1YUAA

C-terminal domain of escherichia coli topoisomerase i
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
122
structure length
122
Chain Sequence
b'MNGEVAPPKEDPVPLPELPCEKSDAYFVLRDGAAGVFLAANTFPKSRETRAPLVEELYRFRDRLPEKLRYLADAPQQDPEGNKTMVRFSRKTKQQYVSSEKDGKATGWSAFYVDGKWVEGKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOPOISOMERASE I
publication title Solution structure of the C-terminal single-stranded DNA-binding domain of Escherichia coli topoisomerase I.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 12
structure length 122
sequence length 122
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 1995-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08272 Topo_Zn_Ribbon Topoisomerase I zinc-ribbon-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1yuaA02
3.30.65.10 Alpha Beta 2-Layer Sandwich Bacterial Topoisomerase I; domain 1 Bacterial Topoisomerase I, domain 1 1yuaA01
1N2FA 1I6HI 2NVXI 2JR6A 1DL6A 3S2HI 4A3JI 1VLAA 2DE5A 3HOVI 3HOWI 2PK7A 1Y1WI 2E2HI 3S16I 3PO2I 1Y1VI 2JA5I 1TWCI 3HOZI 3S15I 3RZDI 1PFTA 1USPA 4NBEA 4Y7NI 3GTPI 1ZB8A 1Y1VS 3VMHA 3M4OI 1YUAA 1ZB9A 1WCMI 4NBDA 3RZOI 1TFIA 1X3WA 3HOYI 4X6AI 1I3QI 4BBSI 2NVYI 4BXXI 2F4MA 4NBBA 1QYPA 2JA6I 3ESWA 2R92I 3FKII 3GKQA 4A3EI 2R7ZI 1ML8A 2R93I 1WW9A 2HF1A 4A3KI 3S1NI 1TWHI 2DE6A 3GTMI 4NBAA 2VUMI 4NBFA 3GTMS 4BBRI 1RLYA 4NOZA 3CQZI 3HOXI 2J6AA 3I07A 4NB8A 3S1MI 4A3BI 3HOUI 4BY7I 3GTQI 3VB9A 2RBLA 1TWFI 3GTKI 3M3YI 1RO4A 1K83I 3VMGA 3I4NI 4A3LI 4A93I 3GTOI 4NB9A 5C44I 3S17I 4MH4A 3Q87A 3S1RI 2AKLA 5C3EI 1TWGI 4Y52I 4A3MI 2JNYA 2JS4A 1I50I 5C4XI 3H0GI 3K7AI 2E2II 4A3CI 4XX2A 2F4OA 2KPIA 3EERA 4NBHA 3U50C 2B63I 4NBCA 1LQLA 4QTUA 2YU9I 4NBGA 2K5RA 3D6WA 3PO3I 1X3ZA 5FLMI 2JA8I 4A3DI 3PO3S 3GTLI 1L1OC 3S2DI 5C4JI 3S14I 4A3II 1SFOI 2P3YA 5IP9I 5IP7I 2DE7A 3GTJI 1USPB 2BJOA 3I4MI 2E2JI 5CM2M 3S1QI 1TWAI 1R9TI 3GCFA 3H3VJ 2NVTI 3GTGI 4QTTA 4A3FI 3LUSA 4BY1I 3VMIA 4A3GI 2JA7I 2NVQI 1NUIA
