2RBLA

High resolution design of a protein loop
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
89
structure length
89
Chain Sequence
b'LDAPSQIEVKDVTDTTALITWSMQLSQLEGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tenascin
publication title High-resolution design of a protein loop.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 8
structure length 89
sequence length 89
chains with identical sequence B, M
ec nomenclature
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2rblA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2rblA02
5E9DE 4BY1I 2ENYA 1EFQA 1LQSR 1U8NB 2IFFH 4QRQB 1OSPH 3QCTH 4NN7C 4R97C 5IQ7L 1LO3L 3UTSA 3ARDD 3BRGC 4KTEH 5E9DA 3TWCH 5IB4B 1T0MB 1IGIH 3GSNL 1R3IL 4KJYA 3FB8B 3O4LD 5F9OH 1GHFH 4RGMC 4ZPVB 2MTPA 4NQCB 3WKMH 4OD1L 1GXEA 4UB0H 4AENA 4QHKI 2IJ0C 1U8LB 4Y2DD 3SDAD 4C59B 5B3NA 3KYKH 1JNLL 1OOAA 4XWGH 3LKSB 3B8SA 4GKSB 3MRCB 4PJFE 5DRXA 1ERNA 4XMPL 2GK0B 1S9KC 2F5BH 4RMTA 4PJFA 3ARTA 3HMWH 4ZFOL 3TJHC 4LEOB 5C08E 2IFGA 2JIXA 4XI5C 4I3SL 3KWWA 5C08A 4QHMA 1WWCA 1F5WA 3BIKB 3THMH 2E7MA 4J3SA 4ORGB 2XICA 4GRLA 5BV7B 4YO0B 1KGCE 5EC2B 3LAFA 4H25B 4AMKL 2W0PA 2R69L 3GIZH 5T1LA 4I8DA 3GCFA 1ZSDB 2OMBA 3H9HB 4BJLA 4LARH 3P4NB 5I8OL 4G6KH 7CGTA 4PJHF 2YD1A 2Z92B 4LKCB 4OSUL 4PD4J 2KDGA 3ET9F 1FO0A 1ML8A 3MV8D 4DTGL 3QUMB 3H7LA 1SM3H 4LVNC 2VJXA 1UWGL 4AIOA 1I1RA 4OIIH 1PKQB 3W9EB 4P5MB 3K3QA 2XWBA 3CH8A 4HH9A 3HG1E 4N9OB 5EOCL 4NRYB 3V5HA 3HG1A 1C5DA 1G7MB 2F58H 3BZFA 4KZDL 5CMAA 3VJ6B 2VZUA 4NFCA 3V0VA 3VD5A 3QWQB 1PX3A 3RZOI 2AK4D 5FO7A 3RTQC 2NY1B 2GK2A 2UZXB 4JVUA 3BZDA 3FO9A 2M1KA 5EU3B 3GKQA 1F4HA 2YPLD 2FATH 3TF7C 4S0TD 1IQDA 1PZUB 1OM3L 3MGOA 4LLMA 4B7LA 3ARWA 5MEND 5JHDD 4NKDA 4KKBC 1DQDL 1S9YA 4KTYA 4HS8L 1R5IB 1KJMB 4OFVA 4NN6C 3HRZA 4M8VA 4P2QB 1JHKH 4HWBH 4TPRL 1TFHA 4E41D 2XZQL 5DD3L 1JPGB 5F7NC 1ZHLB 4EN3A 2HT4D 1RURH 4I5BB 4ZODA 1H8NA 5DEFB 3WNKA 5T3XL 1FE8L 1PG7W 1IBGL 1RK1B 3FFDA 2K5RA 1N8ZB 3H3PH 5F7DA 1SVZA 3T2NL 5CEZH 4OZFH 5E6IB 1U2HA 3T4AB 1GVIA 1TETL 2WLYA 5SV3A 4MJ5A 3TZVD 2Y5TB 1NSNH 4G6JL 2P1YA 1RK0A 4R9HA 1CF8L 2D9QB 1HIML 2CK0L 5IW6A 3IKCA 2ZWLT 3IGAB 5IGXL 1PEZA 4XPTL 2FHCA 3R06B 4MNQD 2A83A 4Y16B 3D39D 1NBYA 3BN9C 3QDJE 3LN4B 5C0FB 5FGBC 4X7TB 4X5LA 4APQB 4XP5L 3BPOB 2X4TB 5EG6C 1MFCH 5DMKA 2F19L 4P46B 4ZUWB 3FOMB 3V52L 1BWWA 4R3SA 3UYOD 2CGRH 3DVIA 4H88L 5HGAB 4I9WE 5DEGB 1BJ1H 1DBKH 3I6KB 1IM9A 3CXHJ 2YS4A 1GZPB 1VDGA 2NY5C 4OLZH 1NCDL 4R26L 1T2JA 1OP5K 4GG8B 5F3BB 1J8HD 2YKLL 5HI3C 2A6KB 2F74B 4JO3L 1U8JB 5FO8B 4XPFL 3GIVB 4AYFA 4JDTH 1NEZA 4JFFD 4QHKJ 1N64L 5CKGA 5F1KC 1K3IA 4U6HA 3MXWH 4JO1H 4CMMB 4LLWA 1VFOA 2NY5H 3PP4H 4S1RH 5CZVL 4HJGA 3MV9E 4KHXL 2VXTH 3T1FA 3ULVC 1BQHG 2Z9TA 1RUKH 5EUOA 2XWTB 3MV9A 4JGUA 2Q86A 5EULV 4DKEL 5IMLA 1RSFA 1A7QH 4HBQA 2P7TA 5GXBB 3VWKD 3CDYA 1MAMH 2CJUH 3Q6GL 4HCRL 2RR3A 1Z9OA 1HCVA 3CU1A 4UTBH 1WISA 3LQZB 1W0WB 1B4RA 3ZE2F 3SGDI 2BOBB 5HGDA 4PV8A 2BMKA 2EDOA 4BFEA 3MO1A 2BVYA 1H5BB 1R3JB 5DJ8B 3MV01 3BD3A 2HT3C 2PYED 3QYCA 1OAUL 3MJGX 4RFNB 3HZKB 3WNPA 1HH6A 1UZ8A 4RAVB 2B0SL 1KIQB 3DRQB 5EZOL 4PD4K 5DHVB 5BO1L 1JV5B 1O0VA 1I1YA 5SX4H 1FFQA 5KOMC 2J6EA 4X7EC 5C6PB 4GBXC 2AABH 5HY9B 1JVKA 3KYOA 1RMFH 4BH8B 1BVKA 4OV5A 1K6QL 3OJDB 4OJFL 4OF6A 1QTYT 3L3KA 3BQUC 2A9ML 4V1DD 1WV7T 3L6FB 3ARFA 1X4YA 2DM4A 3QXDA 1MCDA 3CVHB 3EO1A 5E8DH 4M7KH 4ZXBA 4KRNA 4KXZH 4G6ML 3SDDC 3LY6A 1NFIA 2ZG2A 3KPSE 1X3DA 4W81A 4HIHB 4GRLC 5BXFB 4GAGL 1GGBH 4HV8B 3KPSA 4LPCA 2E27H 3HI1B 3MOBH 3RVWC 3MJ9A 2VOTA 4PJ8D 5ICXB 1F97A 4OQTH 2PW2A 4K8RC 3DMMD 3RIFK 5F44A 4YDVB 4NC1E 1E28A 1ZAGA 1ZEAL 1ZA3B 4JHAH 2CSPA 4NM4H 2E9IA 3CFEB 2BC4B 3SKOB 3GSRA 1H3PL 5GGVH 1D6VL 1MFAH 4PTTA 3D1MC 4K8RH 1JWMA 4KDTC 2NVYI 1RZFH 2BNQE 2VR5A 1S7WB 4MA8H 3O2DA 5AYUL 3OKNA 3T65A 1XF4A 2WIMA 4NO5B 4QXUL 1FO0H 2BNQA 5E8PB 2VUOA 2DQDH 3PO3S 3HUJF 4ZNCD 4X98A 1T03L 5JXAH 3RL2B 3U2SA 2DWEA 1EA9C 2E7HA 2VXQL 1XGUB 3L3JA 1INQA 4FQLH 3HR6A 2EDDA 2CDGB 1ND0A 3DWTA 3LN5B 5HHOD 1A6PA 4QRRD 3EO9H 2FL5B 5EUOF 4QT5A 5BVPH 2EXYC 1OGAE 5JW5A 3FOLB 4NQED 4WI3A 3NIFF 5D8JL 3KLAB 4IMLB 1XF3A 5EO1A 2EO1A 4P5KB 1OGAA 1CTOA 5DWUL 4NC0B 1VEMA 3K80A 3PV7A 3GO1H 1IC1A 5ALBH 4K71C 5L6YL 5IFJB 1EGJA 2BHZA 5L2KE 1FZMB 4KQ3L 1GPOL 4CVUA 4UBDD 4Y4KC 3QFJB 4OFKA 5L2KA 1AD0B 3ESWA 4JFYB 4OFDA 5HHNA 4EN3C 1U92B 1JMXA 5IB3A 1DL6A 1EJOH 2QQQA 3CXHK 5JR1H 4H0GA 3T0WA 3MNZB 4HPYL 3VFWB 3PWPD 4M00A 1P53A 3NZ8B 4YXKL 4G9DB 1NBVH 1J0IA 3MUJA 4QGTA 1LK2A 4PTUA 5HVHB 4F57L 4PB9H 3C6LC 1I3GH 4P2OC 2N1KA 1KELH 2CKBA 5FA3A 1X5AA 1E27B 5EZLA 2R4RH 1ZGLP 4DUWA 4PBXA 4PJXE 2GIYA 3ILPB 5HDQL 3ZKXC 1QRNE 2R8SH 2OK0L 3IDMA 5J4MA 1FNEA 2AEWA 1ZLVK 3MRFB 4PJXA 3IB4A 1QRNA 4N90E 3MLZL 1U42A 4FQIH 2OX5A 3VB9A 4DGIL 4WENB 2BY3A 4JM2D 1YEGH 5C0AB 2BDNH 1U6AL 3KR3H 3HOZI 1TTGA 4MJ2A 5C6TH 5I1AB 4KMLB 3ZE0F 4N0YL 5IP9I 1G7PA 4GW5B 4HW6A 2DQUH 4DJMA 2QQNL 1B3JA 1TJGL 1ZTXH 4EOWL 1EUTA 1UVQB 1NCUA 4Z7WF 1G6RB 4U7SA 1YY9D 2GJ6B 4N68A 1HOCB 2ZNXA 5IUSA 1F2XK 2FSEB 4U1LB 2FX9H 2QQKH 4XHQA 1KB9J 2EYSA 3JWDC 3FQWA 2ZG3A 1MFEL 3QPXL 3DVNB 1HYSC 