2RBLA

High resolution design of a protein loop
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
89
structure length
89
Chain Sequence
LDAPSQIEVKDVTDTTALITWSMQLSQLEGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Tenascin
publication title High-resolution design of a protein loop.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 89
sequence length 89
chains with identical sequence B, M
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2rblA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2rblA02
4HH9B 4J3VA 4JFPA 5C0BB 4MHHG 5D2LF 1NUFA 2GCYB 5LGHL 3H2WA 2UY6A 4XC3H 2XRAH 1TZIB 1G6RH 4YBQD 3BD5A 3CDFA 3CX2A 4FOMA 2O93L 1RZKC 2WBJD 1NFDA 4ZO8A 3SKOA 3D6GA 2W0PA 1BP3B 4HCRL 4HWBA 4PYGA 2NVTI 2ATKB 4RGNE 4UIKL 4YDVA 4LIQL 3S36H 5IHZB 1K85A 3QCVH 3GKWL 4JO1L 2ICCA 5DRWB 4DGYL 4AH2B 3P40A 2GYSA 4OLYL 4MNGB 4PJAB 2IADB 1SFOI 5I9QC 1DBMH 4ORGB 5L88L 4XGZA 4PTUA 4YUEL 1KULA 3S88L 5JXEA 3SE3A 1QFHA 2BNUA 1FE8L 2R56H 3PWUB 3MV01 3TA3C 1MRFL 4FXKB 5HVHB 1J8KA 1F97A 3KPSB 3NMEA 3I07A 4P5TA 5D1ZC 3N50A 2IQ9L 4NIKB 4OLUH 4N9OB 4JPVH 4NO2A 1UJ3B 2R2BB 5KSAB 1F58H 4QRRB 3K4ZA 1MCPH 2H26A 3QI9B 5A2JH 4S1SH 1MELA 3I6LD 4ZTPL 4PRIB 1G9MH 1PG7W 5AYUH 5DUMH 5F9WB 3EO0A 2P42B 1N0LA 4WU7A 3G6AB 4UT9L 2VERN 4JFEA 1H0DA 4EI5C 3FO9A 5AZ2H 3UYPA 5DWUH 4FRWA 1J8HB 1T1XB 4PJ8A 1BFVH 4PJIB 4FQXA 5ICZB 2CLRA 4DTGH 2LQRA 3DURA 3EYUL 2E7LC 1YEIH 4AT6A 2O5XH 3JZ7A 2XXCB 4HWNA 4AEHH 3MJ8A 4YNYB 4MXQD 4D0DB 4HUUA 5BVJA 3JV4A 4YHZH 4XMKH 3LH2H 4WW2A 3WHE1 3NA9H 5T1KD 3QG6B 4HKJA 3D48R 4BH7A 5I1AA 3O6KL 3FN0H 5HXMA 4DFIA 4OF0A 1NCDL 4OLVH 1CE6A 3LRHA 3ZZ1A 4N0FA 1IC4H 3DNKA 1R5IB 3W9EA 3CCHB 1JMZA 3MRFB 4ZXBA 2DD8L 3WCYA 2R8SL 3OSKA 1F4YL 4LVEA 3KPNB 2N4IA 3BH8B 1QBLL 1NC4A 4NZDA 1LO5B 4BZYA 3TESA 3L5WB 3EYFB 3I6GB 1HI6B 4NRYA 1IGIH 4IIQA 4GG8B 4K7PH 4AIOA 1MOEA 3VXSB 1HHIB 2BSRA 2A73B 2BFVH 2AKRA 4GH7B 3U1SL 3VRLE 2XA8H 4BQ8A 5T3XL 1B4RA 3MACL 2AI0L 3IDYB 1ZLWH 1KPUB 1HHGB 3ECBA 5E1AA 4F7EA 1EH9A 1GGBL 3MLUH 4A3JI 1HSBA 1UB6B 3EYVB 4U1KA 5EBMB 2X42A 2B1HL 3U83A 3CMGA 1IBGH 4K71B 1CI5A 2DIAA 2JELH 2GJJA 2YRPA 2VIRA 2DIBA 3ILPA 1LEIB 1D9KC 1KFAH 5ICYA 1TFHA 1L1OC 1G0YR 3O0RH 4HPYL 5F9DC 3JTSB 2BHUA 4KKCD 5DJAA 2EXWC 2PYFA 5HGBA 3IF1A 1CXIA 3VFOB 4HZLB 4YLQT 5TQ2L 1UKTA 1H3PH 2EDDA 3FQNA 4AM0A 3CDYA 4TSAH 4XPFH 4U2ZA 4FFWC 5B22A 4QOKA 2JIXB 3I85A 5IT2L 3A6BH 3QDGD 3W39B 4XCNB 3Q5OA 4P3DA 1IGJB 2DI9A 1E6OL 2MMXA 1BVKB 5KS9F 4X4ME 3AROA 2I24N 1NC2D 1XIWC 5L6YL 3H9SE 1AFVH 5BMFL 4HUKB 5C6TH 5DK2B 4NBHA 4DK6A 4M8QA 3QPQD 2HJFB 1Y0LA 4ZUTA 1F90L 1FVEA 5FDYA 4Y5VB 3C6SB 3OQ3B 5JHDE 2AV1A 1T03H 2BSSA 5GRVL 1E4KC 5KAQG 1I9IH 3QUYD 1D5XB 4JPWL 2DL9A 4NQSA 4W70A 5IIEB 3D3VD 1T4KA 4JG1L 1T0NA 4U7KA 4Y7MA 3VXTA 4AG4H 5CINH 4UV7L 2NY4B 4R90L 1JGUL 1WEJH 5HI3C 2NLJB 1INQB 3QISA 4PS4H 3ARVA 2VL5A 2WBWB 5JXAH 2FGWL 4ZPVA 2YUVA 3F65A 2NY6B 2ADJB 5DD1L 4PJCE 1LK2B 5CGYD 4HKXB 4RGOL 4NNPH 1R6VA 1H5BB 2AGJL 1AJ7L 1AGEB 3RVXC 1DQDH 3QUZB 4YEFA 2CMRH 1A7QH 5GQBA 4GRLA 1CGYA 3VXUE 3L3JA 4X0KA 1I7RB 1NCTA 3IDJA 4R7NA 1AO7B 1U8JA 4RFEB 4C54A 5C09E 3VWKD 4P2OA 3C2SA 3FFDB 1ROWA 2A1WH 4KUCF 4U1NA 2Q3AA 1EJOL 3R06B 4KKAC 3V4VH 32C2B 1PSKH 4R8WH 3PWPB 4F37F 1ML8A 1MREL 1IAIM 4NWTH 4O4YH 3HUJF 4IRJB 5GGVL 2OM5A 4MD0A 4ZQKB 1XCTB 3CFBA 2VLME 1V7NH 5HGHA 5D5MA 2P5EA 5C08B 3GIVB 4RX4A 1CK0L 4BQ9A 3RTQA 3GMMA 3O9WA 3EDFA 4HWBH 1PG7L 3KXFA 5J3HD 2VXQH 1QA9A 3T04D 1DVFA 2VLKB 2EDKA 1AXTL 1WISA 5BOPA 2FZ3B 3MRHA 1VCAA 3MUJA 1IEAA 1XZ0A 2VDLL 3BESR 5EN2B 1IGML 3EO1B 1YPZF 5DXWA 3RUGB 1MQKL 1T3FB 4MWFB 3I75B 3T65B 3L3KA 3PP3H 3LEXA 4HLZG 2EZ0D 3RNQA 4WEUD 2PYED 1RMFH 4Z7UB 3RWIA 4HX1B 4I5BA 5H94A 4ZPTB 5MENE 4U6XA 5J6HB 4KMTL 3T0AA 3LKNA 5CKGA 4JFHD 1T22A 3ZHKA 5CBEA 3X3FH 4OSUH 3ARDD 5JNYA 3RL1B 2LVCA 4OAWB 1U6AH 4JPIB 3LS5L 2BOBB 1DDHB 3B3IB 4LEOA 3MV9D 3MGAA 1ZLWK 1J18A 3HOWI 3GI9H 4J6RL 4KQ3L 3C8KA 1CDIA 4MAYB 5GPRA 2CO7B 3QDJA 4GKSA 2C4FU 2IPUK 2YBRA 4ZD3H 3P73A 4LASH 3HE6B 1BJ1J 4WCYL 4X6DF 5MEPB 4UILH 2DQUH 3O8XA 2E2II 4JFYB 2F19L 1KCVL 1UKQA 4XP9H 4G43B 3E3QC 5H37H 4Z77B 2VDNH 1TCRA 2J8UF 4KK9D 3QULA 1N6QH 5T33L 3GMOB 3MJ9A 5C0IA 1Q9WA 3VRJB 1FC1A 1YZZA 3DX8A 1CICA 1EZVX 1A02N 4CJ1A 3KHQA 1EMTL 2YD1A 1TVBA 5F1SA 4ZFOA 4G6KL 2D2OA 1GZPB 3B8YA 1Z3GH 4RBPK 4JN2B 2R1XB 1MCBA 4JHAH 4XNMB 1KCRL 2Z93A 4QF1A 3AREB 1ITCA 4M1DL 5JXEC 3GB7B 3MREB 3NGBB 3SE3C 3B5GA 1U2HA 5I2IB 4FQ1H 3SDXB 1JK8B 4PJBE 3ZTJG 2E9JA 5FGCB 2A6DA 1KOAA 5IESH 2WANA 2GTWB 5JOPD 4P5TC 1AY1H 1JIBA 5HDBE 3L95A 2A9ML 3ZDXF 3O2DA 4MH4A 1LE5B 1F6LL 4XB7A 1I8MB 2VE6B 4JG0L 5CEZE 2Y1VA 2FB4H 3O2WL 1LP9F 5FHBH 4X7TA 2DYPB 5DRNB 1NMCC 5CD5D 2NPLX 5HHQA 1U8MA 3V6OA 4XNUL 1T21A 3MLWL 1QSFD 2HFTA 1LD9B 1BVLA 2GSGB 2J4WL 3WXWH 4K9EL 4NGHL 5F9JA 3HG1E 3D9AH 1J88A 1G7JB 3UJJH 5E56A 1VEMA 5E2WH 1A4KB 4OKVB 1K8DA 1BF8A 1A9EA 1NFDF 4PJ8C 5CMAB 4FQXC 3BPNC 1NPUA 2X89D 5HHNA 1GVIA 2ZG3A 4YQXL 1OAUH 5FDWB 5I30H 4HUNB 4IOFD 4ZYKB 3S7GA 4OUUA 3W0WE 4CMHB 4R4BA 3DROA 2YXFA 4ODSH 2BVYA 5DC0A 4M6ML 3X17A 3HS0A 4WW2C 1MF2L 2F53D 3PDOA 4XPTH 