chains in the Genus database with same CATH superfamily
2V45A 2NVXI 3CPWY 1QVFY 3NH4A 3HOWI 3KIFA 2PK7A 3G6EZ 3BG0B 3CXCY 3HOZI 3CCVZ 1Y1VS 3CCJ1 4HGYA 3VMHA 2WAQA 1Y8CA 1KC82 1NJI1 1K9M2 3HOYI 1RO0A 4X6AI 1Q811 2JA6I 2V8IA 1YIT1 2JIOA 3I551 3GKQA 4A3EI 3G71Z 2HF1A 4A3KI 5IT9f 2DE6A 4E31A 2GTIA 1VQ4Z 3GTMS 1Q16A 3CC7Z 1YJWZ 4NB8A 3CCV1 1NJI2 4A3BI 3HOUI 1P9NA 1Q861 3MZLB 3GTKI 1VQL1 1RO4A 1K83I 3VMGA 1Q812 3I4NI 3CD61 2LIYA 3S17I 1FDOA 4MD8A 3I561 3S1RI 4Y52I 2JS4A 2V8KA 2QLVB 3H0GI 1Q821 3T4NB 3G4SZ 2V8JA 3U50C 2B63I 1VQ9Z 1S7MA 5T67A 1K8A1 1LQLA 4NBGA 2EGTA 2Y0SA 1Q862 4MRIA 2OTLZ 3CC71 1QVFZ 1YJ91 3S2DI 1L1OC 4DGLA 3TDHB 2P3YA 3CXCZ 3D2LA 5D1OA 3MZKB 2VPXA 2IZ3A 3CMEZ 1QVGZ 2HU9A 2QKDA 4E32A 3J81f 2QEX1 4QTTA 5FLXb 3G4S1 4NH1C 3LUSA 3VMIA 2JA7I 1RNIA 4DQYB 2IV2X 1N2FA 2VPYA 2VPZA 2JR6A 2OOYB 4NFRA 2OTL1 3S2HI 1AA6A 2E2HI 1VQO1 1YHQZ 1N8R1 3P5JB 1VQPZ 2O4HA 1TWCI 3NDIA 2JA5I 3RZDI 3S15I 1USPA 4NBEA 4Y7NI 3GTPI 1S721 1RO2A 3M4OI 3CME1 2W04A 2QRCB 2LFUA 1JJ2Y 1WCMI 2E7ZA 1YIJ1 1X3WA 1VQNZ 1I3QI 4BBSI 1KD11 1K9M1 4BXXI 2F4MA 3JAMf 4RV9A 3IX0A 3ESWA 3J81b 2VUGA 2R7ZI 1N8R2 1ML8A 1WW9A 3CMA1 3VTNA 3CC2Z 4NBAA 2RHBA 2VUMI 4RS4A 3CCE1 3IR7A 3CCU1 1QVGY 1YHQ1 1RLYA 1X0TA 4NOZA 1VQP1 2M48A 3CQZI 4AYBA 3I07A 3GTQI 3VB9A 1KD12 2RBLA 2Q51A 4A93I 2RIQA 5D1OB 1WJ2A 1TWGI 2JIPA 1VQN1 4MONA 1I50I 5C4XI 2E2II 3F3PC 4A3CI 2JIQA 2F4OA 1WIIA 2V3VA 4NBHA 2JIMA 3G6E1 4RVFA 3MONA 3CCRZ 4QTUA 3CC21 3JAMb 2YU9I 3M3YI 2K5RA 3D6WA 4S1TA 5FLMI 3PO3S 2P28A 3NH8A 2JUBA 2LEXA 4A3II 5IP7I 1YI2Z 4RVDA 3GTJI 1USPB 5CM2M 1R9TI 1JJ2Z 2KI7B 3G711 2QA4Z 2NVTI 3CC4Z 3GTGI 1M902 2K3RA 4EWCA 3FQMA 2NVQI 3J80f 3FQQA 1QF8A 3CCSZ 1VQ41 2PM9A 3CCR1 1VQKZ 1I6HI 1YJW1 1VQ5Z 5IT9b 4RVHA 1VLAA 1YJNZ 3CCMZ 1Y1WI 3S16I 2YADA 1KQSY 1Y1VI 1PFTA 2OOXB 4E30A 4HH4A 1YI21 1YUAA 3CCQZ 1ZH1A 1ZB9A 1VQ6Z 5A2Qf 4DK1A 2QA41 1VQ91 3CC41 3OW2Y 2GU2A 3CCS1 2R92I 3FKII 2H85A 