1YUAA

C-terminal domain of escherichia coli topoisomerase i
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
122
structure length
122
Chain Sequence
MNGEVAPPKEDPVPLPELPCEKSDAYFVLRDGAAGVFLAANTFPKSRETRAPLVEELYRFRDRLPEKLRYLADAPQQDPEGNKTMVRFSRKTKQQYVSSEKDGKATGWSAFYVDGKWVEGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOPOISOMERASE I
publication title Solution structure of the C-terminal single-stranded DNA-binding domain of Escherichia coli topoisomerase I.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 12
structure length 122
sequence length 122
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 1995-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08272 Topo_Zn_Ribbon Topoisomerase I zinc-ribbon-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yuaA02
3.30.65.10 Alpha Beta 2-Layer Sandwich Bacterial Topoisomerase I; domain 1 Bacterial Topoisomerase I, domain 1 1yuaA01
1X3ZA 2E2JI 4A3LI 1RO4A 1I50I 4A93I 2R92I 4NBDA 2JA6I 4BY7I 3S2DI 3GTLI 3I4MI 5CM2M 3S17I 1Y1WI 3LUSA 1PFTA 5C3EI 2KPIA 3VMHA 4NBAA 1YUAA 1VLAA 3M4OI 3S1QI 4NBHA 4A3FI 2P3YA 4NOZA 3RZDI 4BY1I 2E2HI 4XX2A 2VUMI 2HF1A 4A3GI 1Y1VI 3GTOI 4NBEA 3VMIA 1K83I 2DE6A 3I4NI 1X3WA 4A3II 2F4OA 3GTPI 3HOZI 4A3JI 5FLMI 1TFIA 2JA7I 2NVYI 2J6AA 1WCMI 1ZB9A 2K5RA 1I6HI 3HOWI 2AKLA 5IP9I 1LQLA 1RLYA 3PO3S 1USPB 4NB9A 4QTTA 3HOXI 5C4XI 3PO2I 2JNYA 3K7AI 3S14I 1TWCI 3RZOI 1L1OC 2B63I 2R93I 3VMGA 1ZB8A 1NUIA 2NVQI 1TWHI 3GTMI 3I07A 4NBFA 3H3VJ 2F4MA 1I3QI 2DE7A 2BJOA 4NBCA 1SFOI 1DL6A 4A3EI 3Q87A 4MH4A 4A3CI 3ESWA 3S16I 2NVXI 2JA5I 4A3MI 1WW9A 3GKQA 2NVTI 3GCFA 1TWAI 1Y1VS 3M3YI 3GTJI 3HOYI 3S1NI 2JS4A 3GTGI 3PO3I 1TWGI 3CQZI 1QYPA 3H0GI 4BBSI 4NBBA 5C4JI 3GTQI 2JR6A 4QTUA 3EERA 4X6AI 4Y7NI 2JA8I 2E2II 3HOVI 2DE5A 3FKII 1TWFI 4A3DI 1ML8A 2RBLA 4A3BI 4NBGA 3GTKI 3U50C 4BXXI 2YU9I 3S1RI 1USPA 3S15I 5IP7I 4NB8A 4BBRI 1N2FA 3S2HI 2R7ZI 3D6WA 3GTMS 5C44I 3HOUI 3VB9A 4Y52I 3S1MI 2PK7A 4A3KI 1R9TI
chains in the Genus database with same CATH superfamily