4KV5F 2Y7QA 1KB5B 4BSJA 4YDIH 3E6FA 4D9LH 2EYRA 5IFHL 4OIBA 1PQZA 2JA6I 1EEZA 3TT3H 2PTUA 4S1SH 2YPKA 3JWDH 3QUZB 3H0TB 3F65A 3MBXL 3DX8A 4YIQB 2X4QA 4XGZA 4H1LH 3CK0L 5IHUL 1TFIA 4GJTB 3TV3L 3HRPA 1Z3GH 4FG6C 4OBRA 4XHJC 2HVJB 4FFVD 1ZK9A 1CGUA 2FR4A 2YD4A 4HIXL 5JZ7C 1YMHB 3M17A 2OSLA 2ZCHH 4QYOB 5F7UA 3G08A 4PJ5D 1M05A 1I9JH 5D96C 2HJFA 4M7JL 1SYVB 3S4SG 1U95B 4KRMB 5GRJH 3F6LA 4WTZG 1ZT1A 2DKUA 1CDUA 1IEAB 1H3GA 3NAAH 3CGTA 3LS5H 3T1WA 2X4UA 4KMTH 3UAJD 5ACZA 2OZ4A 2XI9A 5T3XD 4L9DA 5TJWK 5C9JB 3WJJA 4X6BA 1Z9SA 2MWCA 3OJVC 3RVUC 1J18A 5T1DL 1T6VN 1P7QB 2DLFH 1YECH 3SDXE 5JDSA 1MPAL 4OFYD 3ZKMD 2APTA 5ID1B 2GY5A 4J7RA 4JDVB 1KIPB 3D18A 3MLWH 5AWNH 3SDXA 2DLEA 3L1OH 4CN4A 1IMHC 2MQ0A 4I0KA 5KJRH 3IETA 4HJ0C 2V9TA 1OSPL 2AV1A 3UBXA 3ARFC 1X6LA 1FFRA 1U93A 5BJTA 3D85D 2RGSA 3S34H 9CGTA 3RY6A 1X9QA 1I8LC 3WIHH 4ZXBC 1SY6A 4N8VB 5TDNB 4L4TD 3DGGA 1IGTB 5SWQA 3BPCA 3OKYA 3PGCB 3TVMB 3KYKL 4Q9RL 1J87A 1I9IH 4Q7DA 4F7PB 5EORH 5GGQL 2CD0A 3QIWD 3N0PB 5DXWA 5KSBB 4NZDA 4NWTH 4KY1H 1JE6A 2F5BL 3HNTH 2YN3A 1XEDA 4ODUB 5HDOA 1HHIB 4Z7UB 3O3BB 2R2EA 4LHUA 4KK6C 5AUMB 3NIGE 3S37X 3QQ3B 3IDYC 3OKLB 4Z77B 3THML 3O6KH 1BMGA 4OCYH 1WC7A 1KPVA 3ZSSA 1NLBL 2RFXA 5MEQB 4BK5A 1CICB 4N0RA 4HWUA 1IAIL 3MLPA 5D7LD 4MB4A 3IDIA 1B4JH 1XGTA 4ODVH 4OF5A 4HC1A 3QNXA 2H32B 5FYJE 3ZHKA 1DN2A 2LAGB 4MMXC 2NXYB 1RZ7H 1HK6A 4K3GA 3CSBA 4LIQE 3MRHB 4JVWA 4YC2C 4KRPB 1T3FB 4ACPA 1U2CA 3G5XA 3MV11 4F37K 3QSKB 5J13C 3V7AG 1FG2A 4OIIL 3AGVA 4NZUH 5E99H 1ORSB 4HUUB 3BPNC 3DRTA 4XP4H 3X14A 2VWEE 5ISZE 1Z5LA 3GMQB 1HWGB 4FFWD 1BF8A 5IF0B 2RBLA 4BFIB 3GSWA 3KLHD 5ISZA 2F58L 4P4KA 4UU9B 4TOYH 15C8H 4QHLA 1S7XA 2LVEA 1L6ZA 3GJEA 1J86A 2OI9B 5HYJE 4YHMH 2ENSA 5CKAA 1QKZH 4LLDA 1INEH 3SO3C 5HYJA 2HFTA 3CDGB 3W39B 3SDYH 2Y23A 4WUUB 3PGDA 5FDWB 5GGRB 4MJ4A 3RNKA 12E8H 3GTPI 3C5ZC 1LHZA 4E9LA 1KB9K 3PWLA 5C0CB 1FNAA 1MRCH 1A4JA 4HT1H 2DD8H 3UX9B 1NDGA 4W6YB 1GCFA 1IGML 1Y6KR 1QBLH 5J3HC 1RURL 3MBED 2BVOA 4PJ9D 2D7NA 1AC0A 5HBBA 3SGEI 5HHQB 3GKWL 5CEZL 1BIIA 3H3KA 1OTTD 3AREA 2Z35A 1IAKB 4NBGA 2ADGB 4HUMB 3QIBC 1NSNL 1IARB 2VITB 5JW4Q 3JVGA 5C0EB 2YC1A 2QKIB 3HAEG 5HYEA 1KN2H 4I48A 5DUML 1A6WL 1YMMD 3KPOB 1T83C 3MR9B 3G6AA 2J8OA 4HUXA 4LCWD 3P9MA 3W5MA 4JCLA 5DO2D 4JFHD 1UB5A 2IH1B 1S9VB 4TQEH 1AP2A 4U3XA 1MFCL 2ITCA 4TNWK 5GS2H 1IAMA 5D7SL 3H9ZA 3NIGF 3OKKA 5C07B 4TUKH 1J05A 2CGRL 4TSAH 4YHYB 3ZYOA 2VN4A 5HYQB 4ISVB 3BEVB 2VXUL 3STZA 1HHJB 2OXHA 3PWUA 4F7MB 3ZKQD 5KSAD 2QEJA 1MCOL 5D9SA 4D0DB 1IEBA 2ILLA 5KG9A 4U7KA 1MLBB 3NN8A 3PV6B 1NGZA 4NKOA 5J1AB 3IDNB 3VFMB 3V4PH 4DOHB 3DECA 4P2RD 5DK2A 5EU7E 3WO4C 2NY5L 5GRXG 3MGAA 4Z7QE 4EUPG 5FHBH 2LVCA 4OCSH 1RUKL 5ALCH 3NPSB 4ZOCA 3AC0A 5IMOA 1JUFA 3MRMB 4WGVB 3NCYP 4NM8L 4PP1C 1NGXA 3C6SB 3GSVA 4R8WH 1A7QL 3L5HA 4N1CA 5F7LB 4CDGC 3LRHA 3BP7A 3FT4A 4YUEH 5IOPB 4UTBL 3ULVL 2HJLA 5L88L 5HHMD 4PRPB 2K9UA 4ZD3H 3CFKA 4PFEA 3IU4H 5KSUA 2WP3O 4L4VD 5E1HB 3EAKA 1T66C 4LSSL 4GKOA 5F88B 3RQ3A 3REWB 1DANU 1OF2A 2CXKA 3RKPA 3LD8B 4ZFZB 2D0FA 4G8IA 2A6IA 3ARBD 4L9LA 5E8NB 5D1ZC 2OZ4H 4X7FC 1N4XL 4F15C 3OL2A 2VDRL 4G42B 1UWXK 2HFFA 3RVTC 4I3RH 2AS5M 1LQLA 1TNMA 1FGNL 5CHNA 5DJXA 1NLDL 3WLWD 4HGWA 4UIMA 1QHPA 1BX2B 2EDHA 4GLRH 4I4WA 4JLRA 5K93A 3MLTA 4HDIB 5I1DA 1QFUH 2YRZA 5E2UL 1AI1H 2HWZH 2WWKT 1N6QH 3GUTB 1RMFL 2UWEE 4RQQB 3H9SE 5F1NB 3A6CH 2H8PA 2AJSL 2UWEA 5JOPE 4NKMB 5IVXF 1ZS8A 4P49A 3H9SA 2YRLA 1QA9B 4GG6F 5DD1L 4MVBD 3BFOA 3S4SB 4YHZL 1F3DJ 4BSVB 1HNFA 5E8DL 2R1XA 4M7KL 1HH9B 4CAGA 2PTTB 5JTWA 1FNFA 5GGRY 5EWIL 2VDPH 5ESQA 5LGHH 3IU3A 2E27L 1B6UA 1WBXB 5FF6A 5CIPB 1XGQB 3T04D 4FTVD 3BEWA 4K3JL 1KOAA 4PJDF 5JW4M 1I7ZA 5DJDB 4HEME 1XF2B 1KEMH 5JLZA 4HF5H 4JHAL 4A3FI 4HZLB 1DVFC 3QJFB 3CH1B 3LQAL 5GGVL 4MD5A 1RAMA 4NBYB 1BGXH 3WN5B 1U3HC 4K8RL 1JYWA 5EO0B 3QUXB 3DX9A 3ME0A 3TIEB 2AXGA 4BFGA 5KVMC 3IRPX 3KNBB 2IMNA 4MA8L 3DYOA 4NZRH 3T8XB 2WANA 1FO0L 4RGNB 5DSCB 2DQDL 1HE7A 3P0VH 2X05A 3DROB 4TVPE 3ZDZE 2VWEC 4KJWD 4P4KC 2EKSA 4FQLL 3O9WD 1VFAB 1Q94B 3I2CH 1FZKB 1P9MA 5FV1L 1NBZB 4DZBB 3N85L 1A5FL 2BNRB 4GQ9L 4OF3A 5T1MA 3VRJA 2VLJD 3U0PA 3QFDB 3EO9L 2OYPA 4S11A 1BPVA 1QBBA 4RBPH 1U8OA 1JP5A 3CC5B 4OZ4B 4UNVA 4M1GH 1U8IA 3ARDB 2YD7A 3V8CA 1LK3H 3GO1L 5ALBL 1XGPB 4K9EC 4I18B 1Q9KA 4KKLD 4P3CH 4XNQA 4Y2DB 3SDAB 2YR3A 2F8XC 3S16I 3LRSB 2GJJA 4JREB 1YEKL 1D9KB 2I9LB 1WEJH 3BO8A 3DJ9A 1NEUA 1EJOL 3NPZB 4MDIA 4K94C 4K9EH 3BUTA 2MMXA 4Z7VE 3C87A 4X6DB 3D25B 1CU4H 3HC3H 1QBMH 1F4WH 2JCCE 3AREC 5GGUB 4Z7VA 4AT6A 1GGIH 4N0CD 5KBNC 2RCSL 4N0UB 3O3EA 2JCCA 2DE5A 1XR9B 4WV1A 3VXOA 4K94H 4UQ3B 1K5NB 5EUKA 3TBWA 3ELAT 2R4RL 5FA4A 2AERT 1EDQA 1PEWA 5L0QC 4DK6A 1D5MB 3BHBA 4UZGA 3CZFB 3WBDA 4KDWA 5D2LF 2Y9RT 1CFTB 2YHGA 3P9LB 1H0DA 4FQIL 3WEXA 1SJHA 2GTZA 3BN3B 2P5ED 4F80A 1KEGH 5EBLB 4JZOA 2I5YH 3TJHD 2IBZY 3I50L 3NFNA 5I1HH 5C6TL 4XI5D 5F9AC 3MV8B 1RV6X 4Q97A 2VLMD 2MKWA 4HFWA 5C0BD 4XNXL 1XZ0A 4BA8A 2L7UA 2R2BA 5E00A 5FUCC 1MLCB 5IG7B 5AEAA 1XCTA 1ZTXL 1I8KA 3SE4C 3KYNA 1KTLA 3SCMA 2ARJA 3DO3A 1A02N 3OKMA 4KUZH 4JRWA 1JBJA 4OZGE 1CZ8H 4TVSa 4G8EA 3RWCB 