JJUA 4JHAH 3FRPG 3QUKB 4P2RA 1AGFA 3TZVA 4KAQH 3WIHH 3MV7D 5H35A 5MI0B 4AT6B 5D7KE 3RWGB 4HDIA 2D7OA 4DZ8A 3B9DA 1S8DA 4CU6A 1VLAA 4OGAC 1KENL 2NY0B 3R8QA 4P0DA 3LB6C 1I9IH 4ZO6A 5KJRH 2GCYA 4YZFE 5I73B 1IQDA 3QNXA 5DMJB 1FGNH 1Q0XH 2R1YA 43CAA 1K9TA 2VWEC 3O3DB 5BS0E 2IPTH 1T1YB 4EUPB 3VXUE 4U4BA 3U0TA 3O3BA 2OS7A 2HVJB 4FXLA 4OFDA 4W6XB 4Y7MA 4NO0A 3THMH 4ZFGH 1ED3A 4Z7WF 4L8SB 5F7EH 4JR9L 1BJMA 1KIQA 4OGXH 1UKTA 1BJ8A 4KDWA 4AIXA 5IIEA 4E0RA 4XNMB 2WBJD 5DMIH 3RQ3A 4P4KB 4PJ9C 5EZIH 3ECBA 1Q1JH 4R8WH 5C0IB 4ODVH 1KTLB 2JB5L 2D0HA 4DEPB 5CSZA 1AHWA 3G5YA 1I85C 5INDB 4X6BA 3GI9H 4FTVE 1XH3B 5CUSH 3T3MF 4PTUA 2QQLH 5TFSL 2AQ3A 3CD4A 3P0GB 3GSXB 1Y6MR 1MUJB 2KQNA 4HUXB 4JRYB 4K3GA 4HQQL 4R4BA 4NWUH 1NAMH 4EKXA 1JZ5A 3LN5A 1QFWL 2NY1D 3MLZL 3HAEB 3SJVE 3ZSSA 5T33L 3WIFA 5J11B 3KGRA 4Q6IA 5BS0D 5TPWL 2IQ9H 3MV7A 1J9CT 1FNAA 1TZHA 2VABB 5IQ7L 3ZYOA 3QXAA 3DUUA 2DQTL 3VGHA 2XWTB 4NC2B 1H9VA 1VGEH 4OLZH 4P99A 4R96B 1OW0C 4BQ8A 1XGPA 1M7XA 5D6DC 5C0FA 1AXTH 2R69H 4XT1C 3KPPA 2FBOJ 4Y19E 3S4SG 2MSPA 4RFOL 5T1KD 1AP2A 4GBXB 4DN3H 4IIQC 5IW6A 2VDOL 2ICEA 1RUPH 3CFEB 2XTJB 4MZ2A 3D69A 5A2JH 3T4YB 4G7VH 1TZIA 1J87A 5HDBF 4FTVD 32C2B 3MACH 5GIRA 4TRPL 1D6EB 1JK8B 4HG4K 1FN4B 4TUKH 5EWIH 4X4MA 5BXFB 5IMOA 1YN7B 2WBJA 1YEDB 3ARFB 3G5VB 3CSYB 1NKOA 4LKCA 4OF8A 5DQ9A 2CD0A 5I74C 5K9KA 3EDDA 5HJ3A 5IK3B 3QA3A 4PRAB 3KWWA 4Y5YB 3EFDL 3H3BC 3SJVD 5KVEH 1ZSDA 2AEPL 4PJXE 4M5YH 2P46B 5DDHB 4DTGH 4XPTL 4ZNEA 4M4PA 4Y2DA 5A2LH 4O5LL 5DA0B 3SDDB 3P9LB 1MHPL 2BY0A 3NIGF 2A9ML 1TENA 2ZUYA 1N6UA 3TNMB 3I6GB 1AQKL 1U8JB 4HKXB 2NX5B 4HXAL 3SGDI 5H37H 3CLEH 3OR7A 4A3EI 1QQDA 4X6DB 3C8HA 3SDYL 3FO0L 1DLFL 2NZIA 3QULA 3Q5OA 4J8RB 4R7NB 1IBGL 4ZUVB 2NW2A 1TJGL 2IH1A 3V4VH 4MQ7B 4NM8H 4MNHA 3GMQA 4YNYB 3HUJB 3QDAA 4RZCA 2BOCB 4APQC 3OKNB 2V2TB 1KEGL 1R24A 3FB6B 5IW1B 3UTTA 1WCQA 3S34L 1LDSA 4WTZG 1JI1A 2EDWA 4OM1H 3TH2T 5B3JF 4F33B 3HRPA 3HB3D 4OD2A 4XNZB 2NVTI 4YHOL 4MDIA 4GXUM 2YD8A 1OGAE 5CP7A 4JFXA 1WT5C 4O2EB 1SYVB 3EHBD 1ES0B 4CJ0A 2J88L 1YYMH 2EC8A 3GSOB 3IF1A 1F6LL 5EOQL 4WW1A 4Y7NI 2YMXH 5BW7C 2O5YL 1BOYA 5KAQG 5D2LB 2EXYC 3QUZC 5DZNA 2SEBA 4WEUD 2VXSH 2Q3ZA 4FTVA 5AWNL 5EO1B 1R5WB 3B9VA 1NJ9B 1FZMB 4A6YA 1CFVL 4OZIF 3CC5A 4NN6C 1AGBB 5GGRA 4U2ZA 3GMLB 3O11A 3SJVA 3IETB 2AJ3A 2HTKD 5GRUL 1DQQA 3BH9B 5CEXA 5KAQF 4LDOB 5GJSH 1YMME 3TLRA 3WFBH 