1VQK1 1Q7Y1 3S1NI 2M6NA 3GTMI 3HKZA 2AYDA 1YJN1 3CCM1 4NBFA 2J6AA 3IF8A 1Z03A 4E2XA 2QR1B 3S1MI 4BY7I 2E9HA 2I3CA 3CCQ1 2G2KA 4A3LI 2QREB 5C44I 1VQ61 2NAPA 2JNYA 1Q7Y2 4HGZA 1VQ7Z 4XX2A 4E2YA 1SIWA 5LL6f 5A2Qb 1W2BZ 2W03A 4NBCA 3F3FC 1YITZ 1X3ZA 1YUKA 2JA8I 4A3DI 3GTLI 2IZ4A 3S14I 1KQSZ 1VQ8Z 1K731 1RQFA 2DE7A 4CL1A 1FDIA 2E2JI 3S1QI 1TWAI 2QRDB 3NFZA 1VQLZ 1WZNA 1VQ71 3CD6Z 3OW2Z 3I56Z 1M901 3KIHA 2PMZA 3EEDA 5T64A 2OZKA 1DL6A 2RT9A 1Z02A 1K732 2JMOA 4A3JI 2DE5A 3HOVI 3PO2I 4MD9A 1VQ81 1ZB8A 1JWHC 1YJ9Z 5AN9F 3NDJA 4NBDA 3RZOI 1TFIA 1W2BY 2VF1A 5FLXf 3CCLZ 2OTJZ 2JIRA 2NVYI 3J7A4 4NBBA 1QYPA 2QEXZ 1M1K1 3IFUA 2R93I 1KRLA 1TWHI 2Q4ZA 3NH5A 3BG1B 4BBRI 3D9XA 3QWUA 1QXFA 3HOXI 3CPWZ 1TWFI 1VQOZ 3GTOI 4NB9A 4TNUA 4MH4A 3Q87A 2AKLA 5C3EI 4A3MI 1S72Z 1Q822 3CCL1 1M1K2 2OTJ1 3K7AI 2O53A 1VQMZ 2KPIA 3EERA 1VQ51 4E33A 1YIJZ 4MXUA 5T6BA 1K8A2 5D1PA 3J80b 1Z01A 2WB1A 3PO3I 4RVGA 5C4JI 3CMAZ 2GTHA 1SFOI 5IP9I 3CCEZ 3CCUZ 3CCJZ 2BJOA 4MD7A 3TE5B 2R6MA 3I4MI 2VPWA 4E2ZA 3GCFA 3H3VJ 2RPRA 1VQM1 2ZAEB 1NP6A 4A3FI 1KC81 4BY1I 4A3GI 4E2WA 1NUIA 3I55Z
chains in the Genus database with same CATH topology
2NVXI 3CPWY 1QVFY 3NH4A 3HOWI 3KIFA 2PK7A 3G6EZ 3BG0B 3CXCY 3HOZI 3CCVZ 1Y1VS 3CCJ1 4HGYA 3VMHA 2WAQA 1KC82 1NJI1 1K9M2 3HOYI 1RO0A 4X6AI 1Q811 2JA6I 2V8IA 1YIT1 3I551 3GKQA 4A3EI 3G71Z 2HF1A 4A3KI 5IT9f 2DE6A 4E31A 2GTIA 1VQ4Z 3GTMS 3CC7Z 1YJWZ 4NB8A 3CCV1 1NJI2 4A3BI 3HOUI 1P9NA 1Q861 3MZLB 3GTKI 1VQL1 1RO4A 1K83I 3VMGA 1Q812 3I4NI 3CD61 2LIYA 3S17I 4MD8A 3S1RI 3I561 4Y52I 2JS4A 2V8KA 2QLVB 3H0GI 1Q821 3T4NB 3G4SZ 2V8JA 3U50C 2B63I 1VQ9Z 1S7MA 5T67A 1K8A1 1LQLA 4NBGA 2EGTA 2Y0SA 1Q862 4MRIA 2OTLZ 3CC71 1QVFZ 1YJ91 3S2DI 1L1OC 4DGLA 3TDHB 2P3YA 3CXCZ 5D1OA 3MZKB 2IZ3A 3CMEZ 1QVGZ 2HU9A 2QKDA 4E32A 3J81f 2QEX1 4QTTA 5FLXb 3G4S1 4NH1C 3LUSA 3VMIA 2JA7I 1RNIA 4DQYB 1N2FA 2JR6A 2OOYB 4NFRA 2OTL1 3S2HI 2E2HI 1VQO1 1YHQZ 1N8R1 3P5JB 1VQPZ 2O4HA 1TWCI 3NDIA 2JA5I 