4MNHB 5DJ8B 3LS4H 3PWVB 2HT2C 4DUVA 4PRHA 4G6ML 2NY1D 4PLJC 5C1MB 1YNTA 5DMKB 2Q6WB 4ZAKB 5EU4A 3W2DL 1XF3A 2V9TA 1CLCA 4PJGB 3G04A 3MV8E 3RWDA 4O51A 5I15L 1HQ4A 1RZFH 1ZTXL 3ZT6A 1DLHB 4E41D 1LE9B 4OZHB 4ZXBC 3JWOL 4N0CC 3GBMH 4QRPD 4U1MB 8CGTA 4H26A 3QEUA 5L9DL 5DA0B 4PG2A 1MQ8A 5F7HA 2WP3T 2CLZB 3VJ6A 3LQZA 4HK3N 1X6LA 4GT7A 4M7ZB 3TNMB 4URTB 4IIQC 5DMGD 4HBCL 3CGTA 2Z8WC 2D3VA 5C0AD 1EDQA 1I7ZA 2C7UA 2R2EB 4P5MA 3RZDI 3HMXL 1MY7A 3K8KA 3RDTB 3V0WH 4I77H 2JJTA 3MJ7B 3S35L 3TO2A 4EN3A 1NSNH 4YXHL 4ZFFA 5A2FA 4JGJA 3TN0A 3IDMB 2KPIA 2N7AA 2VWEC 2DE7A 4X8JB 3B4NA 2DWEB 4YXLH 3OZ9H 1EFXB 4M6OL 4XPGL 5IMLB 4RGMB 2AXGB 3IT8D 4WW2F 1SEBA 5JZ7C 4Y19B 2IAMD 1EHLH 2BMKA 2WWKT 3SCMB 3CSGA 3KPLB 4FZEL 1T1WB 1UT9A 3FO1A 3VW3H 5D93B 4WU5B 3B2VH 1OLLA 5DJXB 3P2TA 4DGIL 4EZMA 1G7MB 3G5YB 1W8NA 5BQ7B 2R4RH 1D5BA 2HLAA 3MV11 3QDHA 1NANH 5D70L 1QR1A 1AQDB 4XC1L 4XVUC 5HBBA 5E6IA 1JL8A 3RWFB 5MP6L 1NUGA 2IANE 3IRPX 3U30B 2WUCH 4Y1AE 2APTA 5HHOE 1K83I 5I16B 2LU4A 3O41B 3D0LB 3TCLA 1OPGL 1NQBA 4H1LA 1K6QL 4NC1E 5K33A 1CTNA 3IDGB 3PF2A 2DQGL 3MRPA 4FXGB 1SY6L 3QJFB 4P57B 2WLZA 1F3DJ 2AV7B 2HVJA 2EYRA 5HJ3A 5FYKL 3MRQB 5D72H 4U6HB 1QG3A 5DD3L 3P9MB 5DR5L 4EBQL 2R69L 2HYMA 2ZKHL 1ORSB 1EGJL 4L8SC 4RRPG 3AU1A 3M07A 4IRSD 4NN7C 4FQ2L 5DRZB 4GRLC 2Q87A 5H35B 1KPVB 3UTTB 4PRDA 2XTLA 3UTSA 1ZXQA 4Y5XA 3D39B 4P2OC 4RGND 2FYYA 1AD0A 4KROB 4WI9A 1LO0L 4X6FA 4M1GL 3GUTA 3T0VA 1JWMB 5EUOA 5ACLA 4JVWA 2XA3A 5LAXA 3ISWA 3HE7A 4JKWA 1KSRA 1C7SA 5TDOA 2NX5D 3GSQB 5IWLA 4UDTB 4L3EA 2HFEB 1IQDB 3WS3B 3OKKA 4PJAE 4L5FL 4OFYD 4WHTB 2DL2A 4QO1A 3RTQC 3O9WC 4NZRL 3ULVC 4NKDA 3U36A 4BH8A 1CIUA 2R2HA 1DVFC 1FFPA 2DQIH 1M05B 2IFGA 4GKNA 1G7IA 5DJZB 3NAAH 3V6FB 3DXAE 2H2SC 4UDUA 1G1YA 1TNMA 3BDXA 4QRRE 2HKFH 3CLFH 3JV6A 4FFZH 4UU9A 5JW3H 5KVDH 3ZE2F 3RU8L 4U1LB 1P4BL 3P4NA 4LBEB 1LDPL 2K3TA 4ODBD 4KI5E 1NGZB 3NTCL 3MYJB 1NGQH 4U31A 1E27B 4X7SH 3K3QA 3QG7H 1MFAH 4ZO6A 4XAWL 4JHWL 4HLZH 3O2DH 3STLA 5AEAA 4U05A 4HS3A 5IKCA 5SWZE 5KS9E 1DQQB 4I3RL 2FX8L 4RRPA 1DQLH 4PJ5D 2AJYL 1J8HE 1EBPA 4KZDH 1H15A 3BN3B 3S1NI 1MCEA 4H0GA 3VFUB 1YYLL 1E4XI 1FLTX 1UEYA 2YWYA 4X6BA 5ADPL 4JGMA 3O8XC 4MDIB 5HYSG 5ANMB 4JZNA 4NBBA 3QEHA 4PP2B 3P4LA 3OR6A 2VOTA 2C3VA 4X4ZA 5D5MF 4NQCE 1BBJA 3B9EA 3JWNC 2O5YH 3WHXA 4LHUD 3LRSA 1DFBL 2FNBA 4JM4H 3ULVF 2XTJC 5KAQF 1VPOL 1CICC 2ZUSA 3O3EA 5I8KH 4JFDB 3PIQB 5D7IE 1NFKA 4TUKH 3MRMB 3GGWB 5AUMB 1XF5A 2Y06L 4OT1L 5LJYH 1GH7A 1T7ZA 4QTHB 3ZKNC 1E28A 4ODVL 3R8BB 1X3ZA 2FJHA 4M9PA 3KYKH 2BVPA 1Q94B 4LSUL 1KLGA 2WW8A 1TQCB 2N56A 1JNJA 3S1RI 1MVFA 1HIML 4PFEA 4C4KT 4KY1L 4X83A 1CXKA 5IF0B 2NXYD 3L5IA 5C0EA 4GG6E 3ZTJH 3UPRA 2OI9B 4OIIH 5E2VH 3EYQC 1AGFA 1F45A 4ZS6D 5TE6L 2ADGA 1QEWA 1EVTC 2IPKA 4IMLA 2YD7A 2ICEA 3V6OC 3HC3H 4OM1L 2YC1B 5ABDE 5D7LA 5I75B 1BFOA 1Q9LB 4PRPB 2QQKL 2XQYG 1EEYA 1X5FA 1NGYA 3WLBB 1C5BL 2D9QB 3MUHL 1N59A 4JKPL 4X99B 5DUBA 1MPAL 2SEBB 3U0WL 1NBVL 5HYSA 1QSZA 1BGXL 1X5AA 1ZA6B 4G6JL 2NY2C 3L6FB 5I71B 5B3NA 2HJLB 3GJFB 1OSPL 1RHHA 1T83A 3QCUH 2J12B 3PGDA 2GAZA 1QNZL 2EDEA 2V17H 1UXSA 1NAKL 4HLJA 2OTUB 3VFWB 1EX0A 2FIKA 1G7HA 2D31A 2VLRE 2QBWA 5FKPA 5DFTA 2Y9RT 3LEVH 5JO5A 3GIZL 3WD5L 1HNGA 2HLFD 5J06A 1I1RA 3DRQA 5D6CB 4ZDHA 4HH9A 4XBEH 2LU7A 2RQ8A 1GRWA 4PLKC 2AJSH 2W65A 3DETC 2JB6A 3BN9C 2VL4A 1JCKA 3WMSA 4U0QB 5ILTL 1XT5A 2I9TB 4XPBL 1JBJA 3IFLH 3GMQB 2JB5L 1B90A 2DJSA 3REWB 4TVPE 1HDMB 4PG2C 3MV7E 2H9GB 1M71B 2ATKA 4YBLB 5DFVD 2PETA 5ALCL 1P69B 3HTLX 5DRWA 2ZUQC 4HJ0D 4MNGA 1AKJD 5FCSH 2IADA 1OAXH 1R9TI 3ZKMC 3K8LA 4Y2DB 5I73B 2JJTC 1B3JA 4EN3C 2X4PB 4KRPD 4AEIL 4FXKA 4U1JB 5FUCE 4P46B 4KZEL 1AXSB 3HFML 3VXUD 3KPSA 3HMWH 2D0GA 3TN0C 2HKHH 2NYYD 3QNZB 1K4DA 2X1WL 5C09D 5DD5L 5E5RB 5D1QD 3NCBB 1G7PA 5E6ZA 1UJ3A 2R2BA 4MB4A 1MJ7H 2CUHA 1WBYB 3GTKI 1TDQA 5GSRB 5DI8B 3P0YH 3QI9A 3UX9B 4PGZA 5B8CB 5I1CH 4NBDA 1PGRB 4JVPA 4F33A 1KELH 1WF5A 2FJGB 2XZAL 3ZDXE 1I1AB 3V5KB 4J7RA 1F3JA 3SOBL 3U79A 1IL1B 4OD2B 4K8RD 2LV4A 3VWJB 2ZCLL 3ULSB 5I76B 2XWJB 4NUGL 5DHYB 3KR3L 3QAZB 1S9YB 3RJQB 2IQAB 5ICZA 5C6WH 5IV2B 2VZ3A 2EH8H 5E6IC 3VXMA 4BUHA 5C0DA 2VLKE 2ZOLA 1RFDH 1T0MA 2F54D 3VD4A 2LTQC 4FQJL 3E3QE 4YNYA 4QEGA 2BXYA 2NZ9C 4D0DA 4ODHL 4P2QD 1D6EB 4QYOB 3QG6A 3KGRA 1MCJA 1V7MH 1CFQA 3L5XL 3U7WH 3IDXH 2EC8A 4HH8A 4YHOH 2VDOH 1DQMH 1RIVH 4BXXI 1MCOL 3ZL4L 1R5IA 5CM2M 3CCHA 4GQPH 3BXNA 1REIA 1T7XA 3MRFA 5F7UA 2WIIB 3RKDC 5JMRA 1TETL 1CU4L 2NY5H 5EO0A 2BVQA 1LO5A 4XI5C 2MQ3A 2ZSVB 1ZGLB 3L5WA 4L9LB 3I6GA 4WO4A 3VFVB 4GG8A 4L4JA 3VXSA 1NCWL 1QBML 2A73A 3QEQB 4G8EB 4JN1L 4ZFGL 4QXGL 1KIUA 4Y5XC 4MDJB 1KV3A 4OGYL 1LK3L 4PJ7B 1KPUA 1HHGA 2E9BA 3VI3F 1OQOA 1H9VA 4NQEB 3KJ4C 3EYVA 5EBMA 2IALB 5F6HJ 5GXBB 2NTFB 3HE7C 3QWQB 1UM5H 5IWLC 4GBXB 1FNHA 3GSUB 4RQQB 3NABL 1IGTA 4NNXA 3JTSA 1NCAH 5F3HA 3MRGA 2OK0H 3WL9A 1ZA3B 5C2BH 5TE4H 1YC8A 4XMLL 3VB9A 1KENL 1A1NB 3ZYOA 4CVXB 1G7QA 2UYLB 2DM2A 5CJ5A 1EEZB 5K9KB 3BDYL 4WHDA 1FSKC 2DQEH 3W39A 4MA3B 5DQ9A 4XCNA 2C26A 2PN5A 3DVFA 2OXGA 1Q8MA 1Y6KR 3PL6A 1IGJA 4YO0B 4I4WB 5E99H 5GS2H 5HHME 5DD6A 5IMKB 5EWIL 5GS0H 2NY5C 