1U8MA 5D1QA 1P4BH 1A1MB 4OZGA 4C83B 4AEIL 4D8PA 1GOGA 2AK4B 2VDNL 3CSYB 2FX8L 3HAEB 1L4IA 1NC2A 1X5HA 5FKPB 4N8PA 4W6WB 4XBGA 4YDIL 1NFKA 4ZDHB 2A77L 2CLVA 5ETUA 1GOFA 2UUDK 2WQ8A 2L4OA 2YPLB 4WFHD 3FMGL 3RNQB 3LQMA 3TT3L 1T1XB 4S1SL 1CDJA 1E4XL 4NT6B 3JWDL 4NOFA 3VU2A 3DV4A 2DQGL 5MENB 5GZNC 5JHDB 3OKOA 3IJYB 2JB5H 1IM3A 3N50A 4GKZB 5E6IC 4BQBA 2OCFD 2H6PA 2IPUK 4QRPD 4F58H 3OKDB 2Q8BL 5KVFH 1CG9B 5GRZA 4L29A 1XGRB 4E41B 1NGPH 3QXAB 3RTQD 5DTFB 4PGDB 4L9LC 3TBTB 5A3IC 1T7YA 4LSPH 3V6ZA 1SBSH 3FB7B 3FQXA 4WHCA 1I9JL 1BD2D 4GRWB 4XCFH 1QPPA 4CADB 1K83I 2VC2H 3C60A 4M03A 1AIFA 1SJXA 2CRYA 3NAAL 4JN2B 3TZVB 4MA7H 3LS5L 4APQC 3B6SB 5IMMA 1J1OH 4KKBD 5HHPB 3DV6B 3BPOC 1F6LL 5CEZD 2BVEA 1TZIB 4IJ3B 2VL5A 3B9AA 5DJCA 5LBSL 4LLQB 3WIFA 1BECA 4EUPB 4MNQB 1EO8H 3D39B 1AO7D 1KXVC 1HXYB 2ZOKA 3L1OL 1OP9A 5F1SA 3HCVB 4ZSOE 4XRCB 3DSNA 4WI8A 2P45B 1GAFH 4OLXH 4H26B 3AXLB 1C08A 2DQJH 3GMRA 3Q48A 2YRPA 2IALA 4ZSOA 3S34L 4QTHB 5CSGA 5GRUH 1S7RA 1FFPA 4J23A 2V7NB 4FXLA 5I6XB 1OB1B 2M8XA 4HXBL 5FM5O 1I9IL 1UXWB 2IH3A 4X9GA 2NW2B 4BSWA 5IEHA 4U0RC 1U91A 2G2RA 4HLJA 3LEYL 4LSTL 3VFSB 4K7PL 3JV4A 3BN9D 3CXDH 3RZCA 1MHHB 4NWTL 1J8HB 4ZTPH 1K4CA 4KY1L 4G3YL 1QFWM 2XKUA 1WUNT 1YC8A 2DTMH 1ZA6A 5JO5B 3DPBA 4HK3J 3ZL4H 3PIQA 1QVOB 4JFFB 1HQ4A 4LVEA 1G1YA 2VDOH 4G5ZH 3FO2A 5JHLH 2Y25A 1WBYA 2P43B 4IOIA 1USPA 1BQLH 2MHAA 2NZ9C 3QEQE 3T4YA 2D4FA 1L7TH 3P4OB 5F7FA 2HF1A 1F3RB 3QEQA 3RL1B 4XCYB 3VWKB 3BP4B 4LDEB 2HJKA 3INUL 1BZ9B 1B4JL 1TCRB 1OTSC 3B4NA 2ICWI 4RFNC 3WXWH 4OLWH 1P9MC 1V7NL 3ZDYE 3O2DL 2ED9A 3O11A 3V5KA 1RZ7L 2W65B 3Q0HA 2FH6A 2DQHL 4LP4A 4QGYA 5CP3A 1Z2KA 2HFEA 4WDIA 3CMOH 5HVGB 3ULVD 1KPUA 2PYEB 1FZJA 3DARA 3R0NA 5TE4H 3TIDB 1KUMA 3FCTB 4TN9A 1VCAA 1NGWB 4AEEA 2OQJB 4NZUL 2ICEB 3JTTB 4TVPH 4S1DC 1WLHA 2BXZA 5IQ9B 2J88H 3VG0H 4XP4L 3MMEA 5EBMA 2GTWB 2GSIB 3BUYA 1ADQH 3JUZA 1ES0A 5DHVH 3AROA 2EDXA 4A3JI 4LAJH 4QXTA 3MRPA 3QI9A 1F3JA 1OPGL 4M62L 1HDMB 3CFDB 4LLVA 3RWDB 2WBJA 3RWIB 4FQHA 1INEL 4YJZL 1EGJL 4WFFD 3AS2A 2LV4A 4JQXA 2XTJD 2Q8AH 3SE9L 1KF9B 4V1DB 3UTSD 5E7FA 4NP4L 5E9DD 4MS8C 3CVHH 5IW1B 12E8L 1TWGI 3DX7A 2BOCA 2VR4A 4WI5A 3TFKC 4FXGA 4PJEE 4NQVB 5DDHB 4M9OA 4DVRH 4HAGA 1VEOA 4PJEA 4HT1L 4XMKL 1MHEB 2W9DH 1N59B 5DD6B 5KANG 2PYFB 4GBXD 1RZGB 4RISH 3MRQB 2WLZA 4PJ8B 1MCKA 1G9NC 3QA3B 3FN0L 2CRMA 3DMMB 4LSDA 2EC9T 1MFBL 3Q1SL 3BQUD 3X17A 5GISL 3KPMB 2P4AB 3LPWA 3P40A 5DRNA 2CRIA 3FQNA 2AEIT 4PRDA 4WO4A 3L9RA 4P23A 1KN2L 3G6JB 5C08D 1G9NH 1WTGT 4XVJH 1MREH 4RFEA 2XWJB 4GRLD 1I75A 3VFPB 1P4LB 3P77B 3BI9X 3RVWD 3VFRA 4JHZA 3SCMC 5T1LD 1KGCD 3AM8A 5DRZA 3ILQD 1QOKA 2XNAA 1YNTB 3B2UD 4K8RD 4TQEL 1CBVH 4U1MB 3X3FH 4KUCF 4NJAH 1X7QA 1G9MC 3K1DA 1LILA 2I27N 5ESAB 3BKMH 3EYFA 2ZUVA 5D1QC 5HHOB 2XZAH 4QRRB 4PP2B 4LSVL 5DUPL 4X9IA 2X4NB 3IDJA 3OAYK 4TSAL 2DYPA 5J9PB 4WEMB 5D7KE 3S1RI 2ZNWA 3MYJB 4ZS6C 1S5IL 4Y19E 3VXNA 5BQ7A 1G9MH 3W2DL 1KLGA 1CLYH 2C3WA 4JFOA 4Y19A 2FIKA 5I66A 3G5YB 3HG1D 3O81A 4GUPB 1IFHL 4UTAL 2D0HA 3P2TA 4NNYB 5HHXL 3QO1B 5ACMA 5GJSL 1R24B 2VZSA 2X5PA 1GRWA 3GSNB 1HCFX 3ULUC 5FHBL 4OCSL 4NBFA 5I8KL 5ALCL 2HMIC 3IDGB 1K8IB 1G1CA 3PWPB 3MUZ1 1FHGA 1F3DH 2YA2A 4KPHH 3C60C 4LCUA 1EBPA 3ZT6A 3ULUH 2V7HB 1IC5H 2JJSA 1MCPH 3LEVH 3T3MF 1JNHB 5KZCB 2MQCA 4PY8J 5GRVK 4HWEH 5FYKE 4R0LB 1HILB 3K74B 5D5MB 4ZFOB 1ONQB 1VFMA 2J12B 4PGEA 4PJIF 4EN3D 1D7FA 5FXCH 2VDQH 3N1MC 1FN4A 3HMXH 1UEMA 2OZ4L 2YPVL 4YAQB 3SPVA 1TQBC 2CUHA 3BP5A 3LIZH 3OHXA 3OAUL 1NANH 1F4AA 2ICWJ 5J8OA 2R39A 4JM2B 4JFEE 4G80A 5K9KA 1NDMB 3UJIL 5DK0A 4MQXC 5D71L 2UYLA 4JFEA 4M6NL 4DGVH 5AD0B 2V5YA 4YHOH 4NCC1 1QFUL 3UTPE 4M48L 1RZ8A 4FN0A 4HIEB 1KN4H 3VFTB 3F7RA 1ZOXA 3QPQD 1KYOJ 4PYGA 5BZWA 1N6QL 1R5WB 2Z4QB 4W4OA 3RZCC 1G6RH 4D0CB 1N2RB 3GGWB 2R1WB 4JHBA 4U1HB 4F9LC 3LZFH 3QDJD 4GKNA 4JAMB 5GZOC 5GGTA 2ADIA 2X4PA 4NNXB 1P2CB 3F7YB 3QUZC 5IM7A 2BVQA 3DUUB 5CGYC 3OXSB 1F58H 4U6XB 1YYMH 3AMKA 2JKXA 3SKNA 5B38A 4JVPA 2VDPL 1KB5H 4XCCH 5BMFH 4X4XB 1IGJA 5LGHL 2OM5A 2BNUB 2E8ZA 1IM9D 1JGLH 4I9WD 3WHXB 3WJLA 4LGSB 4NSKB 5BRZE 1CIUA 3PL6A 5F9WC 1MSPA 5C0JB 5E03A 1SEQH 1JPFB 5IB5B 4JANA 5C0GB 5BRZA 4HF5L 1ZT4A 2V5SA 2EIZB 1I4FA 2DBJA 1BGXL 2DWDA 4WTXA 1C12B 4HC1L 1T5XB 3GJFH 4NQXA 3MV9D 3GTMI 1HYSD 5C09E 4HAFA 4PJ5B 1V05A 5C09A 3KHOA 5D7IB 2ZCKL 3EERA 5GS1B 2X4OA 3P0VL 1TDQA 8FABB 4LIQL 3VFVB 1EHXA 3QI9C 1CT8B 2VH5H 5B8CB 2Y06H 4RZCB 2BJOA 3EFDH 3TVMC 4YGVA 1CLOL 2R1YB 5C86A 3C5SB 1EEUA 3MLSH 4G7VL 1UM5H 4M1GL 3JTSA 1LK3L 5INDB 2P46B 3D85B 2D7QA 1I7UB 2IBGA 4Z8FL 1I85C 4L4TB 4M6OH 3TO4A 5MHSE 1CCZA 3RBSA 4IDLA 4PS4H 4RMVA 4O2FA 4JDZA 1T4KB 3U4AA 4MDJB 3ROLA 4EBQH 5ICYA 2DLTA 3QIWB 4X99A 4POUB 4LK4A 3SGJA 3VH8G 2BSED 1YDPA 4NO0B 1A6TA 1ROWA 4JKLA 2A2QT 3HC3L 4WEUD 1QBML 4FMFA 4HJ0D 4D3CH 3QXWA 2NY4C 3ARFD 4L3CA 4NQDE 3DI3B 2HA1A 5INCA 1L7IL 4EJ1C 4ZXBD 4NQDA 4WO4C 2DDQH 4PREB 4P23C 4K94L 2XYCA 4WW2B 1HI6B 3WD5H 4KKCD 2CDEA 2C1OB 3KPSD 2GY7B 4WWKA 4XXCC 4CDHA 4U1KB 5CCKH 3L3OA 4U6TA 3AU1A 5D7LB 1SQ2N 3DX6B 3HZVA 5D7JC 3T0EE 2FHFA 4MA1B 1DQTA 2EE9A 2H32H 4E0RA 4AEFA 3T0EA 1OGTB 1KEGL 1QSFE 