2Z31C 3MLXL 3DSFL 1Z9OA 3FAXA 3X17A 3LN9A 12E8L 1I4FA 3JBG7 2FCBA 1B3JA 3FQUB 1ZHLA 4LHJB 1PYWA 1ZT1B 4E41E 1I1AC 2FEDD 1INQB 2D7NA 4OZ4B 2ZNWA 5SWSD 4F57H 2Y5TA 2W9EH 2OL3L 4OGYL 5TE4L 3W39B 2NPLX 2W65A 4GLRI 5FOBA 4MHHI 1NC4B 3UJJL 5E4IA 3BPOB 3AS0A 3UBXG 2YU9I 2BNUB 2H1PL 1W0WB 1MHCA 2B1HL 5IP7I 3RWFB 1DCLA 1H0DA 4LCWE 5T1LD 4G42B 1IGTA 4JY5L 3NN8B 5IMKA 1FYTE 3HE7C 3C2AH 5DZOA 3PIQA 1DUZB 2GSGA 1HWHB 3TA3D 2Q86A 4W70A 2PF6A 1O7VA 1N0LA 4O9HH 1MJUH 3F7VA 1BHGA 5TJWK 2I5YL 1F3DJ 3BDXA 3FO9B 1M05B 3BYYA 4LIQH 2NZ9D 3KPSE 4WEBH 1EDQA 1P4IL 3BWAB 2PO6D 5F8QC 1ZGLB 1F6FB 3K2MC 5F1SA 4XC3H 1HYSC 3V6OE 2EEAA 4R3SB 1GCFA 4PG2A 4WI2A 5ESQB 1QLRB 4YHZH 4X8JA 4R7DA 1S7SB 1Y6KR 3TO4D 2FHCA 2HJFB 2R2CA 4E41D 1HXYA 3WIIL 3I2CH 4WUUE 3K4ZA 1E6JL 2DQDL 4HFUL 2W0PA 1NAKL 2DICA 1K6QL 3STBA 3ZDXE 3MA9L 2R9HC 4G6AC 2YD3A 3RWCA 4DUVA 4Y0GA 1N5AB 4M61B 2Q7NA 3T0DA 5BMFH 2XZZA 3C87A 3GTQI 1EJ6A 1RZJH 4X4YA 1FYTD 2BOBB 3EZ8A 5SWSA 3GRWL 1YQ2A 4FFVC 5EBMA 4KPHL 3S2HI 2ERJC 1KB5A 3H8NA 3KXFE 4XP5L 2W1NA 3ES6B 1H8OA 1WGOA 1F4XL 5TE6L 4LHUG 4ZAKD 3IDYB 4BELD 2DKUA 3KPSD 2Q7YA 3VWKC 4I0PB 4NBGA 1VPOH 5AYUL 4R26H 3NACL 3O6KL 1WFUA 4BFIB 2R93I 3E6HB 1MCSA 3TA3A 4MD4B 4OFIA 1P53A 5K9QG 3G9VA 1RVFH 5CAYB 3MRLA 1DBMH 3HFMH 3MYZA 3RZDI 3S17I 5MEQA 5I16B 2V17L 2K1MA 2KPIA 4HH9B 1YNTB 1DQJB 5BV7B 3SE8L 5C9KA 2PO6A 3LQAL 4YGVA 1ZLWK 1HIML 2F53B 1P9MA 5MEOB 1K8IA 4S1DD 3LUSA 1FAKT 3NCJL 1ORQA 2XRAL 5TH2B 3TO4A 2YPLE 4OF0A 3AXLA 4ODUA 2GW5A 4E41A 4W6YB 4D3CL 4NP4H 4ONFL 1O0VA 1RJLA 1FFNA 4WUKH 2IPUK 3WCYA 2ZP0T 1T1XA 3KXFD 2DE6A 2VO5A 5DUML 4MJ5B 2DS4A 4JKKA 4KY1H 4KDTA 1JGDB 3ZKQD 3F7RA 5IOPB 2CIIB 2AABL 1OAZH 5A2FA 1RMFL 4GW4A 3GMMB 2ZZUT 3ZYIA 1X5HA 4MXQD 1RIVH 2ICWJ 3LDBC 2EZ0C 4XWGL 2Z93A 5F9OL 1C5DA 4DWHA 2DJ4A 1FYTA 1DDHA 5D9SA 3V8OA 1CLYH 4JN2B 1SVCP 2EDKA 4FNLH 4PRPE 4HUWB 3N1MC 2YWYA 3FFCE 4OZHB 4MA3A 2DTMH 3FT2B 2DI8A 1A9BB 1CD0A 3VG9B 1OB1B 1OPGH 4LSQH 3V5KA 4S1QL 5A2IH 5DJ8A 2ZSVB 4DZBA 2BNQB 4HKJA 1QBLL 1FZJB 2YD6A 4WCYL 1W8OA 1FO0L 3PQYD 1CBVH 1KJMA 3CJJA 4NCDA 1SFOI 2VKWA 3RY4A 4D0CB 5T3ZE 5JW5B 1KT2A 2HT3D 3VDBA 2X7LB 4QTHB 1C5CL 2FSEA 1A9EB 3FKII 5GSVB 4CN4A 2R4RH 1X5AA 4TSCL 5I1EH 4O2CB 3G6JE 1IGML 4ZPTB 2APFA 2QV2A 5FGBC 4U6XB 2AAVA 1ROWA 2IJ0C 4FXGB 3K0WA 4EQ3A 3SKUD 4PP1D 1BOGA 2WANA 2NY3D 3KG5A 2G9HB 3T08A 3H3PH 2OLDA 3SDXE 4PRHE 