3RZDI 3S15I 1USPA 4NBEA 4Y7NI 3GTPI 1S721 1RO2A 3M4OI 3CME1 2W04A 2QRCB 2LFUA 1JJ2Y 1WCMI 1YIJ1 1X3WA 1VQNZ 1I3QI 4BBSI 1KD11 1K9M1 4BXXI 2F4MA 3JAMf 4RV9A 3IX0A 3ESWA 3J81b 2VUGA 2R7ZI 1N8R2 1ML8A 1WW9A 3CMA1 3VTNA 3CC2Z 4NBAA 2RHBA 2VUMI 4RS4A 3CCE1 3CCU1 1QVGY 1YHQ1 1RLYA 1X0TA 4NOZA 1VQP1 2M48A 3CQZI 4AYBA 3I07A 3GTQI 3VB9A 1KD12 2RBLA 2Q51A 4A93I 2RIQA 5D1OB 1TWGI 1VQN1 4MONA 1I50I 5C4XI 2E2II 3F3PC 4A3CI 2F4OA 1WIIA 4NBHA 3G6E1 4RVFA 3MONA 3CCRZ 4QTUA 3CC21 3JAMb 2YU9I 3M3YI 2K5RA 3D6WA 4S1TA 5FLMI 3PO3S 2P28A 3NH8A 2JUBA 4A3II 5IP7I 1YI2Z 4RVDA 3GTJI 1USPB 5CM2M 1R9TI 1JJ2Z 2KI7B 3G711 2QA4Z 2NVTI 3CC4Z 3GTGI 1M902 2K3RA 4EWCA 3FQMA 2NVQI 3J80f 3FQQA 1QF8A 3CCSZ 1VQ41 2PM9A 3CCR1 1VQKZ 1I6HI 1YJW1 1VQ5Z 5IT9b 4RVHA 1VLAA 1YJNZ 3CCMZ 1Y1WI 3S16I 2YADA 1KQSY 1Y1VI 1PFTA 2OOXB 4E30A 4HH4A 1YI21 1YUAA 3CCQZ 1ZH1A 1ZB9A 1VQ6Z 5A2Qf 4DK1A 2QA41 1VQ91 3CC41 3OW2Y 2GU2A 3CCS1 2R92I 3FKII 2H85A 1VQK1 1Q7Y1 3S1NI 2M6NA 3GTMI 3HKZA 1YJN1 3CCM1 4NBFA 2J6AA 3IF8A 1Z03A 4E2XA 2QR1B 3S1MI 4BY7I 2E9HA 2I3CA 3CCQ1 2G2KA 4A3LI 2QREB 5C44I 1VQ61 2JNYA 1Q7Y2 4HGZA 1VQ7Z 4XX2A 4E2YA 5LL6f 5A2Qb 1W2BZ 2W03A 4NBCA 3F3FC 1YITZ 1X3ZA 1YUKA 2JA8I 4A3DI 3GTLI 2IZ4A 3S14I 1KQSZ 1VQ8Z 1K731 1RQFA 2DE7A 4CL1A 2E2JI 3S1QI 1TWAI 2QRDB 3NFZA 1VQLZ 1VQ71 3CD6Z 3OW2Z 3I56Z 1M901 3KIHA 2PMZA 3EEDA 5T64A 2OZKA 1DL6A 2RT9A 1Z02A 1K732 2JMOA 4A3JI 2DE5A 3HOVI 3PO2I 4MD9A 1VQ81 1ZB8A 1JWHC 1YJ9Z 5AN9F 3NDJA 4NBDA 3RZOI 1TFIA 1W2BY 2VF1A 5FLXf 3CCLZ 2OTJZ 2NVYI 3J7A4 4NBBA 1QYPA 2QEXZ 1M1K1 3IFUA 2R93I 1KRLA 1TWHI 2Q4ZA 3NH5A 3BG1B 4BBRI 3D9XA 3QWUA 3HOXI 3CPWZ 1TWFI 1VQOZ 3GTOI 4NB9A 4TNUA 4MH4A 3Q87A 2AKLA 5C3EI 4A3MI 1S72Z 1Q822 3CCL1 1M1K2 2OTJ1 3K7AI 2O53A 1VQMZ 2KPIA 3EERA 1VQ51 4E33A 1YIJZ 4MXUA 5T6BA 1K8A2 5D1PA 3J80b 1Z01A 2WB1A 3PO3I 4RVGA 5C4JI 3CMAZ 2GTHA 1SFOI 5IP9I 3CCEZ 3CCUZ 3CCJZ 2BJOA 4MD7A 3TE5B 2R6MA 3I4MI 4E2ZA 3GCFA 3H3VJ 2RPRA 1VQM1 2ZAEB 1NP6A 