4DGLA 4A3LI 1RO4A 1VQ9Z 1ZH1A 4NBDA 4RVFA 1AA6A 3S2DI 2RPRA 1PFTA 5FLXb 3CMEZ 4EWCA 4NBAA 2VPZA 1VLAA 3S1QI 4A3FI 2GU2A 2K3RA 1QVGZ 3RZDI 4BY1I 4NFRA 3IX0A 3CXCY 4A3II 2WAQA 4A3JI 1RQFA 5FLMI 2AYDA 2J6AA 1YI2Z 2JIPA 3EEDA 3G4S1 1YHQ1 2LFUA 1YJN1 3CCUZ 2H85A 2NAPA 1KC81 1USPB 4NB9A 2Q4ZA 2ZAEB 3CCV1 3PO2I 1JWHC 1RNIA 1TWCI 1YJ9Z 1Z01A 1KC82 2R93I 3H3VJ 1I3QI 2BJOA 1FDOA 1JJ2Y 3CCS1 4MH4A 3NDIA 1VQKZ 3ESWA 2VF1A 3I55Z 4A3MI 2RIQA 3VTNA 1NJI2 3HOYI 3GTGI 4TNUA 2PMZA 1QVFY 2RHBA 3CCQZ 5C4JI 3GTQI 2JR6A 4QTUA 2V8IA 3EERA 2QEXZ 4X6AI 3CMA1 2QRDB 2G2KA 1ML8A 2RBLA 3BG1B 4A3BI 3GTKI 4RVDA 1VQMZ 1Q862 3S1RI 1USPA 2OTLZ 4E2YA 3CC71 4NB8A 1VQ41 3J81b 3J80f 3D6WA 3HKZA 3CC2Z 5C44I 3VB9A 3NDJA 2YADA 1Q822 4MD8A 2M6NA 4E2ZA 1R9TI 1X3ZA 3P5JB 1K8A2 2QR1B 2JA6I 4DQYB 2JIRA 3G6EZ 1Y1WI 5C3EI 2KPIA 5T6BA 4S1TA 1YUAA 1QVGY 4NOZA 1Z02A 4XX2A 3CC41 3CCE1 2HF1A 3CCRZ 1YJWZ 1VQ8Z 3VMIA 1K83I 2OOXB 2F4OA 1VQ7Z 2JA7I 1VQ6Z 2NVYI 1VQOZ 1ZB9A 3F3FC 1Z03A 3HOWI 2E7ZA 2JMOA 2R6MA 3PO3S 3QWUA 2IV2X 3CD6Z 1VQPZ 1QXFA 3S14I 5AN9F 2Y0SA 4RS4A 1NUIA 2VPXA 3I07A 3GTMI 2F4MA 4NBCA 1SFOI 4MD9A 3JAMf 3T4NB 2W04A 2NVXI 1K731 2P28A 2QA41 1WW9A 4NH1C 2NVTI 3GCFA 4RVGA 3CCLZ 3M3YI 2LIYA 3S1NI 1M901 3CQZI 3H0GI 1QF8A 2JA8I 4AYBA 3BG0B 5D1PA 1Q7Y1 3G4SZ 3CCM1 3F3PC 4BXXI 2YU9I 1WIIA 1VQK1 3S15I 5IP7I 1Q7Y2 3CCVZ 1N2FA 2R7ZI 4CL1A 3IF8A 3NFZA 1N8R1 2PM9A 3HOUI 2PK7A 2W03A 1YIJZ 4A3KI 5IT9f 3OW2Z 2OOYB 2E2JI 1NP6A 4MXUA 2QEX1 2HU9A 3CCSZ 2RT9A 2M48A 3I4MI 5CM2M 3S17I 3LUSA 3CCJZ 4HGZA 2OTL1 3M4OI 3D9XA 4NBHA 1VQN1 2V8JA 2E2HI 2QREB 1M1K1 5A2Qf 1K9M1 3TE5B 3CC21 1Y1VI 1VQ51 4NBEA 3I4NI 1X3WA 3HOZI 1TFIA 1YIT1 1RO2A 2K5RA 2AKLA 4E2XA 1Y8CA 1VQLZ 3G6E1 1Q811 2OTJ1 1RLYA 3I561 4QTTA 1KQSZ 2WB1A 3K7AI 4RV9A 4E33A 1L1OC 3TDHB 1VQ81 4NBFA 1S721 1VQ71 2GTHA 1VQ91 1KD11 3G71Z 4A3EI 3Q87A 4E30A 2Q51A 2QLVB 2JUBA 4MD7A 3MONA 3CPWZ 3S16I 2JIOA 2JA5I 1Q16A 1TWAI 3CCEZ 3CME1 2JS4A 2QKDA 3PO3I 3JAMb 2O4HA 2V3VA 4NBBA 2VPYA 3FKII 1TWFI 5LL6f 3FQMA 2KI7B 3NH4A 2VPWA 1YI21 3MZKB 3KIFA 1RO0A 3CCU1 4HGYA 3CCL1 3GTMS 2JIQA 3S1MI 3OW2Y 1K732 5FLXf 1SIWA 1I50I 1YJ91 4A93I 1W2BY 2R92I 1YUKA 1M902 4BY7I 3GTLI 4MRIA 1YHQZ 1YJNZ 1WZNA 2QA4Z 1S7MA 2V8KA 5D1OA 3VMHA 3I551 5IT9b 2O53A 1P9NA 2P3YA 1KRLA 2VUMI 1X0TA 4A3GI 3GTOI 3CCQ1 1YIJ1 2DE6A 1NJI1 3GTPI 3IFUA 3CCMZ 3FQQA 3CXCZ 1N8R2 2OZKA 1W2BZ 1WCMI 3J80b 1WJ2A 1I6HI 5A2Qb 2LEXA 5IP9I 3D2LA 1VQM1 1FDIA 1LQLA 4HH4A 1KQSY 3CCJ1 3HOXI 2JIMA 5C4XI 3J7A4 2JNYA 3NH5A 3RZOI 3CMAZ 2B63I 3VMGA 1ZB8A 1Q861 