4HIJB 1BBJB 3TPUB 4NQSA 4KK6D 3TBYB 5I1HL 5FGCB 1QSFA 1MCIA 1T2XA 4JPWH 1V3LA 2YUZA 3HPLB 4ELME 5CP7B 3B9KA 2F54E 4HUWB 3SDCA 1TPXB 3HPJB 4ELMA 2BNQD 4XPBH 2Z91A 2F54A 1U8PB 2HH0L 4N9GB 4UDUA 3RIFF 4P59H 1TMCB 5JPNB 5HVWA 1WGOA 5CEXA 1CZ8L 5DFVC 1Z0NA 4R7DB 4NKIL 5T33L 2HG5B 1P4BL 3OGCB 4LHJB 1K3ZA 3CPLA 4NPYA 4ONGH 4MQ7B 1CYGA 4WI9A 3PDOA 1KYOK 3RWHB 1DFBH 2G75B 4M4RA 2GFBB 3TA3A 2DAVA 2AEPH 1NUGA 4S1QH 1KCSH 1OGAD 1YN6B 3JWNC 4GMSH 3FKII 1OD9A 1H8SA 3PWJA 4J3OC 5FKAB 4AIZA 1PG7H 3QUYA 2DMCA 1DL7H 2JJSC 1MCCA 4WW1B 1S7UB 1T6WA 1IILE 4OAWA 3H42H 1MIMH 5F3HB 4JO2H 3MRRB 3MNVA 3KPPB 5KVFL 1Q0YH 5L2KD 5JIIA 1NGPL 1T0NA 4YR6B 3BJ91 1H15B 3MBEB 3TBVA 5HPOA 3F7VA 4LSPL 3BXNB 3FB6A 1SBSL 1RUQL 5F7KC 4EDXA 2EDQA 3CVIL 2HTLC 1OAYL 4KJPD 3KDMB 4A3BI 3MRLA 1YN7A 3VGHA 3L7EB 4MA7L 5AZEH 3O2WH 5T5NG 2R0LH 4JFDB 1J1OL 4BZ2H 5EPMB 2GJZB 2X42A 1YMMB 1UEYA 3GRWH 5FUOH 1UQSA 2D31B 1RPQA 1N5YH 1EAPB 4IIQB 1Y18A 5J3HD 4LCWB 5TQ0H 3L7FA 3UZVB 4NCDA 3GTQI 1QRND 5BVJB 3QEHB 2QL1A 1J0HA 4X6FA 4UIKH 4M7ZB 5F72S 3U46A 1GAFL 3OG6B 1LO0H 4N90D 3NFPB 3L95B 4HS6A 3ARGA 4WFED 4MD0A 5GRUL 3JWOC 1MH5B 5DD0L 4M93B 4J8RB 4TRPH 2X70A 1R5VA 1A9BA 1JWUA 4ZPTB 5TF1L 3QH3A 3LH2H 5JNYB 3PDGA 2R0KL 3WJLC 3IXAA 1OARH 3W9DA 3VXSE 5J12B 4YDJB 1T1WA 5JORB 1D5ZB 2WIIB 3FONB 5DJ6B 5KSAB 5I9QC 2EDRA 2FECL 3VXSA 3CXDL 3JWOH 5SWSB 3GTOI 5F1IB 3NPSC 2DKMA 3PL6C 3K4AA 4HKBA 1KLUB 3MLVH 3BH8A 4YXLL 3ZL4L 4LP5A 1T7VA 4Q9QL 1A7PH 5F7WC 1MCQA 4P2RB 1FGVH 2Z8VC 3CIQA 4WNQA 5JIKA 3T0XA 3P30H 2VDOL 4G5ZL 5DVOA 5J06A 5JHLL 5K9OA 2XZZA 4OT1L 4D2NA 5DZNA 1L7TL 5E70A 1CXKA 3QRGH 3T3PE 4PRBB 5IKCA 1CL7I 2R23B 3V9FA 1AXSA 1JRHI 1S8DA 3BZEA 5HHMB 4QTTA 4WU5B 1LD9B 3T0AA 4L4VB 5EU6E 3OB0K 4A3KI 4OZHE 1FLRL 3O41B 4UV7H 2Z93B 3I02B 5EU6A 4Y5VA 2XG4A 1A6UL 2H26A 3T77A 4B41A 4OZHA 1M7IA 5TE4L 4RNRB 3ARBB 5HDBE 3IDXH 5EIIB 2P24A 2DQTH 2FBJH 4TVPL 4PP1D 3VG0L 1BAFL 3VMPA 4EEEA 5F3BA 3QDME 2YSSB 4QRQA 2DQIH 3RX7A 3TO4C 1CLZL 3EGSA 1D5XB 1YY8B 3QDMA 3LKNA 1KCRH 3BX7C 1IC4H 2WMPA 5GJTH 1T66D 1U8LA 2F15A 3CFCH 3OR6A 1OWWA 1IGCH 1WQVT 3IF1A 3MRCA 5D1ZD 3F5WB 4YBQD 2YEZB 5DC9B 2IBBA 2NXZD 3RVTD 2W1NA 1MJUH 1ZMYA 2ZG1A 3GMOB 3QDGE 4HUVA 1X3ZA 3IFNH 4LDOB 4LGRB 1TWFI 2CLZA 3QDGA 4DVRL 3MRDA 5D4QA 5HYSG 3MOAL 4MD4B 2ITDA 3QEGH 4XNZB 3P11H 3SQOH 3VXPB 3DOSA 4OQ1A 5I1EL 4RISL 4UT9L 5CIPH 4XAKE 2P49B 4WWKC 1IT9H 3L5JA 1CFSA 3SJVD 4FTVB 3PHOB 3WN5C 1R3KB 2A74B 1E6JH 1Z6JT 4L3EE 4HUNB 2V2WA 3FT2A 3BP6A 32C2A 3QEUA 5D6CB 3TT1H 5FHAL 3T0EC 4L3EA 1QO3B 5C70A 4RGNC 4LHUD 3WHE0 4LNRA 2JJTA 3O3DA 1UZ6F 1G9NL 4H5SA 2WUBH 4XVJL 4MB5A 5D2NB 4YHNA 1MREL 1LP9B 5E8EA 4N8CL 3C5JA 2DLHA 4CVXB 4U6YB 3VI3F 1XR8B 3SDCC 1OWRM 3BJLA 1AR1C 2WW8A 1T5WB 2JB6B 4PG9A 1AGBB 3VH8B 2NVXI 3HFML 5KW9H 4K3EH 4MWFB 2Y07H 4RFOL 2R7ZI 1JGVH 3B9DA 4A3LI 3HOXI 2FLBT 3X3FL 4NJAL 3O9WB 3VXUE 1FVEB 3ARDC 3QBTB 3TEUA 2XZAL 2ATPA 1ZLWK 3VG9C 2CDFA 2VLJB 3VXUA 3QHFH 1BEYL 4LPXA 4BY7I 1HSBB 3MLYH 3UTQA 1TNNA 1RI8A 2E7LA 4OM1L 3TA3C 3T09A 2UVFA 1G9ML 3S14I 3PABA 4JREC 5IJVB 1D9KC 2ICCA 2YUXA 1A6ZA 3C08H 1R3LB 2X89A 2FH8A 1NMBL 1RUMH 3LKOB 3UDWA 3L5IA 1JL8A 3EO0B 5ISZD 4P4KD 2IEPA 1UCTA 1EBAA 1JF1A 5E2VL 4PRAA 3GMLB 4EI5A 1DBJH 1V8HA 1KJMA 3U4EA 2J6AA 3BDBA 1GC1C 1JGUH 1BREA 4RDQF 3DBXA 4LL9A 1AQKH 1ORQB 5HYJD 5I73B 2OLDA 5L9DH 1K8DB 1ZHLA 4KPHL 5AAWA 4R97B 1X3WA 3V4UH 1UYWL 3PE9A 3ZKNC 1FH5L 3ULUL 4CN1A 4ODWB 1MCPL 3LEVL 4WTWA 1G84A 5IWLA 2ERJB 1B0GB 4WCYL 4ZUUA 1XF5B 3L3IB 3EFFA 3I6GB 2PK7A 2ADJB 3MNWA 2AGJH 3F12A 5DZOA 3G6DL 5KTEL 2APBA 5F70A 2IG2H 4DCQB 3BAEL 4N0FB 3LIZL 3G5VA 4AIXA 4LKXA 1H9VA 5AZ2H 2P5EB 3I6LE 4EQ3A 3ARED 1WVZA 3ARGC 2RQ8A 5LXGL 4U7MA 3UZQA 4JHWL 4KTDH 4Y4FA 2DS4A 3E2HB 4DGVL 4YHOL 5C0BB 4P46A 1KJ2A 4CW1B 1FZOB 3MGTB 2VE6A 2GCYA 2J4WL 1G6RL 2P8PB 5GPRA 4LRNH 4WU7A 3I6KA 3O2VH 2ESVE 1AGDA 5DGRA 1TZHA 4H20H 2ESVA 3GB7B 1RJZB 5FO8A 4XBEH 4JPVL 3BKYL 3M1BB 1AD9B 3AY4A 3K4ZA 3TCXA 5IHLB 1RJYB 1F58L 2SEBB 2DQFA 4Z0XB 1NGYB 1KB5L 3LN9A 5BMFL 4OFIA 4LVNB 1JGLL 3NBNA 2N7BA 2I07A 2EYTB 1FVCB 3GM0A 4JY6B 5I18L 2XWTA 3P4MA 4L5FL 2ID5A 5H2BB 1V7ML 3AB0C 1QLFA 2IQAB 2E7CA 4C4KO 1SEQL 5B3JF 5IR1A 4NYLA 3VFGL 1S9XB 1WIPA 2APXA 1A2YB 1KJVA 4QRPB 5E08H 1KCUH 2BSRA 3QO0B 3C8KA 3VA6A 3MUGB 4RWHA 1W0WA 1CWVA 4UNTA 4Y5VC 3GEWB 4RWYH 5JA9A 3RTQB 3LUSA 2DJSA 3PGFH 3K0WA 4TYUA 2B4CL 3FQUB 5C6WH 2FRGP 2J7LA 1BD2B 4GRWH 1CE1L 5DD5H 3GMPA 1G7LA 5DJZB 1MJJA 2YD3A 43C9A 1LE9A 5CEYB 4MNGB 2OJEA 3HS0B 4L8CA 5GZND 2BFVH 3DNKA 2IANE 3IFPA 4NBDA 4XVSL 1DUYA 1RZKC 4OI7A 4NN6B 2IANA 1MWAA 3RI5F 2X1WL 1YZZA 4EUPH 1JV5A 5I75C 1OAXH 3QWOA 5HSFA 3VI4F 2X1PA 4FP8H 1NCWL 3WFBH 4TSBH 2APFA 4E5XA 1E6OH 4X5WA 1HZHL 1AO7B 1KXTB 4WIQA 4GAYA 1JGDB 2Z31A 4QTUA 3S36L 1RZKH 43CAA 1NEZG 1RFDL 4YZFE 5I1LA 1XT5A 4OKVA 4E42B 3G5ZB 5F9JB 1UJ3B 5KN5B 4M6OL 4Z7NE 1OAKH 4J3WA 4MSWA 4X6EB 4OUOA 2OTUA 3KPQB 5DJ2B 4H1LG 1UKQA 3NVQA 1A7OL 2NY2C 3WDJA 3CFBB 3T0VA 1I9RH 3RZDI 1LGVA 4ZAKC 1HHGB 2P8MA 5JW4N 5IJKA 3X3GH 5FYLE 1JWSA 1XF1A 4R96B 3H9SD 1DP0A 1GH7A 4D3CL 1WFUA 1MUJA 1PYWA 2VZTA 2ZP0T 4BZ1H 2FGWH 