2RBLA

High resolution design of a protein loop
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
89
structure length
89
Chain Sequence
LDAPSQIEVKDVTDTTALITWSMQLSQLEGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tenascin
publication title High-resolution design of a protein loop.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 8
structure length 89
sequence length 89
chains with identical sequence B, M
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2rblA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2rblA02
5GS2D 3UEZA 5B3JE 4Y1AB 1OF2A 3HNSL 4LAJH 4IRJA 4HXBH 2DOCA 3RL1B 1KFAH 4K3HA 5GRJH 4HPOL 4U1LA 3HI1B 4G6AD 2R0WL 3LZFH 9CGTA 5KZCB 4OCWL 4RQQB 1X5FA 1JMXA 2EKSA 2BMKB 4F7EB 1G6VK 4KXZI 5DUPH 1G6RB 2CGRH 4KRPC 3LKPA 2HJFB 1S7XB 4KJYA 4YBLC 3Q3GA 2A0LC 3C87A 4LLYB 4R4FH 1UCBL 3L3KB 4P2QD 4WY7L 4ZOBA 5F7WC 4Q58C 4ZNCD 3HZYA 1AIFA 3T8XB 4S2SB 5JW4M 1S7SA 4YPGA 1S5IH 3NPSC 2A9MH 2D7TH 4PJ7E 2Z8SA 4H1LH 1MCWW 3G5VA 5IQ9A 4X5WB 2EIEA 3CUPB 2ICEA 4FQIL 1GAFL 3FONB 3RPIB 4ETYA 2YPLE 4PTTA 4GKSA 5IT2L 3QIUA 1M7IA 4N8VA 3GSXA 4WGWB 1BEYH 4P4KD 1K6QH 2D3VA 2UVEA 3GBLA 3GUTA 4WCYH 1WICA 4Y8DC 1CGSL 4RRPG 4R4ND 5IHLB 1ML8A 5JDJA 3UTSE 3HC3H 1G0XA 4OF0A 4NKMB 4JRYD 3FFCB 4OLVH 3C08H 3STLB 5D7LD 2VDKL 4RGMB 3TBYA 3UX9B 3WJLC 1LE5A 5E6IC 5EIVA 1N3NB 4TSCH 3B6SB 4LGPB 4LQFH 5I1CH 1R0AL 1I4FA 3FT2B 3NFPA 4KK5D 2NY3B 4WI8A 5EBLA 3TN0A 4C54A 2EDDA 2Y72A 1F4YH 4KKLD 1U8IB 1F11B 1PX3A 2V2WA 5SV4A 2XN9E 3WEXA 3QCTH 1SEQL 2CMRH 4F3FA 2G5BA 1KENH 5IF0A 3GTGI 1CFVH 3IKKA 5D1QC 5I0ZA 3IVKA 3MV01 4QRPA 2KPIA 3BO8A 3DI2B 3VXQA 1HEZB 4BH7B 3BVNB 3ULUE 3PABA 2KL6A 3GKWL 3BKJL 1NDGA 1YEFL 3MYZA 1UB5B 3GNML 3V5KB 1BP3B 4L8CB 2P45B 5M94B 5IBTL 4HS3A 1M7DA 1JRHL 4LLQA 1QLFB 4JDZB 3RX5A 4M8QB 3ZKNC 1JYXA 5E24E 4GBXC 4WI5A 5DRXB 3LN4A 2PF6A 3WO4B 2DQCL 5IR1B 43C9B 3CVHB 5A2KH 3QZWB 1GRWA 1GGBL 4HKZA 4JR9H 4PRDB 1MLBB 2BY0A 2X70A 1NCCH 4YDVB 3MZGB 1JNNH 1BZ7A 4XHJD 1MCRA 5DD5H 2CDFA 1XF1A 2OSLA 3DXAD 2BNUA 2P5EB 4AY0A 2C3HA 1UQSA 3CFBB 2DWEA 3KPOA 1VFAA 2R39A 2XWTB 1SM3L 3WFDL 4MD5A 3VXMB 3R8BB 1NGWB 1DVFD 1D6VL 1NANI 4Y4KA 1LO5B 4PB9L 5TH2B 3REVB 4N9GA 4FOMA 4KVNH 2Y6SC 2O5ZL 3EYUL 4HKJA 4O51A 5F7FA 5T1KB 3TT1H 1Y18B 4CMMA 5L8KB 1HYSC 1UACH 4LVHC 3PP3K 5C4JI 3N9GH 2AV7A 4U6XA 3N1GC 1X9QA 1UYWL 4GAYB 2IJ0C 4JN2A 3TO4C 1JGEB 5BZWB 1CQYA 3UPCA 4BQBA 1I3QI 3T4AA 2GCYB 2VC2H 2Q76A 4JPVL 5DC4B 5FUCC 4HJJH 4ORGB 3TA3B 5D1XA 5C7XL 3IJHA 4PP1C 4LCYB 5I1GH 5CJXA 3MGOB 4JFOB 2UY6A 2VR5A 1DANU 5HVFB 2X10A 3MBXL 1OAYL 2VOTA 3B5HA 2CJUL 4NQTA 4OZ4A 4XP6L 3PXHA 4NQEE 5TF1L 5GQBA 1H15B 1IAOA 2BHUA 5C0IB 4LSVH 3W39B 2X7LB 1MFEH 1NMAL 3O9WA 2FHBA 3VFRB 2ZNWA 1PFCA 1C08A 1NBZA 4LAQH 2HRLA 1CFQB 4WNQA 2FATH 3U30C 3JWOC 4Q0XH 3KLHD 2ZUUA 2KBGA 1UA6H 1G7HB 4JM2C 1QLRA 4UDUB 4W68A 2NVTI 4GS7B 4X99A 4Z78A 3RWCB 3V5HA 5J1AA 3KPRE 3TH4T 1TVBB 4FFWC 2G75A 1JPST 1TZGL 4K71C 2Z31B 1TWFI 4XI5C 4G42B 1ZOXA 3QUKB 4JZJC 4M00A 2AV1B 4X6DE 1P69B 4OUUA 3B43A 4J8RA 1NMCB 4D9RD 1LK2B 1NC2B 1Q9OB 5EU6D 3QULA 5IVXF 2R4RH 3G08A 2J5LC 4Y19E 1GOGA 4MMZC 3H3BC 4KV5E 5E8PB 1KEML 4KHXH 3BN9C 3I3DA 3QUMB 3MLYH 3H3PH 1MCWM 1P4LB 2DJSA 3TIEA 2V2XA 4LSRL 2E8YA 4M03A 1HN1A 5F89B 1PY9A 1OF2B 1T21A 3VE0A 2YD1A 3DSFH 1B2WL 2HT3D 4U1LB 4N8CL 3FRPA 4A3FI 1WSST 5LBSL 2A9NL 4I18A 4EI5C 3ARGD 3PQYB 2D7NA 2EKSB 1NQBA 1CGUA 3EJYC 1Y1VS 3LKPB 2F54A 4KJYB 3Q3GB 1E4XI 2DQEL 3T04D 1XCQB 2X4TA 1V8HA 3HZYB 1FVDA 2P44B 3ARFA 2HH0H 1S7SB 3RVUD 4YPGB 4P46A 1LO0H 5IGXL 5C6TH 5J89A 4KH2A 2B8OT 2DQTL 4OFYA 4AL8H 1YEIH 3OF6A 2GW5A 1T04A 3KHQA 5EFIA 4KWUA 2HLAA 4JO4L 3G5VB 5F6HI 5IQ9B 5F21B 2ICEB 4R97C 4GKZB 1PEWA 2PXYC 4PTTB 3QIUB 1M7IB 4N8VB 1UM4H 3GSXB 4G3YL 5D2LE 3IXTA 3SJVB 2W9DL 3Q6GH 3GUTB 3MV7A 3MMEA 5CILL 5TQ2L 4EDXB 4ELKB 5IV2A 1HH9A 2AK4D 3QDME 1QPXA 1FC2D 3IDJA 4LU5L 3RI5F 1HXYA 15C8H 2CKBH 5MHSE 3TBYB 4P4RA 4UB0L 2O5YL 5INCA 3F7RA 5DVKA 4LLWA 4Q9QH 1IT9L 1BX2B 1TTUA 4PLKD 1B88A 5A2FA 1I4FB 4P0DA 3NFPB 4YX2L 5EBLB 5IVXB 3TN0B 1JHTA 1IM9A 2YK1L 2XG5A 4Z8FH 1L7TL 3QJHA 2V2WB 4JY5L 3BD4A 3WEXB 5CZVH 3ZL4L 3O8XC 2FH8A 3DV6B 5IF0B 3JVGA 2G5BB 4F3FB 1NLDL 4XVSH 1HZHH 1U3HC 4QRPB 3UTPE 1FNFA 1DUYB 3BO8B 1RURL 2FHFA 5CGYD 3PABB 1A7RH 5C08E 1NDGB 2AJ3A 4JKWA 4WUKL 4MJIE 5F7EH 1NCNA 1W8OA 2IQ9L 3HPJA 3I85A 4X4YA 2C4FT 1Q9LA 1UT9A 2YPKB 4HS3B 1M7DB 4LLQB 5B4MD 2BXYA 5LXGL 4QOKA 4MNQD 4HWEL 2MMXA 5JIPA 3V0WH 4F37F 3LN4B 3UPRA 3D2UB 4XP4L 3BZFA 4A3II 2XV6B 1MREH 3H0GI 4HKZB 4RA3A 2DLHA 3E6FA 1NGPL 3QEGH 2DM3A 2EDQA 5FO9A 2X70B 1X5HA 3M07A 3OAYK 3MACL 3MRGA 1BZ7B 5L0QC 5HDBF 3V2AR 5L6YH 2Z8WC 4KMTL 2CDFB 1FIEA 5I15L 1T83C 1FFQA 2BNUB 4G8FA 1UQSB 3KPOB 2DWEB 3OMZA 1VFAB 5B39A 3QUZD 3P4OB 2R1YA 4Y52I 4MD5B 5TPWL 1QR4A 1TVHA 2FLRT 2HJKA 3CMOL 3QIBA 1H3GA 4F15C 4QRSA 4W4OC 4MXVE 4N9GB 2YN3A 4PJBF 1PZ5A 2DKUA 1ZLVH 3UPAA 4HKJB 3P77A 4A3GI 4XPHL 3UC0H 4CMMB 1KJ2A 5DK2A 4DTGH 1TETH 4KTYA 1INEL 1X5KA 5IB2B 3QXWA 2AV7B 4U6XB 5CHNA 5I17A 3S37X 4JN2B 1MAML 5DK0A 2AEIT 3AGVA 2H9GA 1KUMA 3T4AB 2Q76B 2CLVB 5C3EI 4OQTH 1LEKA 