4A3FI 1KC81 4BY1I 4A3GI 4E2WA 1NUIA 3I55Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2F A;  1I6H I;  2NVX I;  2JR6 A;  1DL6 A;  3S2H I;  4A3J I;  1VLA A;  2DE5 A;  3HOV I;  3HOW I;  2PK7 A;  1Y1W I;  2E2H I;  3S16 I;  3PO2 I;  1Y1V I;  2JA5 I;  1TWC I;  3HOZ I;  3S15 I;  3RZD I;  1PFT A;  1USP A;  4NBE A;  4Y7N I;  3GTP I;  1ZB8 A;  1Y1V S;  3VMH A;  3M4O I;  1YUA A;  1ZB9 A;  1WCM I;  4NBD A;  3RZO I;  1TFI A;  1X3W A;  3HOY I;  4X6A I;  1I3Q I;  4BBS I;  2NVY I;  4BXX I;  2F4M A;  4NBB A;  1QYP A;  2JA6 I;  3ESW A;  2R92 I;  3FKI I;  3GKQ A;  4A3E I;  2R7Z I;  1ML8 A;  2R93 I;  1WW9 A;  2HF1 A;  4A3K I;  3S1N I;  1TWH I;  2DE6 A;  3GTM I;  4NBA A;  2VUM I;  4NBF A;  3GTM S;  4BBR I;  1RLY A;  4NOZ A;  3CQZ I;  3HOX I;  2J6A A;  3I07 A;  4NB8 A;  3S1M I;  4A3B I;  3HOU I;  4BY7 I;  3GTQ I;  3VB9 A;  2RBL A;  1TWF I;  3GTK I;  3M3Y I;  1RO4 A;  1K83 I;  3VMG A;  3I4N I;  4A3L I;  4A93 I;  3GTO I;  4NB9 A;  5C44 I;  3S17 I;  4MH4 A;  3Q87 A;  3S1R I;  2AKL A;  5C3E I;  1TWG I;  4Y52 I;  4A3M I;  2JNY A;  2JS4 A;  1I50 I;  5C4X I;  3H0G I;  3K7A I;  2E2I I;  4A3C I;  4XX2 A;  2F4O A;  2KPI A;  3EER A;  4NBH A;  3U50 C;  2B63 I;  4NBC A;  1LQL A;  4QTU A;  2YU9 I;  4NBG A;  2K5R A;  3D6W A;  3PO3 I;  1X3Z A;  5FLM I;  2JA8 I;  4A3D I;  3PO3 S;  3GTL I;  1L1O C;  3S2D I;  5C4J I;  3S14 I;  4A3I I;  1SFO I;  2P3Y A;  5IP9 I;  5IP7 I;  2DE7 A;  3GTJ I;  1USP B;  2BJO A;  3I4M I;  2E2J I;  5CM2 M;  3S1Q I;  1TWA I;  1R9T I;  3GCF A;  3H3V J;  2NVT I;  3GTG I;  4QTT A;  4A3F I;  3LUS A;  4BY1 I;  3VMI A;  4A3G I;  2JA7 I;  2NVQ I;  1NUI A; 
#chains in the Genus database with same CATH topology
