1YUAA

C-terminal domain of escherichia coli topoisomerase i
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
122
structure length
122
Chain Sequence
MNGEVAPPKEDPVPLPELPCEKSDAYFVLRDGAAGVFLAANTFPKSRETRAPLVEELYRFRDRLPEKLRYLADAPQQDPEGNKTMVRFSRKTKQQYVSSEKDGKATGWSAFYVDGKWVEGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C-terminal single-stranded DNA-binding domain of Escherichia coli topoisomerase I.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords TOPOISOMERASE I
total genus 12
structure length 122
sequence length 122
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 1995-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08272 Topo_Zn_Ribbon Topoisomerase I zinc-ribbon-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yuaA02
3.30.65.10 Alpha Beta 2-Layer Sandwich Bacterial Topoisomerase I; domain 1 Bacterial Topoisomerase I, domain 1 1yuaA01
4QTTA 3HOUI 2PK7A 2E2II 1VLAA 1PFTA 2NVYI 1L1OC 2AKLA 1R9TI 4BXXI 2JS4A 4A3LI 3RZOI 1Y1WI 5C44I 3I07A 1TWAI 1X3ZA 2J6AA 4A3CI 3U50C 3VB9A 3GTPI 2VUMI 3GTKI 3GTMS 2R7ZI 1X3WA 4A3KI 4NBAA 4NBEA 2R92I 2NVQI 3PO2I 3S1MI 1TFIA 4XX2A 1RLYA 2R93I 3D6WA 4NB9A 1Y1VS 5IP9I 1K83I 3RZDI 3PO3I 1USPB 2JA7I 3M3YI 5C4JI 4BBSI 4NBBA 3S14I 4BY7I 2KPIA 2F4MA 3H3VJ 3LUSA 3S1NI 4NBFA 4A3EI 2HF1A 4MH4A 3S2DI 4A3II 3I4MI 4NBGA 3ESWA 3EERA 5IP7I 3S1RI 2BJOA 3GTQI 2K5RA 5C4XI 5C3EI 4A3MI 2JA5I 3HOWI 3VMIA 1USPA 1TWCI 3VMHA 2P3YA 2NVTI 1LQLA 4A3BI 1ZB9A 4BBRI 4A3DI 4A93I 1Y1VI 3PO3S 3K7AI 2B63I 3M4OI 3S17I 3Q87A 4NB8A 3CQZI 5CM2M 3HOYI 1TWFI 3HOXI 2JR6A 1ML8A 4X6AI 2RBLA 2JA8I 4A3GI 3FKII 3GTOI 1TWHI 2NVXI 3GTLI 3S1QI 4NBCA 2E2HI 2E2JI 1NUIA 1TWGI 4A3FI 2YU9I 4NOZA 1RO4A 3GTGI 1I3QI 4Y52I 3I4NI 4NBDA 2DE5A 4BY1I 1SFOI 1N2FA 3S16I 4NBHA 4QTUA 5FLMI 1ZB8A 2DE7A 2F4OA 1YUAA 4A3JI 4Y7NI 1WW9A 3GCFA 1I50I 1I6HI 1WCMI 2JA6I 3GTJI 3HOVI 3S2HI 1DL6A 2DE6A 3GKQA 3S15I 1QYPA 3GTMI 2JNYA 3H0GI 3VMGA 3HOZI
chains in the Genus database with same CATH superfamily