2NVQI 1TWHI 2DE7A 3NH8A 4RVHA 2QRCB 4E31A 1M1K2 1K9M2 1DL6A 1JJ2Z 2IZ4A 4MONA 3CPWY 4A3CI 3CC7Z 1Q821 1VQ4Z 4E32A 1VQNZ 3GKQA 1VQL1 2E9HA 1Y1VS 3GTJI 4E2WA 1K8A1 1VQ5Z 1TWGI 1QYPA 4BBSI 1QVFZ 1Q812 5T64A 4Y7NI 3CCR1 3J81f 2E2II 1YJW1 3HOVI 3KIHA 2DE5A 3MZLB 1YITZ 4A3DI 4NBGA 3G711 2OTJZ 3U50C 4DK1A 1VQ61 1VQO1 5T67A 3I56Z 2VUGA 4BBRI 2IZ3A 1KD12 3S2HI 2EGTA 5D1OB 3CC4Z 3IR7A 2V45A 2I3CA 3CD61 1VQP1 4Y52I 2GTIA 1S72Z
chains in the Genus database with same CATH topology
4DGLA 4A3LI 1RO4A 1VQ9Z 1ZH1A 4NBDA 4RVFA 3S2DI 2RPRA 1PFTA 5FLXb 3CMEZ 4EWCA 4NBAA 1VLAA 3S1QI 4A3FI 2GU2A 2K3RA 1QVGZ 3RZDI 4BY1I 4NFRA 3IX0A 3CXCY 4A3II 2WAQA 4A3JI 1RQFA 5FLMI 2J6AA 1YI2Z 3EEDA 3G4S1 1YHQ1 2LFUA 1YJN1 3CCUZ 2H85A 1KC81 1USPB 4NB9A 2Q4ZA 2ZAEB 3CCV1 3PO2I 1JWHC 1RNIA 1TWCI 1YJ9Z 1Z01A 1KC82 2R93I 3H3VJ 1I3QI 2BJOA 1JJ2Y 3CCS1 4MH4A 3NDIA 1VQKZ 3ESWA 2VF1A 3I55Z 4A3MI 2RIQA 3VTNA 1NJI2 3HOYI 3GTGI 4TNUA 2PMZA 1QVFY 2RHBA 3CCQZ 5C4JI 3GTQI 2JR6A 4QTUA 2V8IA 3EERA 2QEXZ 4X6AI 3CMA1 2QRDB 2G2KA 1ML8A 2RBLA 3BG1B 4A3BI 3GTKI 4RVDA 1VQMZ 1Q862 3S1RI 1USPA 2OTLZ 4E2YA 3CC71 4NB8A 1VQ41 3J81b 3J80f 3D6WA 3HKZA 3CC2Z 5C44I 3VB9A 3NDJA 2YADA 1Q822 4MD8A 2M6NA 4E2ZA 1R9TI 1X3ZA 3P5JB 1K8A2 2QR1B 2JA6I 4DQYB 3G6EZ 1Y1WI 5C3EI 2KPIA 5T6BA 4S1TA 1YUAA 1QVGY 4NOZA 1Z02A 4XX2A 3CC41 3CCE1 2HF1A 3CCRZ 1YJWZ 1VQ8Z 3VMIA 1K83I 2OOXB 2F4OA 1VQ7Z 2JA7I 1VQ6Z 2NVYI 1VQOZ 1ZB9A 3F3FC 1Z03A 3HOWI 2JMOA 2R6MA 3PO3S 3QWUA 3CD6Z 1VQPZ 3S14I 5AN9F 2Y0SA 4RS4A 1NUIA 3GTMI 3I07A 2F4MA 4NBCA 1SFOI 4MD9A 3JAMf 3T4NB 2W04A 2NVXI 1K731 2P28A 2QA41 1WW9A 4NH1C 2NVTI 3GCFA 4RVGA 3CCLZ 3M3YI 2LIYA 3S1NI 1M901 3CQZI 3H0GI 1QF8A 2JA8I 4AYBA 3BG0B 5D1PA 1Q7Y1 3G4SZ 3CCM1 3F3PC 4BXXI 2YU9I 1WIIA 1VQK1 3S15I 5IP7I 1Q7Y2 3CCVZ 1N2FA 2R7ZI 4CL1A 3IF8A 3NFZA 1N8R1 2PM9A 3HOUI 2PK7A 2W03A 1YIJZ 4A3KI 5IT9f 3OW2Z 2OOYB 2E2JI 1NP6A 4MXUA 2QEX1 2HU9A 3CCSZ 2RT9A 2M48A 3I4MI 5CM2M 3S17I 3LUSA 3CCJZ 4HGZA 2OTL1 3M4OI 3D9XA 4NBHA 1VQN1 2V8JA 2E2HI 2QREB 1M1K1 5A2Qf 1K9M1 3TE5B 3CC21 1Y1VI 1VQ51 4NBEA 3I4NI 1X3WA 3HOZI 1TFIA 1YIT1 1RO2A 2K5RA 2AKLA 4E2XA 1VQLZ 3G6E1 1Q811 2OTJ1 1RLYA 3I561 4QTTA 1KQSZ 2WB1A 3K7AI 4RV9A 4E33A 1L1OC 3TDHB 1VQ81 4NBFA 1S721 1VQ71 2GTHA 1VQ91 1KD11 3G71Z 4A3EI 3Q87A 4E30A 2Q51A 2QLVB 2JUBA 