3NIDE 4YX2L 4KI5F 5BS0B 3D69B 3WFZA 2PW1B 1ZA3A 1EPFA 4J4PA 2G5BB 3CFEA 1RZIA 5EO9A 3GSOA 4O2CA 1DDHA 3QIUA 4FQQA 2WZPD 3E6HB 3L5XL 4F33A 5EIQA 5CCKL 4HK3N 3EKCA 3RUGB 3MJ8A 2B20A 3NCEB 1S78C 1LO2H 4QRUB 5D6DA 5D72H 4A3GI 3L3DA 1LEIA 4PGZA 4FHBD 2GAZB 2VSCA 3FFCE 4MXQC 1B0WA 4OCNC 1KNOB 4IMKA 4TSCH 3FFCA 1FPTH 1F45A 1G7HA 4JPWL 1SFOI 4ODHL 3BWAB 3SBWA 1UKTA 4JFPA 5HYSB 3PP3H 2E7LC 4X7CC 2NZ9D 2AJUL 1CD8A 2Y5EA 4LVHB 5HPMA 5F89B 4XT1C 3FAWA 1EK3A 4XPBL 4PRNB 4IMLA 4P59L 1MCRA 1ZLWH 4PJ7E 1LE5B 2CUMA 4X5XA 3FT3B 1K2DB 1IL1A 5TDPA 5KVEL 4TVPD 1IAIM 3MROA 4PJ7A 1I3RB 4EI5C 4CU8A 1INDH 4G9FB 1W0VA 4LF3B 5F8RC 3ULSB 1ZHKB 1ETZB 4FXKB 4IRJA 1KCSL 2XTJB 5ENWA 4S1DD 3UTSB 5DMYA 5KAQG 3MNZA 5E9DB 4P5TA 4RIRA 3VFWA 1JI2A 4FZEH 4KJYB 2VLLA 1L6XA 4DN3L 5KS9E 1DL7L 4Z78A 5H37G 3ROOB 3DMMC 4XCEA 4ZO9A 4PRHD 3LDBB 4AENB 3H42L 5KS9A 4UDTA 3IJHA 1YNLH 4X0KB 5EOQH 3RWGA 3MRJA 3U0TB 5TPWH 4OD2A 4PJFB 3NA9H 5HGBA 3OZ9H 4JPKL 4MS8D 3U79A 4F7TA 5FYKL 4GT7A 1JTOA 2R0LL 4JGJA 4BZ2L 2ICES 3KWWB 3WSQH 4FQCL 5C08B 1T2QH 4QHMB 3WO3B 3GI9H 2C5DC 5FUOL 4GRLB 3S8WA 1FYTE 1N5YL 3NFSH 4OZIE 3SE3A 4J3UA 2BY2A 4ALAH 5TQ0L 3MFFA 1B88A 2YD9A 5T1LB 1FYTA 1JZ7A 1DBBH 3VFUA 3GTMS 4OZIA 5TGBA 2A1WH 3BKJH 4UIKL 3WNLA 1LO0L 5L8LB 4C56E 3I07A 3OJ2C 4D94A 4EVNA 1U8KA 3WIIL 4TRPL 1FO0B 1MJ7H 2WSKA 4C56A 1VGKA 4HZAA 4KK8C 1T04A 3HOUI 3TYFA 3G9VA 4MLIA 4DAGH 1P4IH 3KG5A 5EU4A 1OARL 1F90L 4JPIA 4ZFGL 1UC6A 4XTRD 5IIEA 3WFCH 2VSDA 2B63I 2X4SA 2XWBB 3JWOL 4HH9B 3LOWA 3SCMD 5IESL 1HINH 3BD4A 3JUYA 1NJ9B 1LDPH 3V5HB 3HG1B 1C5DB 2AK1H 1RY7B 4MXWH 1QR1B 1A7PL 3BZFB 3QAZB 5CMAB 1LO3H 1FGVL 4BQ6A 5D1QD 4D9RE 1YUHA 5EZJA 3GSNH 3P30L 3V0VB 4BZYA 3EDDA 2HRPL 4HWNA 1NC2D 4XX2A 3FO9B 1NCNA 4PJAE 2NQCA 4XPAH 4ZS6D 2P44B 4PJAA 1HKLH 4MXVF 5T3ZE 3DURA 3MGOB 4LLMB 4NKDB 5ITBL 1S9YB 1KSRA 4XX1E 3HRZB 5K59E 3RHWF 1MHPL 5DMIH 4UV7L 3D0LA 1JZ3A 2R0WL 4EN3B 3BGMA 4I2XE 1RIHL 2HMID 3KAAA 3RGVA 2HN7A 1KCLA 2DQTL 2FBJL 3D3VE 5F7DB 4I2XA 1BQHA 1JNNH 1BZQK 2JNYA 3C60D 1LO5A 1GZQA 4IBLT 3D3VA 4MJ5B 1MQKH 4Q6IC 1RK0B 3ORJA 5AYQA 1S7QA 1TJIH 3ULUF 5IW6B 3IKCB 1IC4L 1CXLA 5GJTL 4OSUH 5E5MA 2A83B 3CFCL 3ZKXB 4YHPA 1NBYB 4M5YL 2VO5A 5IJKC 1IGCL 5CD3B 3KXFE 3E1F1 3MOQA 3QDJB 4YH6A 2NYYC 2X2YA 2C4XA 3IFNL 5IB2A 4FFYH 4M8QA 5DMKB 1DQQA 1FDLL 4KHTH 4MQXD 5EOCH 3RJQB 3O8XA 3P3YA 3O3BA 3QEGL 3SQOL 1ZHBA 4KZDH 3HZYA 2PETA 1IM9B 2UVEA 1A6VH 4UINL 3PO2I 4F2MA 3RZCD 1E6JL 5D6DC 2XA3A 2H3NB 3B2VH 1CICA 2BSSA 3Q3GA 5DVLA 5GZOD 3HOVI 4LVOC 2F53E 1NEZB 1OLLA 2V6HA 5IK3A 4U6HB 1MOEA 2EDTA 4LLWB 3QUZD 1OM3H 3QWRA 2F53A 2CIIA 4JFZL 4U4BA 1SHMA 5CGYD 4CGTA 3SBWC 4HJGB 4J3VA 4PJGE 3T1FB 1DQDH 3MV9B 4OTXH 4PJGA 7FABH 2XQYG 2Q86B 1FSKC 3UBXG 5IMLB 3QEQD 3ZKMC 2XZQH 5DD3H 2P7TB 5ECJE 1AJ7L 5JUEH 1KCVL 4K3EL 3NZHL 5SX4I 2XN9E 1Y0LA 5IFAH 3EHBD 3PO3I 4NUJA 5T3XH 1FE8H 2XN9A 3T2NH 4P4RA 4UMGA 5HGDB 2BMKB 2GQHA 3HNSH 2YK1H 2ATKA 3MO1B 3QHFL 1TETH 4YK4C 1RUAH 3F8UB 4ZO8A 1TWCI 2UZIH 3MLYL 4G6JH 4JJ5A 1JTTA 2B8OT 3MRKA 5IEKA 1CF8H 3IFOB 3PWVA 2CK0H 2DB8A 4HX1A 2EC8A 3MJ7A 3M4OI 3QIWC 4XPTH 5CWSA 2JS4A 1MRDH 2VIRA 3C08L 4HXAH 4KXZI 3HOYI 1WT5A 2IAMC 1HH6B 3GDBA 4LHUG 5CSZA 1UZ8B 1RUPH 3N1GC 5BW7A 3EYOA 4M61A 1CDGA 4IRSA 4GQPH 4JKPH 5GGRA 1I1YB 4XP5H 2D2OA 1P6FA 3QI9D 3TBSB 5GHWH 1BQUA 5A2IH 1C5BL 2F19H 3DHJA 3UPAA 3V52H 2WAHA 1JGUL 2WBJD 4M6MH 1BVKB 4Z9KB 4OV5B 2VXVH 3M07A 2YD8A 2R0ZH 2F8VA 2X9WA 5I8EA 1KACB 5I8CA 3L3KB 1BFVL 3ARFB 4LQ1A 4R26H 3QXDB 1X5XA 3EO1B 4YHIA 2ZCLH 4X6CE 4ZXBB 1GC1L 3QZWA 4JO3H 1NFIB 4XPFH 5T1KA 3CLFH 1N64H 3KPSB 4RDQG 1I6HI 2QKIA 2W9LA 4MNHA 5CZVH 4U6VH 3S15I 2EKJA 4KHXH 3K7UA 1S7TA 2PW2B 5KSBF 5IBLC 5AZ2L 2RIKA 5DK3A 3N06B 1TPXC 5I15L 2NY4D 1E28B 2ZUWA 1C7TA 1EMTH 4KTDL 1DJSA 4Z7UF 1X5IA 3GSRB 4WO4D 4ZG1A 3IDYB 3VGAB 3WNOA 4P23D 5HJ3A 3KLHC 4PTTB 4QRTA 3CFJB 1WTLA 1JWMB 4JZJA 3MA7A 4HS3A 3T65B 1XF4B 3MV7E 4LRNL 1J0JA 2BNQB 1W72A 3O2VL 3MV7A 5D7JD 4X98B 1OAUH 2VXSH 4MAUL 4ETQA 3U2SB 2DWEB 5ERWA 2FEDC 1HQRA 1INQB 3RDTA 3SY0A 4PLJC 3PWNA 4XBEL 1NQBA 4CVZA 3CZJA 2HT2D 3VFMA 2MJWA 2DYPD 5JPMA 4QT5B 4IHOA 2A73A 5B39A 5JW5B 3RWJB 2VDKH 2C4FT 5EO1B 1XF3B 5J13B 3TYGL 2KZ1B 2W60B 5AG9A 1OGAB 2DLGA 5D7KD 3VGGA 3BPNB 4Y19D 4Z76A 1K6QH 4OJFH 3P73A 4R90H 1YYLL 4MB3A 2VLRE 4YPGA 4WUUD 5DFVD 5I1IH 1KCUL 2A9MH 4NRZA 1TENA 4Y4HC 1NFDE 2VLRA 5L2KB 1UM6H 2QSQA 1JCKA 1QSEE 1U3ZA 5FUZL 3BMWA 4TULL 5HHNB 5T3ZH 1NFDA 4G6MH 2HTKD 3PGFL 1QSEA 5GSVA 1FL6A 3SO3B 4QHNA 4IIQC 3S9DB 3NCYS 4HUKB 1UWEH 3FN3A 3MUY1 1HHHA 1NAKL 5DO2C 2E6QA 1LK2B 4PTUB 1N2FA 3ZE1E 5FA3B 2CKBB 1J7VR 3BGAA 1BLNA 4M93C 2ZSWA 1MVUA 1OAXL 5FYKD 2G9HA 1LEGA 1YPZE 4N5EC 3WFBL 4Y5YA 4ZUTA 3IDMB 1H3PH 1FNEB 1E6OL 4RMRA 4PJXB 1D6VH 1I3VA 1QRNB 1YPZA 2MCG1 1FG9C 2FBOJ 3D87B 2MFNA 5AYUH 4PPTA 2V9RA 2HTLD 4G7YH 4NDMB 2O5ZL 4QXUH 5F7EL 4KVNL 2EH8H 4UAOC 2AI0L 1D6EA 4JFED 3S4SA 4Q0XH 5SX5H 1T03H 2QBWA 1G7PB 2VXQH 3GSQA 5GSRA 1I9RL 4NWUH 2G60H 3UTPD 2AQ2A 3QHZL 1NMCC 3V6BR 2EEBA 2VRAA 1FJ1A 5CINH 4PJBE 3HNVL 1KBGH 4MQSB 1AKJA 5D8JH 4PJBA 3QG6A 3EOAA 2NVQI 3TNNA 1AGEA 1FL5B 4BZ1L 2FGWL 