1EHXA 3B83A 4UV4H 1FG9C 4K23L 4WWKC 3NH7H 4PRPD 2EYTA 1D5IL 2XA8H 5AUMA 1SMOA 4JFYA 4QHMA 3KXFA 5DEGA 3BDBA 2C26A 3OKMA 1JGVL 3SE4A 5C0CD 2VE6B 3QJHA 4WU5B 4G6JL 1NAMB 3MRMA 2APBA 5D1XD 3ARTA 4B41A 5B39A 4OQTA 3GO1L 4A3LI 2BVOB 4NBZB 1RZKL 2HRPH 1JGUL 5F7DB 2P24B 1D5BB 4JRXD 4R4ND 1ZLUK 3QUYC 4F8QA 2XKUA 3L5IA 4ZS7L 4J3UA 3SKMA 5KVMC 1S5IH 2VLKB 5T3ZD 1KTRL 1IEAB 1IC5H 3HE6C 2X4RA 3VI4E 5B3NA 1J8KA 4U6YA 4ESKA 1EZVY 4KJQC 4BA8A 1INEL 2X1OA 5KS9F 1UACL 2RFXB 1IC7L 2WP3O 3GEWB 2GAZB 2PYEB 5F89A 2DQHH 2NY7H 1IGCL 2QR0A 5FO9A 4HS8H 4XPHL 4G9FE 2IALA 3PQYA 1Y0LB 2JF1A 2FX9L 5F96H 1X9QA 3BDYH 1KN4H 3J7HA 3CZFA 3WV0A 3VGAC 3I84A 4PRHD 4D0BB 1EJOL 3LY6A 4JFEB 3ULSB 4K3EL 1B6DA 4ENEC 4N9GB 1F4WL 4PJ7B 1AGEA 4G7YH 4NN7C 1U91B 1WWAX 2VITB 1KCRH 1WFTA 4QKXB 5I1DA 1V05A 4K8RD 1FIGL 4YEEA 3L3KA 1E4KC 2VLLB 4GUPB 4H5SB 3KHOA 1GGCL 5KSAC 1U3HB 5D1ZB 4NFDA 4EXKA 3IXTB 2G5BB 5E95B 1EGJH 1EO8L 4RX4D 1XAUA 1QSZA 5DJ0B 1ZE3C 1I9RH 1JWMB 2Q8AL 1FC2D 4F7TB 1Q94B 4IRSD 1CYGA 1JRHI 4YQXH 5D5MA 4U3CA 2F8XC 5C0CA 1WIPA 4PFEA 3QXVA 5I8KH 4GKZA 2YEZB 5D1XA 3UTQB 2X42A 2ORBH 3MGOB 3DV4A 3AM8C 3S35L 4RAUA 4JRXA 1K8DA 1ZHBB 4CAGA 2DKSA 2QQNH 2JR6A 2BXYA 3DURB 4HAFA 1ZLWH 5FB8A 1RIUL 4MJIB 2L7JA 2XPGB 1YEHH 4TTDD 2E9BA 1BD2B 3RGVC 1MRCL 5EU4B 1BJ1J 1RK1A 4RFEA 2VTFA 2R1XB 3VFRB 1T22A 2JB6A 1U9KA 3INUH 2FL5A 4UDTB 4XRCA 3PXHA 4KKCC 5J6HA 1E6OH 4YXLL 3HCVB 2UYLB 1VA9A 2YUVA 2A74B 1JTOA 2E2JI 2FHFA 5IV2A 5FUCE 4G6FD 1JGEB 3NFNA 2E7LC 5FLMI 1OSPL 4TN9A 5T3XE 3LV3A 4QY8A 5I1GL 2WQRA 4KDVA 4P5TC 4HIEB 4ZFZB 4L8CB 3ZKNC 3VCLA 3L5XL 2C3GA 3WFCH 4YHNB 3C5ZD 3QISA 5C86A 1ZA3B 3ROLB 3KLAA 1BFVH 1JWUA 4JRYE 3K7UA 4Y16D 2DE7A 2ZKHL 5I75C 2VYRE 2MNUA 3MNZB 4DGYH 1FL3B 1I8IA 2AJUH 4I18A 2XWBB 4A3DI 2FJHB 3TT1L 2NY6C 4HC1H 4MAYB 2IGFL 5DO2C 1MHEA 4RAVA 5I30H 3VB9A 1SEQH 1MIMH 1BBJB 4LEXL 4PJIB 2VUYA 4RGOL 3O4OC 1HHKB 3UO1H 2X40A 4UT6H 2ARWA 1YECH 4J3SA 1NUGA 2K7QA 4PS4H 3Q1SH 3SO5A 1UA6L 2C3VA 3W9DA 5CBEA 4YBQC 5C0RH 3PL6D 3LEYL 4YXKL 5D2NA 4ZSOB 3BW9B 1FJ1A 2QHRL 3OG6B 3STLB 3BN9C 3AU1A 5IGXH 4Z7OF 4P4RA 3DRTA 3HA0A 2XKSA 5E5MA 1NGQL 5E7BA 1JE6A 4WW2A 3SQOL 3FOLA 2VAAB 2GT9A 3QEQA 4PV8B 3FB5B 2NMSA 4N5EC 5DVOA 4WFEE 2FO4B 4IMLB 4CW1B 2ITDA 1F00I 3D6GA 1QYGL 3CVHB 1FL5B 5KSBA 1UC6A 4U31A 2ZG3A 3N50A 3L7FB 2VL4A 3OHXA 5MENA 3GHEH 2OR7A 1CE6B 2BJML 1R3HB 3QUXB 5CILL 