1MCFA 4Y5XC 3IJHB 3D69A 4XC1H 5EOQH 5TE6H 4OB5H 4NCC2 1T22A 5KANG 4PGBA 1F90H 5JOPE 3Q1SL 4Z7OE 4OZ4B 2PN5A 3OV6A 1IAOB 1CU4L 1D9KA 5IHBA 4UDTB 3LRHA 1CICA 1BAFL 1KB9J 3O9WB 2ED7A 2E5EA 5FDYA 1G7PA 3KYAA 1C08B 1NBZB 4HFWA 3VWKD 4G6JL 4Y5VA 4M93B 5HHPA 1DQML 1FYTD 4GW5A 2BVYA 2VZ1A 2ADIA 3BP6B 1G84A 2LU4A 1J86A 4J7RA 5HHOD 1QLRB 2WIMA 5T1DH 3QFJE 2D0FA 2X4OA 4OCRH 4Z78B 1I9JH 1H5BC 3V5HB 3GSRA 3I50L 5J1AB 1XF4A 1UZ6F 3VXSE 1N6VA 3C8HA 2G75B 2NXYD 1CR9L 1YZZA 1YQVH 1A6WL 3W2DH 5JA9A 3EO9L 3QWRD 1UWXH 4D9LL 5BCAA 3QQ9D 1RUAL 2AJZA 4LHUD 4BFBD 1KN2H 1FO0H 4MJ2A 4OUUB 4J8RB 3N1FC 3U1SH 4OJFL 4BELD 1GOHA 1IGMH 3QULB 4PG9A 5HVGB 1X3DA 3G08B 3VU2A 2HN7A 2P7TA 4NFDA 2NY4C 1YNTA 4HS8H 1G7QA 2EIZA 2AK1H 4PJBB 4XPFL 3TIEB 2V2XB 2ZZUT 1JZ3A 4OLYL 3PWPD 5DWUL 1WBYB 2MCPL 1NBQA 2HVJA 4WUUE 4FMKA 1T21B 5D7SL 3VE0B 4ZAKB 5EORH 1UEYA 2OMBA 1RU9H 5E9DA 1I1AC 2GJ6E 2Y36L 5IJKA 4DN4L 1TTGA 2GITA 4M7KH 3L3JA 3RZCC 4TQEL 4KQ4H 3OKYA 3TBTA 3VXRA 3DPBA 4I18B 3F7PC 3A67L 4WHYG 1UFUA 4HWBA 2F54B 5I30H 1VEMA 2VLKE 4RDQG 1A9BA 1GVIA 2X4TB 5F7YC 1OTTC 3K81A 1FVDB 2F58H 1GYAA 3ARFB 4BK4A 4ZD3L 1WLHA 2RBLA 4P46B 5IFAL 4Y4FD 1X3WA 1T1YB 3P4NA 5ID1A 2XQYK 5EFIB 2HLAB 3F58H 5TE7L 5L9DL 5C07D 5J13B 4HLJA 1G9ML 5DRNA 2AABL 2M1KA 2MTPA 3QUYD 3NIFE 4R4BA 3NIGE 1MCQA 2UUDH 2IH1A 3IXTB 5FO8B 3ILQC 5M7QA 3MMEB 1KCVH 1IMHC 1RHFA 3LS4H 1U41A 3OGOE 5IV2B 3WNMA 4N1CA 1MRCL 1F6FB 5EOCJ 3SDAC 4NRZA 4CU8A 2DQGH 1T0PB 3MNWA 5ADOH 3QIWA 3IDJB 3I6GB 1HXYB 1ONQA 4G7YH 2EXWD 3GHBH 1ZXQA 3U4AA 4P4RB 4L3EE 1E28A 5INCB 2AXHA 3OG4B 4LLWB 3K2UL 2H6PA 1TQBC 4G7VL 2BRRH 2DLFL 3P30L 1X5AA 4LASL 1JHTB 1IM9B 5DD1L 4PUBH 4GG8A 3RTQA 3QJHB 1FIGH 1I7UA 3ARDD 1K3IA 4JGMA 5E7FA 1SBSL 4J3VA 5BRZD 5IWLC 2Y25A 4DFHA 4A3JI 4LCIH 3LS5H 2IPUK 3OL2A 4F9LC 3S1NI 5C0CE 3PV7A 1TZHA 3N85H 1HCVA 4HIIB 1AFVH 5D2NA 5HDQL 3AS2A 4LDLB 1Z5LA 4PRHD 5EWIL 2FBJH 1NFKA 2L0DA 2AJ3B 4H1LG 4N0UA 1U8KA 1OTUC 3HPJB 4X4YB 2ZUQC 1ZB8A 1Q9LB 5F96L 4ODVH 3OBAA 3L5IA 1S7WA 2IFFH 1VLAA 4Q9BA 3CLFL 4Q9RH 4PJFE 1VKXA 3ALWA 3UPRB 5H94A 3TZVA 3BZFB 1PLGL 3PV6A 4TVPE 5SWSD 3S3JA 4XBEH 3E6FB 4L9DA 2X1PA 1JF1A 1OARL 5CSBA 4BSWB 5FO9B 4FXKA 3TWCH 5I75B 1C1EH 1CGYA 4YHZL 3MRGB 2MPAL 1KC5L 2R0ZH 4AQOA 1I9EA 1GPOL 3ROLB 1CDCA 4Y1AE 5EBWA 4OLZL 4G8FB 2DIAA 4L4TA 1ULVA 3G5XB 4UT7L 3B2UC 1RIVH 2ICWA 2OXGA 4MSWA 3ZTJG 1FE8H 2R1YB 1RULH 1MCOL 1TVHB 4HMEA 4JQIL 2HJKB 3BKYL 3HLAA 3BT2L 3CH8A 3ZE2F 3FN0H 3QIBB 1PW3A 4YZFE 4QRSB 1BVZA 3WIHA 1KLUA 1ITBB 5L7XL 1PZ5B 5DMKA 3EYVA 3DGGA 3P77B 5F71A 1KJ2B 5DK2B 5KN5A 5DVNA 4N9OB 5FYLH 3OJVC 4EUPH 3ULUC 5CHNB 3PUCA 4GQPH 5I17B 4POZC 1MH5A 4GMSH 2V7NA 4M7LL 2JJUA 3MRBA 3QHFH 1N8ZA 1DQQA 1LDPH 2H9GB 4GAGH 3IDYC 1T7WA 5ALCH 3MV7D 5L8LB 4XX2A 1QRNA 3VW3H 4HCRL 3X3GH 1LEKB 1BHGA 4NZUH 5ICXA 4R26H 3D69B 3BSZH 4HKXB 3KPSE 3QISA 4S1RL 1IQDA 3O6MH 1T22B 1QTYT 4NBCA 4TPRH 3O2VL 4PRBA 4RX4A 5C0BD 5C70A 5GRXG 1BWWA 4KKCC 3HS0A 1RJLA 2Z8RA 3QUMH 1BJ1H 1D9KB 4PJCE 1IC5L 1KTDA 1CICB 1K3ZA 2R56L 3RY4A 2EZ0D 1RLYA 1B3JA 3H6JA 1J1OH 3FHQA 1G7PB 4HFWB 4KI5F 3FFCE 4X5LA 4Y5VB 4TTDC 3NN8A 5HHPB 4GW5B 4HH9A 2J8UA 4NZTL 2ADIB 3SGEH 3ZDZE 5DHYB 5F9OL 1NSNL 2AJXL 3NIDE 2X4OB 4PGEA 3GSRB 1UH2A 1XF4B 3CSYA 4Z0XA 2WIIA 1NLBH 5L88H 2XRAL 2EE2A 5KTEH 2AJZB 4XVUC 4K9EL 1PKOA 4XP5L 4NSKA 4Q97A 1FVCA 3RIFF 3OKMA 4M1CD 3P0GB 4KROB 3C5ZA 5DHVH 3BPOC 3DJ9A 4X7TA 2OL3L 4UI2A 3OXRA 2HN7B 4YEFA 4V2BA 2P7TB 3SKJL 5IEHA 2DN7A 3AM8A 4M3JA 4QXGL 1G7QB 4Y4HC 2EIZB 4ERSH 1MLCA 3BHBA 3LEVH 4LGRB 1LO2L 1NCDL 5HY9A 5JQHC 4U05A 1ZANL 3GKZA 3Q6FA 4TN9A 2HVJB 3BEWA 1BQLH 1W0VA 3KVQA 1X5JA 3OAUH 1KLGA 1YPZE 1IM3A 2ATPA 3PNWA 2GITB 1F4HA 5DFWH 5EU6E 4A2LA 4OGXH 3VXRB 3TBTB 3EDJA 3GHEH 4R7DA 2HAZA 2VL4A 4JJ5A 5CJOH 2FECI 1Z0MA 2V9RA 4Z77A 5JXAL 2FJGA 1DJSA 4MNGA 2WINA 1MIEH 1BFVL 3L7EA 1EERB 3AY4C 5E5UB 3HAEG 1AO7A 4RMQA 1U3YA 3VA2C 3W5NA 1A9BB 1EHLL 4JDTL 3G04B 5FGSA 2WWMC 3WHXA 2P5EE 4NCC1 1N2RA 2DBLH 5EC2A 3P4NB 5ID1B 1VB9A 3VXME 2Z91A 2QADB 4ZXBC 5JW5B 2FRGP 4N8PA 3MLPA 4JFYA 4NO3A 4A3KI 3FMGH 3K74B 1G7JA 4R4BB 1FLTX 3H42L 2IH1B 1AJ7H 4MDIA 3V7AG 5I19L 1AQDA 3QQ3A 1JNHA 2A83B 1HILA 2M2DA 5D1ZD 3TJEL 3BQUD 1YJDH 4NRZB 4JDVA 1WEJH 1LO3H 1B4JL 5F8RC 3AUVA 3QIWB 4U3XA 4XTRC 1ONQB 1PBYA 3KR3L 2APFA 1E28B 4NKQB 4PRPD 4HSQA 4HK0A 4WEBL 1UCTA 1DBKH 5IOPB 2BDNH 1CF8L 1GHFL 4EEEA 4GG8B 1FYHB 1I7UB 4NC0B 4IIQA 1U8MB 4DN3H 1WJ3A 4Q9CA 4FTVA 2P5WA 3N0PB 1M6OA 1PQZA 4K8RH 1TZHB 4H88H 3U6RA 3HE6C 2UZXB 5T3XL 5D2NB 1TMCB 1K85A 2W9EH 3OPZL 3CSGA 5EN2B 2JIXD 3GTLI 3PXJA 3H7LA 2J7LA 3BPNC 4N0UB 1J12A 3V6ZA 3MJ8B 1MWAL 2C4XA 2V7HA 3G6DL 5LAXA 5DK3A 3H3VJ 2FR4B 5IFJA 2QBWA 4K94C 4Q2ZA 5E7BA 4GLRI 2J8UF 5GZOC 4O58H 4JO1L 1VKXB 1RZIA 4FABH 5H94B 5E9DD 3TZVB 1EEZA 1KN4L 1WISA 1AE6H 2ZCKL 4HUNB 3PV6B 4TNVF 3MX0A 1NCWH 2XWJA 1JF1B 3FT4A 5FV2A 3TVMC 4FXKB 3MO1A 2BOCA 3LIZH 1CDHA 2NTFA 1T7XA 1IGIL 1U2HA 5CKGA 3EZJB 2AJSL 5EBWB 3SEPA 3WFBH 5C6PB 2W65B 6CGTA 1QSFD 1OAZL 3B5GA 3NGBC 5CAYB 5DEGA 2ICWB 3NCYP 4MSWB 4HBQA 3VWJC 4EN3C 2GK2A 2YSSA 3HLAB 2X5PA 3SN6N 5FA3A 2YKLL 1SBBA 2DDQH 2BNQA 