3HOUI 3FQQA 3J81b 3MONA 1VQ9Z 2E2II 4E2ZA 1R9TI 3BG1B 3CC41 2OOYB 3I07A 1TWAI 2QA4Z 3CME1 2OOXB 3GTPI 3JAMf 1VQLZ 3GTMS 3CCE1 4NBEA 4RVFA 1QVGY 3J80f 2NVQI 1TFIA 4E33A 4DGLA 4MRIA 3G6E1 4E30A 2LIYA 1SIWA 3OW2Y 3NH8A 4BBSI 3J81f 2PMZA 2F4MA 3G4SZ 1VQPZ 3I561 1K732 2HF1A 1N8R1 1VQ71 3KIFA 1Q812 5IT9b 4NBGA 2K5RA 5T67A 1VQ41 4A3MI 5C3EI 2JA5I 1M901 4MD9A 3I551 1LQLA 4NFRA 3CCEZ 3PO3S 2E7ZA 1VQ8Z 1RO0A 2VUGA 3CCJZ 2B63I 1RQFA 2W04A 2V8KA 2P28A 1Q861 3P5JB 5CM2M 1TWFI 3HOXI 2VF1A 5A2Qb 4A3GI 3BG0B 1TWHI 2NVXI 2QKDA 2RIQA 2E2JI 4A3FI 2IV2X 3IR7A 1RO4A 5FLXb 3I55Z 2QEX1 1S721 3GTGI 2IZ3A 2O53A 1SFOI 4BY1I 2RT9A 4HGZA 2O4HA 2KI7B 4EWCA 1W2BZ 2JIRA 3GCFA 1WCMI 2JA6I 4TNUA 3HOVI 2IZ4A 2OTJ1 2DE6A 1DL6A 1KD12 3H0GI 1KQSZ 2QREB 3HOZI 1K8A2 4QTTA 1NJI1 2PK7A 2NVYI 4E31A 1QXFA 4RV9A 1KC81 2JIOA 1YJNZ 2YADA 4DQYB 1X3ZA 4A3CI 3CCLZ 2WB1A 1RNIA 1JJ2Z 1X3WA 3D2LA 2OTJZ 1M1K2 3S1MI 3CC7Z 1YJWZ 2OTL1 4HH4A 3D9XA 1ZH1A 1Y1VS 1WIIA 1USPB 3NH4A 5C4JI 5IT9f 2HU9A 2V45A 2OZKA 1FDOA 4A3EI 2LEXA 1QVGZ 1P9NA 2WAQA 3S1RI 1VQKZ 4E2WA 3VTNA 1YI21 1YJ91 1VQ61 4BBRI 1VQP1 3NFZA 1Q16A 1YIJ1 3CC71 3CC4Z 1X0TA 1Q7Y1 3MZLB 4E2XA 2QRCB 2Q4ZA 2I3CA 3CCQZ 1YIT1 4NB8A 3CCVZ 2RBLA 2JUBA 2VPZA 1YUKA 1NUIA 1TWGI 2QRDB 4NOZA 3J7A4 1I3QI 4Y52I 3I4NI 4E32A 2QEXZ 1VQM1 4NBDA 1S72Z 2G2KA 2R6MA 4QTUA 2F4OA 5D1OB 3CCS1 3CCUZ 3CD61 1WW9A 3GTJI 1M902 3S15I 3GTMI 2QLVB 1WZNA 4CL1A 5T64A 3CCQ1 1L1OC 2AKLA 2RHBA 3CC21 4BXXI 1VQL1 3OW2Z 2JIQA 5C44I 1VQN1 3CPWY 5T6BA 2V8JA 3U50C 3CCSZ 3CCU1 2VUMI 3GTKI 1K9M2 1VQ7Z 1Q822 1QVFZ 3F3FC 4NBAA 4A3KI 3CCMZ 4RVGA 1QF8A 4XX2A 1KQSY 3D6WA 1YJW1 3TE5B 3G4S1 3CCR1 4NB9A 3RZDI 1K83I 3IFUA 3CXCZ 2E9HA 2JA7I 3M3YI 4NBBA 3S14I 3CC2Z 2KPIA 3H3VJ 1JJ2Y 4MXUA 4HGYA 3S1NI 2QR1B 1VQO1 4MH4A 1K8A1 3I4MI 3S2DI 3ESWA 2EGTA 1Q862 2VPXA 2GTIA 1QVFY 2LFUA 1USPA 1Z01A 1YI2Z 4RVDA 3VMHA 1RO2A 2M48A 2NAPA 2P3YA 2NVTI 4A3DI 4A93I 1Y1VI 1VQ51 3K7AI 1K731 5FLXf 3M4OI 3JAMb 1N8R2 1Q811 3Q87A 3IX0A 2VPYA 3CQZI 3CMEZ 2W03A 2V3VA 2VPWA 3IF8A 1KRLA 3FKII 3KIHA 2E2HI 4S1TA 4DK1A 3NDJA 3G6EZ 3CCJ1 2DE5A 1NJI2 1VQMZ 4RVHA 1Y8CA 2Q51A 4NBHA 2DE7A 4A3JI 4Y7NI 3I56Z 3CCL1 1VQK1 3CD6Z 3S2HI 1YHQZ 3GKQA 2JIMA 2JIPA 2JNYA 1Z02A 2RPRA 1YJ9Z 4AYBA 2V8IA 1M1K1 2GTHA 4E2YA 1Q7Y2 2JMOA 1VLAA 1PFTA 2AYDA 5D1OA 2JS4A 4A3LI 3RZOI 3FQMA 1Y1WI 5A2Qf 2J6AA 1WJ2A 3VB9A 3CCV1 2ZAEB 3NDIA 3QWUA 2R7ZI 3G711 2R92I 3PO2I 1NP6A 2M6NA 1RLYA 2R93I 5IP9I 3PO3I 2PM9A 3EEDA 1YJN1 4BY7I 3J80b 1YHQ1 2GU2A 3LUSA 1S7MA 2K3RA 1FDIA 4NBFA 4MONA 3F3PC 1VQ81 4A3II 3EERA 5IP7I 1VQ4Z 