1YUAA

C-terminal domain of escherichia coli topoisomerase i
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
122
structure length
122
Chain Sequence
MNGEVAPPKEDPVPLPELPCEKSDAYFVLRDGAAGVFLAANTFPKSRETRAPLVEELYRFRDRLPEKLRYLADAPQQDPEGNKTMVRFSRKTKQQYVSSEKDGKATGWSAFYVDGKWVEGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOPOISOMERASE I
publication title Solution structure of the C-terminal single-stranded DNA-binding domain of Escherichia coli topoisomerase I.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 12
structure length 122
sequence length 122
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 1995-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08272 Topo_Zn_Ribbon Topoisomerase I zinc-ribbon-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yuaA02
3.30.65.10 Alpha Beta 2-Layer Sandwich Bacterial Topoisomerase I; domain 1 Bacterial Topoisomerase I, domain 1 1yuaA01
4Y52I 2DE7A 3GTJI 3VMHA 4NBCA 3PO3S 5CM2M 4MH4A 3HOXI 3GTMI 3H3VJ 1TWCI 3S2DI 3M3YI 2KPIA 5IP7I 3GTKI 3RZOI 4A3BI 1VLAA 2DE6A 4Y7NI 3GTQI 2PK7A 3GTGI 2P3YA 2BJOA 3LUSA 3M4OI 1Y1WI 1TFIA 1TWGI 1WW9A 3K7AI 5C3EI 3GKQA 4A3JI 3HOVI 4A3FI 3GTLI 4A3DI 5IP9I 3CQZI 4BY1I 3H0GI 5FLMI 3I4MI 1QYPA 4BY7I 1USPB 4BBSI 2NVTI 3S1RI 2YU9I 1Y1VS 4NBGA 4A3EI 3S2HI 3HOYI 2JA7I 1TWHI 3Q87A 3S1QI 2R93I 5C44I 2JNYA 4BBRI 4A93I 2E2HI 3S14I 1X3ZA 4A3GI 1USPA 3D6WA 1RLYA 3PO2I 3GTOI 3VB9A 1I3QI 4A3II 1RO4A 4BXXI 4NOZA 2E2JI 2DE5A 4A3CI 3GTMS 1TWAI 4A3KI 2E2II 4A3LI 1TWFI 2NVXI 1R9TI 3PO3I 5C4XI 3HOWI 2JS4A 3GCFA 2VUMI 4NBDA 1N2FA 2NVQI 4QTTA 1SFOI 1WCMI 2B63I 3I4NI 3ESWA 2RBLA 5C4JI 2JA5I 3S1MI 1K83I 4NBAA 4NBEA 3S17I 1YUAA 2K5RA 2F4OA 3S16I 1ZB9A 1LQLA 3U50C 2JA8I 3S1NI 1L1OC 1X3WA 1PFTA 1ML8A 2R7ZI 3VMIA 2JA6I 4NBBA 1ZB8A 2NVYI 1Y1VI 1I6HI 4NB8A 1NUIA 3HOZI 1I50I 2J6AA 3S15I 4NBHA 2HF1A 3HOUI 4XX2A 4QTUA 2AKLA 2JR6A 4NBFA 3GTPI 4NB9A 2F4MA 4X6AI 4A3MI 3I07A 2R92I 3FKII 1DL6A 3EERA 3RZDI 3VMGA
chains in the Genus database with same CATH superfamily