4X7EC 1F3DJ 5DMKB 1ADQL 1MJUL 5B21A 3DGGB 3GI8L 3CFKA 5KN5B 1SJEA 5F7NC 2XXCB 1MH5B 3ECBA 5JW4N 3HPLA 3MRBB 4O4YH 4BQ8A 1N8ZB 1DQQB 1RFDL 4HLZH 1OP5K 5I1EL 4PJAE 2AS5M 2VZUA 1T66C 3DVIA 1OLLA 4JREC 1QRNB 3HUJF 3I9GH 3EERA 1OWWA 5FO7A 5ICXB 1UJ3B 2WUCL 1BFTA 1WTLA 2DQUL 1IQDB 3NACH 2NY2B 4IRSC 1RSFA 4PRBB 4IJ3B 1YEJL 3WKML 3JBG7 2HTKC 1RHHA 5LQBH 3HS0B 3QQ4A 1RZKH 4ISVA 1W72H 4H25A 1JGDA 1KTDB 4HUUA 4LEOA 1N7ML 3L6FA 4P9ML 3S37H 3ARWA 3NN8B 4HH9B 3C6LA 4MAYA 2J8UB 1NGQH 1ZT1A 2B0SH 4U1SA 1MEXH 1XF5A 5I71C 2GJZA 1RIUH 4GKNA 4AG4L 5FCUL 3GSOB 3KXFB 3LD8B 2FX9L 4PGEB 2GYSA 1PJ9A 1BOYA 1A1OA 2APWA 3EO0A 3CSYB 4PJ9B 5IBLC 2XTJB 4XMKH 4Z0XB 2WIIB 3MUGB 3BD5A 4HWNA 4QTIL 4YHYB 4ZS6C 4Z7WA 4K3GA 1MRDH 5LKNA 2AAVA 4HV8A 3LRGA 3NA9H 4LRNH 3D39A 4NSKB 4KUZL 1FVCB 4QRPE 3C5ZB 4PS4H 4X7TB 2DM4A 4GRLC 3OXRB 5DSCA 3K8LA 5IEHB 2AI0L 1IE5A 5ID0A 1P1ZB 4JG0L 1NFDA 1KCKA 1MLCB 5DRZA 5HYSA 4LSPH 5TQ0L 5HY9B 1XH3A 3Q6FB 1HWGB 1Y6MR 4ZTOH 1W0VB 4CVZA 5AAWA 5I1AA 1AH1A 1KLGB 1JN6A 1HSBA 1S5HA 1XCTB 1IM3B 5AZ2H 2ATPB 3PNWB 3FO0L 5BXFA 2EDOA 3MLSL 4YHML 2CK0L 3BZEA 4R7DB 4IDJH 2IAMA 4JJ5B 3PWLA 1R3LA 2FJGB 4O2CA 3HUJB 5HHVH 4MNGB 2WINB 3L7EB 5E8DH 3VFTA 1AO7B 3ARZA 3IRPX 3SE9L 2CRMA 2E27H 5EOCH 1I1FA 3RDTD 3WHXB 2YRZA 3NCBB 1N2RB 1GGIH 5IMLA 2LVCA 5EZIH 5IESH 2CLZA 1JI1A 5EC2B 2FO1A 2Z91B 4LKCA 3KJ4C 5CP3H 2D7PA 3HR5A 5FYJE 2OJEA 1YY9C 4H26A 5GGRA 4ELMA 4JFYB 4IMLA 4OLXL 2VISA 4NO3B 1G7JB 1D5BA 1GCFA 2J6EL 4W6XB 2IBBA 4MDIB 5D7KD 1FGNL 3WHE1 3S3PA 5DF0A 1AQDB 1R3IL 1JNHB 3QQ3B 1NEUA 4WDIA 1JNLH 1HILB 4I0KA 3WCYA 4JHWL 3T2NL 2VAJA 5ECJE 2B1HL 3SGEI 3EOBA 4CBPA 4GJTB 5DJ0A 1J88A 3R0MA 1TWCI 5FGBA 4MB5A 3PGFL 1CGWA 1IZJA 3C5JA 2VZOA 3U0PA 1ZHBA 1AGBA 4HK0B 4YDIH 3CLEH 2XQBL 1F8TL 4A3LI 1H3VA 5J11C 4YDJA 3V6FA 4D8PA 4KVCH 4PD4K 2JCCA 2P47B 5D7IA 1CT8A 3MV9D 5GS0H 2A38A 4IIQB 4L8BA 1VHPA 1FCGA 4MD4A 5B8CA 2F8VA 3EYSL 1RMFL 4L29A 4YFEA 2HLFC 5T33L 1M6OB 3GMQA 1KB5A 3VGAB 2CR3A 1PQZB 3V9FA 4MXWL 3U6RB 1MQ8A 2H2SC 4OZHF 2YPVH 3DWTA 1WWWX 4BH8A 2PO6D 4IOIA 3A6BL 4BKLA 4ESKA 4YIQA 5CIPA 3BDXA 4RFEA 3V6ZB 1WW9A 2HFFA 3LAFA 1FP5A 3L7FA 4CVUA 2YA2A 3DMMA 5B38G 2V7HB 3EFDL 3C8KA 3IF1A 5H35A 2QTEA 1GZQA 3MJ7A 4Z0BH 5IFJB 1YEDA 4L9LC 4Q2ZB 5T5FL 5C0AB 1RZIB 1A9EA 3WXWH 1D5IL 4TRPH 2A6DA 1FH5H 1EEZB 3MCLL 3JWOL 4M02A 4F7PA 4ZO7A 4P2YA 2EKJA 2Y07L 3QCUL 3SO3C 1OPGL 2XWJB 4F8QA 2ZG2A 1IKFL 3FT4B 3MO1B 5FYKE 2BOCB 5HPOA 1AR1D 3SDYH 4QEGA 2X40A 1EIBA 3GO1L 3CSPA 4HEPG 5IMMA 1JJUA 4NQDA 5E2UH 5DEGB 3A0OA 3B2VL 1F13A 5JXED 5DZNA 2F5BL 3BYYA 5JPMA 4JM4H 1N4XL 3NFNA 2YSSB 3QXVA 2X05A 5FA3B 4NYLA 3T08A 3HI5H 3UBXG 5D96C 1NFDF 2BNQB 3EHBD 3QDGA 2A2QT 2JJVA 3QUXC 1FFPA 3GRWL 1MCBA 2F54E 3I6LD 3INUL 5JHLL 3CFKB 1Z2KA 5EZJA 4EI6A 5IB4A 2F19H 4U7KA 3HPLB 3M8OH 3JWDC 4LVNB 5CJ8A 5A43C 2H26A 4NM4L 2Q3AA 4NOZA 4CDGC 5FO7B 5ALBL 4ONGH 5GRUL 3MLVH 4MCZB 3KLSA 3OZ9H 5SWZD 2P43B 4HIEA 4O02H 3RIAK 4Q7DA 2JB5H 5JIIA 1U95A 1RHHB 3T09A 7FABL 1TPXB 2IBZX 3QQ4B 5GGTH 4ISVB 3MV7E 3GTJI 5GISH 5LGJA 1JGDB 1LWRA 4LEOB 5KVEH 2W07A 4V1DA 3L6FB 4XNYH 1IQWH 3DTXA 3GI9L 1H0DB 1YYLL 1X4YA 4XCYA 4FTVD 4MAYB 1HYRC 4OM1H 5C0BE 1ZT1B 1X6NA 5EZOH 4OSUH 4U1SB 1XF5B 5FB8A 1CN4A 3IU3A 4KK9D 1A1NA 3K1KC 2C3GA 2CH8A 2GK0B 4Q6YA 3RJDA 1A1OB 4N5ED 4ODHH 3O6FA 3QEQA 1T0MB 5EC1A 4NGHL 3B5TA 3G6JA 1EHXA 3MGTA 3M3YI 2OP4L 3DUSA 4Z7WB 4HV8B 4LF3A 5D70H 3NTCL 3D39B 2VLJD 1E6OH 4EUPG 2FYYA 4WEUD 4DW2L 4ZO9A 4MA8L 1D5MA 2C4FU 2EEDA 1RAMA 1J0IA 4JVWA 5DSCB 2JCCF 5D7IF 1AHWA 2I27N 4BFEA 4A3BI 3MUJA 1NFDB 3ARYA 5DRZB 3J8F7 1A6ZA 4KJWD 5HYSB 5HHMD 1M7XA 2DB8A 1XH3B 5DGRA 4XVJL 4JGUA 4CVZB 5I1AB 3V0AC 1JN6B 4QOKE 1HSBB 1S5HB 4LIQH 4NBHA 2AEPH 5BXFB 4RBPH 4YNYA 4JB9L 4TNWF 3BZEB 4KTDL 4D9QE 2WLYA 3IDGB 4C58B 3LKOA 3PWLB 1R3LB 3RU8H 1CBVL 1WBXA 3LCYA 3DX6A 4MMXC 2RCSL 3MXVL 5EUKA 4UNTA 4RGMC 4Y5YA 3VFTB 4DUXA 2NY3C 4Y2DA 4NKIL 3MRFA 1TJIL 4JZJA 5IMLB 3BN3B 5KOMC 4P3DA 1AGDA 2CLZB 5JZ7C 1OGAD 3MSPA 4ZS7L 3E0GA 3U0TA 4J4PA 5CCKL 2H2PC 4LKCB 2VDRL 1MCPH 1WK0A 3ARED 4DVRH 3BYTA 1MJJA 3BWUC 4H26B 1RK0A 5D7JA 4ELMB 4IMLB 3MJ6A 1ACZA 2VISB 3MTRA 4RRPA 1D5BB 1F42A 1FRGL 1A7NL 4CAGA 1MELA 1JPFA 4WDIB 5IP7I 1R5IA 1LP9A 1MJ7L 1EFQA 1RJYA 3EOBB 5DJ0B 1GC1C 2YD8A 1PG7H 5E03A 5GS2H 2W91A 3AC0A 3ESVF 3C5JB 3U0PB 1ZHBB 4JPKH 3WHE0 2ZUWA 4Y0GA 1S9WA 2Q3ZA 3PP4L 4MQXD 3WO4C 5DJAA 2ZUVA 1G9EA 4YDJB 3V6FB 4D8PB 1F5WA 2JCCB 3HE7A 5D7IB 1CT8B 4KY1L 1JYWA 1BD2A 4FQXD 4DKDC 4L8BB 5F9AC 4LSTH 2VQ1A 3MC0A 3CX2A 3JTSA 4MD4B 5E6YA 5B8CB 5I1KH 4P2RA 4L29B 4GG6F 4ODWA 3GMQB 1KB5B 3FKUS 4M6NH 1T6VN 4NO0D 2DJUA 3HG1A 3OR7A 4BH8B 3MRNA 4IOIB 5T3XD 1BM3H 2NYYC 1YC7A 1NAML 2A1WH 5CIPB 3LKRA 4YIQB 4RFEB 4JN1H 3G5YA 3KPQA 2HFFB 2F15A 1N26A 3DMMB 2X4NA 3MA7B 3C8KB 1HDMA 3IF1B 2OX5A 4K7PY 1FNEA 1GZQB 5IVNA 3MJ7B 4QWWC 1YEDB 1A7OH 3LVEA 4JEGB 4OLEA 1EVTC 1KJ3H 4R7NA 3UDWC 2H3NA 3PL6D 1A0QL 3Q2CA 5EA0L 1A9EB 1EHAA 4JFFD 4P59L 4GQ9H 3HRPA 1CXHA 1WWCA 4UINL 1F3DH 3FRUA 1TWGI 4S1DC 4XX1G 1P9MC 2PUQT 3TA3C 4CL7A 3E8UH 3KG5A 3BAEH 4FFYL 1KBGH 3O4LA 1P4IL 5C0RL 3B9KD 2AJVL 5FM5M 