 2V45 A;  2NVX I;  3CPW Y;  1QVF Y;  3NH4 A;  3HOW I;  3KIF A;  2PK7 A;  3G6E Z;  3BG0 B;  3CXC Y;  3HOZ I;  3CCV Z;  1Y1V S;  3CCJ 1;  4HGY A;  3VMH A;  2WAQ A;  1Y8C A;  1KC8 2;  1NJI 1;  1K9M 2;  3HOY I;  1RO0 A;  4X6A I;  1Q81 1;  2JA6 I;  2V8I A;  1YIT 1;  2JIO A;  3I55 1;  3GKQ A;  4A3E I;  3G71 Z;  2HF1 A;  4A3K I;  5IT9 f;  2DE6 A;  4E31 A;  2GTI A;  1VQ4 Z;  3GTM S;  1Q16 A;  3CC7 Z;  1YJW Z;  4NB8 A;  3CCV 1;  1NJI 2;  4A3B I;  3HOU I;  1P9N A;  1Q86 1;  3MZL B;  3GTK I;  1VQL 1;  1RO4 A;  1K83 I;  3VMG A;  1Q81 2;  3I4N I;  3CD6 1;  2LIY A;  3S17 I;  1FDO A;  4MD8 A;  3I56 1;  3S1R I;  4Y52 I;  2JS4 A;  2V8K A;  2QLV B;  3H0G I;  1Q82 1;  3T4N B;  3G4S Z;  2V8J A;  3U50 C;  2B63 I;  1VQ9 Z;  1S7M A;  5T67 A;  1K8A 1;  1LQL A;  4NBG A;  2EGT A;  2Y0S A;  1Q86 2;  4MRI A;  2OTL Z;  3CC7 1;  1QVF Z;  1YJ9 1;  3S2D I;  1L1O C;  4DGL A;  3TDH B;  2P3Y A;  3CXC Z;  3D2L A;  5D1O A;  3MZK B;  2VPX A;  2IZ3 A;  3CME Z;  1QVG Z;  2HU9 A;  2QKD A;  4E32 A;  3J81 f;  2QEX 1;  4QTT A;  5FLX b;  3G4S 1;  4NH1 C;  3LUS A;  3VMI A;  2JA7 I;  1RNI A;  4DQY B;  2IV2 X;  1N2F A;  2VPY A;  2VPZ A;  2JR6 A;  2OOY B;  4NFR A;  2OTL 1;  3S2H I;  1AA6 A;  2E2H I;  1VQO 1;  1YHQ Z;  1N8R 1;  3P5J B;  1VQP Z;  2O4H A;  1TWC I;  3NDI A;  2JA5 I;  3RZD I;  3S15 I;  1USP A;  4NBE A;  4Y7N I;  3GTP I;  1S72 1;  1RO2 A;  3M4O I;  3CME 1;  2W04 A;  2QRC B;  2LFU A;  1JJ2 Y;  1WCM I;  2E7Z A;  1YIJ 1;  1X3W A;  1VQN Z;  1I3Q I;  4BBS I;  1KD1 1;  1K9M 1;  4BXX I;  2F4M A;  3JAM f;  4RV9 A;  3IX0 A;  3ESW A;  3J81 b;  2VUG A;  2R7Z I;  1N8R 2;  1ML8 A;  1WW9 A;  3CMA 1;  3VTN A;  3CC2 Z;  4NBA A;  2RHB A;  2VUM I;  4RS4 A;  3CCE 1;  3IR7 A;  3CCU 1;  1QVG Y;  1YHQ 1;  1RLY A;  1X0T A;  4NOZ A;  1VQP 1;  2M48 A;  3CQZ I;  4AYB A;  3I07 A;  3GTQ I;  3VB9 A;  1KD1 2;  2RBL A;  2Q51 A;  4A93 I;  2RIQ A;  5D1O B;  1WJ2 A;  1TWG I;  2JIP A;  1VQN 1;  4MON A;  1I50 I;  5C4X I;  2E2I I;  3F3P C;  4A3C I;  2JIQ A;  2F4O A;  1WII A;  2V3V A;  4NBH A;  2JIM A;  3G6E 1;  4RVF A;  3MON A;  3CCR Z;  4QTU A;  3CC2 1;  3JAM b;  2YU9 I;  3M3Y I;  2K5R A;  3D6W A;  4S1T A;  5FLM I;  3PO3 S;  2P28 A;  3NH8 A;  2JUB A;  