1Q861 1VQ51 2DE7A 3VMHA 4RVDA 3CD61 3VTNA 3HOXI 3GTMI 2OTJ1 3CME1 3S2DI 5FLXf 4E2XA 2QEX1 3GTKI 1VQ81 3J81f 1M1K2 4Y7NI 1VQPZ 3GTGI 1Y1WI 2RPRA 1TFIA 4E31A 3CCL1 1RO0A 3K7AI 3GKQA 5IT9b 2HU9A 5IP9I 3H0GI 3I4MI 3CMAZ 2ZAEB 1VQ6Z 4NFRA 5IT9f 1Y1VS 2G2KA 2VPZA 3Q87A 2WAQA 1K9M2 4TNUA 1K8A2 1VQ5Z 2JNYA 4BBRI 4DGLA 4A93I 3S14I 3QWUA 3MZLB 2Y0SA 1RLYA 1VQNZ 3GTOI 1YJWZ 3CCLZ 2LIYA 4NOZA 4BXXI 2O4HA 3GTMS 5D1PA 2E2II 2OOXB 2P28A 3OW2Z 3HOWI 2JS4A 2W04A 4RVFA 2NAPA 3IX0A 2B63I 2JIPA 2JA5I 2V8KA 2QKDA 2GU2A 4NBEA 2LEXA 1RQFA 1VQ41 1W2BZ 2JA8I 4NBBA 1VQOZ 2KI7B 1I6HI 4RVHA 1YHQZ 1NJI1 1Q812 1Q821 1K732 4E30A 2E9HA 4NB8A 1NUIA 3NH4A 2J6AA 1N8R2 3HOZI 2HF1A 1P9NA 2OTLZ 3HOUI 4NBFA 3HKZA 4NB9A 4X6AI 1YJNZ 1VQK1 4A3MI 1AA6A 3IF8A 3CCUZ 3I55Z 3CCQZ 3RZDI 3VMGA 1RO2A 4Y52I 2JIQA 3GTJI 2JIMA 4NBCA 4NH1C 3CC2Z 2VPYA 5CM2M 3M3YI 1VQ4Z 4HGYA 3J80b 3CCSZ 4A3BI 1VLAA 3G4SZ 2RIQA 2P3YA 3LUSA 3CCRZ 1WW9A 1YIJ1 4A3JI 1Z01A 4A3FI 1VQ7Z 4BY1I 5FLMI 3CCM1 3KIHA 2IV2X 3CCE1 1JJ2Z 3S1RI 2IZ3A 4EWCA 3F3PC 3HOYI 1KC82 2M6NA 1WZNA 4E33A 3G6E1 2R93I 3CPWY 1S72Z 2E2HI 5D1OB 1X0TA 3P5JB 2RT9A 1JWHC 2LFUA 2QR1B 1KD11 1NP6A 2Q51A 3CC71 1RO4A 1YJ9Z 1VQL1 2VPWA 4A3CI 1TWAI 4A3KI 4A3LI 1TWFI 3D9XA 5C4XI 3TE5B 3CCEZ 2V45A 1KQSZ 4QTTA 3ESWA 2AYDA 5C4JI 3CD6Z 3S1MI 1K83I 2OTJZ 3CMEZ 1YUAA 2QEXZ 3CCJ1 1Q16A 1VQ8Z 2OZKA 3S16I 4MD8A 1YIT1 2EGTA 1ML8A 1ZB8A 2R6MA 2NVYI 4RVGA 3BG1B 1VQM1 3D2LA 5D1OA 1YI21 2V3VA 3S15I 2V8IA 1Q7Y2 2QRDB 2GTHA 4HH4A 2H85A 2PMZA 1M1K1 2O53A 4MONA 1FDOA 4E2WA 4MH4A 3CXCY 3H3VJ 3TDHB 3KIFA 5IP7I 3RZOI 4E2ZA 1YITZ 1Z02A 2DE6A 4E2YA 1VQ91 2IZ4A 3GTQI 2PK7A 3NFZA 2BJOA 2OOYB 1Q862 1TWGI 1K9M1 2YADA 2E7ZA 4MD9A 1VQMZ 3GTLI 1YUKA 4MXUA 1K8A1 1YI2Z 4A3DI 1Z03A 4BBSI 3MZKB 2NVTI 3CC41 2JA7I 3S1QI 4CL1A 5C44I 2PM9A 2QREB 2JIOA 1QVGY 1S7MA 4A3GI 1USPA 4HGZA 2WB1A 1SIWA 3D6WA 3PO2I 4E32A 1QVFZ 5LL6f 3VB9A 1QF8A 1VQP1 3CCV1 1VQKZ 2NVXI 3PO3I 2QRCB 2V8JA 3GCFA 3CMA1 2VUMI 4NBDA 1N2FA 3CC4Z 2NVQI 3NDJA 1SFOI 1VQ61 1WCMI 2RBLA 1Q811 2M48A 1K731 4NBAA 1QXFA 1N8R1 3G711 3S17I 1WJ2A 2K5RA 3NH8A 2F4OA 1FDIA 1LQLA 2GTIA 1X3WA 1YIJZ 3VMIA 2JA6I 3I561 2JMOA 2VPXA 3CCMZ 3CCVZ 1I50I 1VQN1 4XX2A 4QTUA 2RHBA 1YJW1 1M902 3I07A 3G6EZ 5AN9F 1NJI2 1Q822 5T6BA 2QA41 3PO3S 1KQSY 2QLVB 3G71Z 4RV9A 2W03A 1TWCI 2KPIA 4MD7A 3JAMb 3IR7A 3CC7Z 1VQLZ 1ZH1A 1KC81 3I56Z 3M4OI 5C3EI 1VQO1 3HOVI 1YHQ1 3CQZI 3JAMf 1QYPA 2K3RA 2VUGA 4BY7I 1USPB 3OW2Y 1Y8CA 3FQMA 2OTL1 2YU9I 4DQYB 4NBGA 3FQQA 4A3EI 3S2HI 1TWHI 1YJN1 1WIIA 5A2Qb 3CCJZ 3CCU1 3I551 