5IMMB 5E9DE 1MQKH 2BVUA 4NQDB 4XHQA 4P2OD 1BREA 5CEZL 3TYGL 3VXRE 4DWHA 5JPMB 3U36A 3NFNB 3VH8G 1G0DA 1ZAGA 4WFED 4NYLB 3K4AA 2WP3O 3QDGB 1WIOA 4M7ZB 1FFPB 3WXVL 3TF7C 1XIWD 2XA8H 5FUZH 4U1JA 4EOWH 4DOHB 3V4UL 5EZJB 4EI6B 4GRWB 4Z7VA 5IB4B 4RMUA 1FLRH 5DUBA 4KZEH 4GS7C 2EE3A 4I48B 4IS6A 1P7HL 2J8OA 3UYOD 3LDBB 1EA9C 4LRIC 2H26B 5DMGC 5GGQH 1JGUH 1U58A 1CE1H 2EEAA 5JR1H 4TYUA 2GT9A 2Z31C 5MEND 1HH6B 1ZKAA 4GG6B 1NGYB 4KRLB 1YNLH 5CD5C 1WIUA 1NMCC 4F2MA 4HIEB 4JO2H 3R8QA 5HYJD 2EDFA 5D72L 2WZPD 5GHWL 4KRPD 4D2NA 4EIGB 2A0LD 4I3GA 1XFPA 4V1DB 4G5ZL 3KPNA 5JPNA 1MF2H 1T2QL 3DTXB 1DSFL 4Y16A 5DJZA 4JLRA 1SQ2N 3VMIA 3EJZC 2IMMA 3CXHJ 4IRJC 4K3DH 1ZTXL 4LLDA 3ZYIA 4EIZC 1DQLL 5GSVA 5FB8B 4P9HC 3IU3B 1A1NB 3HMXL 3M17A 3UJIL 2COQA 1F00I 1EBPA 3CAFA 1G9NC 3O6FB 3QCVL 3IU4H 1U8NA 1LP9F 2B2XL 3QEQB 3QO1A 5EC1B 3O6LH 3G6JB 3MGTB 1F58H 3DUSB 4WHTA 3GBNL 4CNIA 4LF3B 5GGUB 4EXPX 3MV11 4YE4L 2O5XL 3C8DA 3ET9F 3K3QA 2FYYB 3M1BA 2AGJH 3PHQA 2X9WA 4K23H 2JJSA 3CFJA 4F37K 5I8EA 2XZAH 2V9TA 2VXUL 1AHWB 3ZMRA 5C9JA 2QQNL 1JI2A 4N0UE 5JOFA 5D9SA 1A6ZB 3QRGL 2FGWL 3VXUD 3QIUC 1DFBL 2LAAA 5KG9A 5J1TC 4YNYB 1R5VA 3ESUF 1PX4A 2ED9A 3LKOB 3JTTA 3MJGX 5D1QD 1WBXB 3SPVA 5ILTH 3DX6B 5H2BB 5EUKB 1JMZA 4Y5YB 4XNUH 4NWUL 2WP3T 1FGVL 5F1IA 5IM7A 2YRLA 4NM8L 4U2YA 4OTXH 1F3RB 4WU5A 1BOGA 4Y2DB 4LHJB 4PP2A 5F1KC 4L4TE 5E2JA 3MRFB 3TN0C 1UXSA 4FQLH 3VFNA 4P3DB 3FN9A 5J0BA 1AGDB 3RWJA 4PJHA 3LOWA 5BS0A 1CGTA 3U0TB 3OSKA 5IQ7H 5HDLA 4C56A 3ZKND 2OR9H 3LN5A 3S97C 4GBXD 1ACYH 2Y06L 3T77A 3GTQI 1MJJB 3ISWA 1RK0B 5D7JB 1U6AH 1CK0H 4I9WE 1T5WA 3SDCA 4PJ5D 4JANA 1EV2E 1FBIL 1HIMH 1RUQH 4HJ0C 4RA0C 5B3NA 1J18A 1KIRA 1JPFB 4RIRA 1R5IB 3WNOA 1LP9B 2Q86A 2VDNL 1RJYB 2QSCL 1MCLA 3LHPH 2OJZL 1QRNE 5I8OH 4HEME 4PGJA 3RA7L 1MFDL 4KZDH 4KKBC 4QHKJ 4LLMB 2AJUL 4BSJA 3SOBL 2VN7A 1IGTA 4M62H 2APTA 5DJAB 4Z7VF 3HE7B 4G9FA 2VLMD 2Y6SD 3JV0A 3ULUL 2VLRD 4MD0A 1BD2B 1HYSD 4PJXA 5CS7A 3D6WA 2DTMH 1YMMD 4M43L 3S17I 2VQ1B 3FQXA 3QWQB 5GS1A 3JTSB 1E4KA 1P5UA 4YHLH 5E2VH 4P2RB 1E4XL 4ODWB 3TO4D 2EDJA 3X3FH 4PB0L 3PDOA 2J8UE 3HZVA 4U1IA 3HG1B 3OR7B 1JF5A 5C2UB 3MRNB 1JZ5A 4PP1D 3LKRB 3SGJA 3G5YB 3KPQB 4KRMB 4FQ1L 4Y4KC 2FJFA 2AXJA 4X4XA 1ZGLA 3AMKA 3CXDH 2XTJE 1KPRA 4X6FA 4LK4A 5C2BH 5CMAA 1HDMB 1FNEB 1L9MA 3OKNA 1NCAL 5GJSL 5HGHA 5A16A 2HMIC 4JFHE 4R7NB 2AQ3A 1H9VA 4OCNC 2H3NB 5TFSL 2EDHA 3FRUB 4K2UH 2GTZA 1DTUA 5CFHA 5D1XC 2Q6WB 2FX7H 3L5HA 3FO1A 1NMBH 5CJXC 4JM2D 3O4LB 1IGYA 3U9PH 4U7MA 3WNKA 2VDPL 4FFZL 4XB8A 2L7JA 2DI9A 3U7YH 4QXUH 4JQVA 4O5LL 3ZSTA 4FFWD 1CE6A 4F57H 5FUOL 4YXHH 3VGEA 2CKNA 4DQOH 4TULL 3S6CA 4XI5D 3ZZ1A 5I1JL 4JKPL 5HD8C 1D7FA 3U36B 3FN3A 3O9WC 5JOEA 2R9HC 3W5MA 1JWSA 4MJ4A 4MNGE 4YAQA 1OP3H 35C8L 1NBVL 1I3RA 4M93C 1ZA6A 1FDLH 4KKNA 2VDQL 3L1OH 4U1JB 2NY5C 2VDLH 1RUKH 1MUJA 2R69H 1EZVX 5IW6A 3BN9D 43CAB 1H3UA 4Z7VB 5H8DA 2VKXA 5DUBB 4IS6B 1KLFA 1DN0A 5E2WL 3WIIH 1JYNA 3V4PH 4HZLA 1JTTA 3FOLA 3C09B 1U58B 1INDL 3M45A 5GSRA 3X14A 2GT9B 2VABA 3IB4A 4KGLA 5GXBB 3RQ3A 5ITFB 4RGNB 4XGZA 5I6XB 4NN5B 3MNVA 3WO3B 4EI5D 1XAUA 3CZFA 1EUUA 4OD3L 4F2MB 4ZUTA 1IJ9A 2X4RA 3EJYD 3IYLW 2GAZA 4OCYL 4GXVL 1CDIA 3OJMB 4R0LA 4X83A 5CZKA 4S0SD 2R0KH 3MRCA 2ICWI 4XP1L 3KPNB 4Y16B 4K3JL 5DJZB 4JLRB 5T5NG 1BIHA 1GIGL 4S10A 1BQHG 2D7TL 4LLDB 3BMVA 5JUEH 2HYMA 3MRKA 1HE7A 5GSVB 3R1GH 3K7AI 3GSNH 5DZLA 5GGVY 3NCYS 4X6BA 1IAKA 4I18C 5LVEA 3HMWH 3M17B 2PXYD 5I18L 1KPVA 1U8NB 2VYRE 3QO1B 4AEEA 1PD6A 3EYOA 2R1WA 4WFFD 2F4OA 2E8ZA 4PJIA 4FTVE 2R29L 4CNIB 2P5WE 3NBNA 2G60L 5D5MA 3ARFC 5IHZB 3M1BB 5I8KL 4P46C 2VDML 3PHQB 4TVSa 3BPLB 3CFJB 3QHZL 4D0BA 3OKOA 5I8EB 1FL3A 2VSCA 4HC1H 5C9JB 2YWZA 4E41A 2M8XA 4PJXF 5J13C 2EE9A 4OT1L 5JOFB 5D9SB 3UZEA 3HKFA 1RZJC 2R4SH 1J8HA 4NCDA 2OZ4H 3PDDA 3BDYL 2GEEA 2E9WA 4AZ8A 3P9WB 5KG9B 1NC4A 4LCUA 2BNRB 1F4XL 2HT4C 1R5VB 1QSFB 2YD6A 3O8XD 5BMFH 3F12A 2BSRA 3VFGH 3O3AA 1HHHA 1U3HD 4MZ3A 4YXKL 1S9KC 3RWHA 1XF3A 3GJFH 5F1IB 5IM7B 3STZA 5EBMA 3WYRA 4WU5B 1BOGB 4PP2B 4X9BA 1E0OB 4K94L 3W11C 5DTFA 2NVYI 3VFNB 2HKHL 4WHDA 3U4BH 3RWJB 3V79C 4PJHB 3BGMA 3S34L 5LWYH 1T89A 3LN5B 4PLOB 5FHAH 2NQCA 3T77B 5DFVC 5JO5A 5J6GA 3JVGC 2BNQE 2KH2B 1WCQA 4ZO6A 3OR6A 3EDKA 3VG9B 3SDCB 4CN6A 5EZLA 1CG9A 1UENA 4JANB 1NCCL 2LV4A 3B83A 5CIPH 1RZ7L 1VEOA 2A6IA 1KIRB 1LDSA 4RZCA 1WITA 3DHJA 4RIRB 1DBBH 4M6AA 3O4OB 1QYGL 5DD5L 3VRLF 2Q86B 3TT3H 3IETA 5ESVA 3S35L 3WUZA 4HG4J 1NDMA 4NJ9L 1JHLH 3WSQH 5JTWA 2AJYL 4XWOC 1I3GL 3HNSH 2HP4A 1I50I 5J06A 2R2EA 1CFTB 1WZLA 1OAQL 3ZDXF 4OBRA 2FNBA 4MD0B 4N0RA 4EXKA 4PJXB 4HULB 5I75C 1T7VA 3FQXB 5IB1A 5GS1B 4OCWH 4FQCL 5AYQA 2EH8L 4B7IA 3DLQR 4ZYKA 5KSBA 3PDOB 5FGCB 4ZFOL 3HZVB 4H1LA 4U1IB 2LTQB 4WY7H 4ZPVA 3RIFK 3VFUA 4Z7QE 4AEIL 4WW2A 4ZG1A 3HOYI 3QO0A 3NCJL 5D4QA 5B22A 4ZUSA 4XCNA 3QIBC 2FJFB 2V5YA 3NABL 4X4XB 1IEBA 4HS6A 1ZGLB 4QCIA 1YDPA 1KPRB 1NL0L 5CMAB 4YQXL 3T0EA 1ORQA 4MA1C 3BP7A 3OKNB 5HGHB 3OAZK 5A16B 3WE6A 4Z7WE 4OCXL 5AWNL 1KXQE 1GAFH 3D39E 3JV4A 5IT2H 5E4EB 3FTGA 1OT2A 3FB8A 2GTZB 1H3XA 1MJ8H 4DKEL 1NFDE 3FO1B 4J3SA 4PJIF 1IGYB 3SE8L 4KTEL 2VDKH 3PWJA 