3FQWB 1BF2A 5I30H 5DHYA 4JY5H 4G43A 5DT1L 4PGJA 5L6YH 3LVEA 2WUCH 1G7IA 2Y7QB 4KQ3H 4K7PY 1MCBA 3E6FB 1I3UA 2EYRB 3ZDXE 4N1HB 5J6GB 4HPOH 1QSZA 3FRPA 1PQZB 1UB6B 1EEZB 2J8UE 1LO2L 5D72L 1QNZH 2N7AA 3DX8B 4CU6A 3PL6D 3U30C 2N56A 1BFOA 1QEWB 2X4QB 2J8UA 4XGZB 2EDBA 4R4FH 5BRZD 4EDWL 4GRMA 4NRXA 4DEPC 4YXKH 4TSCL 3GMMA 3Q2CA 4ZFFA 1FPTL 3KS0J 5ID0A 3WO4B 3RIAK 4HMCA 2FR4B 3M17B 2OSLB 1TVBA 4MHHI 3G08B 3VD7A 2N4IA 4OB5H 2HJFB 1GGTA 1QG3A 5HDQH 5C09D 3U7YL 2IADA 1ZT1B 2ICWA 1FFNA 3NTCL 3SKMB 2X4UB 3MLZH 3O4LE 4IRSC 5ACZB 1QPXA 4X6BB 1WIOA 2DI8A 3QT2A 4YBLC 3O4LA 4I18A 1INDL 1JZ2A 1U6AH 2YU9I 3SDXB 3D18B 3IXTA 4N0YH 4XNZC 3KVQA 4ZQKA 5D1ZB 1UH4A 4F15B 3UBXB 2AV1B 2I9TA 2NXZB 1U93B 2QQNH 5BJTB 3WFHA 1A7RL 5C2BL 1C5CH 4FZEL 4EOWH 1CGSL 1OQOA 3NGBC 1MVFA 3DHMA 3TO4D 3DGGB 3L3HA 5SWQB 3BPCB 4PJHE 4DGYH 3CQZI 2NLJA 5MHSD 1Z9MA 5EOQL 1ZHNA 3MZGB 2VDMH 4PJHA 4PV9B 5DQJA 1AQDA 1IC7H 3QPXH 5D2NC 3WL9B 5TPWL 2FNBA 4OCRH 5DLML 3RVXC 3V5DA 3QDHA 3DYPA 4KDVA 3NA9L 3V2AR 4K2UH 3AAZA 1URLA 5I16A 2R2EB 4LHUB 4Z6AT 3WS3A 1TZGL 4NQDD 4IS6A 3WSQL 3D0VA 1T2QL 1A22B 4HG4K 4MH4A 3CK0H 1DUZA 1QLRA 3GI9L 5IHUH 1KPVB 3TV3H 2RFXB 3NFSL 3MV8A 5LJYH 35C8H 4WWKD 1QFHA 4ALAL 5I71C 1OW0A 3MCLH 2DMKA 1HHKA 4MAYA 4XWOC 5HDLA 1CGVA 3MLXL 2P48B 2A1WL 1XGTB 3FQTA 3BKJL 4GAFB 4HIXH 3QNXB 1KJ2L 1D5BA 3RDTC 3T0ED 3DSFH 4RGND 4RMQA 5JIHA 4BBRI 1NCCL 1QSFD 5CBEA 1T1ZA 2GUOA 3G5XB 4KKLC 3ZLQC 4D9QE 2A6JA 4C83A 2D7OA 3FTGA 1X5GA 1FG2B 2XA8H 3WFCL 3SDCD 4L3AA 4M7LL 4CNIA 1AR1D 1RHHA 1AY1H 2GHWB 3X14B 1Z5LB 4O2EA 5I73C 2CR3A 5MENE 4JB9H 5JHDE 3GSWB 4MXWL 5ISZB 4P4KB 2P5WE 5DR5L 3W0WE 1V3MA 4W68A 3RVVC 4N0CC 5MENA 4QHLB 1S7XB 1EFXA 3OWEA 5JHDA 1Y6MR 2GYSA 2P5WA 3FZUC 4O51A 3W0WA 3GJEB 4CJ1A 5IBTL 4KMQA 4E41E 3VW3L 2ERJC 3BRDA 4LLDB 1FL3A 2BHYA 2PCPB 5HYJB 4Q9RH 3TA3D 4E41A 4XPAL 1HKLL 3QXAA 4RAUA 4YFDB 3CJJA 3KJ6H 5GGQH 3B83A 1D9KD 3PGDB 2VR9A 3RNKB 2HKFH 2AV7A 3V4VL 5FCSH 1UCBH 3QUYD 3ALPA 1GL4B 2W92A 1PZ5A 3PWLB 1NPUA 4ONHA 1A4JB 4JN2A 2BVUA 5DMIL 2HVKA 1M71A 1NDGB 3VXTA 4GXVL 3ZTNL 4OI8A 1FAIL 3E2HC 4Y5YC 2BVOB 5GRWA 4FZ8H 4IRZH 1VADA 3REVA 5H35A 3WDHA 4P57A 1NLBH 1JNNL 1BIIB 4FQJH 4X6DF 3AREB 1HEZA 1HXYA 2DIBA 1RLYA 1IAIH 3ZKND 1MQKL 1JIBA 2YC1B 1TJIL 2OS7A 4YWGL 2ZUYA 1IGYA 1M7DA 1FYHB 2EIBA 5CD5C 5L0QB 3G6AB 4HUXB 1AGFA 3GSUA 3P9MB 2NW2A 3MACL 4YHLL 1UB5B 1J8HE 1AP2B 3KJ4B 4NBEA 1J8HA 4FFYL 2LTQC 2ZOLA 3ARGD 3MTRA 2ITCB 3CD4A 4KHTL 1Q9OA 3OKKB 3N9GL 4EQ2A 1J05B 3ARVA 2MPAL 2AP2A 3ZE2E 4Y8AA 1BVLA 3STLA 3STZB 1A6VL 3A6OA 5E94A 3PWUB 5IHZA 4JR9H 3OQ3B 3VXSD 4PR5A 3VFOA 3VGBA 5EH1A 1IEBB 3B2VL 3RBGA 5KG9B 5C0IA 3NN8B 3VWKA 5FB8A 3V6OC 2APVA 1NGZB 1OY3B 4NKOB 5LCVH 1YJDL 1OSZA 5DK2B 4UILL 1B6DA 4F3FA 4TTGA 1KTDA 1QRKA 4OTXL 4XC1H 3U9UA 7FABL 5IMOB 3DETD 3ZYJA 1JUFB 5J56B 1T80A 1NGXB 4BQCA 3GSVB 4LSRH 4GLRI 1IGMH 5JUEL 2PO6A 3BP7B 3FT4B 5GS0C 3MCG1 5IFAL 2OQJA 3U0WL 3L3GA 2HJLB 3GKWH 3DUSA 3CFKB 3H3VJ 1I1FA 5KSUB 1A3RH 4Y8DC 3HNSL 2YK1L 2OBGA 3SO5A 1ZGLA 3A6BL 1RUAL 1UJ3C 4Q74A 4R4BA 1E4KA 1OF2B 2UZIL 5EU6D 3LKPA 4PGCA 2GKIA 4G8IB 2A6IB 1P7KA 4L9LB 5DUMH 2JE8A 1WFTA 4POZD 5C8JA 1A6WH 4Z95L 2AJVL 2PF6A 2HFFB 4W70A 1VENA 1MRDL 1A9EA 4HXAL 5CHNB 4NCC2 5DJXB 3VGEA 1OLZA 4GRWF 1C1EL 1RUPL 4HGWB 4UIMB 3QXUA 4X4YA 4I4WB 4JKPL 4JLRB 4C4KT 3QDMD 5IW1A 3MLTB 5I1DB 5E95B 1ZWIA 4OF8A 4U1NA 5GHWL 3BH9A 1JZ6A 4QXGH 5FEBA 1KXQE 3GTKI 4P2CG 1MFNA 5D7SH 2F5AL 3IS0X 4M6ML 2VXVL 2FDBP 4OM0H 4KK5C 2R0ZL 2H8PB 4J3XA 2UWEB 1N26A 4B50A 1RD6A 3BD5A 1ZS8B 3H9SB 1OT2A 2AQ1A 3PQYE 4MCYA 5CGTA 2VXUH 4PBVC 4X80H 4KVCL 1FQ9C 4GFTB 1CXEA 2IPKA 3PQYA 2ZCLL 5FK9A 5ADPL 2R1XB 2A0LD 2HAZA 3HUJE 3K2UL 1A6AA 1MCOH 3QDGD 2IQ9H 3LPFA 1PLGL 5DJAA 4XCNA 1WFOA 3HUJA 5CJOL 1ZVYA 3CLFL 5ESQB 3IU3B 2NY2D 4HK0A 2P42B 5FF6B 1NAMA 4ZAKD 4U0RB 5EUOE 4U6VL 5I2IA 4XAKD 1XIWA 2FEEI 3S96A 3VFPA 3NIFE 4LVHC 3BVNA 2NX5E 4FQ2H 4URTB 2W0LA 4NM8H 4L3ED 5FM4A 3JXAA 3KPRE 5JLZB 3UZEA 2NX5A 1EMTL 4KGLA 4O9HL 3KPRA 4N8VG 4MD5B 3BW9A 5BOPA 5ACLA 3ULVH 5I17A 2Y72A 5L88H 3DX9B 1A47A 2AXGB 4ETYA 3IAQA 3K46A 2EECA 5CJQL 4NQEE 5CSBA 4LSSH 4Z5RA 5I0DA 1J8KA 1EIBA 2CO7B 4QXWA 4NQEA 1S78D 2VXSL 1CD1A 2AJ3B 3PXHA 2XTJC 1N4XH 2EKSB 1KG0A 5IW3A 2VDRH 4MXQD 2E6PA 1FGNH 5T1MB 3VRJB 1NLDH 2GITA 3U0PB 3VXUD 5FGSA 1PFTA 1QACA 2Q7YA 2YZ8A 3HE6A 1KTKE 3LDBC 4WFGE 2QHLA 2VDKL 1U8OB 3O3AA 1SYSA 5E2UH 2XKSA 4QOKE 4BH7A 3T2PA 1U8IB 2X89D 3EBAA 4QOKA 3QQNA 1F2QA 2AJSH 4R90L 2QR0A 1KV3A 4PRHB 1Q9KB 4XNQB 5I1IL 5DD1H 1ODAA 1CFQB 3S3SA 5CJBA 4YHZH 1UM6L 2VUYA 4EI5D 1X5LA 5F1OB 3BO8B 5T3ZL 3LS4H 3ZE0E 4AG4H 4MDIB 1CTNA 1S9WA 5EWIH 1VKXA 4X9HA 4ZFOA 3X13A 4M6AA 3QXTA 4Z7VB 2XQBL 4M5ZL 1UWEL 2YZ1A 4YDKL 5EU5A 1KIUA 4Z7WE 3LQAC 4M3JA 1E4WL 3O3EB 2JCCB 4JM4L 4K3JH 3ILQC 1TVHA 3B2UC 4WV1B 4Z7WA 3VXOB 3O3UN 1DQJA 1YEIL 3BESR 5I19L 3TBWB 3W82A 1BOYA 5FA4B 3BPLC 3J7HA 1N6VA 2V2TA 2YBRA 3BHBB 1CXIA 5I76A 3LQAH 3S97C 4KV5E 1H0DB 4HMDA 3WEXB 1R5WA 2D7PA 2GTZB 3U6RA 3QG7H 4UT6L 4G7YL 2D4DA 4JEGB 1X6NA 4V2BA 3KS0H 3VE0B 4JZOB 5FYKU 2EH8L 4BXXI 3I6LD 3OAZH 3NFNB 4U05A 4Y4FD 4Q0XL 