3CCQ1 4S1TA 2QA4Z 3CXCZ 3F3FC 1KRLA 1X3ZA 1RNIA 3CC21 1W2BY 5A2Qf 3CCS1 1M901 1I3QI 3G4S1 4A3II 2E2JI 2DE5A 3CCR1 1R9TI 3T4NB 1VQ71 3BG0B 5T67A 1KD12 4DK1A 3I4NI 2JUBA 2VF1A 4MRIA 2I3CA 1QVGZ 3NDIA 2JIRA 1Q7Y1 1VQ9Z 1S721 1ZB9A 3U50C 3NH5A 3S1NI 1L1OC 1PFTA 2R7ZI 2Q4ZA 1Y1VI 3MONA 5T64A 4NBHA 1QVFY 3EEDA 2AKLA 2JR6A 1YJ91 3GTPI 3IFUA 2F4MA 1JJ2Y 3CPWZ 3J80f 2R92I 3FKII 1DL6A 3EERA 4RS4A 3J7A4 5FLXb 4AYBA 3J81b
chains in the Genus database with same CATH topology
1Q861 1VQ51 2DE7A 3VMHA 4RVDA 3CD61 3VTNA 3HOXI 3GTMI 2OTJ1 3CME1 3S2DI 5FLXf 4E2XA 2QEX1 3GTKI 1VQ81 3J81f 1M1K2 4Y7NI 1VQPZ 3GTGI 1Y1WI 2RPRA 1TFIA 4E31A 3CCL1 1RO0A 3K7AI 3GKQA 5IT9b 2HU9A 5IP9I 3H0GI 3I4MI 3CMAZ 2ZAEB 1VQ6Z 4NFRA 5IT9f 1Y1VS 2G2KA 3Q87A 2WAQA 1K9M2 4TNUA 1K8A2 1VQ5Z 2JNYA 4BBRI 4DGLA 4A93I 3S14I 3QWUA 3MZLB 2Y0SA 1RLYA 1VQNZ 3GTOI 1YJWZ 3CCLZ 2LIYA 4NOZA 4BXXI 2O4HA 3GTMS 5D1PA 2E2II 2OOXB 2P28A 3OW2Z 3HOWI 2JS4A 2W04A 4RVFA 3IX0A 2B63I 2JA5I 2V8KA 2QKDA 2GU2A 4NBEA 1RQFA 1VQ41 1W2BZ 2JA8I 4NBBA 1VQOZ 2KI7B 1I6HI 4RVHA 1YHQZ 1NJI1 1Q812 1Q821 1K732 2E9HA 4NB8A 1NUIA 4E30A 3NH4A 2J6AA 1N8R2 3HOZI 2HF1A 1P9NA 2OTLZ 3HOUI 4NBFA 3HKZA 4NB9A 4X6AI 1YJNZ 1VQK1 4A3MI 3IF8A 3CCUZ 3I55Z 3CCQZ 3RZDI 3VMGA 1RO2A 4Y52I 3GTJI 4NBCA 4NH1C 3CC2Z 5CM2M 3M3YI 1VQ4Z 4HGYA 3J80b 3CCSZ 4A3BI 1VLAA 3G4SZ 2RIQA 2P3YA 3LUSA 3CCRZ 1WW9A 1YIJ1 4A3JI 1Z01A 4A3FI 1VQ7Z 4BY1I 5FLMI 3CCM1 3KIHA 3CCE1 1JJ2Z 3S1RI 2IZ3A 4EWCA 3F3PC 3HOYI 1KC82 2M6NA 4E33A 3G6E1 2R93I 3CPWY 1S72Z 2E2HI 5D1OB 1X0TA 3P5JB 2RT9A 1JWHC 2LFUA 2QR1B 1KD11 1NP6A 2Q51A 3CC71 1RO4A 1YJ9Z 1VQL1 4A3CI 1TWAI 4A3KI 4A3LI 1TWFI 3D9XA 5C4XI 3TE5B 3CCEZ 1KQSZ 4QTTA 3ESWA 5C4JI 3CD6Z 3S1MI 1K83I 2OTJZ 3CMEZ 1YUAA 2QEXZ 3CCJ1 1VQ8Z 2OZKA 3S16I 4MD8A 1YIT1 2EGTA 1ML8A 1ZB8A 2R6MA 2NVYI 4RVGA 3BG1B 1VQM1 5D1OA 1YI21 3S15I 2V8IA 1Q7Y2 2QRDB 2GTHA 4HH4A 2H85A 2PMZA 1M1K1 2O53A 4MONA 4E2WA 4MH4A 3CXCY 3H3VJ 3TDHB 3KIFA 5IP7I 3RZOI 4E2ZA 1YITZ 1Z02A 2DE6A 4E2YA 1VQ91 2IZ4A 3GTQI 2PK7A 3NFZA 2BJOA 2OOYB 1Q862 1TWGI 1K9M1 2YADA 4MD9A 1VQMZ 3GTLI 1YUKA 4MXUA 1K8A1 1YI2Z 4A3DI 1Z03A 4BBSI 3MZKB 2NVTI 3CC41 2JA7I 3S1QI 4CL1A 5C44I 2PM9A 2QREB 1QVGY 1S7MA 4A3GI 1USPA 4HGZA 2WB1A 3D6WA 3PO2I 4E32A 1QVFZ 5LL6f 3VB9A 1VQP1 1QF8A 3CCV1 1VQKZ 2NVXI 