1XF3A 5EZIL 3IRPX 3RWIA 4FN0A 1KACB 1U8HB 1TTUA 1ZLUH 3PWNA 3ARGB 3C5ZA 4U1KA 4BH8A 2HF1A 2W0FB 1KB9K 4S0SD 1CDHA 4JKPL 2EYRA 1FH5H 4Y16A 2NX5E 3IT8D 5ADOH 3DVFA 1U92A 4X6DE 4F58L 3DOSA 3TBTA 2K5RA 2VZOA 1T0PB 3V2AR 1A14L 2OJZL 3GB7A 4YLQT 4N90E 1I3VA 3R0MA 5IFHH 3SKOB 3DETD 43C9B 1QR4A 1PZUB 3L3IA 5ITFB 3UC0H 2YA1A 3C8KA 3C60C 4WFED 4Q9QL 1BQUA 1CLOL 1EO5A 2HYMA 3D39B 3PL6A 4WNQB 5DWUL 5C2BL 4WI9A 2V6HA 1G7LA 2CRMA 5CEZL 3QDMD 3QIBD 5ICYA 2Z35B 4YE4H 1MY5A 4XCCL 2CLZB 1AIFA 5D2LE 4U6VH 4JFQB 5B8CA 4QXUL 1ZEAH 5KSUB 3QRFM 4HUMB 2X9YA 2J6EH 1NGWA 3HPLA 2V5YA 1OL0A 5MI0C 3BE1H 2IPKA 5GSRB 4TUKL 5CLTA 5EWIL 1JL8A 3QFDB 5JIHA 3T0WA 3D85D 3MJ6A 2NY0C 1CTOA 3UZVB 1WZ1L 2Q6WA 1MH5B 3BZ4B 5ALBH 5FYJE 2BHYA 1Q38A 1JNHB 1BX2B 1U36A 2O5XL 1HDMA 4LOUC 4N90D 4XPAH 1ZB9A 3NCMA 4ZNCD 3CXHJ 4YAQA 3QCVL 4HPYL 1CFNA 1D9KB 1DN2A 1RK0B 4KMTH 3S1NI 4PGBA 4CNIB 1T04B 3S1QI 2G2RA 2FJFB 4Q74A 5F7UA 3ZDZE 5TDOA 4JN1L 4N8CH 3X11A 1F2XK 4L8SC 2J2ZA 3IVKA 4X5XB 1NCWH 4OIIL 5E8PB 3H42H 5FAAA 1AY1H 4P4KC 4GG8B 3WYRA 1V7NL 2YA0A 1WICA 1GSMA 2OSLB 3PNWB 4JVWA 5D7JB 4HF5L 1H8NA 1ZMYA 2F4MA 5DTFB 5FEBA 3GCFA 3VFPA 1JHKH 4MA7H 4M8VA 4U2YA 4LPXA 3QIUD 3E8UL 4MLSA 3D0VA 3DRQA 1Y1VI 1SEBA 3EIFA 3RWJB 3UDWA 5IWLC 5DFVD 5EA0L 1M71A 2VJXA 2VR9A 5IB3B 5EU3A 1UXWA 3M1BA 3QDMA 5I1IH 3L3OB 2R7ZI 3QPQD 3QIBA 5FYJD 1YYML 5DJZA 4N0YH 4P2QB 3VXMD 1MCNA 5F3HB 3DMMB 4H1LG 5C0GB 3TFKD 1C12B 5J11C 2JIXB 3JVGA 1HSBB 3UZEA 4GKNA 4NRZA 5HHVH 3SOBL 1XF2A 2UVFA 1HHIA 1G0XA 2YXFA 1QA9B 3QEHA 4XMLH 1CFQB 1PKQA 2F74B 2XT1B 3D85A 4W68A 3VFTB 1CD8A 1F3JA 1NC2D 2QL1A 2WM0A 1UJTA 1JN6B 3IJHA 4LEOB 5F6HJ 2F54B 1A4KA 3P4OB 4IOSD 4GBXC 3ILPA 1T2JA 2KZ1B 4NBDA 2Z91B 2XTJC 3QIWD 4XBPA 3GSNB 3L3JA 4PG9B 1SY6H 2D03H 4M6AA 2AI0L 2ZUUA 2OYPA 3D0LA 4L1HA 4YHML 1WTLA 2QSCL 2M8XA 5CD3A 1K4CB 4Y2OA 2UZXB 3SHSA 3VFWB 1MAML 3HOUI 2HJLB 3G04A 4M48H 3ARFC 3ULUE 2VERN 2HJKA 5K9JH 2EH7L 4P59L 5GS0H 4H20H 3JWOH 1FZKA 4KTEL 4NBYB 3QIUA 4X6DF 1C16B 2VRAA 5TF1H 3MRFA 1G6RL 3KR3L 3SDDC 1CLZH 4LLQA 3CMGA 4NC1C 2I24N 5GHWL 1B0GB 3QQ4A 3UTSB 1T03L 3BYTA 4NHCL 2YOCA 3HUJF 1CGYA 1S7QB 2F53E 1Z5LB 3HMXH 3CVHL 3VXMA 4WEBL 1BREA 5ITBH 5E99H 5EZJB 4O4YL 3W2DH 2X4SB 2ICWI 4L3AA 3RWDA 1NBZB 2DQGH 4OCRH 3VRJB 1ZANL 2J12B 4OB5H 1BEYH 3LS5L 2MFNA 2NY2B 2WUCH 3MCG1 1SJEA 2OZ4A 5IP9I 5ADPH 2FX7H 3MRKB 1NC2A 3EOTH 4L8BB 