1NUDA 1CE6B 2B4CH 4GMTL 4RISL 4BSVA 4Q74A 1D9KC 3KYMA 1R0AH 3QQNA 2R0LL 1CICC 5CEZD 3EO1A 1V7MH 4HT1L 1JWSB 3KLDA 4LSQH 5J9PA 3EW3B 1T7ZA 5BS0D 2X89A 4YAQB 4Y5VC 4U1HB 4LARL 1I3RB 1ZA6B 3IFPA 1O7VA 5MP6L 1SEQH 2NY4D 1MUJB 1Q0YL 5IW6B 2QQQA 4I4WA 3X12A 3AS0A 1UZ8A 3DRQB 2VZSA 3I3EA 4LPCA 4WFEE 2Q7NA 2X42A 2I60H 1DN0B 2I25N 4HZLB 3FOLB 4RDQF 1DQTA 3X14B 5GSRB 5I1HL 3GKWH 1I1AD 2VABB 1MCIA 3BKJH 3IFLL 1G7LA 3KYKL 1YEFH 3O2DL 3D3VD 3RZCD 4XGZB 3WN5A 3MNVB 4ELME 5IMKA 1JRHH 1UKTA 4KROC 4ZUTB 1DBJL 4X98A 2GAZB 3B3IA 3RGHA 2VXVL 4R0LB 2KDGA 3BP4A 5CJBA 2DQCH 4ZQKA 1C5BL 1OTTD 3MRCB 2C3WA 4E42A 2NVQI 3MRHA 1DCLA 1GGBH 4BK5A 1LO0L 1OCWL 3O3EA 5HYJE 5IJKC 1XR9A 4KRNA 1DP0A 1LNUA 3MRKB 1MI5A 2Z93B 2XY1A 4BBSI 4X6BB 1IAKB 4AJ0A 2IMNA 2JCCE 5D7IE 4LFHD 1KPVB 3OKKA 2R1WB 4AT6A 3WFDH 3RNKB 4DCQA 1J1XL 1E4WH 4PJIB 1D6VH 3ILQD 1Q94A 4UT6L 5HYEA 4FQHB 3W81A 3ZE0F 5D5MB 2O5ZH 3EYUH 4GXUN 3SDAD 15C8L 3PGDA 1BGXL 2CKBL 4XCEA 4D0BB 3OKOB 1FL3B 4O00A 3MRQA 1DDHA 2O61A 3QJFA 1UYWH 4DGIL 1KJMB 2QADC 4E41B 5GPRA 1OW0A 3RGVA 4YJZL 1J8HB 3N1MC 5L2KA 4JPVH 1AY1L 3ES6A 4PGZA 2UYLA 4XBGA 4Z8FL 1QLEL 5KSBF 4B53A 1A22B 5C3TA 5SX4I 2V17H 4QKXB 3KNBB 1MIML 1NC4B 1NKOA 4YBQC 3SDDB 5E1HB 3MBXH 4WW2F 4OFVA 3HAEA 4XVSL 2BSRB 2CJUH 4XP6H 3O3AB 5TF1H 1HHHB 5CSGA 3QIWC 2D03L 4P99A 5J1SC 1MY7A 1XF3B 2DTSA 2VB5A 2VXSL 3STZB 1FAKT 4P3WA 4WI9A 5EBMB 3MRMA 4LNVA 5IHUL 4I0CC 1WCMI 5F7EL 3BZ4A 5DJDB 1OTUD 1DEDA 3GB7B 4NQDE 2AEQL 3K80A 2YD9A 2YPLD 5DTFB 3U46A 4OZGF 3I4NI 3RTQC 3BGMB 4OCSL 5CJQL 2JLLA 4P5TA 3V0WL 1EH9A 1YUAA 1KGCE 3P73B 1KJVA 5JO5B 5J6GB 3BXNA 3EFFA 3QDGE 3OR6B 3N06B 5GS3A 4NFCA 1TZGH 1AGCA 3UTSD 3KJ6L 3VG0L 3D87B 3TCLA 3TBSA 5D2NC 5EZLB 1LGVA 4DOHE 2MNUA 3BE1L 5MEPB 4JZOB 2A6IB 5E2TL 2JELL 3CJJA 4GRWE 4RZCB 3LV3A 1VDGA 3IETB 1EEYA 5JIHA 3DX8A 2FIRT 3JV6A 3QBTB 3U0WH 1EMTH 4AK1A 4HUWA 3AFLA 1KEMH 4YHNA 3B2UD 1FL6A 2GSIA 4PJ5E 1ZLWH 4DGYL 4LSRH 4DAGL 1QO3A 5BVPH 2XN9D 4WRLA 4ZSOA 4NZRL 4PGCB 3TZVC 2R2EB 5F44A 2XNAB 1B2WH 3DROB 2CDGA 5ICZA 4N8CH 3T0VA 5GRZA 2IANA 2A9NH 5IB1B 5LG1A 3ULUD 4V1DE 3I07A 3GMLA 3JWDL 4POZD 2E9IA 4AIZA 3MZTA 1NPUA 5DQJA 5KSBB 5C0GA 1ES0A 4H1LB 4PJEF 4OQTL 4MCYB 2DQEH 4QRRA 2BFVL 2P1YA 5HVHB 4ZPVB 3VFUB 3QNZA 2ZP0T 4XC1L 2QR0A 4JPWL 4WW2B 1QSEA 3QO0B 5ELIA 4ZUSB 4LPYA 1UADC 4XCNB 3VRJA 1V3KA 4JFEA 1PY4A 4TUKH 4HS6B 5IGXH 3MLUL 3QEQE 4J3OC 4I8DA 4TVPL 1H3PL 1ORQB 3BP7B 3G6JE 4KKCD 3WE6B 4JO4H 4JPIA 1IGCL 1BBJB 4WHCA 3JV4B 5IG7A 1M4KA 3FTGB 4G3YH 2CKBA 1QKZL 4OZGB 2W9DH 3X11A 1PFTA 4TTDD 5KOVC 3QZWG 2K7QA 2IPKA 5CILH 5TQ2H 5IB5A 4MA7H 4U49A 4M1DL 2EECA 2FDBP 2O26U 5T1DL 5DA0B 1G6RL 4LU5H 2NY2C 3ETBF 2NY6B 3PWJB 4IJ3C 4K7PL 4MS8C 3UJJL 4PRID 2O5YH 4BSVB 4LDEB 3KYMB 3NVQA 3ZHKA 5KVGL 4YX2H 3EO1B 5I1IL 3L3IA 2OK0L 4MLIA 4XVUD 5J9PB 5F3BB 5T3ZE 1IAMA 1L7TH 4M1GL 4ODUB 3T3MF 3AXLA 3IFPB 2XKNA 4JY5H 5DJYA 5AZEL 1QQDA 5E08L 4I4WB 3X12B 1NLDH 5FKAA 2YBRA 2AQ1A 4Y4HD 1UZ8B 3LD8C 4NO2A 4XVTL 4G6KL 2NY1B 4UTAL 5FM8A 1RURH 1RU9L 1G7MA 1QG3A 2ADFL 2XTJC 4HUXB 4J6RL 1CLZH 4YHYC 1S3KH 1G7LB 4FS0A 4KQ4L 3CSBA 4WUKH 5ESQA 5GJTH 2IQ9H 3WN5B 4Z7NF 3D85A 3QG7L 4PJEB 4U2ZA 3ARRA 5IMKB 1SJVA 3C5ZC 5LXGH 4HWEH 3S2HI 1FN4B 4X98B 3H9SD 3E3QE 3B3IB 1T6WA 2OR7A 2FEDC 4UT9L 1L6XA 2ZUYA 3AM8C 3B9VA 4XP4H 4ZQKB 4E42B 1LP9E 5A40E 1C5CL 3GEWB 5E4IA 3MRHB 4G43A 2EDKA 3BFOA 2ARJB 2WWMD 1ZK9A 1NGPH 5T1MA 5EIIA 3O3EB 3KPRD 3I2CL 1XR9B 3MACH 5A2LH 4NQSA 1AI1L 1T20A 1LNUB 1MI5B 3F58L 1AD0A 3MJ9L 3QUXA 4KMTH 4ZXBD 5MEQA 4GUPA 3RVXC 4PR5A 1QFWI 1QFOA 3OKKB 3ABZA 4AT6B 1BD2E 1QFHA 1JZ4A 5TPWH 4DCQB 1TCRA 4QRTA 3CMOH 3SDXA 1MCKA 1Q94B 2R93I 4U6HA 3ZT5A 4Y19D 2VWEE 1A5FL 3LS4L 4P2RE 4RNRA 3ROOA 1VACA 4PREA 4UAOC 3T0ED 3KYOA 1GC1L 1IGJA 4F58H 2Y23A 1AXSA 5ADOL 4XPHH 1X4ZA 5CLWA 3HG1E 3PGDB 1WVZA 4XCEB 4TOYL 1INEH 4XTRD 5CP7A 1DDHB 3MRQB 1N2FA 3QJFB 4PGDB 4WFFE 1RK1A 4NNXA 1MAMH 3CVHL 3QA3A 4XXDA 4M6OL 1WGOA 4LQ1A 3RGVB 1LMKA 4M6MH 5L2KB 3ES6B 2UYLB 4XBGB 2BP3A 4AQ1B 1XGTA 4XBPB 1VPOL 4OD2A 5HI4C 4U0RB 1DZBA 1X3ZA 1YECL 3ARBB 4R90L 4LCIL 3HAEB 1CU4H 1AP2A 3HE6D 3NH7L 2FBJL 1A3LL 1BAFH 2YOCA 5IP4A 2PETA 2X89D 3MRMB 2K9UA 4G6JH 1OAUL 1S7XA 2DMBA 3BZ4B 3F6IA 4LLYA 3ZT7A 1DQMH 3L3KA 4NBEA 3GK8L 3U46B 4UBDC 4MJ6A 2W0LA 1RJZA 3GDBA 3GSWB 4IIQC 1FO0A 3TV3H 5FEBA 4P5TB 4Z76A 3RPKA 5GZOD 5K9QG 1EO5A 1KJVB 3I50H 3BXNB 3T0DA 3VGAC 3EFFB 3U7AA 2E7CA 1CR9H 2Q8BL 3QDMD 4N1EA 3TBSB 1YY8A 3P9LA 3S96B 3CUPA 3HNTL 3S8WA 3EO9H 1W0YT 3TWCL 4D9LH 1F2XK 1RUAH 4JY6A 2PYEA 1MHEA 5AAMA 3TVMD 5MHSD 3C6SA 4KI1A 3LV3B 4YHKL 5T1LD 4OJFH 1ZV5A 3RX7A 1LO4L 1CXIA 3MLRL 2IQAA 3DX8B 3JV6B 3GSQA 3SBWA 4HUWB 4YHNB 3QI9A 5IK3A 2GSIB 4XPFH 2BC4A 3VWJD 4RGNE 4OLYH 5KVFL 1QO3B 5DWUH 2MCPH 5D7SH 2XG4A 1N3NA 2Y36H 4DN4H 2CDGB 3FT2A 3BEVA 4TQEH 1WZ1H 5AYUL 4MDJB 4U33A 3UTPD 2IANB 4KKAC 2B7DT 1MVUA 3WNPA 3GMLB 3MBEA 5C08D 1U8IA 3A67H 4DZBA 1WTGT 5DQJB 1JVKA 2EDRA 3WS6A 4MJID 1NCBL 1T66D 4QRRB 4DK3A 2DE5A 2HF1A 2XICA 4R26L 3QNZB 3T2OA 2IALA 2QR0B 4KUCD 1EHNA 3UTTA 4ZD3H 3ZE1F 5IFAH 4JFEB 5J4MA 1S7QA 1T3FA 3HZKA 1HHGA 4IRSD 5EBGA 1J8KA 