3PO3I 2QRCB 2V8JA 3GCFA 3CMA1 2VUMI 4NBDA 1N2FA 3CC4Z 2NVQI 3NDJA 1SFOI 1VQ61 1WCMI 2RBLA 1Q811 2M48A 1K731 4NBAA 3S17I 1N8R1 3G711 2K5RA 3NH8A 2F4OA 1LQLA 2GTIA 1X3WA 1YIJZ 3VMIA 2JA6I 3I561 2JMOA 3CCMZ 3CCVZ 1I50I 1VQN1 4XX2A 4QTUA 2RHBA 1YJW1 1M902 3I07A 3G6EZ 5AN9F 1NJI2 1Q822 5T6BA 2QA41 3PO3S 1KQSY 2QLVB 3G71Z 4RV9A 2W03A 1TWCI 2KPIA 4MD7A 3JAMb 3CC7Z 1VQLZ 1ZH1A 1KC81 3I56Z 3M4OI 5C3EI 1VQO1 3HOVI 1YHQ1 3CQZI 3JAMf 1QYPA 2K3RA 2VUGA 4BY7I 1USPB 3OW2Y 3FQMA 2OTL1 2YU9I 4DQYB 4NBGA 3FQQA 4A3EI 3S2HI 1TWHI 1YJN1 1WIIA 5A2Qb 3CCJZ 3CCU1 3I551 3CCQ1 4S1TA 2QA4Z 3CXCZ 3F3FC 1KRLA 1X3ZA 1RNIA 3CC21 1W2BY 5A2Qf 3CCS1 1M901 1I3QI 3G4S1 4A3II 2E2JI 2DE5A 3CCR1 1R9TI 3T4NB 1VQ71 3BG0B 5T67A 1KD12 4DK1A 3I4NI 2JUBA 2VF1A 4MRIA 2I3CA 1QVGZ 3NDIA 1Q7Y1 1VQ9Z 1S721 1ZB9A 3U50C 3NH5A 3S1NI 1L1OC 1PFTA 2R7ZI 2Q4ZA 1Y1VI 3MONA 5T64A 4NBHA 1QVFY 3EEDA 2AKLA 2JR6A 1YJ91 3GTPI 3IFUA 2F4MA 1JJ2Y 3CPWZ 3J80f 2R92I 3FKII 1DL6A 3EERA 4RS4A 3J7A4 5FLXb 4AYBA 3J81b
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y52 I;  2DE7 A;  3GTJ I;  3VMH A;  4NBC A;  3PO3 S;  5CM2 M;  4MH4 A;  3HOX I;  3GTM I;  3H3V J;  1TWC I;  3S2D I;  3M3Y I;  2KPI A;  5IP7 I;  3GTK I;  3RZO I;  4A3B I;  1VLA A;  2DE6 A;  4Y7N I;  3GTQ I;  2PK7 A;  3GTG I;  2P3Y A;  2BJO A;  3LUS A;  3M4O I;  1Y1W I;  1TFI A;  1TWG I;  1WW9 A;  3K7A I;  5C3E I;  3GKQ A;  4A3J I;  3HOV I;  4A3F I;  3GTL I;  4A3D I;  5IP9 I;  3CQZ I;  4BY1 I;  3H0G I;  5FLM I;  3I4M I;  1QYP A;  4BY7 I;  1USP B;  4BBS I;  2NVT I;  3S1R I;  2YU9 I;  1Y1V S;  4NBG A;  4A3E I;  3S2H I;  3HOY I;  2JA7 I;  1TWH I;  3Q87 A;  3S1Q I;  2R93 I;  5C44 I;  2JNY A;  4BBR I;  4A93 I;  2E2H I;  3S14 I;  1X3Z A;  4A3G I;  1USP A;  3D6W A;  1RLY A;  3PO2 I;  3GTO I;  3VB9 A;  1I3Q I;  4A3I I;  1RO4 A;  4BXX I;  4NOZ A;  2E2J I;  2DE5 A;  4A3C I;  3GTM S;  1TWA I;  4A3K I;  2E2I I;  4A3L I;  1TWF I;  2NVX I;  1R9T I;  3PO3 I;  5C4X I;  3HOW I;  2JS4 A;  3GCF A;  2VUM I;  4NBD A;  1N2F A;  2NVQ I;  4QTT A;  1SFO I;  1WCM I;  2B63 I;  3I4N I;  3ESW A;  2RBL A;  5C4J I;  2JA5 I;  3S1M I;  1K83 I;  4NBA A;  4NBE A;  3S17 I;  1YUA A;  2K5R A;  2F4O A;  3S16 I;  1ZB9 A;  1LQL A;  3U50 C;  2JA8 I;  3S1N I;  1L1O C;  1X3W A;  1PFT A;  1ML8 A;  2R7Z I;  3VMI A;  2JA6 I;  4NBB A;  1ZB8 A;  2NVY I;  1Y1V I;  1I6H I;  4NB8 A;  1NUI A;  3HOZ I;  1I50 I;  2J6A A;  3S15 I;  4NBH A;  2HF1 A;  3HOU I;  4XX2 A;  4QTU A;  2AKL A;  2JR6 A;  4NBF A;  3GTP I;  4NB9 A;  2F4M A;  4X6A I;  4A3M I;  3I07 A;  2R92 I;  3FKI I;  1DL6 A;  3EER A;  3RZD I;  3VMG A; 