4OF7A 4LU5H 2R39A 4D2NA 5K9OB 2P8MA 2PR4L 3MRQB 4XNZC 2DQJL 4MXVF 1AR1D 4BQ6A 4JKLA 2PXYD 4PJHA 1ND0A 4HPOL 5GRJH 3B9KC 1HYRC 1MLCA 1F4AA 1XF4B 1CT8B 4A3GI 4NZRH 3QIWA 4MDJB 3LD8C 2VZTA 5DRXB 5EZLA 3RBGA 4JZNB 3VH8G 5JA9A 3BESR 4FZEL 5DHXB 2C9AA 3LPFA 1AKJB 1G7QA 4TSAL 4H26B 4OKVA 4X7CC 2Y6SD 1NUNB 1F2QA 3VXTB 1TWAI 3KPRB 1P6AB 1UM6H 4F3FA 3WKMH 5A16B 3QO1A 2GQHA 2ZSWB 2BNQE 2VDRH 4NT6A 1QSFB 1T0NA 4XB7A 2J7LA 3BP4A 5HHOB 2R2HA 1TXKA 3TCLA 3J8F7 4QNPF 3BEWA 5B38A 1CK0H 5HYSG 4XTRD 2Y36L 2R0KL 1MWAH 4RSVA 4H88H 1X5IA 3FRPA 1LEIA 2JA7I 3EYSH 3F6LA 1RZKC 3RIAF 5D93C 4P9ML 2BVQB 3WFHA 1BWMA 1QACA 3BPOC 4XNQB 4JEGB 2PKDA 1UXSA 2VSCA 1CDCA 1MRDL 3NCBB 4E5XA 1BQHG 3AAZA 4JM2F 4Z7WA 5DHVA 2JJWA 3DWTA 4HW6A 5D7LB 5DMGD 1I3GH 3HOVI 1CQYA 1FZOA 1MCJA 2VXTL 1HI6A 4ZTOH 4UZGA 4JM2C 4QHKJ 2DIBA 5HHPB 4IOIB 2PXYA 4PGZA 1VKXA 4LQFH 5BO1H 4CMMA 2HT2C 4OT1L 4AIZA 2Q76B 2RCSL 3VFSA 5IB5B 1RIVL 3JWDH 3ARBC 4L3CB 3SGKA 3JV6B 2VLKE 5D6CA 5EPMB 5E7FA 1T89C 4ZTPH 1U93B 5MEPA 5F97E 1P4BL 2XG5A 2GUOA 4BKLA 2D7TH 4MB5A 1BQSA 2BMKB 4ZFOA 3LVEA 2GJ6D 1L9MA 2CKBH 2PYEE 1OPGL 3DI3B 1D7FA 4ZDHA 1EFXD 3JTSB 2AK4E 4AEEA 5D6DA 1CL7L 4JO3H 2J6AA 4QHUB 5M94B 4X4XB 2E6PA 3SGEI 4F7EA 1U8NB 4IIQA 3TBYB 3PXJA 4JFEE 2A6DA 3P30H 3B9EA 3K3QA 4S1SH 4DK3A 5IROC 4ZG1A 2WUBH 3STZA 4OSUH 5C07D 1OHQA 4GG6B 5T5NG 4CBPA 1N7MH 3BI9X 4JJ5B 3OF6D 4KK6C 1BM3L 1I7ZA 1KPVA 3GGWA 1CFTB 3IDYC 3WLBB 1GOFA 1M6OB 1GC1L 2R1WA 3NABL 1MOEA 4I0PC 4KZEL 1QBAA 3ULUC 3MRJB 4XZUB 1OTTC 2K9UA 3WIHA 3QUMH 3LN4A 3EYOB 1A2YB 2Z8RA 2VLKD 3O41A 4PREA 2X4PB 3QZWB 5T5NF 3RY5A 3E6FA 1KJ2L 1TJIH 3O6FD 4Z7UF 1NFIA 2W92A 3GSNL 4JHWL 2HFEA 4HCRA 2PYED 3VMOA 1F58L 3H9SE 2LABA 3WJLA 1QYPA 1UM5L 3MJ7B 4R2GB 35C8H 5I0DA 5BV7C 1NCCL 2AK4D 1MCEA 4K71B 3EO1B 4JFZH 5IESH 4IM8A 1QR1A 4XVTH 3ARED 5BZDA 3MOQA 3T3PF 4MJIE 1AGDB 4JFED 1BD2E 4Q9RH 3VXPA 3GFUA 3QO0A 1ML8A 4WFFE 2GJ6A 2L7UA 4DKAA 1CD1A 3D9AH 2VDQH 1T0MA 1VFBA 2J8HA 4KMQA 3IRZA 1EFXA 3NA9L 4PJFE 3EYVA 3ARZA 3LSOB 1FG2A 3V6BR 3S97C 4FOMA 3OKEA 2ZPKH 1VEPA 3GBML 3T0VA 1WT5A 5JHDB 3MBXH 5I1AA 4BBSI 4NQSB 5DVLA 3GSVB 1A6UL 3P77A 3FOMA 3W9EA 4OZHF 5IM7A 2AJSH 2BHUA 4ONHA 4LSDA 4NBXB 5C07A 1NGXA 1BFOB 3F12A 4HUVB 4YFDB 3GIZL 2O5ZL 5FK9A 1IAOA 1AO7B 2KUTA 3V6FA 1PQZA 2X89A 1RLYA 1U95A 3OF6A 1HH6A 5CZXC 3H9SD 1JHTA 1MFNA 3VG9C 2CK0L 3GMOA 3UX9B 5IFJA 4WTZA 