5ESAB 3MGTB 4WNQB 5FM5M 4KHXL 3DO7B 1YMMD 2FATH 2ITCB 5D8JL 5GRWA 5EOCH 3V2AR 1U3ZA 5GZOD 1K5NB 2HJFA 3P77B 1W0WB 3HKFA 2FSEA 4Y5VA 4NJAH 1ACYH 1EXUB 3TIEB 5BZWB 4WJ5B 1PFTA 1HWHB 1D5XA 1VADB 2DKMA 5FYJE 3GRWL 1JGVL 3QWOB 1PQZB 4I9WD 3W0WD 1RZJC 2E7CA 4JLRA 5GJTL 5EUOF 5FECB 1VACB 4MXWL 3QIWA 1Q9KB 2ESVB 4U6VL 3ARTA 4PPTA 3UAJD 4LVHB 4LU5L 2ADJA 2N7BA 4JJ5A 3MTRA 4KVCH 1H8OA 1QFWM 1LK2A 4KK8C 1MNUH 4HKXA 5HY9B 4KQ4L 1H5BA 1AGEA 4DKAA 3NA4A 2VWEE 2A74B 5DUPH 5IBTL 2V6HA 4DKEL 5L2KE 1DUZB 3IFPB 1OGAE 1KG0B 3VA6A 1P9MA 3T0EE 1I7RA 4Q0XL 5DZLA 1SYVA 1BQSA 4FQCL 1AO7A 1R3IL 4RFEA 4RMSA 3FQWA 4NBXB 1I9JH 5E8OB 4YHPB 5HHPA 5IP9I 5E8PA 3FFDA 3MO1B 5GS0C 4PRNA 3IDUA 3BP4A 3CLEL 1YMHB 3EZJB 1ZVSA 4CW1A 2PW2B 32C2A 4OZFB 3ESWA 4RWHA 3PWPA 1RJZB 3FZUC 1JGLH 4G3YH 2JF1A 4NZUL 3V7AE 5I8OH 4ZQKA 1CDCA 4MSWA 4YR6B 5C08A 1MRCL 1RI8A 4NNYB 3T8XB 1AI1L 1ZT1B 2FZ3A 4J8RB 5DLMH 4F8QA 3RFZC 4J3SA 5EN2A 4R26L 4ELKB 3EO1A 1AR1C 5LGHH 1MEXL 1QSEA 3RUGA 3I75A 5K9QI 1HINH 4JJHA 3SDDB 4Z7UA 4ZPTA 4HCRH 5J6HA 1FN4B 3EOAB 2QHRL 1PYWB 1T83C 4LIQH 1RIHL 1AR2A 3GKWH 2CDFB 4N0RA 3RL1A 3S34L 4DGYH 4OAWA 4JPIA 2BOBA 1DDHA 5JW4Q 4RIRB 1J12A 3WO4C 5L88H 4YUEH 3S88H 4MMXC 1OAZL 3WIFB 1FE8H 2C3GA 2FHFA 3EYOB 4MJIE 1FL6B 3BMVA 3K2MC 4WHCA 2DICA 1SYSB 4AK1A 4B53A 5MEPA 5ACMA 1JPTL 5HHOD 2IQ9H 4G43A 4HAFA 4DK3A 4Z77A 2ADIA 1SVCP 5EU7C 5MI0C 5MEOA 2I5YL 3GMOA 1F02I 2ARJA 4FQHB 2C3HA 2CGRL 1KN2L 4XP5L 2WWKO 1FG2A 3QJHB 4ZTPH 4EUPB 3ROOB 1RHFA 5EU6D 3QO1A 3S1MI 3TA3D 1IGYB 2W92A 1GZPA 1U8HB 2F15A 4PBVC 4JN2A 4F57L 2R1XA 3LN5B 2YK1L 5CEYB 3NPSB 5DURD 3AREA 2FO1A 4UT9H 5D1ZD 3MREA 1S5IH 5I2IA 3ULVE 3SDXA 3BPCB 5ITBL 3WFZA 4KKLC 5HVHC 1WIOA 2GTWA 4M7KL 4JO4L 2E8ZA 3EYUH 3PABB 4PGDA 1LE5A 1I8MA 1IZKA 1UJ3C 2EIZA 3ALWA 2VE6A 3UJIL 2OTWB 4I0PA 2DYPA 4NCC1 3QI9C 5DRNA 2HG5B 1CFBA 4EI5D 1FBIL 1MHCB 3PWNA 5F9WC 1LD9A 3ILQC 2GSGA 4Q7DA 1NCDH 1G7JA 4N8VB 3UBXI 4CL7A 5CJBA 3HCVB 5JQ6L 5IM7B 2X4NB 4J3WA 1A4KA 4JM2A 4OKVA 2EYTB 1G6VK 3Q0HA 1L7IL 2DD8H 1IKFL 4LRNL 4W6WB 1F4YH 2R8SH 3T4YB 2NZIA 4TSCH 1QBLH 3W5MA 4EEEA 3DXAD 4FG6C 5FDWA 1T80A 3O4OC 1ADQA 2LAAA 1Q9OB 4ZYKA 3EBAA 4X4YB 1EEUA 1I9RL 3KYNB 5JW4N 3RGVA 4RAVB 5E9DE 2RJMA 3ULUE 4HGWA 1MFEL 4JFFE 4WY7L 1N6VA 1V5JA 1DR9A 2R9HC 4MJ6A 3U1SH 3WNMA 5DJ8A 5DGQA 5FYLL 3MACH 2AI0H 5DMKA 4ERSL 4ZAKA 3DJ9A 1GGBH 1P2CB 4PJGA 3H3KA 1ZT7A 1Y18A 2YD2A 5T3ZL 2B1HH 5GJSL 5DQJB 4G9FE 1DLHA 5DMIL 5DRXB 3GMPB 1LE9A 4OZHA 2NTSP 4PJFB 2WV3A 4M1CC 4N0UB 4U1MA 2IJ0C 5IB2B 3DLQR 3K4AA 4O2CB 2CLZA 4HPYH 1B6DA 2FJFB 4BK4A 3RHWK 4P3WA 4WO4C 5KBNC 5TQ2H 5ESQB 4ORZC 3ZLQC 1LEGB 2YU9I 2JLLA 3FRUB 4NQCD 4JQXA 1U3JA 3EDJA 3RDTA 2YHGA 3D69B 5DK3A 3MJ7A 3IDYC 1E6OH 2R0ZL 1OT2A 2XQYK 1CDYA 1UH3A 3U0TB 3K1DA 2YUZA 1D9KD 2ZP0T 2X1XR 3IDMA 2DAVA 2EXWD 2C1PB 4X8JA 1OP5H 2UZYB 5KG9A 1EAPB 4WI3A 2BZDA 1EFXA 5IMLA 2E6JA 5IFHL 4WGVB 4FFWD 4HQQL 2AXGA 3M3YI 4QCIB 4YPJA 1BWWA 4Y19A 3ZSTA 1XGPB 4JPWH 3GO1L 1GGTA 3SCMA 1T1WA 1S9XB 4JG1H 4WU5A 1J5OL 1XGYL 3WUWB 4UV7H 4KUCD 4R90H 1JGUH 2ITDB 3H8NA 1G7MA 3G5YA 1XIWD 1YUHB 2Y25A 5HSFA 3PL6C 2VB5A 5BQ7A 3TWCL 1MUJB 4NBAA 4ONOA 2C3XA 5IB5B 1HOCB 4PRHE 5T1LB 1AQDA 2M26A 3IETB 4WFGE 4L4TB 1BX2B 2AJZB 5DD1H 3EOBB 5C0CE 4LLDB 1P5VA 5L0QB 4RGOH 2AGJH 3H9YA 1CXFA 5CJOL 4Y5VC 1RSFA 3RGHA 4BBSI 3LEYL 2AJ3B 3FHAA 5HI3D 1OSZA 3ORJA 4LAJH 3BZEB 2K9UA 4H0IA 4X7DC 4MQXD 3T09A 3D0LA 5F7NC 4XX1G 3QXAB 4P2CG 3IJYB 2NY4C 4BFGA 3IDGA 3MFFB 4KTDH 3QIWC 4OFIA 4FXGA 1EJOH 1GHFL 3W11C 3FN3A 5JIKA 2G5BA 3QJFA 1QFUL 5E95B 4J3UA 3F7YA 1MREH 4L4VB 1MH5B 1NGWB 3MRQA 3WJJA 4LSSL 4U6HA 1U8OA 3P9MA 3QR2A 4OF3A 1ORSA 1NMBL 1CK0H 4Y0GA 4OZ4B 1H5BC 4FN0A 3UC0L 1JF1B 1PG7H 1FVDB 5B21A 1S7TB 3PUCA 4Y4KB 3HZKB 2F58H 4X9GA 5H35A 1AXTH 1KPVA 1LO3L 4NDMB 4XAKE 1P9MC 5IW3A 2MJWA 2Q8AL 4GAGL 1SY6A 4KKAD 1QHOA 2ARJQ 2KPNA 2VDLH 4QXTB 4ZODA 1IE5A 1IGMH 1UFUA 3G9VA 2DLGA 4HV8B 1O5DT 1JWMA 4XHQA 1WZKA 4HEME 1S7WB 1CXHA 5CHNB 1J9CT 1EGJA 3DUSB 2IG2L 3GSQA 1R5WB 2VDML 1UENA 1GIGL 2BJML 3WS3A 4JCLA 1X5HA 2QL1A 4KMTH 5I1LA 3D87B 4WHTA 3LS5H 3WN5A 3FB7B 2MQ0A 4J6RH 4KQ3H 2P46B 1M05A 1KNOA 1LQLA 5DJZA 3V6FA 4WCYH 4BYHA 4ONGL 1KCVH 4GRWE 3TO4B 4XNXH 4Z95L 3EDDA 4LARL 4LLAA 5EPMB 3B9KB 3RWCB 3SY0A 5ISZB 4LBEA 1NGZA 5T33H 3MYJA 1E27A 3BIAX 1JPGB 2OL3L 1FAKT 1EMTH 4DUWA 2V2XB 3BPOB 3OWEA 5BS0E 4G6KH 4JDTL 1KCRH 1QPXA 2NVYI 3VFUA 4M1DH 4N9GB 5IVXE 1WTGT 2NMSA 4LVNB 1ONQA 1FNAA 1J0HA 4TOYL 3UCRA 4RA0C 4QXWA 3KPOB 3UTSE 4KH2A 1OP5K 3K81A 2V2WB 5ANMA 4POZC 3O3BB 4PP2A 2A9MH 1TENA 2KH2B 4NQVA 2MHAB 2GT9B 1OCWH 4CDGC 2OL3B 2XICA 4RMQA 3LZFL 4XCCL 2QQQA 3BAEL 1T5WB 4JG0H 1DCLA 3HZYB 3O2WH 1WBXA 5EU3A 1EO5A 1I1YB 3IAGC 5JXED 3PIQA 4XNUH 2BNQB 4QLRA 3MLWH 5D4QA 2UV3A 3GGWA 3IU4L 5AUMA 1LDSA 4FTVE 4TUJB 2J4WH 4Q2ZB 2OCFD 3AREC 4QTHA 4Z5RB 4R0LB 2XXMB 4P5TD 3NGBC 3RUGF 1K3ZA 3SDAB 1Q94A 2V5SA 1ACZA 4Z7UF 2VMFA 1BJ8A 1RUPL 4NPYB 2XN9E 3BKML 3T3PF 4YQXH 1VEPA 3T2OA 3L3IB 3E6FB 3F12A 4DN3L 5SWSB 2E3VA 4I0PC 5DC9B 4K3EL 3ARXA 4M6MH 3V8OA 4JFED 3SKNB 2LU3A 1JHLL 2YC1A 4G6MH 4KI1A 5FB8B 1Q9LA 4PJ8D 2MPAL 