4MD7A 3MONA 3CPWZ 3S16I 2JA5I 1TWAI 3CCEZ 3CME1 2JS4A 2QKDA 3PO3I 3JAMb 2O4HA 4NBBA 3FKII 1TWFI 5LL6f 3FQMA 2KI7B 3NH4A 1YI21 3MZKB 3KIFA 1RO0A 3CCU1 4HGYA 3CCL1 3GTMS 3S1MI 3OW2Y 1K732 5FLXf 1I50I 1YJ91 4A93I 1W2BY 2R92I 1YUKA 1M902 4BY7I 3GTLI 4MRIA 1YHQZ 1YJNZ 2QA4Z 1S7MA 2V8KA 5D1OA 3VMHA 3I551 5IT9b 2O53A 1P9NA 2P3YA 1KRLA 2VUMI 1X0TA 4A3GI 3GTOI 3CCQ1 1YIJ1 2DE6A 1NJI1 3GTPI 3IFUA 3CCMZ 3FQQA 3CXCZ 1N8R2 2OZKA 1W2BZ 1WCMI 3J80b 1I6HI 5A2Qb 5IP9I 1VQM1 1LQLA 4HH4A 1KQSY 3CCJ1 3HOXI 5C4XI 3J7A4 2JNYA 3NH5A 3RZOI 3CMAZ 2B63I 3VMGA 1ZB8A 1Q861 2NVQI 1TWHI 2DE7A 3NH8A 4RVHA 2QRCB 4E31A 1M1K2 1K9M2 1DL6A 1JJ2Z 2IZ4A 4MONA 3CPWY 4A3CI 3CC7Z 1Q821 1VQ4Z 4E32A 1VQNZ 3GKQA 1VQL1 2E9HA 1Y1VS 3GTJI 4E2WA 1K8A1 1VQ5Z 1TWGI 1QYPA 4BBSI 1QVFZ 1Q812 5T64A 4Y7NI 3CCR1 3J81f 2E2II 1YJW1 3HOVI 3KIHA 2DE5A 3MZLB 1YITZ 4A3DI 4NBGA 3G711 2OTJZ 3U50C 4DK1A 1VQ61 1VQO1 5T67A 3I56Z 2VUGA 4BBRI 2IZ3A 1KD12 3S2HI 2EGTA 5D1OB 3CC4Z 2I3CA 3CD61 1VQP1 4Y52I 2GTIA 1S72Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3Z A;  2E2J I;  4A3L I;  1RO4 A;  1I50 I;  4A93 I;  2R92 I;  4NBD A;  2JA6 I;  4BY7 I;  3S2D I;  3GTL I;  3I4M I;  5CM2 M;  3S17 I;  1Y1W I;  3LUS A;  1PFT A;  5C3E I;  2KPI A;  3VMH A;  4NBA A;  1YUA A;  1VLA A;  3M4O I;  3S1Q I;  4NBH A;  4A3F I;  2P3Y A;  4NOZ A;  3RZD I;  4BY1 I;  2E2H I;  4XX2 A;  2VUM I;  2HF1 A;  4A3G I;  1Y1V I;  3GTO I;  4NBE A;  3VMI A;  1K83 I;  2DE6 A;  3I4N I;  1X3W A;  4A3I I;  2F4O A;  3GTP I;  3HOZ I;  4A3J I;  5FLM I;  1TFI A;  2JA7 I;  2NVY I;  2J6A A;  1WCM I;  1ZB9 A;  2K5R A;  1I6H I;  3HOW I;  2AKL A;  5IP9 I;  1LQL A;  1RLY A;  3PO3 S;  1USP B;  4NB9 A;  4QTT A;  3HOX I;  5C4X I;  3PO2 I;  2JNY A;  3K7A I;  3S14 I;  1TWC I;  3RZO I;  1L1O C;  2B63 I;  2R93 I;  3VMG A;  1ZB8 A;  1NUI A;  2NVQ I;  1TWH I;  3GTM I;  3I07 A;  4NBF A;  3H3V J;  2F4M A;  1I3Q I;  2DE7 A;  2BJO A;  4NBC A;  1SFO I;  1DL6 A;  4A3E I;  3Q87 A;  4MH4 A;  4A3C I;  3ESW A;  3S16 I;  2NVX I;  2JA5 I;  4A3M I;  1WW9 A;  3GKQ A;  2NVT I;  3GCF A;  1TWA I;  1Y1V S;  3M3Y I;  3GTJ I;  3HOY I;  3S1N I;  2JS4 A;  3GTG I;  3PO3 I;  1TWG I;  3CQZ I;  1QYP A;  3H0G I;  4BBS I;  4NBB A;  5C4J I;  3GTQ I;  2JR6 A;  4QTU A;  3EER A;  4X6A I;  4Y7N I;  2JA8 I;  2E2I I;  3HOV I;  2DE5 A;  3FKI I;  1TWF I;  4A3D I;  1ML8 A;  2RBL A;  4A3B I;  4NBG A;  3GTK I;  3U50 C;  4BXX I;  2YU9 I;  3S1R I;  1USP A;  3S15 I;  5IP7 I;  4NB8 A;  4BBR I;  1N2F A;  3S2H I;  2R7Z I;  3D6W A;  3GTM S;  5C44 I;  3HOU I;  3VB9 A;  4Y52 I;  3S1M I;  2PK7 A;  4A3K I;  1R9T I; 