4JFFA 1N59B 3MROA 1AR2A 4LPUA 3X3GH 4P46D 4OZIA 1K5NB 1RZGB 2OP4H 3RZCB 4NGHH 3QDGB 3O6FA 3MLVH 3SDAD 4QO1A 3CFKB 4OCMC 3WHE1 1CLCA 1IC1A 3TCXA 3I75A 3WO4C 2DMKA 1R5VB 5IVXA 4NWTH 3BEVB 5I8KL 1NL0L 3GTMS 2OM5A 2VDNL 1JZ8A 4GAGL 3D2UD 4FFVD 2AK4A 2ORBL 3ZL4H 1UB6B 1QVOB 1J1PH 5L2JB 1ZB8A 3MRRB 2WP3T 2B39A 2GK0A 3MLTA 4ZSOE 1DN0A 3AREA 3RAJH 1HZHH 1I3RB 8CGTA 3DVNB 4M7ZB 3OX8A 1J1XL 3BD5A 4MD5B 2ZOLA 1SMAA 1T66C 1KLGA 1NBYA 4FXKA 3HE7A 5F1IB 5I17A 4ZPVA 3DIFB 3N0PB 4OV5B 3VRLE 4RAHA 3MUY1 4LIQE 3U82B 2DLGA 4HMEA 3TESA 3VXSA 2B20A 4M6NH 3CK0H 3WDJA 3R0NA 5F3BA 4MAYD 2N1KA 1F3RB 4KRMB 4QXWA 4RISH 3HTLX 4AY0A 3VXQB 1FFPB 4G6ML 3VWJC 1X6LA 1KTDA 4LHUD 5DSCB 3UBXA 4ODXA 4LSRH 4XPBL 4LSVH 1ETZB 4PGDB 1JPTH 2X4NB 2YRZA 25C8L 3H9SA 3NA4A 5CSBA 1X5LA 3GSQA 2XACC 1VACB 3L3DA 4WRLA 3D18B 5H94B 1JTPA 2CRYA 4M3JA 4P5KA 4P46A 5E6IB 4N8VB 4D0DB 4NRXB 4PJ7F 3VMPA 3SDAA 4GS7C 4UOW1 1L7IH 2WMPA 2NXYC 5GGTL 1MY7A 2EDNA 2FH8A 1GH7A 1OGTA 4FFZH 4S11A 3D2UA 5CMAA 5DA4A 4PJFA 1LO2H 4MMZC 3D39E 2EEDA 3DV6B 1TVHA 3QWOA 5HDOA 4G8EA 2I60L 4U1IA 2X1WL 4NNPL 1KIPB 4M8QB 1EEUA 4TPRH 3NZ8A 1U3HC 5D1ZC 5TDNA 2EE3A 3SEPA 3ZE2E 3SCMC 5IGXL 3W0WB 2YN3A 1IILE 5I1JH 1ZTXH 1MCWM 3ROLA 4YDKL 3S96A 5C0BB 5DC0A 5C2UB 3DX7A 15C8H 4LF3A 1QLFA 5HBBA 5IJKC 2AGJH 3ARRA 5F7YC 2HVKB 5GRYA 5LQBL 3BXNA 4JLRA 3BUYB 4HIHB 4QTIL 2BSTB 1ZT4A 4JPIB 4UV7H 1N3NA 1FBIL 2CPCA 4TOYH 2W9DH 4I77L 4YDIL 1TTGA 3PWLA 3HLAB 3F58L 3RWEA 2FATH 4LHUA 4POZC 5ESVA 5KBNC 1A7QH 5ETUA 4X7SH 3U46B 2G5RA 5AEAA 4WHTA 4H0GA 1DVFD 1OWWA 4QRRB 2H9GA 2AJXH 4KVNH 4U7KA 4LVHB 4Z18A 1JFQL 5HVHB 5EORL 1OAXL 1WCBA 3FONB 5FXCH 5JMOC 5ADOL 3HI5H 3EOBB 4LBEA 5IR1A 3IJSA 2YPKA 4XGZB 1MCPL 5HTSA 1I3QI 1XZ0A 4UT9L 5GXBB 1ZT7A 3GTLI 3RVUD 3ZKXB 2W91A 4IRJD 2HFTA 2N7BA 4JPVH 1KLUA 4GRMB 4NC0B 5EIVA 1LE9B 3UC0L 2H32H 4R0LA 1CXLA 4CVWA 3T4AA 4JG1H 1NMBH 4X98B 4YUEL 1NDMB 1DSFH 4Z5RA 2A2QT 4PJIF 1EEZB 2GEEA 4XB8A 1FRGH 2DYPB 2A6IA 5E8EA 5F6HI 5FV1L 4P2QE 1A7OL 1IM9D 4YE4L 4O58H 3KYOB 5CGYD 3G08A 2FYYB 2F8VA 3IDNA 1MWAB 4UIMA 4XVSL 5DS8A 3MRCB 1A1MA 5TDPB 1U8QA 3OAYK 4I0CC 3TIEB 5D1QB 1OAQH 3BP7A 2DKMA 3EYFA 4I3SH 1NQBA 1FIEA 3FQNB 5FGBA 4XPFH 2F54E 2IBZY 3FB8B 1A6VL 2HH0L 5FO7B 1U8KA 2HKHL 2NVQI 1GIGH 4BBRI 1ADQH 5DK2B 1DVFA 1MCRA 5D7JD 3RIFK 3WHXB 1KFAH 2CLRA 3O2DL 2VB5A 4Q58C 4P23B 3VFNB 2BJOA 4FP8L 3TBVB 5GGSA 