2LEX A;  4A3I I;  5IP7 I;  1YI2 Z;  4RVD A;  3GTJ I;  1USP B;  5CM2 M;  1R9T I;  1JJ2 Z;  2KI7 B;  3G71 1;  2QA4 Z;  2NVT I;  3CC4 Z;  3GTG I;  1M90 2;  2K3R A;  4EWC A;  3FQM A;  2NVQ I;  3J80 f;  3FQQ A;  1QF8 A;  3CCS Z;  1VQ4 1;  2PM9 A;  3CCR 1;  1VQK Z;  1I6H I;  1YJW 1;  1VQ5 Z;  5IT9 b;  4RVH A;  1VLA A;  1YJN Z;  3CCM Z;  1Y1W I;  3S16 I;  2YAD A;  1KQS Y;  1Y1V I;  1PFT A;  2OOX B;  4E30 A;  4HH4 A;  1YI2 1;  1YUA A;  3CCQ Z;  1ZH1 A;  1ZB9 A;  1VQ6 Z;  5A2Q f;  4DK1 A;  2QA4 1;  1VQ9 1;  3CC4 1;  3OW2 Y;  2GU2 A;  3CCS 1;  2R92 I;  3FKI I;  2H85 A;  1VQK 1;  1Q7Y 1;  3S1N I;  2M6N A;  3GTM I;  3HKZ A;  2AYD A;  1YJN 1;  3CCM 1;  4NBF A;  2J6A A;  3IF8 A;  1Z03 A;  4E2X A;  2QR1 B;  3S1M I;  4BY7 I;  2E9H A;  2I3C A;  3CCQ 1;  2G2K A;  4A3L I;  2QRE B;  5C44 I;  1VQ6 1;  2NAP A;  2JNY A;  1Q7Y 2;  4HGZ A;  1VQ7 Z;  4XX2 A;  4E2Y A;  1SIW A;  5LL6 f;  5A2Q b;  1W2B Z;  2W03 A;  4NBC A;  3F3F C;  1YIT Z;  1X3Z A;  1YUK A;  2JA8 I;  4A3D I;  3GTL I;  2IZ4 A;  3S14 I;  1KQS Z;  1VQ8 Z;  1K73 1;  1RQF A;  2DE7 A;  4CL1 A;  1FDI A;  2E2J I;  3S1Q I;  1TWA I;  2QRD B;  3NFZ A;  1VQL Z;  1WZN A;  1VQ7 1;  3CD6 Z;  3OW2 Z;  3I56 Z;  1M90 1;  3KIH A;  2PMZ A;  3EED A;  5T64 A;  2OZK A;  1DL6 A;  2RT9 A;  1Z02 A;  1K73 2;  2JMO A;  4A3J I;  2DE5 A;  3HOV I;  3PO2 I;  4MD9 A;  1VQ8 1;  1ZB8 A;  1JWH C;  1YJ9 Z;  5AN9 F;  3NDJ A;  4NBD A;  3RZO I;  1TFI A;  1W2B Y;  2VF1 A;  5FLX f;  3CCL Z;  2OTJ Z;  2JIR A;  2NVY I;  3J7A 4;  4NBB A;  1QYP A;  2QEX Z;  1M1K 1;  3IFU A;  2R93 I;  1KRL A;  1TWH I;  2Q4Z A;  3NH5 A;  3BG1 B;  4BBR I;  3D9X A;  3QWU A;  1QXF A;  3HOX I;  3CPW Z;  1TWF I;  1VQO Z;  3GTO I;  4NB9 A;  4TNU A;  4MH4 A;  3Q87 A;  2AKL A;  5C3E I;  4A3M I;  1S72 Z;  1Q82 2;  3CCL 1;  1M1K 2;  2OTJ 1;  3K7A I;  2O53 A;  1VQM Z;  2KPI A;  3EER A;  1VQ5 1;  4E33 A;  1YIJ Z;  4MXU A;  5T6B A;  1K8A 2;  5D1P A;  3J80 b;  1Z01 A;  2WB1 A;  3PO3 I;  4RVG A;  5C4J I;  3CMA Z;  2GTH A;  1SFO I;  5IP9 I;  3CCE Z;  3CCU Z;  3CCJ Z;  2BJO A;  4MD7 A;  3TE5 B;  2R6M A;  3I4M I;  2VPW A;  4E2Z A;  3GCF A;  3H3V J;  2RPR A;  1VQM 1;  2ZAE B;  1NP6 A;  4A3F I;  1KC8 1;  4BY1 I;  4A3G I;  4E2W A;  1NUI A;  3I55 Z; 