3W2DH 1QOKA 4JB9L 5CSGA 1XFPA 3MLPA 5KANI 4ENEC 5I15H 4JM2C 1ZTXH 1GL4B 2PW1A 3TNNB 1T66C 3GM0A 4MQSB 2X70A 2SEBA 1W72A 5FYKU 2AK4B 4BELD 1JZ6A 1ZA6A 2RGSA 4NOBA 3L6FA 1HH6B 5DDHA 3LIZL 1NUNB 2HJLA 3GJFA 3QFJB 5ETUB 4LGSB 3KJ6L 2NW3B 4QXUL 4LRIA 1HHKA 4ALAH 1U8QB 3KLSA 4XNYL 2HT2D 2OTUA 3VFWA 5GRJL 1EZVY 3RGVC 4PLJD 4HBCH 4ZOEA 4D9QE 2F9BT 4OZIB 2PK7A 3HMXH 2G75B 3BUTA 3SDXF 3KPRE 4G8GE 4ZXBD 4YXHH 3M4OI 4N0CD 2AQ1A 4X6AI 4N0YL 4HIJB 1NC4D 4LSQL 4C59B 1FO0L 1AP2B 5EC2B 5F6IB 2P5WA 4LCWA 4YZFE 4NHCL 5LGJB 2CPCA 3GMLB 4M03A 3REWA 2I9LB 3QXVA 1FNEB 2H9GA 1SBSL 2DLFH 2BSTB 3CZFB 1M71A 4XPGH 4U33A 4H8WL 4M7ZC 1C5DB 3BI9X 1QD0A 4P23C 1WWCA 3LKPB 2F8OA 4FZEH 3KPPA 4JQXC 1ZWIB 4Y2DA 1ZHKB 2FCBA 3RDTC 4DGIH 4JM2F 2H1PL 5J1TC 2F4OA 3LQAL 1QHPA 1FO0B 1S5HB 2X4PA 4U1JA 4F58L 1AXSA 5IUSA 5D70H 5D7LE 2E27H 1KPRB 4P59L 3KLDA 1RD6A 3UP1A 4NKIL 2ZJSL 4MCZB 4PREB 5MP6H 1AGDA 5JZ7D 4LGPB 3X13B 3WE6B 3UTZA 5GSRA 5DI8A 2GJ6B 4QOKD 5DTFB 3CSPA 2CDEB 4KAQL 4P2RB 4Z6AT 4N5EC 2FJGA 3SCMC 1FNFA 4XB8A 2JCCE 1I1AA 4O00A 1OPGH 4YDIL 3V5KA 4PJGF 1IL1A 4OD2A 4ZSOE 3VWJA 5E08L 1P7QB 4XVUD 2YKLL 3ULSA 5I76A 3KYMB 2DQGH 2XWJA 1ETZB 1SY6H 5DHYA 3GHEL 5CJ8A 4OZHF 1S9WA 4NP4L 1TITA 4V1DE 2IQAA 1A3QA 4RA3A 3NVQA 5FYKH 5IV2A 1FIGL 1BJMA 5DR5H 4EBQH 2R69H 1MI5B 2ZKHH 3TBSA 4F9PA 1EGJH 3I4MI 3MRBB 3U30C 3BGMB 3QXDB 4FQ2H 2J8HA 1FAIL 1FLRL 1QLFB 2WNGA 4X6CE 5BV7C 4X5XB 1D6EA 4K3DL 2J2ZA 3B9DA 5F7MC 1KB9K 5IGXH 1LO0H 4KJPC 1RK1B 4PGEA 1WBZA 1OM3L 2KQNA 2P8MB 4HD9A 1FZKA 3MROB 4ETQB 3BT2L 1KLUB 3MXVL 1G7LB 1MLCB 3QQ4B 3BZ4A 4WUUB 4GRLD 3WJJC 4MJID 4L5FH 1KGCE 3OJ2C 1JGEA 3KS0H 2P4AB 2ZSVA 1ZGLA 1MSPA 1DBAL 4L9LA 1ZKAA 4NZRH 4I8DA 4P2OD 1WCBB 3X12B 4FQPA 3WFDL 2VDPL 4G8EA 3NACL 4MZ2A 4X9HA 4QTIH 5FUZL 3VXRB 1UZ8B 2X40A 1ZSDA 1E0OB 3FQTB 4KROC 4PJ7A 1F6FB 3EIFA 4NQEA 3P9LB 2IALA 3BP5A 3RU8H 2P5ED 3LKQB 1P4BH 4RX4D 1LDPH 5EU5A 3RTQD 4P0DA 4GBXA 3NTCH 3TZVB 3O9WD 4IJ3B 1GJIA 3K7UA 3KXFD 3QEGL 4FXLA 4RQQA 3ULVD 4JHWH 1DVFD 5SWQB 4GKZB 1ZA3A 4I3RH 2FX8H 5JW4M 3WN5C 1A1NA 2A0LC 4CVXA 5C92A 5ID0B 1B4JL 3VXME 2ICWI 3QDGB 2UYLA 1FNLA 2AJYH 2H2SD 4GW1A 4ZUWA 1QKZL 1HHJB 3RAJH 1VDGA 3GI8L 5K9KA 2X09A 1YYLH 3WIHA 1Q72H 3REVA 1AQKH 2ZUUA 4MA3A 3HI1B 3NCMA 4ESKA 3ZT5A 5ADPH 1J1XL 3JBG7 3O81A 4OZFG 1HKLL 3TIDB 5CILL 5IMKA 5BRZE 2CQVA 4L9DA 5EIQA 3RVWC 1TZHB 5ESAA 5JOFB 3MGTA 4WNQA 2GTZA 3WNLA 2P3YA 1CYGA 2EH7L 3DO7A 1DFBH 2OX5A 4NZTL 1K5NA 1W0WA 3HNSL 5ACZA 1VPOH 5LWYL 1EXUA 3TIEA 1X5ZA 5BZWA 4WJ5A 4EDXB 3QDJD 2O61B 4FS0A 4U2YA 2Y06H 1NGXA 4OT1H 5FCUL 4K07A 3O8XD 3A6CL 1PQZA 3RNKB 2X4QB 5LCVL 3T0XA 1VACA 1I7TB 1Q9KA 2Y6SC 3BQUA 4LSUH 2ZPKH 2ESVA 1HIMH 4KVNL 1TTFA 4KY1H 3WKNA 4IOIB 2XTJD 4QHUB 1CICD 2FL5A 5HPMB 5HYIA 1W72H 4U1SA 1XH3B 2Z0BA 2DBJA 4F80A 5HY9A 1KT2A 4DUXA 3CPLB 3GJFH 5J8OA 1KXQE 2A74A 3GRWA 5TE6H 1JE6A 1CGTA 3QHZL 3ZKND 3IFPA 1KG0A 3B9AA 4OM1H 2DN7A 5FF6B 1A3LL 1M7DB 2P7TB 3VMHA 5E8OA 4CN4A 4YHPA 4TPRL 2QQKH 1CQKA 3MO1A 3GSNL 1C5BH 1YMHA 3QDMA 1K4CB 4JKPH 2PW2A 1MPAH 2NQCA 4OZFA 1NBVH 3MLXL 1RJZA 4G6JH 3EYQD 4HPOL 4WFFE 4PGCB 3T3ME 2OI9C 1QNZH 4G6FD 4EUPG 1NAKH 5LQBL 4EIZC 4O5LL 4NNYA 4XCFL 3GSNB 3WD5H 4MQ7A 4J8RA 2CUMA 5I75C 3OBAA 5FV1L 4ELKA 4HS6B 4JREC 1I3UA 2PYEB 2VLJE 2NY2D 4CNIB 1MIEL 5A2KH 3MOQA 4MAUL 2PXYB 4PGBB 4XH2B 5ILTH 3O3DB 4HG4J 1M7XA 4XPBH 3SDDA 2JB5H 3FO0L 3BJLA 5J12B 3QZWA 3GK8L 1FN4A 3EOAA 4KV5E 1PYWA 1NMAL 2CIKB 3MV9B 4LRIC 4OGZA 4XP4H 3W81A 5ALCH 4MNQE 1NKRA 2CDFA 4TRPL 4PRHD 4R96B 4WFGD 4RIRA 3ET9F 4UUJA 1A7BA 4PLKD 2E9WA 5CD3B 3ARGB 4N8VG 2KL6A 3DETD 3F6LA 1UQSB 2ZWLT 3BN9D 3WIFA 5JA8B 4OD3L 3EYOA 1FL6A 4AEIH 3BVNB 4KZEH 5ITFA 1SYSA 3HFMH 5D9SB 2XWBB 2NVXI 3OKLB 4YAQB 5DD5H 5LGKA 2H45A 1MWAA 3CXHJ 4NKOA 1A6VH 4B7IA 1TZGL 5HYEA 4Y16B 1AH1A 4BZ1L 2R23B 2XY2A 5TH2B 4X5WB 5D96B 4YBLC 3ZKMD 4Q9QL 3QJHA 4WI2A 4QHKI 2D03L 3ROOA 2XZAH 2I60L 4EN3D 1IGYA 3BP7B 3LN5A 5CEYA 3UYRL 4MQTB 3SOBH 3FT4B 2OR8A 4OF6A 4UQ3B 3TN0D 4Y2DC 3E2HC 2ZCLH 5I73C 1F2QA 5TPWL 4NUGH 3BPCA 3KR3H 4NQDB 1DUYB 5IK3B 4OCRL 3S35X 1NDGB 1T6WA 4OFKA 4XAKD 4HZAA 3PV6B 4BQ6A 2ENYA 3GMRB 5D2NE 1ZHLB 4PJEB 1QSEE 2GIYA 2FECI 4FQJH 2NW2A 1GOHA 1JNHA 3WJLA 2OTWA 4QRUB 1PKOA 1V3KA 4L1DA 4PV9B 4OQTA 2DTSA 3K7AI 1MJJA 4MB3A 4ODHH 1U58B 4Q6IB 2HG5A 1MHCA 2QSVA 1I1AC 5GSVB 2BCKA 4TQEL 1CS6A 2JE8A 4N8VA 3VWJC 5HTSA 5IHLB 4I18B 5IM7A 4IM8A 4NO5B 2X4NA 1MCOH 5E6ID 3ZL4H 2EYTA 3IU3B 2QSQA 3QAZC 1S7UB 3HB3C 3T4YA 1TETH 1AIFB 1CU4H 3C5ZA 3STBA 4M00A 4F9PC 4JRYE 2XPGB 1Q9OA 3BX7C 3V79C 1CT8A 4X4YA 3UZVB 1NCCL 2D7TL 2IFFH 4RAVA 2NY1B 3GMNB 1NCWH 2AXJA 3WUWG 2AK1H 1QUNA 3FJTA 4QXGH 4ZFGH 4U6YA 4PIRF 4S1RL 3OKYA 1LK3H 3FQXA 3RKDD 4HIHB 1P2CA 2UY7A 1L6ZA 4I2XA 4M48L 5DQJA 5DRXA 4CVZB 3THML 4PJFA 1IM3B 4XI5D 4CADB 1I3VA 3V8CA 4F7MA 4N0UA 4Z7OE 1Z9SA 5IB2A 3NABH 2XZZA 3LHPH 4O2CA 2FJFA 5C0AB 4UT6L 3UTSD 4XMLH 4L9LC 1KENH 1BZ7B 1CD0A 2DQJL 5ESQA 1F3RB 1F13A 5F3BB 1LEGA 1IGCL 3EW3B 3TLRA 3C5JB 3FRUA 3BDYH 5JUEL 3NIFF 2OP4L 4G8IB 4RFNB 4Y8DC 1C7TA 3SQBA 5JPNB 3D69A 3X14B 3HE7D 5I1IL 2YEZA 3AAZB 1VA9A 1F8TL 4PB9L 5I74B 