1UYWL 2YD9A 3I6LE 4NQXB 5J4MA 3L6FA 5C0AD 1SJHA 3MXVL 5C8JB 2AK1H 5FDWA 1RHHA 2G60L 3MJ9H 1ZS8B 1OM3L 1DBKH 3WBDA 3CFDB 3U9PL 1CR9H 3MMEB 5IFAH 5I9QC 4Z8FL 3H42L 4IRJA 3QUXC 4PJCB 2AJZB 1JZ7A 2Z92A 4KUCD 4XAWL 1NGYB 5AZEL 1UZ8A 2JLLA 5CJQL 3ARGC 4FZ8H 1LO0L 4J4PC 3CFBB 1JHKL 2CKBB 4LPVA 4M6ML 2ADIB 3CZJA 1HHHB 4PJDE 2CLVA 4XCFH 3WXVH 3FQWA 3QXDB 5I1LA 4KXZH 3UTSE 1G84A 3SE3C 4LK4A 4MZ3A 3IJYB 3LRHA 3S1MI 2ATPB 2DBLL 1IL1A 2Y07H 5BQ7A 1IM9A 1L6ZA 1G7IB 1MI5B 1G1CA 5KS9A 3IDJB 4U05A 1ZA6A 2AJYL 2E6JA 1MFCH 2YRPA 4OF6A 5IBLC 1Q9OB 2P7TA 1UM4H 4DUWA 2AEQL 3HI6L 1AD0B 4TNWF 4XXDB 5CIPH 4YHPA 3C5SA 1YDPB 2UY6A 3ZKND 4NKDA 3ARDB 3RA7L 4OM0H 4XVUC 3MLYH 1J18A 1U8LA 5C7XL 5HVFB 3MRIB 5I71C 3U7YL 4OCXL 3KJ4B 5EFIA 1Y18B 4GOSA 3S3SA 3QHFL 1ITBB 3QUMB 1UH4A 1MEXL 3S16I 3V0WL 4F37F 1OCWL 2AKRB 3TIDA 1RUKL 4Z7VE 4HUUB 3FMGH 5DO2D 1RZFH 2J4WH 1N2RB 1WBZA 3VU2A 3G6DH 4PB0H 3VFOB 4ZOAA 1JGLL 4GW5A 5C0AA 2XZQH 2BDNH 1FVEA 1TWCI 1FNGA 1KIRB 4DN4L 1CQKA 1U2HA 1OLLA 5IBUB 3OKDA 3C8DA 3KPRE 4NO5B 3UTSD 1HH9B 3CLFL 5LAXB 4HJ0D 4UB0H 3NTCL 5DI8A 1QSFE 5SWQB 5ILTH 1QHOA 3OJMB 4NSKA 5HHOE 4F7PB 3O3UN 4H25A 5LWYH 2NLJA 3IFNL 2UZIH 1RURL 3I3BA 4L9DA 5JOFA 1NFDB 3M17A 1D9KC 4HXBH 1RJZB 1X4ZA 2R8SH 5TF1L 4GRLB 1I7RB 4OF5A 1L7TH 1MJ8L 1RFDH 1YEIL 4OLUL 3WS3A 4B50A 4XBEH 2EDBA 5FM5O 4BH7B 4EEEA 4JY4B 4G9DA 4PPTA 3F5WB 2OI9B 1YY8A 4HLZH 4WTWA 2DRUA 2YR3A 5ITBL 1N6VA 5E99L 1UQSA 4TQEL 4NNXB 3W2DL 5KN5A 1YEGL 4KK9C 1U41A 3KAAA 3RZOI 3EO9H 4YHKL 5D7LE 2WUCL 5DR5H 2DQCH 1ZAGA 5I8OL 4LU5L 4IJ3B 3BP5B 3K74B 1MPAH 3WS6C 4NB9A 1M7IB 4GXUN 3I6KB 4LCIH 4NNYA 4F2MA 3VGFA 3ZE1E 1YEFL 2CDFB 1YEKH 4F7MB 1WQVT 4U49A 4KV5E 4XXCC 5IEKA 1IARB 1OAYH 4NZRL 3DMMC 2OK0H 3UYRH 1MCOL 5IG7A 1ODAA 3F6IA 4GSDL 3ZLQC 5DK3A 3MX0A 1XGYH 2GKIA 2H8PA 4UDUB 4PJDA 3LKNB 2JTDA 4G43B 4ORGB 4FQCH 1EHAA 4JZOA 5D72H 4AZ8A 4NHUB 1VADA 5JOPD 3V4UL 1EEQA 3OAYH 4LRNH 2VZSA 4DOHB 5JPNA 3HZKB 2H3NA 4FQ1H 3KYKH 3BIKA 5LGJA 3QNYA 3VFUA 4HJJH 5F1NB 3U7WH 4PRIB 5F71A 2X1XR 4ZXBC 4QXTA 4LQ1A 3O9WB 4YX2H 1DBBL 3P9MA 3S14I 4Y4FD 4GG6E 4RIRB 5AAWA 1CXHA 4OZFG 5A43C 5EZOH 3HRZB 5HXMA 4BSJA 3GMNB 5E2WL 3EYSL 3OJDB 4X7TB 4ACPA 4K55A 3OJVC 1NLBH 1IGIL 5DJXA 1I1FB 1YN6A 4MCYB 4Z7VA 1IEBA 3FQXB 1R3IH 3U9UB 4N0UA 3WLWC 1KN2L 4TSBL 4TUJB 3KVQA 3SQBA 2IH3B 1H15B 2R2EB 4Z0BL 3RRQA 4X7EC 2EDYA 3I3DA 4WHCA 1F11A 