2BJOA 4MD8A 3GTQI 5C4XI 5AN9F 3VMIA 3HOWI 5D1PA 1YIJZ 4NH1C 3CMA1 1TWCI 1KD11 1JWHC 4MD7A 4A3BI 1ZB9A 2H85A 1VQOZ 1VQNZ 1VQ5Z 1W2BY 3S17I 1Z03A 3CXCY 3G71Z 1VQ91 1Q821 5LL6f 1KC82 2Y0SA 3HOYI 3MZKB 2JR6A 1ML8A 4X6AI 2JA8I 3T4NB 3GTOI 3GTLI 3S1QI 4NBCA 1VQ6Z 3CCRZ 2YU9I 3HKZA 1AA6A 2OTLZ 1N2FA 2QA41 3S16I 3TDHB 5FLMI 1YITZ 1ZB8A 4RS4A 1YUAA 1I6HI 1I50I 3CPWZ 3CMAZ 1QYPA 3VMGA 3NH5A 3CCM1 1K9M1
chains in the Genus database with same CATH topology
3HOUI 3FQQA 3J81b 3MONA 1VQ9Z 2E2II 4E2ZA 1R9TI 3BG1B 3CC41 2OOYB 3I07A 1TWAI 2QA4Z 3CME1 2OOXB 3GTPI 3JAMf 1VQLZ 3GTMS 3CCE1 4NBEA 4RVFA 1QVGY 3J80f 2NVQI 1TFIA 4E33A 4DGLA 4MRIA 3G6E1 4E30A 2LIYA 3OW2Y 3NH8A 4BBSI 3J81f 2PMZA 2F4MA 3G4SZ 1VQPZ 3I561 1K732 2HF1A 1N8R1 1VQ71 3KIFA 1Q812 5IT9b 4NBGA 2K5RA 5T67A 1VQ41 4A3MI 5C3EI 2JA5I 1M901 4MD9A 3I551 1LQLA 4NFRA 3CCEZ 3PO3S 1VQ8Z 1RO0A 2VUGA 3CCJZ 2B63I 1RQFA 2W04A 2V8KA 2P28A 1Q861 3P5JB 5CM2M 1TWFI 3HOXI 2VF1A 5A2Qb 4A3GI 3BG0B 1TWHI 2NVXI 2QKDA 2RIQA 2E2JI 4A3FI 1RO4A 5FLXb 3I55Z 2QEX1 1S721 3GTGI 2IZ3A 2O53A 1SFOI 4BY1I 2RT9A 4HGZA 2O4HA 2KI7B 4EWCA 1W2BZ 3GCFA 1WCMI 2JA6I 4TNUA 3HOVI 2IZ4A 2OTJ1 2DE6A 1DL6A 1KD12 3H0GI 1KQSZ 2QREB 3HOZI 1K8A2 4QTTA 1NJI1 2PK7A 2NVYI 4E31A 4RV9A 1KC81 1YJNZ 2YADA 4DQYB 1X3ZA 4A3CI 3CCLZ 2WB1A 1RNIA 1JJ2Z 1X3WA 2OTJZ 1M1K2 3S1MI 3CC7Z 1YJWZ 2OTL1 4HH4A 3D9XA 1ZH1A 1Y1VS 1WIIA 1USPB 3NH4A 5C4JI 5IT9f 2HU9A 2OZKA 4A3EI 1QVGZ 1P9NA 2WAQA 3S1RI 1VQKZ 4E2WA 3VTNA 1YI21 1YJ91 1VQ61 4BBRI 1VQP1 3NFZA 1YIJ1 3CC71 3CC4Z 1X0TA 1Q7Y1 3MZLB 4E2XA 2QRCB 2Q4ZA 2I3CA 3CCQZ 1YIT1 4NB8A 3CCVZ 2RBLA 2JUBA 1YUKA 1NUIA 1TWGI 2QRDB 4NOZA 3J7A4 1I3QI 4Y52I 3I4NI 4E32A 2QEXZ 1VQM1 4NBDA 1S72Z 2G2KA 2R6MA 4QTUA 2F4OA 5D1OB 3CCS1 3CCUZ 3CD61 1WW9A 3GTJI 1M902 3S15I 3GTMI 2QLVB 4CL1A 5T64A 3CCQ1 1L1OC 2AKLA 2RHBA 3CC21 4BXXI 1VQL1 3OW2Z 5C44I 1VQN1 3CPWY 5T6BA 2V8JA 3U50C 3CCSZ 3CCU1 2VUMI 3GTKI 1K9M2 1VQ7Z 1Q822 1QVFZ 3F3FC 4NBAA 4A3KI 3CCMZ 4RVGA 1QF8A 4XX2A 1KQSY 3D6WA 1YJW1 3TE5B 3G4S1 3CCR1 4NB9A 3RZDI 1K83I 3IFUA 3CXCZ 2E9HA 2JA7I 3M3YI 4NBBA 3S14I 3CC2Z 2KPIA 3H3VJ 1JJ2Y 4MXUA 4HGYA 3S1NI 2QR1B 1VQO1 4MH4A 1K8A1 3I4MI 3S2DI 3ESWA 2EGTA 1Q862 2GTIA 1QVFY 2LFUA 1USPA 1Z01A 1YI2Z 4RVDA 3VMHA 1RO2A 2M48A 2P3YA 2NVTI 4A3DI 4A93I 1Y1VI 1VQ51 