#chains in the Genus database with same CATH topology
 4DGL A;  4A3L I;  1RO4 A;  1VQ9 Z;  1ZH1 A;  4NBD A;  4RVF A;  1AA6 A;  3S2D I;  2RPR A;  1PFT A;  5FLX b;  3CME Z;  4EWC A;  4NBA A;  2VPZ A;  1VLA A;  3S1Q I;  4A3F I;  2GU2 A;  2K3R A;  1QVG Z;  3RZD I;  4BY1 I;  4NFR A;  3IX0 A;  3CXC Y;  4A3I I;  2WAQ A;  4A3J I;  1RQF A;  5FLM I;  2AYD A;  2J6A A;  1YI2 Z;  2JIP A;  3EED A;  3G4S 1;  1YHQ 1;  2LFU A;  1YJN 1;  3CCU Z;  2H85 A;  2NAP A;  1KC8 1;  1USP B;  4NB9 A;  2Q4Z A;  2ZAE B;  3CCV 1;  3PO2 I;  1JWH C;  1RNI A;  1TWC I;  1YJ9 Z;  1Z01 A;  1KC8 2;  2R93 I;  3H3V J;  1I3Q I;  2BJO A;  1FDO A;  1JJ2 Y;  3CCS 1;  4MH4 A;  3NDI A;  1VQK Z;  3ESW A;  2VF1 A;  3I55 Z;  4A3M I;  2RIQ A;  3VTN A;  1NJI 2;  3HOY I;  3GTG I;  4TNU A;  2PMZ A;  1QVF Y;  2RHB A;  3CCQ Z;  5C4J I;  3GTQ I;  2JR6 A;  4QTU A;  2V8I A;  3EER A;  2QEX Z;  4X6A I;  3CMA 1;  2QRD B;  2G2K A;  1ML8 A;  2RBL A;  3BG1 B;  4A3B I;  3GTK I;  4RVD A;  1VQM Z;  1Q86 2;  3S1R I;  1USP A;  2OTL Z;  4E2Y A;  3CC7 1;  4NB8 A;  1VQ4 1;  3J81 b;  3J80 f;  3D6W A;  3HKZ A;  3CC2 Z;  5C44 I;  3VB9 A;  3NDJ A;  2YAD A;  1Q82 2;  4MD8 A;  2M6N A;  4E2Z A;  1R9T I;  1X3Z A;  3P5J B;  1K8A 2;  2QR1 B;  2JA6 I;  4DQY B;  2JIR A;  3G6E Z;  1Y1W I;  5C3E I;  2KPI A;  5T6B A;  4S1T A;  1YUA A;  1QVG Y;  4NOZ A;  1Z02 A;  4XX2 A;  3CC4 1;  3CCE 1;  2HF1 A;  3CCR Z;  1YJW Z;  1VQ8 Z;  3VMI A;  1K83 I;  2OOX B;  2F4O A;  1VQ7 Z;  2JA7 I;  1VQ6 Z;  2NVY I;  1VQO Z;  1ZB9 A;  3F3F C;  1Z03 A;  3HOW I;  2E7Z A;  2JMO A;  2R6M A;  3PO3 S;  3QWU A;  2IV2 X;  3CD6 Z;  1VQP Z;  1QXF A;  3S14 I;  5AN9 F;  2Y0S A;  4RS4 A;  1NUI A;  2VPX A;  3I07 A;  3GTM I;  2F4M A;  4NBC A;  1SFO I;  4MD9 A;  3JAM f;  3T4N B;  2W04 A;  2NVX I;  1K73 1;  2P28 A;  2QA4 1;  1WW9 A;  4NH1 C;  2NVT I;  3GCF A;  4RVG A;  3CCL Z;  3M3Y I;  2LIY A;  3S1N I;  1M90 1;  3CQZ I;  3H0G I;  1QF8 A;  2JA8 I;  4AYB A;  3BG0 B;  5D1P A;  