#chains in the Genus database with same CATH topology
 1Q86 1;  1VQ5 1;  2DE7 A;  3VMH A;  4RVD A;  3CD6 1;  3VTN A;  3HOX I;  3GTM I;  2OTJ 1;  3CME 1;  3S2D I;  5FLX f;  4E2X A;  2QEX 1;  3GTK I;  1VQ8 1;  3J81 f;  1M1K 2;  4Y7N I;  1VQP Z;  3GTG I;  1Y1W I;  2RPR A;  1TFI A;  4E31 A;  3CCL 1;  1RO0 A;  3K7A I;  3GKQ A;  5IT9 b;  2HU9 A;  5IP9 I;  3H0G I;  3I4M I;  3CMA Z;  2ZAE B;  1VQ6 Z;  4NFR A;  5IT9 f;  1Y1V S;  2G2K A;  2VPZ A;  3Q87 A;  2WAQ A;  1K9M 2;  4TNU A;  1K8A 2;  1VQ5 Z;  2JNY A;  4BBR I;  4DGL A;  4A93 I;  3S14 I;  3QWU A;  3MZL B;  2Y0S A;  1RLY A;  1VQN Z;  3GTO I;  1YJW Z;  3CCL Z;  2LIY A;  4NOZ A;  4BXX I;  2O4H A;  3GTM S;  5D1P A;  2E2I I;  2OOX B;  2P28 A;  3OW2 Z;  3HOW I;  2JS4 A;  2W04 A;  4RVF A;  2NAP A;  3IX0 A;  2B63 I;  2JIP A;  2JA5 I;  2V8K A;  2QKD A;  2GU2 A;  4NBE A;  2LEX A;  1RQF A;  1VQ4 1;  1W2B Z;  2JA8 I;  4NBB A;  1VQO Z;  2KI7 B;  1I6H I;  4RVH A;  1YHQ Z;  1NJI 1;  1Q81 2;  1Q82 1;  1K73 2;  4E30 A;  2E9H A;  4NB8 A;  1NUI A;  3NH4 A;  2J6A A;  1N8R 2;  3HOZ I;  2HF1 A;  1P9N A;  2OTL Z;  3HOU I;  4NBF A;  3HKZ A;  4NB9 A;  4X6A I;  1YJN Z;  1VQK 1;  4A3M I;  1AA6 A;  3IF8 A;  3CCU Z;  3I55 Z;  3CCQ Z;  3RZD I;  3VMG A;  1RO2 A;  4Y52 I;  2JIQ A;  3GTJ I;  2JIM A;  4NBC A;  4NH1 C;  3CC2 Z;  2VPY A;  5CM2 M;  3M3Y I;  1VQ4 Z;  4HGY A;  3J80 b;  3CCS Z;  4A3B I;  1VLA A;  3G4S Z;  2RIQ A;  2P3Y A;  3LUS A;  3CCR Z;  1WW9 A;  1YIJ 1;  4A3J I;  1Z01 A;  4A3F I;  1VQ7 Z;  4BY1 I;  5FLM I;  3CCM 1;  3KIH A;  2IV2 X;  3CCE 1;  1JJ2 Z;  3S1R I;  2IZ3 A;  4EWC A;  3F3P C;  3HOY I;  1KC8 2;  2M6N A;  1WZN A;  4E33 A;  3G6E 1;  2R93 I;  3CPW Y;  1S72 Z;  2E2H I;  5D1O B;  1X0T A;  3P5J B;  2RT9 A;  1JWH C;  2LFU A;  2QR1 B;  1KD1 1;  1NP6 A;  2Q51 A;  3CC7 1;  1RO4 A;  1YJ9 Z;  1VQL 1;  2VPW A;  4A3C I;  1TWA I;  4A3K I;  4A3L I;  1TWF I;  3D9X A;  5C4X I;  3TE5 B;  3CCE Z;  2V45 A;  1KQS Z;  4QTT A;  3ESW A;  