3K7AI 1K731 5FLXf 3M4OI 3JAMb 1N8R2 1Q811 3Q87A 3IX0A 3CQZI 3CMEZ 2W03A 3IF8A 1KRLA 3FKII 3KIHA 2E2HI 4S1TA 4DK1A 3NDJA 3G6EZ 3CCJ1 2DE5A 1NJI2 1VQMZ 4RVHA 2Q51A 4NBHA 2DE7A 4A3JI 4Y7NI 3I56Z 3CCL1 1VQK1 3CD6Z 3S2HI 1YHQZ 3GKQA 2JNYA 1Z02A 2RPRA 1YJ9Z 4AYBA 2V8IA 1M1K1 2GTHA 4E2YA 1Q7Y2 2JMOA 1VLAA 1PFTA 5D1OA 2JS4A 4A3LI 3RZOI 3FQMA 1Y1WI 5A2Qf 2J6AA 3VB9A 3CCV1 2ZAEB 3NDIA 3QWUA 2R7ZI 3G711 2R92I 3PO2I 1NP6A 2M6NA 1RLYA 2R93I 5IP9I 3PO3I 2PM9A 3EEDA 1YJN1 4BY7I 3J80b 1YHQ1 2GU2A 3LUSA 1S7MA 2K3RA 4NBFA 4MONA 3F3PC 1VQ81 4A3II 3EERA 5IP7I 1VQ4Z 2BJOA 4MD8A 3GTQI 5C4XI 5AN9F 3VMIA 3HOWI 5D1PA 1YIJZ 4NH1C 3CMA1 1TWCI 1KD11 1JWHC 4MD7A 4A3BI 1ZB9A 2H85A 1VQOZ 1VQNZ 1VQ5Z 1W2BY 3S17I 1Z03A 3CXCY 3G71Z 1VQ91 1Q821 5LL6f 1KC82 2Y0SA 3HOYI 3MZKB 2JR6A 1ML8A 4X6AI 2JA8I 3T4NB 3GTOI 3GTLI 3S1QI 4NBCA 1VQ6Z 3CCRZ 2YU9I 3HKZA 2OTLZ 1N2FA 2QA41 3S16I 3TDHB 5FLMI 1YITZ 1ZB8A 4RS4A 1YUAA 1I6HI 1I50I 3CPWZ 3CMAZ 1QYPA 3VMGA 3NH5A 3CCM1 1K9M1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QTT A;  3HOU I;  2PK7 A;  2E2I I;  1VLA A;  1PFT A;  2NVY I;  1L1O C;  2AKL A;  1R9T I;  4BXX I;  2JS4 A;  4A3L I;  3RZO I;  1Y1W I;  5C44 I;  3I07 A;  1TWA I;  1X3Z A;  2J6A A;  4A3C I;  3U50 C;  3VB9 A;  3GTP I;  2VUM I;  3GTK I;  3GTM S;  2R7Z I;  1X3W A;  4A3K I;  4NBA A;  4NBE A;  2R92 I;  2NVQ I;  3PO2 I;  3S1M I;  1TFI A;  4XX2 A;  1RLY A;  2R93 I;  3D6W A;  4NB9 A;  1Y1V S;  5IP9 I;  1K83 I;  3RZD I;  3PO3 I;  1USP B;  2JA7 I;  3M3Y I;  5C4J I;  4BBS I;  4NBB A;  3S14 I;  4BY7 I;  2KPI A;  2F4M A;  3H3V J;  3LUS A;  3S1N I;  4NBF A;  4A3E I;  2HF1 A;  4MH4 A;  3S2D I;  4A3I I;  3I4M I;  4NBG A;  3ESW A;  3EER A;  5IP7 I;  3S1R I;  2BJO A;  3GTQ I;  2K5R A;  5C4X I;  5C3E I;  4A3M I;  2JA5 I;  3HOW I;  3VMI A;  1USP A;  1TWC I;  3VMH A;  2P3Y A;  2NVT I;  1LQL A;  4A3B I;  1ZB9 A;  4BBR I;  4A3D I;  4A93 I;  1Y1V I;  3PO3 S;  3K7A I;  2B63 I;  3M4O I;  3S17 I;  3Q87 A;  4NB8 A;  3CQZ I;  5CM2 M;  3HOY I;  1TWF I;  3HOX I;  2JR6 A;  1ML8 A;  4X6A I;  2RBL A;  2JA8 I;  4A3G I;  3FKI I;  3GTO I;  1TWH I;  2NVX I;  3GTL I;  3S1Q I;  4NBC A;  2E2H I;  2E2J I;  1NUI A;  1TWG I;  4A3F I;  2YU9 I;  4NOZ A;  1RO4 A;  3GTG I;  1I3Q I;  4Y52 I;  3I4N I;  4NBD A;  2DE5 A;  4BY1 I;  1SFO I;  1N2F A;  3S16 I;  4NBH A;  4QTU A;  5FLM I;  1ZB8 A;  2DE7 A;  2F4O A;  1YUA A;  4A3J I;  4Y7N I;  1WW9 A;  3GCF A;  1I50 I;  1I6H I;  1WCM I;  2JA6 I;  3GTJ I;  3HOV I;  3S2H I;  1DL6 A;  2DE6 A;  3GKQ A;  3S15 I;  1QYP A;  3GTM I;  2JNY A;  3H0G I;  3VMG A;  3HOZ I; 