2DKSA 4RWYL 1A7PL 4E9LA 1PKQB 5EWIH 2PF6A 1MFDL 3SE9H 3U9PL 2H3NA 3T0BA 4KHXH 2C1PA 3A67L 4GBXC 5D8JH 5JR1L 2BC4B 4BUGA 2VUOA 3VD9A 3I6KB 5E00B 3BW9B 3RY4A 4J23A 1EAPA 4HIIA 3BISA 4NBFA 3V6BR 3H42L 1VGEL 1XGPA 1RQ5A 1ED3B 1ZLVH 4M3JA 1S9XA 1JGVH 3GRWH 1J0JA 1D5MB 5DJYB 2JJUA 5FLMI 3HLAB 3WUWA 1H8SA 2ZG1A 1ZANL 5GJTH 1OARL 4LLMB 2DOCA 5I19L 3F8UB 4MXWH 1NLDL 1MUJA 5BZDB 5IB5A 1HOCA 2COQA 3IETA 4LU5H 3G08A 5JDSB 3RX8A 4L4TA 1BX2A 5ICXB 1UM6L 1N5YH 4MA7H 4LLDA 4OZFH 3W9DB 1HSAA 1E4JA 4Y4HB 4ELME 1QRNA 1L0QA 4NFDA 3O6FB 5I1GL 3CFEA 1HQRB 5TGBB 4EOWL 3GHBL 4ODWB 5F7LB 4Q0XH 4LCCB 3BZEA 3R4DA 1P7KB 4PJ7F 2UZIL 2NNAA 3QHTC 1WAAE 4PJHE 4P2YA 5I18L 3IJYA 4HKBA 1RJYB 3CLEH 3BQUC 4MJ2A 2C9AA 4KK8D 4IBLT 4D9QD 5FXCH 2W0FB 2XI9A 4L4VA 1MH5A 3L3GB 4NZUH 1NGWA 1RZGB 2WK2A 4M61B 3TH3T 4PR5B 4LSPL 5C0GB 1BWMA 4X8XA 4NQUA 4OZ4A 1MRCH 1CD1B 3SPVB 1S7TA 4Y4KA 3TH2T 2XZQL 3HZKA 5GS2D 4WWKB 4RGNB 3WS6A 4HS8L 1EHNA 5CLTA 1AI1H 5GS0D 1IFHL 4KUZL 1FORH 2CUIA 1T2QL 3O2VL 4YE4L 4QXTA 4LKXA 4R26H 3A0OA 3FZUD 2WZPD 1EFQA 5A2IH 1NAML 4R9HA 1MEXH 4HV8A 1KTLB 4Q9CA 4OFDA 1S7WA 5CHNA 3DUSA 1R5WA 5L8KB 1DBJH 1S7RB 4YHIA 4HWZB 1I4FB 2QHRH 2Y4SA 2EYSA 1MWAH 1RIHH 1I6HI 4AIXA 4DKFL 2GY5A 3S34H 3BZDA 4U49A 5D7LD 3FB7A 4X4XB 5HGDB 1GYAA 1AR1D 4U6TA 1NAMB 2NY3C 1G1CA 1OAZH 3DVGA 3U9UB 3LKRB 1AGCB 1K8IA 3L7FB 1EAJA 5GGTL 2QEJA 3I6LE 2P49B 3TJEL 3QHFL 3TVMA 3TO4A 5E8EB 4F15B 5ISZA 1B0RB 1VFMA 2X1OA 3SDDC 1MAKA 2I5YH 5LXGL 2H8PB 5L7XH 2CGRH 3MLYH 1JPGA 1KN2H 4JZJA 4JCMA 2B4CL 4EVNB 3B43A 4TTDC 2OSLB 3RVUC 4V1DD 2V2XA 3P3YA 1SJEA 4F57H 3V5DA 2YK1H 5DC4B 3S97C 5C4XI 4N9GA 4IRZL 5E0QA 4N1HB 4M4RA 2OMBA 3Q3GB 5ITBH 5I1JL 5FM5O 4BQBA 4PV8B 5C8JA 2V2WA 4M7KH 3MRDA 4JO4H 3O3BA 1QVOB 3UDWA 5E1HB 2MHAA 2R39A 4NRZB 4GUPB 2OL3A 1JZ5A 3KYAA 2B63I 1T5WA 3UJIH 3HZYA 3PHOB 1ZLVK 4BKLA 4PB0L 1I1YA 5F7EL 2BNQA 1UCTA 3WFBL 5DO2D 4GMSL 2JA8I 1FBIH 3VFSB 1J0ZA 4TUJA 3ARWA 4KKLD 3NPSC 4LCIH 4Q2ZA 3KPSD 3OXRB 4Z5RA 2MKLC 1T1ZB 1LILA 5JQ6H 4NSKB 3BEWB 4DZBB 5E8DL 4IS6A 3QFDB 5ID1B 3HC0B 1IKFH 4LRNH 4NPYA 3DECA 1FYTA 4R97B 1OVZA 3MZGB 2AJUL 4CBPA 3L3IA 5SWSA 3WJLC 3U2SB 1I9RH 3ILQD 5CJQL 1XF2B 1MFEH 4WY7H 4QNPE 4Y2OA 3MRIB 1FNSL 3SKNA 1YDPB 4OCSL 1YUAA 3SDCB 4MX7B 5FYLH 1AHWB 3TC9A 4WWID 1HH9B 2VDRH 1KUMA 3STZB 5T3ZH 1JP5A 3VXMD 5KSUB 4ISVB 5GJSH 5DMIH 1INDL 1BECA 1WQVT 4MHHI 1UXWB 2AK4A 1HH6A 3RWEB 4J4PA 3C5ZC 3QFJA 1G9NL 2NW3A 3I2CH 3OKOA 2R9HD 1U2CA 3H9SB 1FZOB 4PGJA 1ZLUH 4LF3B 3MRJA 1FYHB 1NBQA 1PZ5B 5JHDB 2ATPB 5KSVB 1TLKA 1IVLA 2G75A 1JPSL 1U92B 4LEXL 1FFOB 3EOYG 2R0ZH 4M1CD 1MCDA 3TP4A 1NEUA 1A7OH 4JRXA 3GTPI 2HJKB 3T4AB 4K3GA 2Z92B 4NYLB 3RPIA 1R24B 1CG9B 5E5MB 1AP2A 3D3VE 2FLRT 2JNYA 5EC2A 3MOBL 4WO4D 3AVEA 5LGJA 2DM7A 1JRHH 3GMLA 2I9LA 1FNEA 3BGFB 2PTUA 3LQMA 1FNGB 3VXSD 2BSTA 3CZFA 4PJXE 4HQQH 1AKJB 3O4LA 3ZE1E 1C5DA 4PJCB 1IAIL 3GO1H 4Q9BA 3VFGL 2X41A 1P1ZB 3CFIC 3VGDA 4XVJL 3WEXB 1XGYH 4S1QL 3VXUB 1ZWIA 3CVHA 1ZHKA 3CX5J 3OKDA 4HUVB 1FO0A 2OBGA 1S5HA 2CR3A 4YHKL 5C09B 3MBEB 4AQOA 2GW5A 1U91A 1YEKL 3EJJX 4ZTOL 1KPRA 3VGHA 1Q0YL 4MCZA 1X5XA 2MSPA 4HFUL 4ONFL 4PREA 1L4IA 3B83A 3D2UA 3ZKQD 4XWGL 1J1OL 4MB5A 5CJOH 1TWHI 3Q87A 2BNRE 4ODXB 4MZ3A 2GJ6A 1FFNA 3TYFB 1KN4H 2CDEA 2X4OB 3PQYA 4P2RA 1W0VB 5GGRB 5KVFL 3ARFA 3PL6D 3QUML 3HI5L 3VGAB 3G6JE 4QHLB 3TYGL 5FHAL 3LKSB 1RZ8B 1P7QA 2DQHL 4JAMB 3KYMA 4JE4B 1ETZA 1FRGL 4PJFF 1BHGA 1QFUH 4EXKA 1S8DA 5F1IB 2F54B 2FEEI 2OR9L 3FTGA 1OB1B 4LSSH 3VCLA 4GKOA 1PFCA 1MI5A 1NMBH 4F2MB 5L0QC 3MRBA 3L1OL 1WICA 3BGMA 3UC0H 5MENB 3V0VB 2A83A 2P5WE 4LCWE 1YY8B 4PTTA 1OTUC 4UQ2A 1LO3H 1QLFA 3C87A 4TNWK 2Q8AH 3QIWD 1WK0A 3B2UC 4X5XA 4GAGH 3W11D 5HI5C 3VXOB 1NEZB 4JFHE 4NKQB 1RK1A 3EYSL 4J2XA 5CEXB 4H0HB 2VZOA 2DRUA 3MROA 3S16I 2R0KL 2IG2H 2VDMH 5DT1L 3O45A 1F4XL 2BJMH 1CZ8H 1MLCA 3QQ4A 4WUUA 3VGGA 2HFGH 4QRQB 2CIIB 3UO1L 3EKCA 5F72S 3DIFA 1AO7D 4MD4B 3QIUD 5IW1B 3NCYS 4LLQB 5GGQH 4Y4KC 2VSCA 3WS6C 2AXFB 1ODAA 1WT5A 2Q3ZA 5EUKB 4NT6B 1X5IA 4LNVA 3VXRA 1UZ8A 3TT3L 4UAOB 5CEZL 4DFHA 3FQTA 4ONGH 2W60B 4C55A 2ICWB 4Z95H 1NANI 4Z0XB 2G60H 1DBBL 3BPLB 4GXUN 5F7WC 3LKQA 5C08D 5C71A 4PJBB 5IR1B 4GO6B 4UNUA 3TZVA 1ZLUK 1I7UA 2ZCHL 4WI8A 3VI4E 4BY1I 3QCTH 2OL3H 5SWQA 3MNZB 4E42B 1MCCA 2AEQL 5ID0A 2HWZL 1R0AL 4JDTH 1R5VA 1KYOK 3KLAB 2VH5L 1QSED 4EI6A 3V4UL 3HI1A 2DE6A 4TOYH 4A3CI 3HG1B 3TVMC 3TIDA 4Y5YB 4X5LA 3TO4C 3RRQA 3D25B 1QSFE 3P30L 4OLZL 5JOFA 1EUUA 2B1AL 1XF1A 4NQXA 1UYWL 1JZ4A 4Y4FB 4CMMA 1CR9L 1BQHB 4JZJC 1OT1A 3G5XB 5DS8B 4EDXA 3D85A 3BPOC 2O61A 1QLEL 3W0WB 2DQCL 3OB0H 3IU4H 3F5WB 5C07E 2JKXA 5ADOL 1JZ7A 4POZD 4FQQB 5IMOA 1HZHL 2X4QA 4LVNC 4G7VL 1I7TA 4Z78B 1Y1VI 4LOUC 1U3YA 3KDMB 3KPMB 6FABL 1RUPH 5B4MC 2F53E 3UDWC 3MV8B 4IOIA 1NBZA 2WUBL 5IQ9B 1XH3A 4WUKL 4A2LA 3QO0B 3CPLA 4GAYB 3DARA 5IB1A 4E41E 3MCKB 3KLHC 3ARED 2D0FA 4I48B 4QRPE 1JHLH 3WHE0 2VXSH 3EGSB 5FF6A 4OF5A 3FT3B 1M7DA 2P7TA 2CR6A 5BW7A 4HW6A 2MPAH 4BA8A 1BMGA 3GJEB 3MYZA 3WNKA 4JB9H 5JW4R 5T1MB 5EZIL 1M4KA 4ONHA 5FA4B 4FFVC 1WSST 2A9NH 4I0PD 3LIZH 1HNFA 2ERJB 4PGCA 5K9OB 4XBPB 4C58B 4GW5B 4XNYH 