2AYD A;  5C4J I;  3CD6 Z;  3S1M I;  1K83 I;  2OTJ Z;  3CME Z;  1YUA A;  2QEX Z;  3CCJ 1;  1Q16 A;  1VQ8 Z;  2OZK A;  3S16 I;  4MD8 A;  1YIT 1;  2EGT A;  1ML8 A;  1ZB8 A;  2R6M A;  2NVY I;  4RVG A;  3BG1 B;  1VQM 1;  3D2L A;  5D1O A;  1YI2 1;  2V3V A;  3S15 I;  2V8I A;  1Q7Y 2;  2QRD B;  2GTH A;  4HH4 A;  2H85 A;  2PMZ A;  1M1K 1;  2O53 A;  4MON A;  1FDO A;  4E2W A;  4MH4 A;  3CXC Y;  3H3V J;  3TDH B;  3KIF A;  5IP7 I;  3RZO I;  4E2Z A;  1YIT Z;  1Z02 A;  2DE6 A;  4E2Y A;  1VQ9 1;  2IZ4 A;  3GTQ I;  2PK7 A;  3NFZ A;  2BJO A;  2OOY B;  1Q86 2;  1TWG I;  1K9M 1;  2YAD A;  2E7Z A;  4MD9 A;  1VQM Z;  3GTL I;  1YUK A;  4MXU A;  1K8A 1;  1YI2 Z;  4A3D I;  1Z03 A;  4BBS I;  3MZK B;  2NVT I;  3CC4 1;  2JA7 I;  3S1Q I;  4CL1 A;  5C44 I;  2PM9 A;  2QRE B;  2JIO A;  1QVG Y;  1S7M A;  4A3G I;  1USP A;  4HGZ A;  2WB1 A;  1SIW A;  3D6W A;  3PO2 I;  4E32 A;  1QVF Z;  5LL6 f;  3VB9 A;  1QF8 A;  1VQP 1;  3CCV 1;  1VQK Z;  2NVX I;  3PO3 I;  2QRC B;  2V8J A;  3GCF A;  3CMA 1;  2VUM I;  4NBD A;  1N2F A;  3CC4 Z;  2NVQ I;  3NDJ A;  1SFO I;  1VQ6 1;  1WCM I;  2RBL A;  1Q81 1;  2M48 A;  1K73 1;  4NBA A;  1QXF A;  1N8R 1;  3G71 1;  3S17 I;  1WJ2 A;  2K5R A;  3NH8 A;  2F4O A;  1FDI A;  1LQL A;  2GTI A;  1X3W A;  1YIJ Z;  3VMI A;  2JA6 I;  3I56 1;  2JMO A;  2VPX A;  3CCM Z;  3CCV Z;  1I50 I;  1VQN 1;  4XX2 A;  4QTU A;  2RHB A;  1YJW 1;  1M90 2;  3I07 A;  3G6E Z;  5AN9 F;  1NJI 2;  1Q82 2;  5T6B A;  2QA4 1;  3PO3 S;  1KQS Y;  2QLV B;  3G71 Z;  4RV9 A;  2W03 A;  1TWC I;  2KPI A;  4MD7 A;  3JAM b;  3IR7 A;  3CC7 Z;  1VQL Z;  1ZH1 A;  1KC8 1;  3I56 Z;  3M4O I;  5C3E I;  1VQO 1;  3HOV I;  1YHQ 1;  3CQZ I;  3JAM f;  1QYP A;  2K3R A;  2VUG A;  4BY7 I;  1USP B;  3OW2 Y;  1Y8C A;  3FQM A;  2OTL 1;  2YU9 I;  4DQY B;  4NBG A;  3FQQ A;  4A3E I;  3S2H I;  1TWH I;  1YJN 1;  1WII A;  5A2Q b;  3CCJ Z;  3CCU 1;  3I55 1;  3CCQ 1;  4S1T A;  2QA4 Z;  3CXC Z;  3F3F C;  1KRL A;  1X3Z A;  1RNI A;  3CC2 1;  1W2B Y;  5A2Q f;  3CCS 1;  1M90 1;  1I3Q I;  3G4S 1;  4A3I I;  2E2J I;  2DE5 A;  3CCR 1;  1R9T I;  3T4N B;  1VQ7 1;  3BG0 B;  5T67 A;  1KD1 2;  4DK1 A;  3I4N I;  2JUB A;  2VF1 A;  4MRI A;  2I3C A;  1QVG Z;  3NDI A;  2JIR A;  1Q7Y 1;  1VQ9 Z;  1S72 1;  1ZB9 A;  3U50 C;  3NH5 A;  3S1N I;  1L1O C;  1PFT A;  2R7Z I;  2Q4Z A;  1Y1V I;  3MON A;  5T64 A;  4NBH A;  1QVF Y;  3EED A;  2AKL A;  2JR6 A;  1YJ9 1;  3GTP I;  3IFU A;  2F4M A;  1JJ2 Y;  3CPW Z;  3J80 f;  2R92 I;  3FKI I;  1DL6 A;  3EER A;  4RS4 A;  3J7A 4;  5FLX b;  4AYB A;  3J81 b; 