1Q7Y 1;  3G4S Z;  3CCM 1;  3F3P C;  4BXX I;  2YU9 I;  1WII A;  1VQK 1;  3S15 I;  5IP7 I;  1Q7Y 2;  3CCV Z;  1N2F A;  2R7Z I;  4CL1 A;  3IF8 A;  3NFZ A;  1N8R 1;  2PM9 A;  3HOU I;  2PK7 A;  2W03 A;  1YIJ Z;  4A3K I;  5IT9 f;  3OW2 Z;  2OOY B;  2E2J I;  1NP6 A;  4MXU A;  2QEX 1;  2HU9 A;  3CCS Z;  2RT9 A;  2M48 A;  3I4M I;  5CM2 M;  3S17 I;  3LUS A;  3CCJ Z;  4HGZ A;  2OTL 1;  3M4O I;  3D9X A;  4NBH A;  1VQN 1;  2V8J A;  2E2H I;  2QRE B;  1M1K 1;  5A2Q f;  1K9M 1;  3TE5 B;  3CC2 1;  1Y1V I;  1VQ5 1;  4NBE A;  3I4N I;  1X3W A;  3HOZ I;  1TFI A;  1YIT 1;  1RO2 A;  2K5R A;  2AKL A;  4E2X A;  1Y8C A;  1VQL Z;  3G6E 1;  1Q81 1;  2OTJ 1;  1RLY A;  3I56 1;  4QTT A;  1KQS Z;  2WB1 A;  3K7A I;  4RV9 A;  4E33 A;  1L1O C;  3TDH B;  1VQ8 1;  4NBF A;  1S72 1;  1VQ7 1;  2GTH A;  1VQ9 1;  1KD1 1;  3G71 Z;  4A3E I;  3Q87 A;  4E30 A;  2Q51 A;  2QLV B;  2JUB A;  4MD7 A;  3MON A;  3CPW Z;  3S16 I;  2JIO A;  2JA5 I;  1Q16 A;  1TWA I;  3CCE Z;  3CME 1;  2JS4 A;  2QKD A;  3PO3 I;  3JAM b;  2O4H A;  2V3V A;  4NBB A;  2VPY A;  3FKI I;  1TWF I;  5LL6 f;  3FQM A;  2KI7 B;  3NH4 A;  2VPW A;  1YI2 1;  3MZK B;  3KIF A;  1RO0 A;  3CCU 1;  4HGY A;  3CCL 1;  3GTM S;  2JIQ A;  3S1M I;  3OW2 Y;  1K73 2;  5FLX f;  1SIW A;  1I50 I;  1YJ9 1;  4A93 I;  1W2B Y;  2R92 I;  1YUK A;  1M90 2;  4BY7 I;  3GTL I;  4MRI A;  1YHQ Z;  1YJN Z;  1WZN A;  2QA4 Z;  1S7M A;  2V8K A;  5D1O A;  3VMH A;  3I55 1;  5IT9 b;  2O53 A;  1P9N A;  2P3Y A;  1KRL A;  2VUM I;  1X0T A;  4A3G I;  3GTO I;  3CCQ 1;  1YIJ 1;  2DE6 A;  1NJI 1;  3GTP I;  3IFU A;  3CCM Z;  3FQQ A;  3CXC Z;  1N8R 2;  2OZK A;  1W2B Z;  1WCM I;  3J80 b;  1WJ2 A;  1I6H I;  5A2Q b;  2LEX A;  5IP9 I;  3D2L A;  1VQM 1;  1FDI A;  1LQL A;  4HH4 A;  1KQS Y;  3CCJ 1;  3HOX I;  2JIM A;  5C4X I;  3J7A 4;  2JNY A;  3NH5 A;  3RZO I;  3CMA Z;  2B63 I;  3VMG A;  1ZB8 A;  1Q86 1;  2NVQ I;  1TWH I;  2DE7 A;  3NH8 A;  4RVH A;  2QRC B;  4E31 A;  1M1K 2;  1K9M 2;  1DL6 A;  1JJ2 Z;  2IZ4 A;  4MON A;  3CPW Y;  4A3C I;  3CC7 Z;  1Q82 1;  1VQ4 Z;  4E32 A;  1VQN Z;  3GKQ A;  1VQL 1;  2E9H A;  1Y1V S;  3GTJ I;  4E2W A;  1K8A 1;  1VQ5 Z;  1TWG I;  1QYP A;  4BBS I;  1QVF Z;  1Q81 2;  5T64 A;  4Y7N I;  3CCR 1;  3J81 f;  2E2I I;  1YJW 1;  3HOV I;  3KIH A;  2DE5 A;  3MZL B;  1YIT Z;  4A3D I;  4NBG A;  3G71 1;  2OTJ Z;  3U50 C;  4DK1 A;  1VQ6 1;  1VQO 1;  5T67 A;  3I56 Z;  2VUG A;  4BBR I;  2IZ3 A;  1KD1 2;  3S2H I;  2EGT A;  5D1O B;  3CC4 Z;  3IR7 A;  2V45 A;  2I3C A;  3CD6 1;  1VQP 1;  4Y52 I;  2GTI A;  1S72 Z; 