5E6IB 1KXVC 5LCVL 1EPFA 2HTKD 5FGRA 3QUML 5FM4A 4LHUG 3GIZL 5TE7H 3V5KA 5L9DH 3PGCA 1G9MH 3QEHA 4D3CL 1LQLA 2AABH 3HTLX 5IG7B 3MLWL 1J1OL 5HHQA 2QEJA 4LVNC 4UILL 3X11B 3WDJA 1OQOA 3A6CL 1ZHKA 2WM0A 4P9HL 1DLHA 2IPKB 2NVXI 2ESVA 3S5LG 1MRCH 1G9NL 1QEWA 1FZMA 2DIBA 2DQJL 1L0QA 4M7JL 5JHDA 3BPCA 3DETC 4QHKI 3GMPA 5DS8A 5IBLD 2G9HA 3IAPA 1TPXC 1CGVA 1RY7B 2OQJB 3K2UH 5IVZA 4ZS6D 4G7VH 3VI4F 2DLFH 3L3IB 1OQXA 4LASH 4P23A 5AD0A 1VGEL 5DD1H 3OB0H 3AXLB 3C6LC 4MAYC 5DJYB 1P84K 3UCRA 4GRLD 1SBSH 1QQDB 2JJTA 5JQ6H 4PJ8A 3KGRA 3MLZL 1Y18A 2YBRB 5BJTA 2W38A 4NO2B 1D3CA 5HDQH 4HUKB 4ODXA 3OAUL 3V6BR 5KSAA 1G7MB 4PJHE 5EWIH 5BS0E 4OFDA 5JOPD 1DL7L 3MPCA 4C56E 5ESQB 3D85B 4OZIF 4WWKB 3P3YA 1NGXA 5INDA 5H37H 1GZPA 4WGVB 5D93B 5HYFA 3SGDI 3EJJX 1KG0A 2YHGA 3CFCL 3KDMB 1PLGH 1FAIH 5DO2C 1H15A 3B8SA 4XPGL 3AMLA 3QFJD 1XEDA 2DBLL 3G9AB 2GUOB 1OARH 4YO0B 5T1MB 5EIIB 4LSSL 3VXSD 4YHZH 2DD8L 3TBWA 2MPAH 1U8JA 4NQSB 4WHYH 1KC5H 5E5RB 3ULVF 4HBCL 3WFCH 1AD0B 2J12B 1QSZA 3FQNB 5MEQB 1KACB 4GUPB 2IAMC 1HI6A 4R96A 4PR5B 1AXIB 1YY9D 1BF2A 4G9FE 3VI3F 4WO4A 4UT7H 5KW9H 1AJ7L 1RJCA 4H0HB 4PJXE 5EUOF 4EUPA 1TCRB 4QRTB 3BKYH 3SDXB 3BT2H 2HRPL 4U6HB 3RFZC 4UV4L 2F74B 3QNYA 4RNRB 3C60A 3ROOB 3VMPA 1VACB 4PREB 5L7XH 2Z31A 2R15A 3NCMA 2FO4B 1IGJB 4XCFH 1AXSB 1MCDA 1ZT4A 4XAKE 1CWVA 3Q5OA 4GW4A 4WUUD 2ZUTA 5CP7B 3QT2A 1RK1B 2GJ6D 4NNXB 4H0GA 5GGVL 3QA3B 4XXDB 1CTOA 1OB1A 1UM5L 4HQQL 4HCRH 1MHPL 1S78C 4EJ1C 1RV6X 3S9DB 1XGTB 4OD2B 3WBDA 2BZDA 4S1RH 4F9PA 1C8PA 5BV7B 2VLKD 4AIXA 4L3CA 3O2VH 5C09D 2HLFD 3VFMA 4K8RL 4H88L 3CX5K 2QL1A 3NA4A 5I76A 5FGBC 1AP2B 2H2SD 1IC5H 5C0FA 3L95B 4GOSA 3PQYA 4BBRI 1EFXA 2APVA 5FYJL 3ZT6A 1HWHB 2ZPKL 1N0XH 1J7VR 1XCQA 4NZTH 2J5LB 1A14L 2VZVA 4CU7A 3T0WA 3IDIA 4MJ6B 1RJZB 1IAII 3TFKC 2ED8A 1FO0B 5F9OH 4I1NB 1NSNH 2AJXH 4Z76B 5B8CC 3TH2T 5DHVA 3TH3T 3BUTA 2NY0B 5J12B 2XRAH 1YY8B 3P9LB 5I9QB 4CVXA 3R0NA 4GKZA 4JY6B 2PYEB 1MHEB 4JRXD 1I9IL 3C6SB 4EI5B 4XP9L 4XP5H 2LFGA 4DGVH 2LU7A 3DIFA 4L3ED 4WFHE 4OF6A 4NC1C 3SJVA 3ZDXE 4IEFB 2IQAB 1PSKL 3DMMC 5EUOB 2DQIL 3ZYZA 2D7MA 2OL3H 3GSQB 3SKJH 4EDXA 3H8NA 4XCCL 1NEZG 4ELKA 3QI9B 5HYIA 1RZGA 4QXGH 5IK3B 4ONHA 2BC4B 1LO2H 1KCUL 1ZANH 5IFHH 2K1MA 2PR4L 3EOTL 3G5ZA 2RFXA 1S7UA 3QXTA 2NY5L 3QFDA 4C83A 1BX2A 5C0CD 3QUXD 4LCWA 4HK3J 3BEVB 2P42B 1HHJA 5IVXA 2DJ4A 5ISZA 1MVUB 1VCAA 3ZTJH 4NBYB 3MBEB 5JXAH 3RWDA 4DZBB 1BFVH 3DV6A 1EHLH 1I8LA 1A02N 5B38B 2YD7A 2IALB 3UTTB 1ZGLP 3MRDA 1DUYA 2VAAA 1S7QB 1T3FB 3HZKB 1HHGB 1JL8A 3BGFB 4M7ZC 3ZHLA 1J0KA 1U92A 3FQRA 4PJIE 5FYKL 4TVPD 3PGCB 4JFDA 3QEHB 2IBZY 2XPGA 2YPKA 5D5ME 1R24A 1P53A 5CUSL 5DURB 3RZWA 3S37L 2VERN 5GGSA 5HHQB 3LDBC 4PIRF 4EBQL 3H42H 4LLUA 2FZ3A 1K2DA 4Y1AD 2ARJQ 2V5MA 2V6HA 3D2UA 1ZHKB 5I19H 1DLHB 3VD9A 4E41E 2ESVB 4GW1A 3TJEH 4DEPC 5GGRY 1J8HE 5CINL 1QEWB 1FZMB 1B4JH 4QXWA 5KZCD 5JHDB 3BPCB 3MRIA 3FO2A 3KR3H 3VH8A 3GMPB 5DS8B 2G9HB 2BVEA 3UBXB 4OF5A 5HGGS 1GGYA 1PG7W 4WEBH 2B4CC 5B39G 5IVZB 4PLNC 1DLFL 3P0VL 1QBLL 4P23B 1CF8H 3P4OA 5AD0B 5DLML 1GHFH 2KUTA 3NAAL 2BOBA 4RMVA 2WW8A 1IEHA 1RZJL 4PRIE 4PJ8B 4KAQL 1KTRL 5BJTB 4QYOA 1IL1A 4IOFC 3KPSD 5IB2A 5T3XH 1Q1JL 3OPZH 3O6FC 4ODXB 1X5XA 5KSAB 4S1SL 2FJHB 2M26A 3DURB 2GSGA 1HKLL 4OD1L 4NQCA 1MWAH 2CLVA 3G6DH 3S16I 1JTPA 1NGXB 5INDB 1J9CT 1I9RL 1GZPB 3FFCD 1P7KA 4FQJL 3HRZA 4PY8I 1LD9B 4JO1H 5E56A 3LMJL 1AHWC 2EIDA 2IPTL 3RY5A 3T0BA 1MCCA 1KG0B 1KN4H 3IS0X 4FHBD 2ZCKH 3JWNC 8FABB 5EOCL 4QNPE 1OGTA 2NY3D 4UDTA 4L5FL 5CBEB 5HTSA 1IILE 3LY6A 3FQUA 3TBWB 5JZ7D 1U8JB 5C0JA 1IGIH 3H9SE 2AJSH 1A6VL 1OHQA 2H2PD 3HAEH 2G5RA 3W0WA 1HI6B 3BP6A 4R96B 3OJ2C 4WO4B 4JAMB 4NP4L 1JZ8A 1KIPA 2YXFA 4Y5XB 1R3KA 5JDSA 4EUPB 3JZ7A 4Y5YC 4FZEL 4YGAB 1ITCA 1KCSH 3TEUA 2YKLH 3QNYB 1XZ0B 3C60B 5KANI 1DBAL 1ADQH 5KSBE 1T1WB 3QXUA 4Y2DC 1MJUH 4ALAL 1BJ1J 3HNVL 1YUHA 1ZT4B 2DM2A 3GI8H 4GW4B 2CR6A 1SEBA 2MFNA 2C5DC 4J4PC 3QAZC 4YDIL 3UAJC 3B9AA 1RFDH 1OB1B 2H41A 4UIKL 3BH9A 3SQBA 5I1EH 4L8SA 5D7JC 3WFEL 4NKOA 3D48R 1KPUB 3T0EE 1W72A 4XB7A 3PO3I 4PJBA 3S36X 1WBYA 3AROA 2WUCH 3E3QC 1MAKA 1QFPA 1H5BB 2DQUH 4I3RL 4ZAKA 3VMGA 2OTPA 2VXQL 4L3CB 2FEEL 3WKMH 3DX7A 2GJJA 3VFMB 1Q9WA 1S8DA 5HGBA 2P5ED 5I76B 2B1AL 1OSPL 3QP3A 4OCMC 1I8MA 5C0FB 1T2XA 1EFXB 2A6JA 3UXFA 1U3ZA 2YU9I 2HKFL 3VXMD 4P9MH 2NYYD 4G9DA 1A4KB 4HF5H 4FNLL 1K4DA 1KJ2L 4NBFA 2NY4B 3HE7C 2R2HB 3MV8A 4I0PA 3IDIB 5T1KD 5DRWA 4QWWD 4AG4H 3D9AL 5FCUH 3AAZB 1MRFL 2FX9H 1T1YA 2PW1A 2VWEC 1BZ9A 5DHVB 2MWCA 4MWFB 4G8GA 3WIFA 4MZ2A 2LE9A 4NQEA 1A64A 4S1DD 5EOTA 4QTIH 4CVXB 2VL5A 3D3VB 3TA3D 4B50A 1Y6NR 4KUZH 2KZ1B 3DIFB 1MCSA 1QBBA 3TPKA 5FO8A 1WFTA 2AXFA 3KLAB 5E2UL 2AI0H 1RZGB 4JG0H 4ONHB 4JM4L 4J3TA 4ENEC 5SX5K 3QPQC 5K9OA 3RKDC 5TQ0H 3I6GA 3G5ZB 5JW3L 4Z5RA 2RFXB 1S7UB 1TFHA 3QFDB 3RY6A 4C83B 4URTB 1M71A 4N68A 4LCWB 2YUVA 3MLSH 1S7TA 1HHJB 1RZFL 5ISZB 1F6AA 4LKXA 4XPTL 3RWDB 1WV7T 2X41A 3BESR 4APQA 2ARWA 1O0VA 2ZNXA 5DMGD 3U48A 4J1UA 3SE9H 5CP3A 1MI5E 2Z31D 5EU3B 1EO8H 2LABA 2F53A 4HIIA 4HUMB 3MRDB 2VAAB 4JJHA 3DO3A 5CD5D 5IW3A 3QDJA 1KNOA 4KHTL 1NC2D 5GGTL 1U92B 3FQRB 2IGFL 