4IHOB 3D1MC 5SX5H 5EO9B 1SMAA 2VITA 4ENED 2E2JI 1UACL 4JM2D 1T66D 4X80L 2BDNL 5F7YC 3H7BA 1RZKL 2YUWA 4N0YH 4HBQA 4CNIA 4OCNC 3CVHH 1QRKA 3BSZL 4M93C 2PXYA 3LN9A 4PGBA 4XH2A 1FO0H 1RJLA 3F7VB 2ILLA 5DJCB 4LPVA 4NHCH 2D4FA 5AYQA 4YHYC 4NBZB 3MUZ1 3RGVD 4MLSA 4J4PC 1SBSH 5DHVB 7FABL 4H8WH 1U9KA 2HRLA 2HVKB 2K5RA 2IANB 4R96A 5JORB 1QFOA 2H2PC 4QHNA 3I9GH 5FA3B 4L3AA 2JK5B 4Y1AB 3WNNA 5CD3A 4KDTA 3ARGA 4HK0B 1FGVL 3VDBA 1S7VB 5HHOB 1UQSA 2H1PH 4YBQC 3LQAH 5GIRA 4F58H 2EDTA 4WW1B 1IJ9A 2XWBA 2IH3B 3FMGH 2BERA 2CKBL 4YAQA 4P59H 2PCPB 4NKIH 2ZJSH 2E6QA 4JPKL 1YJDL 2RCSL 1WZLA 2Y72A 3VG9C 2Y07H 3QQ3B 1S7SB 3N9GL 1YEJL 4P23D 4Y16A 4L8DA 3MLZH 3QDME 1S7QB 1M1SA 2R23A 2ZUVA 1UEMA 4UT7L 3BYYA 3WLWC 4IMKA 1DL6A 1JNNL 4KAQH 2OTPA 3IXAB 5D1ZB 2E7BA 1PEZA 5J0BA 1LHZA 4YDIH 4MS8C 1YA5A 5F97E 3FT4A 2KBGA 5BXFB 2CKBB 2YKLH 5M7QA 1JV5B 2AEWA 3GHEH 2K7QA 1A5FH 1U93B 4NQDA 1DUYA 5IK3A 2VZTA 3ZE0E 2CLVA 1NDGA 5J56B 3PV6A 1EFXD 1FIGH 3GEWB 3IKCB 4LP5A 1X7QB 4H8WC 3GMRA 3GDBA 3K4DA 4WV1B 1ZHLA 2YPKB 4PJEA 5IEKB 4KMLB 1BD2A 2EDFA 4N5ED 1CN4A 3OB0K 3SCMD 2UZXB 1DSFL 1D6VL 4QRUA 3I02B 4PV9A 5EOTB 1FAIH 1FLRH 4AIZB 2ED9A 4NO0B 2NX5E 1NDMA 3ARFC 3LQAC 4K3DH 3UTQA 5GSVA 3C60B 3NIDE 5IOPA 1QR4A 4I18A 3WIIL 1MCPL 3IU3A 4U1HB 1S7UA 5C0JB 3BT2H 3DXAB 5C0RL 3MXVH 1AIFA 1BJ1H 5H2BB 1K3IA 1MFBL 1DLFL 5CBAB 2VSDA 2XPGA 4NM4L 1DBAH 3VXNB 2K1MA 3DGGB 1YEDA 4GW4A 4W6YB 5IVOA 5F1NA 3RVVC 1UCBL 4KJPD 3C2AL 4JRWA 3WFDH 2VDPH 3NACH 3MLTB 5SWZB 4NJ9L 5HD8C 5KS9B 4UOW1 3OAUL 1I3RA 2DB8A 3SKJL 1TPXC 3F58L 4A2MA 3E1F1 3OB8A 2O5XL 3U7AA 2W07A 1DEEB 1L9NA 4PJ5E 4G8FA 5DJDB 1GOFA 4CVZA 2HTLC 2A6JB 3NA9L 2VZVA 1N0XH 3QEGH 5SX5K 2HH0L 1M7IA 2P47B 2XT1B 4N5UA 4NQCB 3PGCB 1BZ7A 1B4JH 4K23L 2XV6B 3ARSA 5JW5A 1IAOA 5F3BA 1QKZH 1RUKL 3IGAB 1WT5C 2IMMA 1AGBB 3C5JA 3GI8H 5KSBE 5GISL 4JFXA 5FYKD 4G8IA 5EIVA 5D7IB 2A6IB 5CZVH 1X5JA 3GSVB 4RMRA 5SX4I 3X14A 1A2YA 3AAZA 5I8CA 1J1XH 1XCQB 5DF0A 1QQDB 5CILH 2DKUA 5EFIB 2X6MA 1TWFI 2F5BL 2FR4B 1MY5A 2EH7H 2WSKA 2VISB 2BC4A 3TZVC 1IZJA 3I6KA 1G9MC 2CK0L 3NIGE 1MFNA 3BW9A 3QIBA 4IJ3C 4NZTH 5E00A 5ERWB 4B50A 3HNSH 5GZNC 1BZQK 4C56E 4HWEL 4GG6B 4ZNEA 1VSCA 4D0BB 1NH6A 4PD4J 5FCUH 1IBGL 5DJYA 3A6CH 3EUUA 2FGZA 5TE7L 1A6UH 3HLAA 5J11B 2R0WL 5LCVH 3RVWD 4LLMA 1Q1JH 3FO2B 3L9RB 2YSSB 2C1OB 3O3AB 2L0DA 4KVNH 5C0NC 1UVQB 5JDSA 1A1MA 5ICXA 1EEQA 3QUKB 5C3EI 4I2XE 4OGAC 4Y4HA 4ZUSB 1N5AA 1LWRA 3W5NA 1GGUA 2AEIT 2FX9L 3QHZH 3O6FA 4JQIL 5IW6B 3HRPA 5TGBA 4YX2L 1A8JH 4DKDC 1A3LH 3R1GL 5I17A 4TVPL 5A1AA 4TPRH 1AFVL 1U3HA 2VLRB 3GSNH 3U6RA 5F9OL 3NFPB 1MHPL 1RJYA 4CVUA 4KRLB 5E4EB 1Y1VS 3OF6A 1LQSR 3HA0A 1RULL 3MLXH 3GNML 1TJIH 2W0FA 4EJ1C 3FFCE 5F7FA 3L3GA 4X7EC 1RZGA 5DJ2B 2WINB 2V7NA 4Z7VE 4PR5A 5C0GA 3IVKB 2X4SB 1JN6A 3BRFA 4LVOB 5GGVY 1WEJL 5CZKA 3SGEI 5LQBH 1A7RL 2GK0B 1CD1A 2UWEA 3SPVA 3MV7B 2XFXA 4O5LH 3RVTC 4WWKA 1A9BA 4JKKA 3GSWB 3HNVL 4LNRB 4U3CA 2EDXA 5BW7C 4G9DB 5I1DB 3WXVL 3KAAA 3CK0L 1OD9A 2J8UB 3ARZA 4R2GB 1EHXA 1MIEH 4MAUH 3PE9A 5FV2A 1HILB 1KTLA 4FABL 5EORL 2M8XA 5D7JB 4I3SL 4Q9RL 5B3JE 2QQNL 5E8NB 1S9VB 1S7RA 3GK8H 4HWZA 1I4FA 1NMAH 1R3LB 2PKDA 3I50L 2JA5I 3BWAB 1JI1A 4LPCA 4TRPH 2XKUA 2APWA 4W6XB 3DWTA 3LD8B 4X4XA 5EO1B 5HGDA 3PHQB 1KIQB 2OMNA 1CWVA 4RISL 3L3DB 1QRNE 2RR3A 3U9UA 3LKRA 4QRSA 1PBYA 3N06B 4OD3H 3FCTB 4CU6A 4N8PA 2BNRD 1TJGH 2OQJB 1T1YB 2J88L 2FLBT 2IF7A 2WAHA 3MUGB 5A2LH 2PXYC 4JR9L 3MRKB 5DEFA 1YYMH 4GFTB 3TJHC 1TZGH 3OXSB 3U46B 1ZHBA 4BZ1H 4PJ9A 2BRRL 4JFPB 1F3DH 3U4AA 1X4YA 2OSLA 2D03H 2HA1A 3RZWA 2I60H 1HEZB 5GGTA 3UYRH 4AYFA 3SKOB 4KDTC 3ARGC 1OTSD 2F54E 2J5LC 3QRGL 5TPWH 3Q3GA 3S2DI 2VABA 3JV5A 5MERB 1IQWL 3RX5A 4YDVB 2P5WD 1FFQA 4LCWD 3U4BH 3PXHA 3KWWB 4PV8A 4F37K 4P2QE 1QVOA 3OKMB 1GGYA 2WQ8A 4GXUM 2I25N 3ARBD 4I0CC 4NRZA 4GUPA 5SV3A 4DQOL 4Y16C 4UMGA 3HOVI 2YD5A 1IMHC 2ZUTA 1RURL 3P9WB 3WBDA 4IMKC 1II4E 2DQUL 4Y2DD 4GJTB 4XP9L 4TQEH 1U8KB 3OXRA 2BVOB 1T1ZA 1DEDA 5J6GA 4NSKA 4DZBA 2FWOB 3QFDA 2H26B 3VFRA 1NMCB 3IFNL 3HC0A 4MVBC 3IAPA 1PLGL 2K7PA 4RZCA 1S7XB 3EO0B 2MTPA 2VNCA 1RIUL 4WU7B 3Q2CA 2W1NA 1H0DB 4KK5C 1KCLA 1NCCH 2Q7YA 2D7TH 3U2SA 1I1AD 4Z7WA 3FN9A 1XF2A 3VGBA 3FB8B 2AS5M 1YECL 5I1KL 4PJ8B 3GKZA 3VWJD 3MRIA 5I8EB 1YDPA 3BPNB 2CLRB 3SDCA 4MX7A 1WUNT 4S1RH 4P9HL 3MQIA 3TV3L 1EUTA 3HB3D 1VKXB 4AT6B 5J57B 4I18C 1KCSL 4HDIB 5KSUA 4ISVA 5FHBL 1EJ6A 4LLVA 6CGTA 5FO8B 5FYJL 1UXWA 5HHMB 3RWEA 4GAJL 3PHSA 4X4MA 5I1AB 4D8PB 4HUXB 1X4XA 4UT6H 2FH6A 3H9SA 1F5WA 1TWCI 3N1MC 2VXVL 4F7CA 4LF3A 2DQJH 2PO6A 3G5ZB 4OZGE 4Z76B 5E2UL 1IGCH 2NY1C 3SE8L 3W9EB 4XNZB 1VLAA 1V05A 4HULB 1YMME 5JHDA 1QFWL 2ATPA 5JUEH 3BO8B 5I1IH 1U92A 1OAUL 4HUWB 1F8TH 4PB9H 5BCAA 4RAUA 4RWYH 1A7PH 1DN2A 3T4AA 4MLIA 1WW9A 2Z92A 1MFDH 4IIQB 3U9PH 5C07D 3HR5B 5E5MA 5F96H 4PJEF 2BSRB 2C4XA 2R1WA 2Y7QB 3A67H 5JR1H 2W9DH 2AKRB 4I9WE 3LS4L 2ADFH 3H42H 3ZYIA 1VGEH 1FYTE 3ECBB 4F7EB 4ZMAT 1HSBB 4GRMA 1RZFL 4X98B 1NEZG 1P1ZA 3GBML 4NUJB 5L2KB 4RFNC 1ZANH 1AC6A 1OGAB 4NQED 5D1XA 5I19H 4OIBA 3T0EB 1NLDH 2KZWA 1VFUA 5C09A 3MBEA 4GBXD 5DJAB 2PYFB 2F8VA 5CZXC 3IDNB 3FQNB 