#chains in the Genus database with same CATH homology
 1Q86 1;  1VQ5 1;  2DE7 A;  3VMH A;  4RVD A;  3CD6 1;  3VTN A;  3HOX I;  3GTM I;  2OTJ 1;  3CME 1;  3S2D I;  5FLX f;  4E2X A;  2QEX 1;  3GTK I;  1VQ8 1;  3J81 f;  1M1K 2;  4Y7N I;  1VQP Z;  3GTG I;  1Y1W I;  2RPR A;  1TFI A;  4E31 A;  3CCL 1;  1RO0 A;  3K7A I;  3GKQ A;  5IT9 b;  2HU9 A;  5IP9 I;  3H0G I;  3I4M I;  3CMA Z;  2ZAE B;  1VQ6 Z;  4NFR A;  5IT9 f;  1Y1V S;  2G2K A;  3Q87 A;  2WAQ A;  1K9M 2;  4TNU A;  1K8A 2;  1VQ5 Z;  2JNY A;  4BBR I;  4DGL A;  4A93 I;  3S14 I;  3QWU A;  3MZL B;  2Y0S A;  1RLY A;  1VQN Z;  3GTO I;  1YJW Z;  3CCL Z;  2LIY A;  4NOZ A;  4BXX I;  2O4H A;  3GTM S;  5D1P A;  2E2I I;  2OOX B;  2P28 A;  3OW2 Z;  3HOW I;  2JS4 A;  2W04 A;  4RVF A;  3IX0 A;  2B63 I;  2JA5 I;  2V8K A;  2QKD A;  2GU2 A;  4NBE A;  1RQF A;  1VQ4 1;  1W2B Z;  2JA8 I;  4NBB A;  1VQO Z;  2KI7 B;  1I6H I;  4RVH A;  1YHQ Z;  1NJI 1;  1Q81 2;  1Q82 1;  1K73 2;  2E9H A;  4NB8 A;  1NUI A;  4E30 A;  3NH4 A;  2J6A A;  1N8R 2;  3HOZ I;  2HF1 A;  1P9N A;  2OTL Z;  3HOU I;  4NBF A;  3HKZ A;  4NB9 A;  4X6A I;  1YJN Z;  1VQK 1;  4A3M I;  3IF8 A;  3CCU Z;  3I55 Z;  3CCQ Z;  3RZD I;  3VMG A;  1RO2 A;  4Y52 I;  3GTJ I;  4NBC A;  4NH1 C;  3CC2 Z;  5CM2 M;  3M3Y I;  1VQ4 Z;  4HGY A;  3J80 b;  3CCS Z;  4A3B I;  1VLA A;  3G4S Z;  2RIQ A;  2P3Y A;  3LUS A;  3CCR Z;  1WW9 A;  1YIJ 1;  4A3J I;  1Z01 A;  4A3F I;  1VQ7 Z;  4BY1 I;  5FLM I;  3CCM 1;  3KIH A;  3CCE 1;  1JJ2 Z;  3S1R I;  2IZ3 A;  4EWC A;  3F3P C;  3HOY I;  1KC8 2;  2M6N A;  4E33 A;  3G6E 1;  2R93 I;  3CPW Y;  1S72 Z;  2E2H I;  5D1O B;  1X0T A;  3P5J B;  2RT9 A;  1JWH C;  2LFU A;  2QR1 B;  1KD1 1;  1NP6 A;  2Q51 A;  3CC7 1;  1RO4 A;  1YJ9 Z;  1VQL 1;  4A3C I;  1TWA I;  4A3K I;  4A3L I;  1TWF I;  3D9X A;  5C4X I;  3TE5 B;  3CCE Z;  1KQS Z;  4QTT A;  3ESW A;  5C4J I;  3CD6 Z;  3S1M I;  1K83 I;  2OTJ Z;  3CME Z;  1YUA A;  2QEX Z;  3CCJ 1;  1VQ8 Z;  2OZK A;  3S16 I;  4MD8 A;  1YIT 1;  2EGT A;  1ML8 A;  1ZB8 A;  2R6M A;  