#chains in the Genus database with same CATH homology
 4DGL A;  4A3L I;  1RO4 A;  1VQ9 Z;  1ZH1 A;  4NBD A;  4RVF A;  3S2D I;  2RPR A;  1PFT A;  5FLX b;  3CME Z;  4EWC A;  4NBA A;  1VLA A;  3S1Q I;  4A3F I;  2GU2 A;  2K3R A;  1QVG Z;  3RZD I;  4BY1 I;  4NFR A;  3IX0 A;  3CXC Y;  4A3I I;  2WAQ A;  4A3J I;  1RQF A;  5FLM I;  2J6A A;  1YI2 Z;  3EED A;  3G4S 1;  1YHQ 1;  2LFU A;  1YJN 1;  3CCU Z;  2H85 A;  1KC8 1;  1USP B;  4NB9 A;  2Q4Z A;  2ZAE B;  3CCV 1;  3PO2 I;  1JWH C;  1RNI A;  1TWC I;  1YJ9 Z;  1Z01 A;  1KC8 2;  2R93 I;  3H3V J;  1I3Q I;  2BJO A;  1JJ2 Y;  3CCS 1;  4MH4 A;  3NDI A;  1VQK Z;  3ESW A;  2VF1 A;  3I55 Z;  4A3M I;  2RIQ A;  3VTN A;  1NJI 2;  3HOY I;  3GTG I;  4TNU A;  2PMZ A;  1QVF Y;  2RHB A;  3CCQ Z;  5C4J I;  3GTQ I;  2JR6 A;  4QTU A;  2V8I A;  3EER A;  2QEX Z;  4X6A I;  3CMA 1;  2QRD B;  2G2K A;  1ML8 A;  2RBL A;  3BG1 B;  4A3B I;  3GTK I;  4RVD A;  1VQM Z;  1Q86 2;  3S1R I;  1USP A;  2OTL Z;  4E2Y A;  3CC7 1;  4NB8 A;  1VQ4 1;  3J81 b;  3J80 f;  3D6W A;  3HKZ A;  3CC2 Z;  5C44 I;  3VB9 A;  3NDJ A;  2YAD A;  1Q82 2;  4MD8 A;  2M6N A;  4E2Z A;  1R9T I;  1X3Z A;  3P5J B;  1K8A 2;  2QR1 B;  2JA6 I;  4DQY B;  3G6E Z;  1Y1W I;  5C3E I;  2KPI A;  5T6B A;  4S1T A;  1YUA A;  1QVG Y;  4NOZ A;  1Z02 A;  4XX2 A;  3CC4 1;  3CCE 1;  2HF1 A;  3CCR Z;  1YJW Z;  1VQ8 Z;  3VMI A;  1K83 I;  2OOX B;  2F4O A;  1VQ7 Z;  2JA7 I;  1VQ6 Z;  2NVY I;  1VQO Z;  1ZB9 A;  3F3F C;  1Z03 A;  3HOW I;  2JMO A;  2R6M A;  3PO3 S;  3QWU A;  3CD6 Z;  1VQP Z;  3S14 I;  5AN9 F;  2Y0S A;  4RS4 A;  1NUI A;  3GTM I;  3I07 A;  2F4M A;  4NBC A;  1SFO I;  4MD9 A;  3JAM f;  3T4N B;  2W04 A;  2NVX I;  1K73 1;  2P28 A;  2QA4 1;  1WW9 A;  4NH1 C;  2NVT I;  3GCF A;  4RVG A;  3CCL Z;  3M3Y I;  2LIY A;  3S1N I;  1M90 1;  3CQZ I;  3H0G I;  1QF8 A;  2JA8 I;  4AYB A;  3BG0 B;  5D1P A;  1Q7Y 1;  3G4S Z;  3CCM 1;  3F3P C;  4BXX I;  2YU9 I;  1WII A;  1VQK 1;  3S15 I;  5IP7 I;  1Q7Y 2;  3CCV Z;  1N2F A;  2R7Z I;  4CL1 A;  3IF8 A;  3NFZ A;  