#chains in the Genus database with same CATH topology
 3HOU I;  3FQQ A;  3J81 b;  3MON A;  1VQ9 Z;  2E2I I;  4E2Z A;  1R9T I;  3BG1 B;  3CC4 1;  2OOY B;  3I07 A;  1TWA I;  2QA4 Z;  3CME 1;  2OOX B;  3GTP I;  3JAM f;  1VQL Z;  3GTM S;  3CCE 1;  4NBE A;  4RVF A;  1QVG Y;  3J80 f;  2NVQ I;  1TFI A;  4E33 A;  4DGL A;  4MRI A;  3G6E 1;  4E30 A;  2LIY A;  1SIW A;  3OW2 Y;  3NH8 A;  4BBS I;  3J81 f;  2PMZ A;  2F4M A;  3G4S Z;  1VQP Z;  3I56 1;  1K73 2;  2HF1 A;  1N8R 1;  1VQ7 1;  3KIF A;  1Q81 2;  5IT9 b;  4NBG A;  2K5R A;  5T67 A;  1VQ4 1;  4A3M I;  5C3E I;  2JA5 I;  1M90 1;  4MD9 A;  3I55 1;  1LQL A;  4NFR A;  3CCE Z;  3PO3 S;  2E7Z A;  1VQ8 Z;  1RO0 A;  2VUG A;  3CCJ Z;  2B63 I;  1RQF A;  2W04 A;  2V8K A;  2P28 A;  1Q86 1;  3P5J B;  5CM2 M;  1TWF I;  3HOX I;  2VF1 A;  5A2Q b;  4A3G I;  3BG0 B;  1TWH I;  2NVX I;  2QKD A;  2RIQ A;  2E2J I;  4A3F I;  2IV2 X;  3IR7 A;  1RO4 A;  5FLX b;  3I55 Z;  2QEX 1;  1S72 1;  3GTG I;  2IZ3 A;  2O53 A;  1SFO I;  4BY1 I;  2RT9 A;  4HGZ A;  2O4H A;  2KI7 B;  4EWC A;  1W2B Z;  2JIR A;  3GCF A;  1WCM I;  2JA6 I;  4TNU A;  3HOV I;  2IZ4 A;  2OTJ 1;  2DE6 A;  1DL6 A;  1KD1 2;  3H0G I;  1KQS Z;  2QRE B;  3HOZ I;  1K8A 2;  4QTT A;  1NJI 1;  2PK7 A;  2NVY I;  4E31 A;  1QXF A;  4RV9 A;  1KC8 1;  2JIO A;  1YJN Z;  2YAD A;  4DQY B;  1X3Z A;  4A3C I;  3CCL Z;  2WB1 A;  1RNI A;  1JJ2 Z;  1X3W A;  3D2L A;  2OTJ Z;  1M1K 2;  3S1M I;  3CC7 Z;  1YJW Z;  2OTL 1;  4HH4 A;  3D9X A;  1ZH1 A;  1Y1V S;  1WII A;  1USP B;  3NH4 A;  5C4J I;  5IT9 f;  2HU9 A;  2V45 A;  2OZK A;  1FDO A;  4A3E I;  2LEX A;  1QVG Z;  1P9N A;  2WAQ A;  3S1R I;  1VQK Z;  4E2W A;  3VTN A;  1YI2 1;  1YJ9 1;  1VQ6 1;  4BBR I;  1VQP 1;  3NFZ A;  1Q16 A;  1YIJ 1;  3CC7 1;  3CC4 Z;  1X0T A;  1Q7Y 1;  3MZL B;  4E2X A;  2QRC B;  2Q4Z A;  2I3C A;  3CCQ Z;  1YIT 1;  4NB8 A;  3CCV Z;  2RBL A;  2JUB A;  2VPZ A;  1YUK A;  1NUI A;  1TWG I;  2QRD B;  4NOZ A;  3J7A 4;  1I3Q I;  4Y52 I;  3I4N I;  