4NBAA 1J0YA 4HFWB 3HA0A 4KROC 4OFPA 4P0DA 1XZ0B 3QAZC 2W0FA 2E2II 2BHUA 3G6JF 2R2BB 5E00B 3F62A 4NWUL 3N85H 1A5FH 2G60L 4GQ9H 3UPRA 1XCTB 1DEEA 1I8KB 1ZXQA 3SCMB 1KTLB 5J6HA 2ZSVA 5CINL 1KBGL 2XG5A 1V5JA 1CXFA 3OKMB 5EFIA 3NH7H 4RGOL 1WWAX 3QHTC 2ESVD 2C7UA 4G8EB 1U8MB 3H7BA 5EN2A 5D1QB 3EYQD 4NKQB 4OZGB 5I30L 5IB5A 1U8HA 5C0GA 4D8PB 2X1XR 2MSPA 4JY5L 4KK8D 4OBSA 2WUCL 1NC2B 4LLYB 5HI4D 4HGKC 2Y6SC 4XBGB 1MJ8H 4LRIA 2JA8I 2CLVB 5ETUB 3TGXA 4ONOA 1UA6L 4HPOL 1V3KA 1YEKH 2PO6C 4F8QA 1QNZL 4MJIE 4OI9A 1WWBX 3DV4B 2PUQT 4X4ZA 5JXEA 1X5KA 2NTFA 3OKOB 3OMZA 4LCYA 4R4FL 4MJIA 2EDNA 1IM3B 3DVFA 2H6PB 5TE6L 3HE7A 3HLAA 1FCGA 2RCSH 4HH8A 4L29B 3SGKA 3N1QC 1I8IA 1I1AA 1CT8A 5F6IC 5KZCD 1TVDA 4CUCA 3V6ZB 4PLKD 3FQXB 3FO0L 1WCBA 2VL4A 3G9AB 3QPQC 4OB5L 1P7HL 1HNGA 2VABA 3C60B 4HD9A 1AXIB 3K1KC 1AIFB 4Y5XA 5IMMB 4QHUA 1SVCP 3PJSA 2YMXL 5FECA 5B38G 3K8LA 2IAND 4O02L 2VL5B 4C58B 1UXSA 5DJCB 4JN1L 3I50H 3WIFB 3VXME 1NUNB 4FA8A 5D5MF 5F7HA 2VKWA 3LKQB 1WZMA 3BOVA 2ZOKB 4XNXH 3VXMA 1PY4A 4JO4L 1TQBB 5IV2A 2W91A 2Z31D 2AKRA 3T08A 3OKEA 1C5CL 1C08B 4ZSOB 3GMRB 2IALB 4JM2F 3K8MA 1S7RB 1FFPB 4L8SA 5JOEA 4DGYL 1YEEH 1CFBA 2VDML 2IH3B 1GOHA 4XB8A 4BSWB 5IEHB 2O5XL 1U91B 2G2RB 4AEIH 1IC7L 1Q9WA 5HGHA 3JV4B 2VDNH 3RZCB 2FX8H 2C1OA 1K4CB 4OCRL 2YD6A 4L1HA 5CZXD 1PG7X 5GRVL 1ZA6B 1PJ9A 4K2UL 3PIQB 2A77H 4X9FA 3W5NA 2NYYD 4PGBA 3HB3D 4H8WC 3FMGH 1R3HA 1HQ4B 1E4XH 3VRLF 1FNGB 3C2AL 4M43L 2DQGH 3UROR 3FO2B 2C1PB 1WBYB 1USPB 1W0YT 2MHAB 1AXTL 1WBZA 3T4YB 5C0DA 3KYMA 35C8L 4ODXA 4RA0C 3QIUD 4A2MA 4HCRA 2Q8BH 3MCLL 3QEQB 3VCLA 4XZUA 4JRXE 2HJKB 3HHRB 4NJ9H 4C55A 5F97E 3GJFB 1BWMA 5F9WB 4JRXA 3DSFL 5H94A 5JOFA 3FL7A 4OCWL 3O11B 3V5KB 5JPNA 2OL3A 1CDCA 3DTXA 1W72L 2D9CA 2OTWB 3HE6C 2NR6C 3UP1A 2HFEB 4WDIB 1KPUB 1FZJB 3V8OA 2XA8L 4MQ7A 2F4OA 1G7JA 1AY1L 1JK8A 5LBSH 3MMEB 2G75A 4YNYA 5EBMB 1B0RA 3EJYD 3BUYB 4ZNEE 5D7IF 1ES0B 4XMLH 4JB9L 5ELIA 2J6EH 4ZNEA 2XFXA 4QXTB 2O5YH 3MRPB 3QI9B 1F3JB 1OHQA 3JSSA 1ACZA 3EZ8A 5E24E 1J10A 4WW1A 4K7FA 4LLVB 1IZKA 3S37L 2WBJB 3TNMA 4FQHB 3KPPA 4IRJD 4KKCC 4ERSL 4HXBH 1FVDA 2LE9A 3KJ6L 4PJ9A 4ZTOL 2HKFL 4P5TD 2IAMD 3DX7B 3LEYH 1A21A 1UCBL 4LSTH 4FQXA 2BOCB 2KH2B 4K7PH 4NO0D 4FXGB 1GIGL 1RULH 4G3YH 1IE5A 3ARYA 3VWJA 4PJEB 1S7SA 5LKNA 5D70H 3CCHA 5FFLA 4A3DI 2QADD 3DIFA 3MJ9H 5LGKA 4NC1C 5DQ9A 1QLEL 2HFGH 2O26U 4FZ8L 4IRZL 3VGAC 4UV4L 4Y88A 5E8OA 1ITCA 1DLFL 3MLUH 1BM3H 1A8JH 2FX7L 4FQJL 5TDOA 1KC5L 2EDWA 4G6AD 2NY4B 4FFZL 4F8TA 3UEZA 5H37H 2AXJA 3INUH 3QQ4A 3FQNB 4PRDB 4WO4B 3L9RB 4P23B 4M1DL 4TTDD 5MERA 4RFEB 1V7NH 4WW2F 3LMJH 3O2DH 1X5ZA 4ZPTA 1RZJL 2IBZX 5JW3H 2K7PA 3VFRB 2DQHH 1FYTD 1CVSC 4OCLC 1CDHA 4NBHA 5DRZB 3RRQA 2X7LA 2WIIA 5D7JB 5L8JB 1T89A 3ECBA 4RA3A 5IBLD 4OD3L 5TF0A 2IPTH 3OXRA 1PAMA 1X7QB 2O61B 4CU7A 3EYFB 5D1XA 5FO9A 2BY1A 1KLUA 4RBPK 4YLQT 4C56D 1RJLA 3IDJB 4XP6L 2C3XA 2DYPB 5I1JH 1CK0L 1OPGH 4M62H 3GTLI 5BQ7B 4JR9L 2H9GA 1KLGB 4JFOB 4Y19B 4PJCB 1AE6H 1RIUH 3S2DI 3CSPA 5I66B 5JXEC 1EGJH 2VQ1A 3QR2A 4GW4A 5LCVL 3SE9H 2FEDD 3S1NI 4KJPC 1U8QA 2NCMA 4PLJD 4NP4H 4O58H 2BVPB 2LABA 5JQ6H 4XBPA 4M4PA 1I1AC 3RWEB 1BOGA 4D9RD 1NANI 3EOBA 4XC1L 4FQ1L 2DJ4A 1MI5E 4XMKH 2D7TL 4LSRL 3V0AC 3FO1A 1YEHL 1K9TA 1SMAA 3WKNA 1TIUA 4M1CC 1G7QA 1MI5A 3QUKA 4HHAB 4LCUB 5T3ZD 3FN0H 5IVXE 1NC4A 3OG4B 1MF2H 4GG6E 3WE6A 2CKBH 5DI8A 3ZZ1A 4C57C 5JW4R 1A3RL 5IVXA 1MFBH 1MRFH 3Q1SH 4GG6A 4A3MI 1BHGA 4Y4HD 5GISH 2AXHA 4DKFL 4JFDD 2P47B 4AJ0A 3ARXA 4PGEB 6FABL 5GS0L 1FN4B 3RGVD 3SPVB 5I1GL 3BP5B 3OHXB 2JJWA 2FYYA 1DBMH 3D3VD 4PJDE 4L8SC 2UYLB 4JFEB 1L0YA 4PJDA 4WI6A 2E2HI 4YHKL 1RZ8B 2FIRT 4QXGL 3K81A 5F9DC 4A3EI 4LSVH 5BZWB 5DUPH 4N5ED 4OM0L 4MD4A 3RPKA 1N5AA 3ABZA 4FTVE 4GKNB 1RHFA 4FTVA 4X80L 1S5IH 1R3KA 2ADIB 3KXFD 4XAWL 5E1AA 3W2DH 2X4PB 3VDBA 1YEDA 2V5RA 5IM7B 2BVQB 3HN3A 5SWSD 2IQ9L 2Q6WA 2BY0A 3SKNB 3NCMA 4G8GE 2A9NH 5B38B 1IFHH 1FRGL 4UTAH 2LQRA 1E4JA 1ZANL 3PF2A 5HHXH 4G8GA 5GJSH 1A4KA 3MQIA 3S98A 3RI5K 5CS7A 5I9QB 2NTSP 4A6YA 1LNUA 3U36A 5I8KH 3PL6B 4FQ2L 1T5WA 4YFLF 1DN0A 1CS6A 5BRZB 1T1YA 4NO2B 1WAAF 1ZT4B 4LASL 3QWRD 2F53D 1I4FB 4LCCA 2EEDA 3O9WA 2NY3C 1A0QH 5KSVA 3WJJC 1MCLA 2DWDB 3O6FA 2DBLH 4ELKA 2VLJA 3V7MA 2LU4A 5SWZE 5GGSA 5C09B 2X4OB 5SWZA 4YBQC 2YPVH 4NGHH 2NXZC 5ANME 2XN9D 3OAUH 1NBQA 5F96L 3LKOA 5L2JA 3ARUA 4S0SD 3RY6C 3MFGB 5ANMA 3MRBA 3FQRA 3UJIH 6CGTA 2BRQA 5D71H 4M6NH 1I7RA 4GW1A 4XP9L 4YGVB 3QRFM 3ESVF 4UUJA 4M48H 4YEEA 3RY5A 3JTSB 5C3EI 5D2LE 3MRNA 3SKJH 4FQXC 4KWUA 1SY6H 1UACL 2QTEA 3IJSA 5D2LA 3TO4B 3EYSH 4IRSD 1FIGH 2FZ3A 2WNGA 2BP3A 4O2FB 5ICZB 4JDZB 3ROLB 5GS3A 1P5UA 5ICYB 4YEFA 4X99B 3LS4L 4OLVL 4AG4L 1KCKA 4G6FD 4I0PA 1NGQH 3GMNA 1YDPB 2ADJA 1QQDA 4I3GA 1A6TB 4HGMA 1MHCA 3I75A 3I9GL 1MY5A 3RPIA 1MFDH 4L3CB 5C0RL 3S35X 5INCB 1XH3A 3IVKB 3GHBH 4NQDB 1AR2A 5TQ2H 1S3KH 4L8BA 2VLME 3VFNA 1K4DA 1KPRB 4O5LH 4WWKB 1ZLSH 2DQEL 3L3OB 5LAXA 3HZVB 4JRYD 4HC1H 1T89C 4PRIE 5E4IA 3QG7L 3RVXD 4E0RB 4PBWD 3T0EB 4IOFD 1B2WH 4PRIA 1N0XH 5FYJH 5GQBA 2ZCKH 4NQSB 5MP6H 1QSFB 1DLHA 4HLZG 1OL0A 4LIQH 4XXDA 2CQVA 5HXMA 1LP9F 3ES6A 3TC9A 1J1PH 