1A4JB 1RVFL 2X7LB 3K46A 4M7LL 2EEAA 1UM6H 4RSVA 5D2LE 1FPTL 3FB5B 4CDHA 3QIBC 1WIUA 3BKYL 5HHVL 5FKAB 2R1YB 4I77L 4P3DB 3TT1L 5I1GH 3QH3B 5HYJE 3TYFA 4EOWH 2X4OA 1GZQB 1W0VA 4NCC2 3RIFF 1KXVC 3PP3K 3DHJA 2UZIH 1I8KB 4QHLA 1IM9B 2Z4QB 3AC0A 5I18H 3GM8A 4FZ8L 1ZMYA 3QXWA 4JAMA 3SO3C 5KZCB 1FVEB 3BE1H 2KQMA 2XYCA 2GFBB 1CXLA 4NQSB 4ZS7L 5IEHA 5KJRL 4LSPH 4JRXE 5CIPB 2VO5A 2QSTA 2M1KA 1J05A 1T0NB 4JANA 4Y4HC 1IAKB 4F2MA 1ZVHA 4KXZH 1VGKB 3DSNA 3HZMB 2XIDA 3QUMA 5F44A 3V0VA 5MENA 2G5RA 2A77L 3O6FC 2XZQH 2VL5B 2WWMC 3FB6B 1YY8A 3QDAA 4ZPVB 1NLBL 1IFHH 4KUZH 3BQUD 4YE4H 2YN5A 3O4LE 2ESVD 1A14L 1NCBL 5DMJB 7CGTA 1NEZA 1U3HC 4Z8FL 2EC9U 3MJ6A 4L8SB 1GPOH 4D3CL 1B88A 4NN7B 5CEXA 5HYFA 4GRLB 4WGWB 4MJIB 2VLLB 4AQ1B 2KUTA 1MCIA 4R7NB 1BQHG 1PJ9A 1DBKL 3ULVL 4DKFH 1JZ2A 3WYRA 3IYLW 2CIIA 3OL2A 1F6AB 2YA0A 4MD4A 4LLQA 1A1OA 4G80B 3S96B 1XGUB 4WWKC 2AXFA 2DBLL 5EUKA 4NT6A 3QDMD 2YPLA 4MD0B 3SJVA 3MODL 3DPBA 1X3WA 3CFBB 5GGTH 3PQYE 1SMOA 4U0RC 1RU9L 2W60A 3TJEH 3QHFH 3HI6L 5EU6E 5ESVA 1MJ8L 3O9WB 4Z0XA 3S4SB 3H7LA 4M5ZH 1A6TB 1N2FA 1DVFB 5EBGA 5IR1A 3K80A 3G5VB 1IEAB 5LXGH 1FGNL 4RMWA 4TVSa 1P4IH 3MBXL 4NN5C 2B4CH 3L7EB 2NY3D 1I1CA 1T20A 1XGTB 1GSMA 2X5PA 3MNZA 1USPA 3DHMA 3X11B 3HRZB 1CFNB 5IB3B 4ZOCA 3KLAA 4JHBA 2ICES 3QUXB 4HJJL 4PJDA 5I1JH 1T22B 2EEBA 1MIMH 3SDDD 5HI4D 3ULUL 3HG1A 5JNYB 3WFCL 3CDGA 4GXVL 3MJ9L 5F7DA 1CGUA 1A47A 4OCLC 3CFJA 4F15C 1MCHA 4TTDD 3RVUD 2RHEA 2Q1EA 4PJ9C 4Y4FA 2MCPL 1KEML 2ED7A 2UWEF 2VDKL 3P73B 1BQHA 4PB0H 5F7EH 5C6PB 4A3FI 3G5XA 3S5LB 3WFBH 4H5SA 4GMSH 3W0WA 4FFZL 1YN7B 2XWTB 2EO9A 4YGAB 1TCRB 5E9DB 2IGFL 4JFFB 4FQQA 1NGQL 4F9LA 4X7SL 4YPGA 5E8DH 2CDGA 4Z78A 1C12B 1CICB 1A6ZB 4UOJA 1J87A 3MV8A 1KXTB 2AJUH 2B4CC 2Z93B 4G9FB 4YXKL 1XF4B 1C1EL 5IQ9A 4PRAA 3DSFH 5CJQH 3QO0A 4GAYA 1TNNA 4D0CB 3MCKA 4TYUA 1N3NB 4I48A 2VDQH 1D5IH 1FV1A 3FT3A 3P11L 3QT2A 1WWBX 4WVRA 2GITB 1B9ZA 4AMKL 1ZAGA 5HGAB 5T1MA 4HXBL 5FA4A 5HHQB 4G6FB 1BVLB 2RIKA 1OP3H 1G9NH 3EJZC 5K9OA 4XBPA 2QADD 4GW5A 3DV6A 2J6AA 3V0AC 1HYRC 4IHOA 1A9EB 4JQVA 2IBZX 1T2XA 3G9AB 5EO9A 3SDCC 2NY2B 3D0VA 4PP1C 1CD8A 1TIUA 4HKZA 1JPSH 4LEXH 1J11A 4KJWC 4C56D 4OIIL 3EZ8A 1RV6X 4OUUB 1C16B 3NCFB 3ZHLA 3C5ZD 3ABZA 3NZHL 4BSVB 5E7FA 3F7VA 3ALPA 2CRYA 3HS0B 2YMXH 3MOBH 3PDOB 5B39B 1GAFL 3HC3L 5C9KA 2OJEB 4KRNA 1MRDL 4PRHB 3OGCB 5DHVA 1YNTB 5JDJA 3UZEA 5EU4B 5C0CB 2IANA 2HMIC 3HUJE 1IAIH 2PO6C 3VFGH 3BYTA 3P4OB 5JORA 1DJSA 5FA3A 2V2TB 3RWHA 4XVJH 4S1QH 4Y1AA 4H26B 4HK0A 5DYOB 5F93C 5GRUH 1MCSA 3VRLF 5IBUB 5J7CC 3V5HB 4TULH 4YHKH 1PY4A 2B20A 3DVNA 2OZ4L 1PW3A 4TSBL 4WW1A 3K74B 2IH3A 1CLYL 1YEKH 4MA8L 4ZTOH 1CIDA 3TF7C 1JVKA 3GKQA 1G9NC 1Q0YH 4HFUH 4ONFH 4E0RB 1YPZE 3QQ3A 1S7SA 4P5MB 5FYLD 2EDLA 4Z7WF 2J8OA 4LLWB 1S7QA 3BGFC 4E5XB 3FKII 4XWGH 1Z9OA 3QBTB 4MA1C 1UWEL 3TO2B 3GFUA 1JHTA 1EO7A 1YQVH 2AJSL 5T3ZD 2CH8A 3C09B 3FFCD 2HN7B 3QUMH 5C0FB 3VMGA 3TYGH 5C0BA 5FHAH 1Y6MR 2GCYA 5BXFA 2CKBA 4OI9A 5D1XC 1TZIA 2DQHH 4G5ZL 4YFLF 1TQBB 2GUOB 4KDWA 1FRGH 1U93A 3MBEC 4GLRH 1CDGA 4CVWA 4L29B 1CFVL 2OR9H 2WBKA 1OLZA 3MCG1 3IKCA 1X7QA 4WV1A 4X6DE 1OAXL 5IHZA 3Q6GL 4ZO9A 4A3II 4AH2A 4NBGA 3I02A 4PJAA 3LV3B 5EZOH 2J8UE 3C9NB 4AIZA 4NO0A 5EA0L 4ORGA 4ODUB 1QR1B 2VN4A 5TDPB 1SQ2N 1J7VR 4D9LL 5I1HL 5IQ7L 5E6IB 2YOCA 3PWUA 3C60A 5EBWB 4L8CB 3VFTB 2LTQB 1YNKL 4HCRA 3I84A 3H0GI 1MJ7L 2DLEA 4KPHH 4L4TD 1K2DB 4NC2B 2JA6I 5AAWA 2APXA 2Z9TA 4OQ1A 1INEL 4U1HA 5C0JA 3DXAA 5D7SL 2R0KH 5DT1H 1BM3L 1F4XH 5KSAA 1QRND 4IEFB 4S1DC 4GRWB 1LO2H 4QRRA 5CSZB 5H2BA 4AENB 4H1LB 2DE5A 1OTTC 3UO1H 1QP1A 3B2UD 4PRIA 4RAHA 5HI5D 3MRPB 2V9RA 1PZUB 2Z35B 3DGGA 2EKJA 5F9AC 4FQLL 2X2YA 3G6AA 5D7KD 5FM8A 2EYRB 5SWZA 3T77B 3T1WA 1LMKA 2KKQA 1CE1L 1LP9E 5BS0B 2EH8L 5CEZH 1J8HA 1T1XA 2NXZD 4L4VD 3AU1B 4PJIA 4MMZC 3UTPD 5IVXB 5C44I 5DJDA 1H8NA 4PRDB 2A6JA 3UTSB 4LHJB 2ZCHH 4Y4KD 1ZB9A 2IPUG 1NFDE 2FYYB 3NBNA 1CFTB 1TCMA 4X6FB 4YH6A 3DMMB 4U1GB 2VDOL 2AEQH 2HWZH 1R0AH 3ARRA 4H88L 5LAXB 3S17I 5IHBA 1U41A 1BD2E 2VH5H 1AGBA 3DX7B 5D7IA 2A6IA 4OCYH 3V4UH 3GSVA 1UM4L 3UPCA 4MJ5B 4FTVB 2Y5TB 1XCQA 3PG2A 3TBVB 4YGVB 1QQDA 2YD8A 3LSOB 1N26A 3KPNA 3P30H 5F8QC 3BH8A 4N8CL 2X05A 3S3PA 3U36B 5EFIA 4BH8B 2B1AH 2FR4A 3H0TB 2R2HB 1WWWX 1FFPB 1CFSB 1UYWH 2YN3A 2VISA 1FSKB 4LFHG 5IG7B 3EYFA 4NBYB 1HI6A 5ERWA 2XN9B 1PD6A 1CR9H 15C8H 4LLUB 3P0VH 3S37X 1HHIA 1MCNA 3DYPA 3VD5A 4GG6A 2DF3A 4D94A 1QLEH 1RZJL 2DQCH 4KDVA 3V4PL 3TVMD 1ITBB 2DTML 3TO4D 1WJ3A 1HZHH 3MJGX 3CQZI 1CLOL 3OJDB 4G7VH 1UB6A 5ISZD 5CUSL 3L9RA 4JY4B 1S3KL 4EIGB 1NCAL 4HS3B 4UNTA 6FABH 4JFEE 4OV5B 5C2BL 4A3EI 5A40E 4QY8B 2CSPA 3O3AA 4WFED 5TDNB 4YHML 1UVQA 1LEIA 4Y7NI 2WUBH 3ME0A 1ZEAL 5J13C 2PNDA 4JKLA 4KFZC 4WUKH 2LVEA 2DI8A 2MQCA 4Y4FC 3VFOA 4HZLA 2FH8A 5F7KC 4GAFB 4YC2B 5IW6A 2JIXA 1UA6L 2B8OT 4NOZA 5GS0L 4LOUD 5ECJE 1OAKL 4S2SB 1IGFL 5B4MD 2GI7A 2VLRA 2VQ1B 1BVKA 2XNAB 3LRSB 5EOCL 3UAJC 1ORQB 4F9LC 3NFPA 1MLBB 5EZIH 4P5KB 2VZSA 4LKCB 5HHXL 4OM0L 3KPRB 4G8GB 4KWUA 4PJBF 4WTXA 3ARQA 5DK2A 5HDBF 2BX5A 3KLHD 4V2BA 2WINA 3C6SA 2P43B 3IVKA 2BNQD 2X4SA 2ZUXA 1OAYL 3Q5YA 2BVPB 