4HS6A 1FVCA 3KPOB 2FIKB 3JUZA 4O2FA 4PJBF 5JR1H 4WU7A 4XBGA 1KPUA 1FVDA 5LXGH 4CADB 1X5KA 3QAZB 4X5WA 4EJ1C 2LU7A 2D2OA 1R3JA 1AQDA 4IS6B 1HQ4A 2FLRT 3QDJB 5T1MA 5FUOH 4G80B 4QCIB 1INDL 5KVFL 1EUUA 1BQLL 4GQ9H 5C71A 3PJSB 1DL7H 2Z8WC 2C3HA 1DANU 1NUFA 1XF5B 3V0VA 1P7KB 3GKWL 5MP6H 1A6WH 3S88H 4AEIL 2NY2C 3RDTD 3TYGH 4LCCB 4FQ2H 2D7TL 4KUZH 4FQXB 1X4XA 3WDHA 2P5EB 1HOCA 4KKBD 4M1CC 3RWHB 2IFGA 1LK3H 2CKBL 4I3RH 2Z8SA 4WY7H 4X6FB 5EUKA 3O4LB 3LRSB 3MNWA 4NFCA 5JHDE 4FABL 5J3HC 1T2QL 1O5DT 5IP4A 3VGEA 4XWOD 2ADFL 4X83A 4UILL 1PX3A 2G75A 4UMGA 5F1OB 4Y4FA 5CINH 3OB0K 4X6CB 1TQBC 2VIRA 3TT3L 1QPPA 3U2SA 5BRZB 2VLJA 4AL8L 2WUBL 4P2YA 1AO7E 5BVPH 4HV8B 3BP6B 1N2FA 1F6AB 5HYQB 4UQ3A 2OL3A 1ZVSA 3WD5H 5LJYH 2W9LA 1U8OA 4A6YH 1Y6NR 2YPVL 3BISA 4R2GD 5HYEA 1YJDH 1RIHH 4OZGF 4GAYA 1QSEB 3AMLA 4YBLB 1QRNB 3RKPA 5C3EI 2V9RA 3C6SA 4YWGH 1UB5A 1XGUB 3OXSA 3VDAA 4KRPC 5D70H 3QQ3A 4HJGB 2IANB 3OAUL 8FABB 3QDGE 3Q2CA 1N6QH 3HNSH 4EI5B 1EXUB 3VGGA 5KZCB 1W0VB 4LVNC 2D7PA 5GJTL 5FF6A 5D96B 3PWVA 3MRPA 1FLRL 2OJEB 3OKOA 5C09A 5A2KH 5IMMB 1S7TA 2MHAB 1LGVA 4LLDB 5FO8A 3PWJB 4MQSB 35C8L 1FDLL 5JHDD 1ZHKA 3RVTC 3OTTA 3E3QC 1I8MA 1AE6L 4IHOB 3T2NL 3EJZD 1X5ZA 2VDMH 2QKIA 4S10A 4JY6B 3A6BH 4MX7B 4L3EB 2EDXA 3RDTA 1IGJB 2H26B 2J5LB 2A9NH 3MUHL 3B3IB 1MREH 3SDCB 1NANH 1YYLH 4U1HA 2XI9A 5DD1H 3CVIH 1QBMH 2VDPL 2ADJA 5ANMB 1K2DB 4PJEF 5ACMA 2E9WA 1TZGH 2ZPKL 4RMSA 2A73B 4XNYH 5JNYA 1BFTA 2DLIA 3GBNL 4JFHE 3REWB 4HLJA 2R56H 4WVRA 3GRWA 3SGJA 5GGRY 4Y4KB 4XNXL 3H9HB 2BY2A 4HZLB 3SKNB 1WBYA 2FBJH 2ICCA 1D5ZB 4PGCA 3X13B 5LGHL 2E8ZA 4N1EA 3CDCA 3MBEB 3DYOA 2HFFA 2UWEE 4JB9L 4ZYKB 2P8LB 4WEMB 3MFFA 3ZMRA 5CHNA 4EN3B 1HSAA 1NGPH 1W72B 4NJAL 1DQDH 4LSUH 2P4AB 3QWRD 3GTMI 2OP4L 1NEUA 4NGHL 1BIIB 2P48B 1CWVA 1T1WB 1LNUA 2A77L 1AH1A 1I9JL 1A7NL 4M9OA 2H6PB 3X14B 2OMBA 3HZVB 3P0VH 3IGAA 3RVWC 4H1LA 4LLMA 4MJ2A 3IDIB 4EDXA 5DQJB 3OZ9L 5C6PB 5JHLH 5HHNA 4G8IA 3R06A 3VGBA 3WMSA 4PTTB 4FMKA 2VL5A 5INCA 4JDZB 5C70A 4O02L 3MRDA 2CK2A 4JFHD 5T1DH 4C56A 1YMHA 4UTAL 4L4VB 3W0WE 1P2CB 5IBTL 4D94A 1LDPL 1BGXH 1F8TL 3FT4B 3NGBC 1KCUL 5D71L 4UBDD 3CU7A 4GMSH 5IB1B 3ZHLA 4MQTB 3TPUB 2V7HB 1I1RA 1CCZA 2RJMA 4RGMC 5B4MC 3T0EB 3O8XB 4LFHG 1TETH 4TVPD 3BO8A 3U1SL 4X5LA 2C4FT 4K71C 4E42B 3L3HA 5JOEA 3RPIB 5C9JB 5DJAA 2FIRT 1FFRA 4A3JI 5CIPB 1HEZB 3DGCR 4QRRE 2BSSA 1CICB 1FL6A