2H41A 2VZ1A 4IDJH 3SDCB 2I60L 4ELMB 1U3JA 2Z91B 4XWOD 1X5JA 2WWMC 4U1IA 1GYAA 2KZWA 2VB5A 5CLTA 4UDUB 5JA8B 3MV7D 1T21A 1CLOH 3NH7L 5CEXB 3VXRE 3RDTD 2BJMH 4G7VH 1HSAA 3VXRA 1FC2D 5ITFA 3MRGA 3OX8A 3VG9B 2EZ0D 4LPTA 4Z8FH 2DE6A 3CPLB 4Y89A 3ZO0A 5C2UB 4NPYB 3PDOB 1MJ8L 1T20A 3TA3B 3ETBF 4TUJA 2R4SL 4Q9CA 3PWJB 1ZLUH 1HXMA 3WV0A 4AIZB 4POYA 5E4EC 2NVTI 3QUYB 4HWBA 5MEPB 2DQCL 2MCPL 4OAWB 5CJ5A 3RVVD 3MNVB 3VMIA 5DJ0A 2VLRD 3FZUD 1L7IH 2VAAA 5EIVA 3WMSA 1QD0A 3K7AI 3JVGC 1T0NB 3TBVB 4XC3L 4OZFA 3F7VB 3FB6B 1QSED 3MA9L 3TM6A 1NMAL 4LPVA 1EHLL 4EDXB 3T2QA 4JFQA 1O7VA 3MRLB 1YN7B 3O45A 5CJ8A 2E9BA 4CVWA 1F6AA 5DGQA 3KJ4C 1MEXH 2ARWA 2FJHA 8CGTA 5KN5A 1UQSB 3S5LA 1OAQH 1Y18B 3BKCL 3ZHDA 3L7FB 1GGCL 2NY6D 2C3VA 4HIIA 4X6FB 2C9AA 4NNPH 3U46B 1H3TA 3GI8L 3CFIC 3RX5A 5JMRA 3ARGB 4M7LT 4MD0B 3HC4H 2X70B 4ZUSB 1R5VB 2HH0H 1A9BB 1JWUB 5HHVH 1YEEL 2ZKHH 3QH3B 4AQ1B 3BGFB 4LBEB 1IEHA 3TCLA 1NKOA 1Q9LA 1RIVL 3IXAB 4NKIH 5T33H 3W9DB 2R9HC 1T1WB 5CD5D 3RHWK 4Y1AE 4F7CA 5EU7C 2JLLA 3VXSB 3PNWA 4IM8A 4MA3A 4Y1AA 4HKBB 3UC0L 5E2TL 1AKJD 3BH8B 4DKDC 2JA7I 3RWFA 4U3CA 1TQCB 4WHTA 1NAML 2BZDA 3MX0A 3KPLA 4WNQB 4LCCC 1JYVA 4OGYH 4U1JA 4A6YH 5T5NF 5K9OB 3O6FC 1J5OH 5TH2A 3PDDA 3WYRA 4H8WL 4L4JA 5HYSA 5IKCB 4OCXH 5BZDA 4NJ9L 4BKLB 2DI9A 1AXSB 4GSDL 3AB0B 3BZEB 5IB1A 1RUQH 4AM0B 2AJYL 3CVIH 2BXYA 1JTPA 1OAYH 2XPGA 1IZJA 3PHQA 4L8DB 3TO2A 5EU6B 4Y5VB 2H26B 3R4DA 3T77B 3W11C 4OZHB 1M4KA 4OV6F 1M7IB 3CDCA 3OTTA 5C3TA 2P24B 1ETZA 2VLKE 1T22A 5ILTH 4NO3B 4QF1A 5EZIL 5TE7H 1JGEA 5DHXB 4XMLL 5GS0D 2VLKA 3EGSB 2J6EL 1LEKB 2KQNA 3QDMB 1MIEH 3C9NA 2O5YL 3LKNB 1EEYA 3D2UA 3V79C 3RIAF 5EA0H 1R0AL 3ROOA 4XVUD 1XCQA 2ORBL 3LKRA 5DD0H 3O0RH 3ZYIA 1S7VB 5I75B 2HLFC 4I0PC 5TF1H 3OR6B 4X0KA 2ZUQC 4GBXA 5M94B 3WNMA 4M9PA 3IF1B 3SQBA 4ZO7A 2R0KH 4LPWA 4OGXL 5B4MC 1FFOA 4XP1H 4OLYL 4HUVB 3U0TA 1RULL 2CLZB 1XGYH 1CFNA 3QDGB 3BQUA 1SMOA 3MRDB 1SEBA 4EI6A 4YXLH 4UT7L 5D70L 5CILL 2ITDB 4OQTA 1OT1A 4Q9QH 1Y1WI 5I0ZA 2ZPKH 3MJ9L 2NY2B 3SDDA 2HFGL 4ZAKB 5BS0D 1OP3K 1CFSB 4PY8I 5C4XI 4HEPG 4KK5D 4OT1H 3MLUL 1BM3L 4LEXL 5DUBA 1VACB 1Q1JH 2V2WB 3BP6B 32C2B 3FT2B 3QEUB 2QSCL 4YQXL 4YDLC 3F58H 4L3EB 4ZS7H 3GJFK 5EOTA 4PUBL 5I1CH 4LNRB 3OB8A 3E8UH 3O3DB 1II4E 4H5SB 1QFWI 4YHNB 2FJGA 4EZMA 5E8EB 3LMJL 2X4RA 3LSOA 5CLWA 2PTVA 3C5JB 3BZ4A 5JW3L 3WFEL 3UJJH 1FLRH 4PG9B 4MAYD 4XH2A 2CMRL 1A6UH 2XACC 4KDTA 3RUGF 4LCIH 2EC9U 2IPTL 1C7SA 5DC0A 2JELL 5FGRA 1NJ9A 1BAFH 2IPUG 2ATPB 2CDFB 5IP4A 3VXUB 2VUMI 1QR1A 3OF6D 3T3ME 5F71A 3UTQB 1CLZH 5I1JL 4AK1A 3ULVF 2QV2A 3H8NA 3PABB 4RRPA 4D9QD 4Q6YA 4G9FD 1A6ZB 4PJIE 3WLBA 1AE6L 1RIUL 1GJIA 4PJIA 5MI0B 1FBIL 3B9EA 4HKXA 3RKDC 2JJUA 4JFXA 4O58L 1JF1B 1EFXD 4PRAB 2P5WD 3W0WD 4QNPF 2CLRA 4EI5B 5JQ6L 3IAPA 4WV1C 3U4EB 2AEQL 1VGEL 3DBXB 3PXJA 4NBZB 4Y4KA 1RQ5A 2EEAA 3MOAH 5I1EH 4UT9H 2B1AL 1OAZH 2FGZA 4QRSA 1VPOH 2A38A 3DO7A 5ABDE 5MEOA 1IQWL 1S5HA 1MF2L 2CKBL 3B3IA 3EOTH 2D3VA 5D93C 1MRFL 5FHAH 4ZUUB 3MODH 1CL7L 3EFFB 4NFDA 3K2MC 2GW5A 3JV6A 2LAAA 1NCBH 3MNWB 2RHEA 2JIXD 1JRHL 3C6LA 4P2OA 3F12B 4JY4A 1L0XA 5A16B 5FAAA 4KQ4L 5DEZA 3G5VB 2CO6B 4N8CH 3FHQA 4LKXB 1GSMA 1BFTA 3QULB 4XTRC 5IMKA 4R2GD 1DBML 5CD3A 4LSUL 4PJFF 5DJYA 1ZT7A 3UTZA 3HFMH 3QDJA 4Y4FB 4RFOH 1JZ4A 3QNZA 1KJ2B 1QHOA 2IGFH 3DXAE 3VRIA 5CAYB 2VE6B 2H1PH 1BEYH 3VMOA 2GCYB 3DXAA 5L7XL 4WU7B 1AGDB 4HKZA 2FO1A 1TZHB 1JYXA 4OM1H 3MZTA 4DW2L 3MC0A 2ESVB 4LMQE 2H3NA 1ED3A 4XX1G 4KKAD 4GAJL 1NMBH 2JK5A 2XOTA 2DQFB 4HULB 2A9NL 4KROD 5DS8B 3ARQA 2YA1A 1EZVY 5EC1B 2E9JA 2I07B 5E2VH 2OR9L 3VXQA 3VD9A 2Q3ZA 4H1LA 5FOBA 3P4MB 1QLFB 2DLIA 1AHWA 1R9TI 5IR1B 2CK2A 4NYLB 1CR9L 3FRUA 2WM0A 2NW3A 4MCZA 1KJVB 3UTTE 3V6FA 1SJEB 2BSRB 1UYWH 3C8KB 1FH5H 4DVBA 2EH7H 4K23L 3UTTA 1A0QL 2DBLL 2X9XA 2Y6SD 4WCYH 2M2DA 5DFTA 1C16A 3CSGA 3IFOA 3GMPB 2OL3L 1G7LB 1MJJB 3G6DH 1ZVSA 3U7WH 43C9B 4XPHH 1LE9B 2PO6D 4C54A 5KTEH 4JCMA 5C1MB 2FD6L 2OJEB 4NGHL 4L8CB 3BAEH 3IFPB 5E6YA 4OUUA 4XNUL 3U83A 1M6OA 1JZ5A 1DUYB 2IANB 4U1GB 1MWAB 1A3LL 4YXHL 5LXGH 3QP3A 2YN5A 3QWOB 4JHWH 2AXFA 3TBSA 4E5XB 4X5WB 4U0QB 5HVFB 3WIHA 4J1UA 3NMEA 4GAYB 1JPTL 2Z31B 4AH2A 43CAB 25C8L 5I1LB 3SKJL 4OKVB 1RO4A 2DL2A 1SY6L 2J4WH 1CE6A 1WICA 3EYSL 3U4BL 1FIGL 4Q6IB 4D0BA 2WQRA 4MSWB 2OTUB 1I8LA 3B43A 2BCKA 4JPVH 4NZTH 1REIA 3BKYH 1IJ9A 2JF1A 2P8MB 1NGQL 2B7DT 4HWZA 1JWSB 1TJHH 3BDYH 2J3SA 3QJHA 2P8LA 1MFDL 1ITBB 1MUJB 1PYWB 4XNYH 3PQYD 5I18H 4L5FH 3GHBL 3Q6FA 3T2OA 3B5TA 3L5WA 3EHBC 1V7MH 5H8DA 5TQ2L 2B4CC 4N5UA 1S3KL 3VFGH 1OP3H 4U1SA 1RZIB 2WBKA 5EO9B 3GSOB 4O2CB 5CZKA 1DDHB 4O5LL 1OTUC 3QIUB 4FQQB 1ZLSL 5HI5D 1I50I 2X9YA 4F33B 4A93I 3CFJA 1XIWD 3MJ8B 5CGMA 3ESUF 4PG2A 3RAJL 1FAKT 2GSGA 2BSTA 2B4CH 3L3DB 1LEIB 2R29L 2D0GA 5LGJA 4DQOL 1B2WL 1CE1H 1N0XL 2XKNA 4LVOB 5FYJL 2NX5D 2PXYA 5MP6L 1AGCA 3FFCB 2NY0C 3KPRD 1G7HB 5CP3H 1IVLA 3EYUH 2KQMA 5F8QC 4JFPB 1F11A 1MNUL 4XVSH 1KENL 1BFSA 4Z0BH 1J1PL 5HPMB 5DQDL 4IDJL 3ARPA 1FSKB 4JG0H 1PVHA 2Y36L 2L0DA 4MJ6A 2WBJC 3D5OF 3RWJA 1A1OA 1NKRA 1NCWH 1U58A 2PR4L 2W60A 1HZHH 4QTIL 4Q2ZA 3QZWG 4JQXC 1KT2A 1YEFH 4X5XB 2BJML 1IL1B