4E32 A;  2QEX Z;  1VQM 1;  4NBD A;  1S72 Z;  2G2K A;  2R6M A;  4QTU A;  2F4O A;  5D1O B;  3CCS 1;  3CCU Z;  3CD6 1;  1WW9 A;  3GTJ I;  1M90 2;  3S15 I;  3GTM I;  2QLV B;  1WZN A;  4CL1 A;  5T64 A;  3CCQ 1;  1L1O C;  2AKL A;  2RHB A;  3CC2 1;  4BXX I;  1VQL 1;  3OW2 Z;  2JIQ A;  5C44 I;  1VQN 1;  3CPW Y;  5T6B A;  2V8J A;  3U50 C;  3CCS Z;  3CCU 1;  2VUM I;  3GTK I;  1K9M 2;  1VQ7 Z;  1Q82 2;  1QVF Z;  3F3F C;  4NBA A;  4A3K I;  3CCM Z;  4RVG A;  1QF8 A;  4XX2 A;  1KQS Y;  3D6W A;  1YJW 1;  3TE5 B;  3G4S 1;  3CCR 1;  4NB9 A;  3RZD I;  1K83 I;  3IFU A;  3CXC Z;  2E9H A;  2JA7 I;  3M3Y I;  4NBB A;  3S14 I;  3CC2 Z;  2KPI A;  3H3V J;  1JJ2 Y;  4MXU A;  4HGY A;  3S1N I;  2QR1 B;  1VQO 1;  4MH4 A;  1K8A 1;  3I4M I;  3S2D I;  3ESW A;  2EGT A;  1Q86 2;  2VPX A;  2GTI A;  1QVF Y;  2LFU A;  1USP A;  1Z01 A;  1YI2 Z;  4RVD A;  3VMH A;  1RO2 A;  2M48 A;  2NAP A;  2P3Y A;  2NVT I;  4A3D I;  4A93 I;  1Y1V I;  1VQ5 1;  3K7A I;  1K73 1;  5FLX f;  3M4O I;  3JAM b;  1N8R 2;  1Q81 1;  3Q87 A;  3IX0 A;  2VPY A;  3CQZ I;  3CME Z;  2W03 A;  2V3V A;  2VPW A;  3IF8 A;  1KRL A;  3FKI I;  3KIH A;  2E2H I;  4S1T A;  4DK1 A;  3NDJ A;  3G6E Z;  3CCJ 1;  2DE5 A;  1NJI 2;  1VQM Z;  4RVH A;  1Y8C A;  2Q51 A;  4NBH A;  2DE7 A;  4A3J I;  4Y7N I;  3I56 Z;  3CCL 1;  1VQK 1;  3CD6 Z;  3S2H I;  1YHQ Z;  3GKQ A;  2JIM A;  2JIP A;  2JNY A;  1Z02 A;  2RPR A;  1YJ9 Z;  4AYB A;  2V8I A;  1M1K 1;  2GTH A;  4E2Y A;  1Q7Y 2;  2JMO A;  1VLA A;  1PFT A;  2AYD A;  5D1O A;  2JS4 A;  4A3L I;  3RZO I;  3FQM A;  1Y1W I;  5A2Q f;  2J6A A;  1WJ2 A;  3VB9 A;  3CCV 1;  2ZAE B;  3NDI A;  3QWU A;  2R7Z I;  3G71 1;  2R92 I;  3PO2 I;  1NP6 A;  2M6N A;  1RLY A;  2R93 I;  5IP9 I;  3PO3 I;  2PM9 A;  3EED A;  1YJN 1;  4BY7 I;  3J80 b;  1YHQ 1;  2GU2 A;  3LUS A;  1S7M A;  2K3R A;  1FDI A;  4NBF A;  4MON A;  3F3P C;  1VQ8 1;  4A3I I;  3EER A;  5IP7 I;  1VQ4 Z;  2BJO A;  4MD8 A;  3GTQ I;  5C4X I;  5AN9 F;  3VMI A;  3HOW I;  5D1P A;  1YIJ Z;  4NH1 C;  3CMA 1;  1TWC I;  1KD1 1;  1JWH C;  4MD7 A;  4A3B I;  1ZB9 A;  2H85 A;  1VQO Z;  1VQN Z;  1VQ5 Z;  1W2B Y;  3S17 I;  1Z03 A;  3CXC Y;  3G71 Z;  1VQ9 1;  1Q82 1;  5LL6 f;  1KC8 2;  2Y0S A;  3HOY I;  3MZK B;  2JR6 A;  1ML8 A;  4X6A I;  2JA8 I;  3T4N B;  3GTO I;  3GTL I;  3S1Q I;  4NBC A;  1VQ6 Z;  3CCR Z;  2YU9 I;  3HKZ A;  1AA6 A;  2OTL Z;  1N2F A;  2QA4 1;  3S16 I;  3TDH B;  5FLM I;  1YIT Z;  1ZB8 A;  4RS4 A;  1YUA A;  1I6H I;  1I50 I;  3CPW Z;  3CMA Z;  1QYP A;  3VMG A;  3NH5 A;  3CCM 1;  1K9M 1; 