4JFDB 3ULUF 5HI3D 2XPGB 1WCBA 1R24B 2J6EH 5GGSB 4LLUB 4F7TA 3EJZD 2OYPA 2FZ3B 1K2DB 2HFEA 4ONFH 3C09C 4GAFB 4IRJD 4OM1L 4AEHL 1R3IH 2YD5A 3WNNA 4GW1B 3IAQA 4JHWH 4RGNC 5I6XC 2B1HH 4BSWA 1DR9A 5L2KE 2YEZA 4HWBL 4ODHL 3MRIB 5E6ZA 3FO2B 3VH8B 3PGFH 4ETQA 5HDOA 5E00A 1MSPA 4FQ2L 5DEFA 3ROLA 4OLUL 4XNQA 4X5XA 1I3UA 1PKQE 1F8TH 1VADA 2XQBH 3G5XA 1HHIA 4Y16C 2HWZL 3O45B 4W70A 5C1MB 1XGYL 2BOBB 2GY5A 3DVFA 4IOSD 2YN5A 2FL5A 4Z7NE 2YA0A 4QRQA 1JZ6A 1RMFH 4BFGA 2Q8AH 5D71H 3KHOA 4QYOB 1IL1B 5KS9E 5I73B 4MXWH 3QIUD 3GMMA 3A6BH 1R3JA 1ZSDA 2APXA 2GSGB 5K93A 2I24N 3IRZA 4N0CC 2BJOA 4RGOL 4NQCB 4HIXL 3EFDH 1IC7L 1N6UA 4P3CL 5F97E 3I84A 3RU8L 5IEKA 12E8L 3BPLC 2JJSC 5T5FH 4HKXA 1P7KB 3HRZB 2XN9B 4PG2A 2CUHA 2YR3A 4KGJA 1JK8A 1BQHA 3MCLH 2B63I 3JWOH 3BMWA 1OGTB 2Y07H 3QCUH 3QR2A 5I2IA 1OPGH 3TN0D 5CEXA 3FQUB 4Y8AA 2ZKHL 3QG6A 2FB4L 5BV7H 5C0JB 4ZSOE 3WFZA 3GO1H 4EVNA 5F6HJ 4H0IA 3W0WB 2K7PA 1KIPB 5DHYA 2VE6B 3B2VH 1R3KB 2F5BH 4OI9A 4QRPD 5JDSB 1N4XH 2IANE 4YFLI 4HJ0D 3F65A 1R6VA 3QXDA 2NW3A 2CSPA 3GM0A 2MCG1 3MOQA 4R8WL 3M4OI 3GRWH 1KYOK 1YUHB 5JHLH 4WFGE 4QRRE 4IM8A 1P2CB 1SEBB 3HB3C 1WUNT 5JMRA 4L4VA 1QSEE 2DKMA 4KKBD 3PO2I 4JO3L 4JFEE 2NX5A 5DMIL 4U1GC 2WBJA 4MVBC 3BH9B 3IS1X 3DX9A 4L8SB 4NKOB 3ULVH 5GGTA 3SCMA 1W72B 1P7QA 3VG9C 3SDCC 2H8PA 5GRUH 1JHKL 5H37G 5K59F 4KJPC 1I1RA 2YD2A 5HVWA 3O4OC 3JV5A 4MQTB 3DX7B 7FABH 4QHMA 1Q9WB 1S8DB 2BY1A 3V4VL 5HGBB 4K8RD 1I8MB 1NGZA 4C55A 1AKJA 2A6JB 3BI9X 4JN1L 1W0WB 3GI9H 4GT7A 4U3HA 3WIHL 4G9DB 2AKLA 3BPOB 3FZUC 4Y4KD 5FYJD 1K4DB 1UXWA 5C09E 5JA8B 3A6OA 2EXYC 3MV8B 3G04A 4I0PB 1U3JA 3UTZA 5DRWB 3GJEA 2HMID 1ZLUK 3IJYA 4I3SL 5GS1C 2PW1B 1BZ9B 1E4KC 4ZOEA 1CZ8L 1TCMA 4ODTL 4G8GB 3WIFB 1V3JA 4XAWL 1UWGL 1FNLA 4NQEB 4NGHH 5JW5A 5EOTB 1TQCB 2VL5B 2LTQC 2OP4H 1N5AB 4WTXA 1A6PA 5D1XD 3NTCH 1A3QA 1L0XA 1I8IA 4DW2H 3SGJC 2GFBA 1BBDH 3OWEA 1N5YL 3ZLQC 2FWOA 3EKCA 2AXFB 4F8TA 4OKDA 2A83A 1XMWA 1MCHA 3LB6C 3TESA 3PWVB 4X6AI 2ZCLL 5K9OB 1ZS8A 2XZZA 5HD8D 3QSKB 4ZUWA 3O9WD 2R9HD 4BZ1H 2EE6A 4JRXE 5E4EC 1JYVA 4XVJH 1MVFA 4Z5RB 2E7BA 1RPQA 3L3HA 4PV8A 3PP3H 4LCCA 4AYFA 1M71B 5HGAA 4JB9H 3ZE1E 1S7TB 4KTDH 5IOPA 5CD3A 5J8OA 2GY7B 1F6AB 1R5WA 1RQ5A 4LKXB 2JB6A 1FLRL 4WVRA 4KDWA 2EC9T 1ED3A 1EZVY 1CBVH 3LKQA 1JF6A 1U8MA 4APQB 2RCSH 3MXVH 4JQVC 4OLWL 5GGQL 1RO4A 1AR2A 1CE1L 4J1UB 3UTQA 2CRYA 1BVKB 4RWYH 2F53B 2XZCL 3UTOA 4TSAL 4EKXA 3H0TA 1YNLL 5T5NF 5TDOB 3CFEA 4NKIH 5EN2A 1TJIH 1FFRA 5HHXL 3QDJB 1KNOB 2RHEA 5ICYA 4JKLA 5I1LA 5CCKH 3SDXE 4N0FA 2ZSVA 5DEZA 2VDRH 3MJ8A 25C8H 3LKSA 2UV3A 2D2OA 1WCBB 5DQ9A 4R2GB 5FYKD 2FR4A 4NJAL 5ACMA 1FNGA 5CSZA 1FRGH 4AIOA 4F7TB 3RZDI 3BP5A 2HFEB 1A7NH 3TC9A 1OAXL 4MXQC 3U9UA 4YUEL 3VI4E 4OBSA 2BSSA 4KUCF 3SGKA 1MJ7H 1RUML 1ZWIA 4G6FB 4YC2C 1KCRL 4NB8A 1Q0XL 2YEZB 5IJVA 3AU1A 1KIQA 3LKNA 4EDWL 2IH3A 4ETQB 5E00B 5DEFB 2F54D 1EJOL 4XNQB 4X5XB 4R0LC 4L3AA 3PP4H 4JZNA 2W65A 4P2QA 1VADB 2VLLA 5BO1L 4KQ3L 3FQTA 3RVTC 3ARFD 1HHIB 2XACC 3FCTB 4FP8L 1TTFA 4P46D 2D7QA 3MCG1 3ELAT 4KXZH 2NLJA 5BOZG 2FL5B 4OFYD 4QRQB 3E1F1 3S4SG 2DYPB 3OF6D 3W82A 4BM7A 1REIA 3BD3A 4LVOB 5A2JH 2F4MA 4MXVF 4LSUL 4CW1A 2HG5A 3UYRL 2H32B 3GMMB 3T3PE 2X44D 3EAKA 1CL7L 4P4KA 3PIQA 4DKFL 1NAMH 1R3JB 1ZSDB 4BZ2H 5EO1A 1NCTA 3T2PA 4CADA 1JFQL 1T1XA 2HT4D 2C7UA 1F02I 1EX0A 5FOBA 1JGLH 5IEKB 1IKNA 2YUZA 1UJ3A 1FPTL 3ULVE 4JRYA 4EN3B 4XPBH 1BFSA 5ADPH 2PYEE 1OT1A 1A0QH 5D7LA 3VFPA 3BUYA 1A7BA 4XMPL 3VI3E 1JK8B 1BQHB 3JSSA 4OTXL 3OKEA 2ID5A 3HI6L 3V52L 5I2IB 3MOBL 3C5SA 4U1KB 3QWOA 3C2AH 2ZUSA 4WTZA 3T2QA 4PV9A 3W11D 5CEXB 1IM9D 4FFYH 4HJGA 2D9QB 3QG6B 3SDDC 1P4IH 1B4RA 3OGCA 4EVNB 2AJVH 4IRZL 5DFVD 1P4BL 2VITB 3WNLA 1L7IL 4NBZB 2D0HA 5DD0H 5CEZH 3TYGH 3GSOA 3KXFA 1GL4B 2BVPA 1B90A 2DQFA 1N6QL 4PJ9A 2VO5A 1FFOA 2K3TA 2FLBT 3E6HA 2NW3B 3QXDB 1VERA 3MUGA 4W6YB 5AEAA 3LHPL 3P11L 3WXVH 1FORL 2NMSA 4ORZC 3L5WA 3V4UH 5KVDL 4L4VB 4QOKD 3MRJA 5DQDH 3UTTE 1T89C 4FXGA 1MNUL 3CVIH 1TNMA 2NX5B 2WBJB 4XWOD 3LPWA 3DX9B 4NNYA 4D9QD 1P1ZA 3SCMB 3BKCL 5HYSG 1P7QB 5EDXA 3T1FA 2H8PB 2DTML 1IEAA 5A1AA 3VD4A 4YHLL 5E2VL 4YWGL 4M5ZH 1XCTA 3X3FL 2DLIA 3LEXA 5D72H 2ITCA 1QFUL 4QHMB 1CXEA 5GHWH 3DXAA 4KJQC 3SKUD 2ESVE 4A2MA 1X5YA 3O0RL 4X7SL 4C4KO 1NGZB 4OF8A 1AKJB 3CGTA 3HUJA 4G5ZH 3TJHC 1N64L 3NOIA 1T2QH 1OAKL 1DSFH 1DVFA 5JHDE 3QIBD 1YEEH 3CXDL 1YN7A 3R4DA 1ZTXH 4H5SA 3G6AB 1UXWB 5F9WB 5AG8A 1ZEAH 2VSDA 3UTZB 3DARA 3GJEB 3N50A 1PG7X 3IJYB 3S36H 3UJIH 1SFOI 3QCVH 1NANH 2OMNA 2B2XH 1ZVYA 3LQAH 4X0KA 5C6WH 3SQOH 2Y7QA 3FB6B 5DT1L 3OAYH 3GBNH 3OHXB 1JPGA 3Q87A 1FNSH 1NMBL 4YE4H 4WW2C 2O5XH 3AS3A 5FK9A 1I8IB 4H8WH 1MOEA 2GFBB 3L5XL 4M4RA 2FWOB 1B6DA 1KELH 3T0EC 2VXUH 2QQNH 2OCFD 3QFJB 1D9KD 1ZS8B 2EYSA 4WTWA 3SKMA 3QRGH 4ZUWB 1CICD 2FGWH 2I5YL 3VDBA 1FZJA 1SVZA 2X1WL 3L3HB 4WWID 2G2RA 3VXOA 4PV8B 3MLXL 1DFBH 4OFKA 3PHSA 4LCCB 4I77L 4MYWB 5FECA 3KPLA 4UUJA 5HGAB 1AXTL 1YEHL 5CD3B 4M9PA 1R5WB 3ARQA 2ADGA 2JB6B 1ED3B 3VA6A 3LKQB 4B0MM 3QHTC 3B8YA 2IG2H 3V4PL 2NY6C 1WBZA 4RFNB 5DUML 1CVRA 4OM0L 4NWUH 1FGVH 3UTQB 4QO1A 2WWKO 4NM8H 1QYPA 3H0TB 3N1PC 3CFEB 2F8XC 