3QWRA 2GK0A 2YRLA 5DHVH 3MV7A 5IIEA 2E7HA 2AKLA 3GSWA 5F8RC 4LNRA 5BO1L 1UACH 4NCDA 5HVFB 1CVRA 4PJDF 2NLJA 4K2UL 1INQA 4K3JH 5D71L 4FFVD 4G9DA 4ZNEE 2BDNH 5I1DA 1FYTD 1YY9C 1VESA 3BSZH 5DUPL 2BOCB 1QEWB 5SWSD 1HE7A 2IPKB 4IMLB 3PV7A 5D7JA 4M9OA 5E94B 1U8IB 1J1PL 1S9VA 3MRLB 1OF2B 4ACPA 3QUZA 5D7LB 4WENB 2JR6A 7FABH 1EEYB 4A3LI 3BWAA 2H6PB 2NY0B 1XGRB 3V7MA 4F8TA 1N59B 3PHQA 1KIQA 1W0YT 4JQVC 1FGVH 4U1IB 1BAFL 4G3YL 4AL8L 5T1DL 1RHHB 5I8OL 1G84A 2JCCB 3R06A 3FKUS 3PGDB 4QOKE 2AK4D 2YD6A 5HYJD 2OQJA 1UXSB 1T1YA 4J4PD 2CKBH 3UJTL 4QRTB 4IRJA 3QFJD 4ZSOB 1BEYL 2FIKB 1G7HB 3MRKA 4JPKH 1XCTA 1YJDH 2RCSH 5TJWK 4CGTA 3GIVA 3OXSA 3N9GH 1YEJH 5JO5B 3U46A 1X44A 4OCWL 4V1DB 4NBEA 2H2PD 3UPAA 4ZDHB 1MAMH 1Z0MA 4G42B 4UT7H 1CLZH 2OJZL 2VLKA 1JNNH 2W65B 2JB6B 3RWJB 1HEZA 1HINL 1I75A 4JRXD 5MI0B 1EHAA 1FDLL 5F88B 1PX4A 4X6CB 2UWEE 1T3FA 4MWFA 3T65A 5MERA 1WIPA 1AD9B 3DYMA 3KWWA 4RNRB 5JLZB 1L7TL 4NC1C 2D7NA 4HX1A 1MCWM 2WP3O 3OKMA 4QHMB 3QNYB 3O4LD 4UIKH 3WLWD 1Z9LA 2L7UA 3DOSA 3TBYB 1I8IB 5DVKA 4JO1H 2Z31B 3BHBB 1DSFH 5F21B 1D6VH 4OLYH 1LGVA 3ZE2E 3B3IA 5FGBA 4MS8D 3EHBC 3AB0C 4KGJA 2VC2L 2VJXA 4MAYA 4QT5B 1K4DB 4DCQB 1ZT4B 1KTKE 5FGSA 1MRFH 43CAB 2ICWJ 3HE6A 1G7PB 1U8KA 3RWGB 1YN6B 2BVOA 4JFYA 3WIIH 1MCQA 2FWOA 1U42A 1YJDC 3EJYC 1GGCL 5C0RH 4TN9A 3D2UD 1OL0A 4F33B 2HT3C 3MLRL 1F4WL 1S7XA 3VRJA 4WV1C 2GJ6D 1MFBH 1DLFH 1F3JB 3PQYD 4P2RD 3CDCA 4NM4H 3ARFD 1H3XA 1S5IL 2VR9A 4M02A 1FH5L 3FB8A 3MNVB 4JO3L 4CUCA 5D5ME 1UCBH 2P5EE 4YFEA 4XNMA 2X9YA 2BY2A 3C2AH 3GSRB 3SGDH 1P7QD 3LN4B 5I8EA 3GB7A 4NJ9H 3KXFE 3V6ZB 3OAUH 1BLNB 3NCYP 3VXMB 3SKJH 1JK8A 5C0DB 3C60C 2ZOLB 3F58H 3ZSSA 2R4SL 1VKXA 1T0MB 1AC0A 3O4OB 3JUZA 1XEDA 4M8VA 5L8JB 1HYSC 1WVZA 1J86A 3FRPG 4HDIA 1URLA 4HT1L 1MI5D 5FO8A 3BDBA 4M7JL 1DTUA 3IFOB 2J3SA 5KSAC 3FQUB 4XPHL 2ZNWA 3CH8A 5BRZB 3RVVD 4L3CB 4D8PA 3E8UL 4HUXA 1CFQB 2HH0H 3Q6FB 3V7AG 1RK0B 3RI5F 4KI5C 5HD8D 4K23H 1I1FB 3AMLA 4Z76A 3G5ZA 2EDBA 1MCLA 3RP1A 1TFIA 3O6KH 3VFNB 1RUKH 4JY5L 3BXNB 4JDZB 1A64A 1BQLL 4HC1L 5GISH 5IBLC 3SGKA 4TSCL 3BO8A 3JUYA 5EO0B 2HTLD 4HUWA 4BZ2L 2BVQB 3C5SB 3I4NI 3CFKB 5CMAA 3QDJE 4APQB 4WO4B 3MNWB 4J3TA 4WUUD 3Q5TA 3SE4A 2E2HI 2F5BH 3DUHA 4J12A 3HR5A 5IJVB 4A93I 5HDQL 2Y7QA 1T0PB 4HIEB 2Q8BL 3F7RA 2CK0H 5EULV 1IC5L 3O3UN 1FL5B 4PJAF 3IJSB 5DJ6B 4HWEH 3SN6N 3VXRD 4G7YL 1G0DA 3RI5K 4MNHA 3PWVA 5T3XH 2XTJE 1CL7I 4X98A 5IFAL 5TE7H 4XPAL 2Q6WA 4HF5L 4NUJA 5L2KA 2BRQA 2R0WH 3LDBB 1OGAA 4Z7WE 1JNLL 3T0EA 5DEGB 1IGTB 4NNXB 1H3GA 5F3HB 5JPMB 3MRGB 2OXHA 4PY8I 3WL9B 3TZVD 4X6EB 4I0KA 5LVEA 3FRPA 3IDNA 1G7QB 5CCKL 1A4JA 2X7LA 1N4XL 3M17B 5GZND 3S6CA 3CFCL 3P0GB 3FB5A 4KI5F 3TNMA 5DQ9B 2ENSA 4RFOL 4XCYB 5FKAA 2B2XL 2R1YA 4RBPH 5LBSL 2FX9H 2BP3A 3PL6B 4CKVX 4JQIH 3QH3A 4YX2H 2R2EA 5DD6B 1GZQA 5IT2H 1JGDB 1ZVYA 4P4KB 2DQTL 3R1GH 3BP6B 3ROLB 4TVPH 1I8KA 3V6OE 4OUOA 1IM9A 2Z4QA 5J11C 4PJIF 5F9OH 5C0ND 1MHPH 3S4SG 1UKSA 2FSEB 5L6YH 1KIPB 4K71C 1RULH 3GNMH 4M62L 4OGAD 5BMFH 2GFBA 2DWEA 2VLJB 3CZJA 4S10A 1F90H 5CIPA 3GTLI 2B5IB 3D85D 1IAKA 2DLIA 1VGKA 4JLRB 3HMXA 3HZMA 2CRMA 3QIWB 1A7RH 3KPLA 4MQXC 3FB6A 1SHMA 5FUOL 4HMDA 3HNVH 5D7IF 3WFHB 4MNQB 5DJXA 2F74B 1TJHL 4Z7QF 1N7ML 1OHQA 4QHKJ 3KPTA 3M8OL 4OCXL 4JJ5B 3WXVH 5DVNA 3CK0H 2FGWH 4L8SA 3UROR 4KJQC 5E4EC 4CN6A 4FABH 5EORH 4MJIA 2Y5EA 1PAMA 4I3SH 3RWFA 4Q9RH 2VLLA 2QQNH 5DVMA 1SYVB 1OWRM 2DQFB 2AEPL 1HWGB 1AJ7H 1UB5B 3QIUB 3FQWB 3RVTD 3I50H 4NFBA 5HHPB 4GG6F 5E8PB 4Q58C 3S5LG 4LVOC 1F6AA 3I3EA 4PRNB 4KTDL 5I16A 3BP4B 2YD4A 4G80A 2A2QT 1ZVSB 3PP4L 3S96A 4CW1B 4WTZG 1XGUA 3O41A 5EDXA 2HT4C 1JZ8A 4RISH 5GS1B 3GZKA 3VD3A 3MRRB 4OI7A 1P6AB 3E6HB 4MSWB 4P57A 4R2GC 4C4KO 1A3RL 4OF8A 2AV7A 4Y89A 2J88H 3RVXD 2NY6C 3CUPB 5GGVH 3S4SA 3ESVF 5FYJU 4JR9H 3JV0A 2F58L 1A6TA 5D7JC 5FUCC 2HP4A 1QLRB 3GSOB 3G5VA 5GHWL 1YEEL 3EO9L 3QUZC 2BRRH 2OLDA 4YBHA 1U8NB 5DRZA 3RL2B 3ESUF 5K93A 3L7EA 5D2NB 3UTTA 1F11B 1XGTA 1QSEB 1CCZA 3X11A 3LD8C 3D39A 3HRZA 1CFNA 4K7FB 5IB3A 3QRGH 4LCYB 3NOIA 1MQKH 3QUXA 2PXYD 2AABL 1IQWH 1X3DA 1O0VA 3TJHD 4D9RD 2YZ1A 3AXLB 4UDTA 2HFEA 5JA9A 4IRJC 2E6PA 1IQDA 1CGVA 3GTQI 1MAJA 3ALXA 1ND0B 1JHKL 3FONB 2VR4A 3NZ8B 3VI3E 4DQOH 2IEPA 1E4XL 4UB0L 1FL3B 3KPQB 3OAYH 1RURH 3QP3A 3ARGD 4NHUB 3RY6A 3SGJA 4JRYB 3S5LA 3SQOL 3MOAL 4XNXL 1YN7A 2XWTA 1QFPA 1RLYA 1NFIB 2ADIB 4WTZA 3PGFL 5E9DA 5MEOB 2F19H 4JFFA 4WEBL 1XMWA 2ARJB 4NO3B 1QYGL 1BREA 2W9EL 3B6SB 1C12A 3IFNH 1FG2B 4U1LA 1A6ZA 4LP4A 3P4MB 4Y16D 5B39G 2YPLE 1PLGH 2FBJL 3QO1B 4CU7A 3SJVE 4R7DB 3IS1X 1RIUH 2XKNB 3VA2C 1NJ9B 4G9FA 1XF4A 3AFLA 5AWNL 3VE0B 3EFDL 1DQQA 3N0PB 5FGBC 2J1KA 4D0CA 1YECH 5I1KH 1EERB 3RZCB 1N6UA 35C8L 2HTKC 1N3NA 1CGSL 4NRXB 4MAYC 3EDEA 5LKNA 4NQDD 5IBUG 1JFQL 1OCWL 4OB5L 4P9HH 3HE6C 3TV3H 4PGDB 4MVBD 1X4ZA 3H9HB 3CXDL 3HNTL 2I26N 1E6JL 2EIZB 2HRPL 4MDIA 2GITA 1RO4A 1KCSH 4I0PB 5HGAA 3DBXB 4EDWL 5GRVK 2F5AL 5FYJH 1BD2D 1ADQL 4KK5D 4XT1C 3S36X 1CGXA 1CDBA 4PJDE 5EUOE 3PWNB 4GAJH 4UTAL 3ZKXB 2X4TB 2GK2A 3OR7B 4NKMB 2QHLA 4L3EE 1JZ3A 4JFDA 1BFTA 2VXVH 3MRMA 4JM2B 2KZ1B 4YDLB 5E2UH 4K9EH 3SE8H 4LPXA 4NGHH