#chains in the Genus database with same CATH homology
 3HOU I;  3FQQ A;  3J81 b;  3MON A;  1VQ9 Z;  2E2I I;  4E2Z A;  1R9T I;  3BG1 B;  3CC4 1;  2OOY B;  3I07 A;  1TWA I;  2QA4 Z;  3CME 1;  2OOX B;  3GTP I;  3JAM f;  1VQL Z;  3GTM S;  3CCE 1;  4NBE A;  4RVF A;  1QVG Y;  3J80 f;  2NVQ I;  1TFI A;  4E33 A;  4DGL A;  4MRI A;  3G6E 1;  4E30 A;  2LIY A;  3OW2 Y;  3NH8 A;  4BBS I;  3J81 f;  2PMZ A;  2F4M A;  3G4S Z;  1VQP Z;  3I56 1;  1K73 2;  2HF1 A;  1N8R 1;  1VQ7 1;  3KIF A;  1Q81 2;  5IT9 b;  4NBG A;  2K5R A;  5T67 A;  1VQ4 1;  4A3M I;  5C3E I;  2JA5 I;  1M90 1;  4MD9 A;  3I55 1;  1LQL A;  4NFR A;  3CCE Z;  3PO3 S;  1VQ8 Z;  1RO0 A;  2VUG A;  3CCJ Z;  2B63 I;  1RQF A;  2W04 A;  2V8K A;  2P28 A;  1Q86 1;  3P5J B;  5CM2 M;  1TWF I;  3HOX I;  2VF1 A;  5A2Q b;  4A3G I;  3BG0 B;  1TWH I;  2NVX I;  2QKD A;  2RIQ A;  2E2J I;  4A3F I;  1RO4 A;  5FLX b;  3I55 Z;  2QEX 1;  1S72 1;  3GTG I;  2IZ3 A;  2O53 A;  1SFO I;  4BY1 I;  2RT9 A;  4HGZ A;  2O4H A;  2KI7 B;  4EWC A;  1W2B Z;  3GCF A;  1WCM I;  2JA6 I;  4TNU A;  3HOV I;  2IZ4 A;  2OTJ 1;  2DE6 A;  1DL6 A;  1KD1 2;  3H0G I;  1KQS Z;  2QRE B;  3HOZ I;  1K8A 2;  4QTT A;  1NJI 1;  2PK7 A;  2NVY I;  4E31 A;  4RV9 A;  1KC8 1;  1YJN Z;  2YAD A;  4DQY B;  1X3Z A;  4A3C I;  3CCL Z;  2WB1 A;  1RNI A;  1JJ2 Z;  1X3W A;  2OTJ Z;  1M1K 2;  3S1M I;  3CC7 Z;  1YJW Z;  2OTL 1;  4HH4 A;  3D9X A;  1ZH1 A;  1Y1V S;  1WII A;  1USP B;  3NH4 A;  5C4J I;  5IT9 f;  2HU9 A;  2OZK A;  4A3E I;  1QVG Z;  1P9N A;  2WAQ A;  3S1R I;  1VQK Z;  4E2W A;  3VTN A;  1YI2 1;  1YJ9 1;  1VQ6 1;  4BBR I;  1VQP 1;  3NFZ A;  1YIJ 1;  3CC7 1;  3CC4 Z;  1X0T A;  1Q7Y 1;  3MZL B;  4E2X A;  2QRC B;  2Q4Z A;  2I3C A;  3CCQ Z;  1YIT 1;  4NB8 A;  3CCV Z;  2RBL A;  2JUB A;  1YUK A;  1NUI A;  1TWG I;  2QRD B;  4NOZ A;  3J7A 4;  1I3Q I;  4Y52 I;  3I4N I;  4E32 A;  2QEX Z;  1VQM 1;  4NBD A;  1S72 Z;  2G2K A;  2R6M A;  4QTU A;  2F4O A;  5D1O B;  3CCS 1;  3CCU Z;  3CD6 1;  1WW9 A;  3GTJ I;  1M90 2;  3S15 I;  3GTM I;  2QLV