3K8MA 1X7QA 1TZIA 5E70A 1TWAI 1ETZA 5FYLE 1YPZA 4KROD 2DI8A 5ICYB 2WLZA 5I1LB 3BKML 2V9QA 4MB4A 4N0FB 2ZSVB 2Y06H 3LKSB 1B0RA 3DVNB 3CZJA 5DQ9B 5J11B 1B9ZA 1SY6A 2GKIA 4K7FA 5K9JL 5HJ3A 2NY1C 1FNGB 5CSZB 5C0AA 3BIKB 3BP5B 1FBIH 3U9UB 4A6YA 4O2FA 3I02B 2BSSB 1Z9MA 3EYQC 4MNHA 1IVLA 4MHHG 4PJFF 3VXRD 2VDNH 3WN5C 1ZWIB 2QSCH 2OJZH 2EC8A 3F62A 3HMWL 5C71A 4PJGA 4C4KT 3ARGA 5IJVB 3AU1B 1KIQB 3LKNB 1MFDH 4K3EL 3RA7H 2IH3B 1DBML 2AJUH 1A4JA 3LQMA 2VDOL 3IXAA 3SOBH 4M5YL 3FO9B 3LQZB 4JZNB 4NPYA 4P2QB 4XNZB 2VLLB 4JFQA 3FQTB 1QFWM 4LMQI 1NFIA 1V3MA 3ULUH 4HFUH 2EO9A 1WWBX 4POYA 3OKLA 2ORBL 2NLJB 3F6LA 4M43H 4HC1L 1DQDL 3HA0A 3PQYE 5ITBL 5E1AA 3U7WL 1Z9LA 1E4XH 1KIUA 4ZODA 4PB0H 2KQMA 2QADD 1OM3L 2R4SL 4OZFH 2NXZC 5DA4A 5F9JA 3MRPA 3SO3B 4YZFF 4CW1B 3RVWC 1BJ8A 2HG5B 1VFUA 4QHNA 4P4KB 3PIQB 3D0LA 5EO1B 4QRUB 1P5VA 1W8NA 2QJDA 1IBGL 4YBQD 4CADB 4FQ1H 1T1XB 2YRPA 2UY7A 2C7UB 2BSED 5FOBB 2AK4A 5DDHB 3MREB 1NCAH 5GJSH 5CLTA 1CIUA 4MCZA 4JRYB 3CFDA 3QIWD 3HHRB 5TFSH 1I8KA 5D7LB 3VFPB 3BUYB 4PRNA 5KAQF 4OZHA 2QQLL 5DD3L 3OG6B 3SJVE 3UBXI 1OW0C 1UM6L 2CPCA 3OKEB 3RGVC 1BLNA 2P3YA 3C5SB 3QWOB 5EG6C 4PV9B 3H9ZA 4Z7UA 1GGTA 3RTQD 4HJGB 4U0RC 1AC6A 1H0DA 4PJCF 1KB5L 2VDPH 3OGCB 4FFZH 5TDNA 4C59B 2VUYA 5EU7E 4O5LH 5L2JB 2WWKT 4C57C 5FUOH 4LCWE 4TULH 2GK0A 5I1JH 2D9CA 1E6JL 4JKPH 5IVXE 3G9VA 5ISZE 2HTLC 1PYWA 2BVPB 4WJ5B 2DQFB 3ZDZF 1BJMA 1FFOB 1T0MA 1DBBL 3E6HB 4JFZL 1CD0A 3NIDF 35C8H 1NBVH 1CD1A 2A77H 2MQCA 1SJHA 2VDQH 1TIUA 2J88L 3L5WB 4HPYL 1DQJA 3WSQL 3PDGA 2VXTL 3SE4A 3MRJB 2EO1A 4MNQA 4P5TC 1U93A 1ZLVK 3VGFA 4FXGB 2WBKA 5E2WH 2BSTA 4NNYB 3TZVD 1INDH 3ZTNL 3T1FB 4ONOA 5DI8B 1S9XA 4JFDE 1MHCB 4XX1E 2B20A 5F72S 1IEAB 1T80A 2EDYA 3RWFA 3GIVA 3PF2A 4OD3H 1G1CA 3PO3S 3CK0H 3LEXB 2ENSA 2ITCB 4YHPB 3DXAB 4OCYH 4GXVH 4L4TD 3GSNA 5ENWA 3VJ6A 1JNJA 3IDGA 3VRIA 1YPZF 3QUZA 3BH8A 2DIJA 4XP1H 4K3JH 1U8LB 5E95B 1DVFB 1MFBL 1CS6A 4PD4J 1WZKA 4PJAA 1GIGH 1MFCL 1YN7B 4H5SB 1MY5A 3THMH 4NWTL 4I9WD 3VDCA 1K8DA 1QFWL 1EK3A 1J05A 3KPSB 4LPUA 4DKAA 4LBEA 4P2CG 5I18H 4HGWA 4MQ7A 4X0KB 3S98A 1A21A 1WAAA 5F7KC 4HC1A 3QPXL 3CU7A 4PJGF 1SVCP 2Y7QB 1HQRA 4PJCB 2R29H 1QRND 1MJ8L 1NUGA 1JPGB 2C9AA 2G60H 5I8CA 5FK9B 1INQA 5IROA 2OZ4A 5I8KH 2LAGB 2VDMH 5CKAA 3AB0B 1UWEL 3DYMA 3QHZH 1UWXK 2NY2D 3RIAF 3IFNL 4RX4D 3I3BA 2B4CL 4MS8D 5HYQA 2DE7A 3LEYL 4CKVX 4OT1H 3K4DA 2P8PA 1V7ML 4NQCE 2EYSB 3SKMB 4LSQL 1NAKL 4KC3B 1J0ZA 1FZJB 3BDYH 2IEPA 3VXTA 3VXOB 2G2RB 3VWKA 3U50C 1WT5A 4BA8A 3GJFA 1FYTA 3KPLB 5FECB 3HC4L 4UUJB 1XT5A 2NR6C 1U2CA 2QLVB 1F4XH 3NZ8B 2J2ZA 2ADGB 2BVQA 5HHOA 4J3XA 2J6AA 3KXFD 1FG2A 4YXKH 2ZCHL 2I60L 4JFXA 4TSBL 1WBZB 4PJ9D 4GSDL 4CMHB 2Z92A 2XTJD 2NZIA 4GXUM 3E2HB 1YEKL 3QWRA 4JFHD 5KSVA 3W0WE 4XNXL 3UROR 4LHUA 4K94H 4KMQA 1X7QB 2YWYA 1TZIB 2HKHH 1ETZB 1YPZB 2EICA 3C5ZD 1J5OL 4WU7A 5D6DA 3S34H 5EU6B 1QBML 3QNXA 4Z95L 4GKOA 4PBWD 2FEDD 1B0RB 3MA7A 4Z7UF 2RR3A 4N90E 2PW2A 4K7FB 2ZSWA 5HDBE 3GMOA 5HJ3B 2H32H 1UEMA 3PWPA 2EH7L 3CQZI 4YGVA 3S5LA 1QNZL 1CDBA 4A6YB 4O2FB 3MGAA 4NHCH 1RZ7H 1J0YA 4YDLB 2DRUA 2F5AL 4XXCA 1V5JA 4MNHB 2FBOJ 1QYGH 2UUDK 1TJGL 3ORJA 2BJML 3B9DA 3RVXD 2WUBL 5T3ZL 3S35H 4PJGB 4WWKC 3ARGB 4PJBE 4NJ9H 2PCPB 3MXWL 1EGJH 1E4WL 1A4JB 4MAUL 4ZNEA 3IXAB 5D93C 5BVJA 2AJYH 1AO7D 4NPYB 1I3GH 1A7PL 4JFQB 2IBGA 2YUWA 1NFIB 5C86A 1OAQH 4MGXA 4HIJA 4Y4FA 1IC4L 1WFNA 3OKLB 5E1AB 2P8LA 4ACPA 3KPPA 4FQCH 2EH8H 1LILA 4XMLL 1XGUA 5C07A 5F9JB 3MRPB 5FHBH 5HBBA 2UZIL 4BQ6A 2VH5L 4JQXA 3QUYA 5FIEA 3MV8E 1JE6A 4QHNB 1I85A 4LEXL 2V17L 4AEIH 2WQRA 3NCJH 4I48A 3D0LB 5HI4D 3NABH 4NIKB 4FZ8H 4OGYH 1ZHNB 3WD5L 1NL0H 1UG9A 3LH2L 1Z0NA 4G8GE 4YQXH 2AK4B 1HH6A 5FFLA 4GG6A 3O3BA 1NGYA 4PJAF 4OCXH 3CFDB 5AWNH 1I8KB 3O2WL 3X13A 4PRNB 4OZHB 1GGUA 2JJWA 3MQIA 3BIBX 1BLNB 2WNGA 3MOAL 1Q72L 5F7LB 1YC8A 1UZ6E 4ZFGL 4DKEH 4UBDD 2DQHL 1WAAF 4Z7UB 1VFMA 4FMFA 5ERWB 3ARDA 2JA7I 3ALPA 3SE8H 4DZ8A 5IIEB 5BV7C 5TDNB 4KTEH 4JHZA 4PLJC 5BRZA 2P5WD 1OY3B 4G8EA 4RAVB 1IAIM 1H3WM 4GMTH 4RISH 4P49A 4S1QL 2YZ8A 2R0LH 4HT1H 1PYWB 4PRHA 1JGVL 3MLTA 3WL9B 4LARH 3MROA 3U0WL 1CD1B 1EMTL 1SJHB 5K59E 5DR5L 5GGUA 3GGWA 5MP6H 1Q0YH 1DQJB 1UKSA 2F53E 4MNQB 5C0AD 1U93B 5M95B 5BVPL 5IB3A 4F33A 5KBNC 2R8SL 1U91A 1LEIA 4IRJB 4X8JA 2BSTB 4NNPH 4YXLL 2NY0C 3QDJE 2DLTA 3HFMH 5I1HH 5J12C 3S3SA 3V8CA 2OI9B 3IFLH 2VN4A 5I9QC 3KYKH 3ULVC 5SWSA 1S9XB 1IZKA 3O2DH 3RWFB 4KKAD 2ENYA 3GIVB 3KWWA 2P24A 1RIHL 4DJMA 2HJLA 2XKUA 5FA4A 3I6KA 5J3HC 5GZNC 5FLMI 1DBJH 3SBWC 3HOZI 2VXVH 3Q5TA 3GSNB 5ENWB 3VJ6B 3QI9C 3VRIB 1AIFB 3QUZB 1ROWA 1C5BH 3BH8B 3MODL 1A1MA 5H2BA 4XC3L 5FCSH 3IDXL 4TUKL 1Z3GL 5IW1A 4YK4B 4PJAB 1OCWH 2BNQD 3UO1L 2ICCA 1JTOA 1K8DB 1J05B 4HZAA 4LBEB 1JPSL 2CXKA 3L3DA 4GKSB 2D31A 3MBEC 4HGWB 4MQ7B 5C92A 4BQCA 3WS6C 3JUYA 5C44I 1J1XH 4KPHL 1HQRB 4UT6H 3RBGA 4MA7L 3ARPA 5I8CB 1J0JA 1INQB 4JHAH 1NEZA 2B5IB 1X44A 4QTHA 1BGXH 1UH3A 3DYPA 3DETD 1LE5B 3BGFC 5C0BA 4DGIH 4RFOL 1AGEA 5HYQB 4PBVC 2JE8A 3T4YA 4G80A 4FG6C 4NQVA 4WV1A 5J7CC 2AKRA 2P8PB 3O6KH 2VQUA 3UJTL 1AY1H 1CLYL 4N1HB 3VXTB 4L8DA 4LLMA 5K9KA 1S7VA 5SWQA 3VWKB 3IAGC