2NVY I;  4RVG A;  3BG1 B;  1VQM 1;  5D1O A;  1YI2 1;  3S15 I;  2V8I A;  1Q7Y 2;  2QRD B;  2GTH A;  4HH4 A;  2H85 A;  2PMZ A;  1M1K 1;  2O53 A;  4MON A;  4E2W A;  4MH4 A;  3CXC Y;  3H3V J;  3TDH B;  3KIF A;  5IP7 I;  3RZO I;  4E2Z A;  1YIT Z;  1Z02 A;  2DE6 A;  4E2Y A;  1VQ9 1;  2IZ4 A;  3GTQ I;  2PK7 A;  3NFZ A;  2BJO A;  2OOY B;  1Q86 2;  1TWG I;  1K9M 1;  2YAD A;  4MD9 A;  1VQM Z;  3GTL I;  1YUK A;  4MXU A;  1K8A 1;  1YI2 Z;  4A3D I;  1Z03 A;  4BBS I;  3MZK B;  2NVT I;  3CC4 1;  2JA7 I;  3S1Q I;  4CL1 A;  5C44 I;  2PM9 A;  2QRE B;  1QVG Y;  1S7M A;  4A3G I;  1USP A;  4HGZ A;  2WB1 A;  3D6W A;  3PO2 I;  4E32 A;  1QVF Z;  5LL6 f;  3VB9 A;  1VQP 1;  1QF8 A;  3CCV 1;  1VQK Z;  2NVX I;  3PO3 I;  2QRC B;  2V8J A;  3GCF A;  3CMA 1;  2VUM I;  4NBD A;  1N2F A;  3CC4 Z;  2NVQ I;  3NDJ A;  1SFO I;  1VQ6 1;  1WCM I;  2RBL A;  1Q81 1;  2M48 A;  1K73 1;  4NBA A;  3S17 I;  1N8R 1;  3G71 1;  2K5R A;  3NH8 A;  2F4O A;  1LQL A;  2GTI A;  1X3W A;  1YIJ Z;  3VMI A;  2JA6 I;  3I56 1;  2JMO A;  3CCM Z;  3CCV Z;  1I50 I;  1VQN 1;  4XX2 A;  4QTU A;  2RHB A;  1YJW 1;  1M90 2;  3I07 A;  3G6E Z;  5AN9 F;  1NJI 2;  1Q82 2;  5T6B A;  2QA4 1;  3PO3 S;  1KQS Y;  2QLV B;  3G71 Z;  4RV9 A;  2W03 A;  1TWC I;  2KPI A;  4MD7 A;  3JAM b;  3CC7 Z;  1VQL Z;  1ZH1 A;  1KC8 1;  3I56 Z;  3M4O I;  5C3E I;  1VQO 1;  3HOV I;  1YHQ 1;  3CQZ I;  3JAM f;  1QYP A;  2K3R A;  2VUG A;  4BY7 I;  1USP B;  3OW2 Y;  3FQM A;  2OTL 1;  2YU9 I;  4DQY B;  4NBG A;  3FQQ A;  4A3E I;  3S2H I;  1TWH I;  1YJN 1;  1WII A;  5A2Q b;  3CCJ Z;  3CCU 1;  3I55 1;  3CCQ 1;  4S1T A;  2QA4 Z;  3CXC Z;  3F3F C;  1KRL A;  1X3Z A;  1RNI A;  3CC2 1;  1W2B Y;  5A2Q f;  3CCS 1;  1M90 1;  1I3Q I;  3G4S 1;  4A3I I;  2E2J I;  2DE5 A;  3CCR 1;  1R9T I;  3T4N B;  1VQ7 1;  3BG0 B;  5T67 A;  1KD1 2;  4DK1 A;  3I4N I;  2JUB A;  2VF1 A;  4MRI A;  2I3C A;  1QVG Z;  3NDI A;  1Q7Y 1;  1VQ9 Z;  1S72 1;  1ZB9 A;  3U50 C;  3NH5 A;  3S1N I;  1L1O C;  1PFT A;  2R7Z I;  2Q4Z A;  1Y1V I;  3MON A;  5T64 A;  4NBH A;  1QVF Y;  3EED A;  2AKL A;  2JR6 A;  1YJ9 1;  3GTP I;  3IFU A;  2F4M A;  1JJ2 Y;  3CPW Z;  3J80 f;  2R92 I;  3FKI I;  1DL6 A;  3EER A;  4RS4 A;  3J7A 4;  5FLX b;  4AYB A;  3J81 b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...