B;  4CL1 A;  5T64 A;  3CCQ 1;  1L1O C;  2AKL A;  2RHB A;  3CC2 1;  4BXX I;  1VQL 1;  3OW2 Z;  5C44 I;  1VQN 1;  3CPW Y;  5T6B A;  2V8J A;  3U50 C;  3CCS Z;  3CCU 1;  2VUM I;  3GTK I;  1K9M 2;  1VQ7 Z;  1Q82 2;  1QVF Z;  3F3F C;  4NBA A;  4A3K I;  3CCM Z;  4RVG A;  1QF8 A;  4XX2 A;  1KQS Y;  3D6W A;  1YJW 1;  3TE5 B;  3G4S 1;  3CCR 1;  4NB9 A;  3RZD I;  1K83 I;  3IFU A;  3CXC Z;  2E9H A;  2JA7 I;  3M3Y I;  4NBB A;  3S14 I;  3CC2 Z;  2KPI A;  3H3V J;  1JJ2 Y;  4MXU A;  4HGY A;  3S1N I;  2QR1 B;  1VQO 1;  4MH4 A;  1K8A 1;  3I4M I;  3S2D I;  3ESW A;  2EGT A;  1Q86 2;  2GTI A;  1QVF Y;  2LFU A;  1USP A;  1Z01 A;  1YI2 Z;  4RVD A;  3VMH A;  1RO2 A;  2M48 A;  2P3Y A;  2NVT I;  4A3D I;  4A93 I;  1Y1V I;  1VQ5 1;  3K7A I;  1K73 1;  5FLX f;  3M4O I;  3JAM b;  1N8R 2;  1Q81 1;  3Q87 A;  3IX0 A;  3CQZ I;  3CME Z;  2W03 A;  3IF8 A;  1KRL A;  3FKI I;  3KIH A;  2E2H I;  4S1T A;  4DK1 A;  3NDJ A;  3G6E Z;  3CCJ 1;  2DE5 A;  1NJI 2;  1VQM Z;  4RVH A;  2Q51 A;  4NBH A;  2DE7 A;  4A3J I;  4Y7N I;  3I56 Z;  3CCL 1;  1VQK 1;  3CD6 Z;  3S2H I;  1YHQ Z;  3GKQ A;  2JNY A;  1Z02 A;  2RPR A;  1YJ9 Z;  4AYB A;  2V8I A;  1M1K 1;  2GTH A;  4E2Y A;  1Q7Y 2;  2JMO A;  1VLA A;  1PFT A;  5D1O A;  2JS4 A;  4A3L I;  3RZO I;  3FQM A;  1Y1W I;  5A2Q f;  2J6A A;  3VB9 A;  3CCV 1;  2ZAE B;  3NDI A;  3QWU A;  2R7Z I;  3G71 1;  2R92 I;  3PO2 I;  1NP6 A;  2M6N A;  1RLY A;  2R93 I;  5IP9 I;  3PO3 I;  2PM9 A;  3EED A;  1YJN 1;  4BY7 I;  3J80 b;  1YHQ 1;  2GU2 A;  3LUS A;  1S7M A;  2K3R A;  4NBF A;  4MON A;  3F3P C;  1VQ8 1;  4A3I I;  3EER A;  5IP7 I;  1VQ4 Z;  2BJO A;  4MD8 A;  3GTQ I;  5C4X I;  5AN9 F;  3VMI A;  3HOW I;  5D1P A;  1YIJ Z;  4NH1 C;  3CMA 1;  1TWC I;  1KD1 1;  1JWH C;  4MD7 A;  4A3B I;  1ZB9 A;  2H85 A;  1VQO Z;  1VQN Z;  1VQ5 Z;  1W2B Y;  3S17 I;  1Z03 A;  3CXC Y;  3G71 Z;  1VQ9 1;  1Q82 1;  5LL6 f;  1KC8 2;  2Y0S A;  3HOY I;  3MZK B;  2JR6 A;  1ML8 A;  4X6A I;  2JA8 I;  3T4N B;  3GTO I;  3GTL I;  3S1Q I;  4NBC A;  1VQ6 Z;  3CCR Z;  2YU9 I;  3HKZ A;  2OTL Z;  1N2F A;  2QA4 1;  3S16 I;  3TDH B;  5FLM I;  1YIT Z;  1ZB8 A;  4RS4 A;  1YUA A;  1I6H I;  1I50 I;  3CPW Z;  3CMA Z;  1QYP A;  3VMG A;  3NH5 A;  3CCM 1;  1K9M 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...