1N8R 1;  2PM9 A;  3HOU I;  2PK7 A;  2W03 A;  1YIJ Z;  4A3K I;  5IT9 f;  3OW2 Z;  2OOY B;  2E2J I;  1NP6 A;  4MXU A;  2QEX 1;  2HU9 A;  3CCS Z;  2RT9 A;  2M48 A;  3I4M I;  5CM2 M;  3S17 I;  3LUS A;  3CCJ Z;  4HGZ A;  2OTL 1;  3M4O I;  3D9X A;  4NBH A;  1VQN 1;  2V8J A;  2E2H I;  2QRE B;  1M1K 1;  5A2Q f;  1K9M 1;  3TE5 B;  3CC2 1;  1Y1V I;  1VQ5 1;  4NBE A;  3I4N I;  1X3W A;  3HOZ I;  1TFI A;  1YIT 1;  1RO2 A;  2K5R A;  2AKL A;  4E2X A;  1VQL Z;  3G6E 1;  1Q81 1;  2OTJ 1;  1RLY A;  3I56 1;  4QTT A;  1KQS Z;  2WB1 A;  3K7A I;  4RV9 A;  4E33 A;  1L1O C;  3TDH B;  1VQ8 1;  4NBF A;  1S72 1;  1VQ7 1;  2GTH A;  1VQ9 1;  1KD1 1;  3G71 Z;  4A3E I;  3Q87 A;  4E30 A;  2Q51 A;  2QLV B;  2JUB A;  4MD7 A;  3MON A;  3CPW Z;  3S16 I;  2JA5 I;  1TWA I;  3CCE Z;  3CME 1;  2JS4 A;  2QKD A;  3PO3 I;  3JAM b;  2O4H A;  4NBB A;  3FKI I;  1TWF I;  5LL6 f;  3FQM A;  2KI7 B;  3NH4 A;  1YI2 1;  3MZK B;  3KIF A;  1RO0 A;  3CCU 1;  4HGY A;  3CCL 1;  3GTM S;  3S1M I;  3OW2 Y;  1K73 2;  5FLX f;  1I50 I;  1YJ9 1;  4A93 I;  1W2B Y;  2R92 I;  1YUK A;  1M90 2;  4BY7 I;  3GTL I;  4MRI A;  1YHQ Z;  1YJN Z;  2QA4 Z;  1S7M A;  2V8K A;  5D1O A;  3VMH A;  3I55 1;  5IT9 b;  2O53 A;  1P9N A;  2P3Y A;  1KRL A;  2VUM I;  1X0T A;  4A3G I;  3GTO I;  3CCQ 1;  1YIJ 1;  2DE6 A;  1NJI 1;  3GTP I;  3IFU A;  3CCM Z;  3FQQ A;  3CXC Z;  1N8R 2;  2OZK A;  1W2B Z;  1WCM I;  3J80 b;  1I6H I;  5A2Q b;  5IP9 I;  1VQM 1;  1LQL A;  4HH4 A;  1KQS Y;  3CCJ 1;  3HOX I;  5C4X I;  3J7A 4;  2JNY A;  3NH5 A;  3RZO I;  3CMA Z;  2B63 I;  3VMG A;  1ZB8 A;  1Q86 1;  2NVQ I;  1TWH I;  2DE7 A;  3NH8 A;  4RVH A;  2QRC B;  4E31 A;  1M1K 2;  1K9M 2;  1DL6 A;  1JJ2 Z;  2IZ4 A;  4MON A;  3CPW Y;  4A3C I;  3CC7 Z;  1Q82 1;  1VQ4 Z;  4E32 A;  1VQN Z;  3GKQ A;  1VQL 1;  2E9H A;  1Y1V S;  3GTJ I;  4E2W A;  1K8A 1;  1VQ5 Z;  1TWG I;  1QYP A;  4BBS I;  1QVF Z;  1Q81 2;  5T64 A;  4Y7N I;  3CCR 1;  3J81 f;  2E2I I;  1YJW 1;  3HOV I;  3KIH A;  2DE5 A;  3MZL B;  1YIT Z;  4A3D I;  4NBG A;  3G71 1;  2OTJ Z;  3U50 C;  4DK1 A;  1VQ6 1;  1VQO 1;  5T67 A;  3I56 Z;  2VUG A;  4BBR I;  2IZ3 A;  1KD1 2;  3S2H I;  2EGT A;  5D1O B;  3CC4 Z;  2I3C A;  3CD6 1;  1VQP 1;  4Y52 I;  2GTI A;  1S72 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...