#chains in the Genus database with same CATH homology
 2NVX I;  3CPW Y;  1QVF Y;  3NH4 A;  3HOW I;  3KIF A;  2PK7 A;  3G6E Z;  3BG0 B;  3CXC Y;  3HOZ I;  3CCV Z;  1Y1V S;  3CCJ 1;  4HGY A;  3VMH A;  2WAQ A;  1KC8 2;  1NJI 1;  1K9M 2;  3HOY I;  1RO0 A;  4X6A I;  1Q81 1;  2JA6 I;  2V8I A;  1YIT 1;  3I55 1;  3GKQ A;  4A3E I;  3G71 Z;  2HF1 A;  4A3K I;  5IT9 f;  2DE6 A;  4E31 A;  2GTI A;  1VQ4 Z;  3GTM S;  3CC7 Z;  1YJW Z;  4NB8 A;  3CCV 1;  1NJI 2;  4A3B I;  3HOU I;  1P9N A;  1Q86 1;  3MZL B;  3GTK I;  1VQL 1;  1RO4 A;  1K83 I;  3VMG A;  1Q81 2;  3I4N I;  3CD6 1;  2LIY A;  3S17 I;  4MD8 A;  3S1R I;  3I56 1;  4Y52 I;  2JS4 A;  2V8K A;  2QLV B;  3H0G I;  1Q82 1;  3T4N B;  3G4S Z;  2V8J A;  3U50 C;  2B63 I;  1VQ9 Z;  1S7M A;  5T67 A;  1K8A 1;  1LQL A;  4NBG A;  2EGT A;  2Y0S A;  1Q86 2;  4MRI A;  2OTL Z;  3CC7 1;  1QVF Z;  1YJ9 1;  3S2D I;  1L1O C;  4DGL A;  3TDH B;  2P3Y A;  3CXC Z;  5D1O A;  3MZK B;  2IZ3 A;  3CME Z;  1QVG Z;  2HU9 A;  2QKD A;  4E32 A;  3J81 f;  2QEX 1;  4QTT A;  5FLX b;  3G4S 1;  4NH1 C;  3LUS A;  3VMI A;  2JA7 I;  1RNI A;  4DQY B;  1N2F A;  2JR6 A;  2OOY B;  4NFR A;  2OTL 1;  3S2H I;  2E2H I;  1VQO 1;  1YHQ Z;  1N8R 1;  3P5J B;  1VQP Z;  2O4H A;  1TWC I;  3NDI A;  2JA5 I;  3RZD I;  3S15 I;  1USP A;  4NBE A;  4Y7N I;  3GTP I;  1S72 1;  1RO2 A;  3M4O I;  3CME 1;  2W04 A;  2QRC B;  2LFU A;  1JJ2 Y;  1WCM I;  1YIJ 1;  1X3W A;  1VQN Z;  1I3Q I;  4BBS I;  1KD1 1;  1K9M 1;  4BXX I;  2F4M A;  3JAM f;  4RV9 A;  3IX0 A;  3ESW A;  3J81 b;  2VUG A;  2R7Z I;  1N8R 2;  1ML8 A;  1WW9 A;  3CMA 1;  3VTN A;  3CC2 Z;  4NBA A;  2RHB A;  2VUM I;  4RS4 A;  3CCE 1;  3CCU 1;  1QVG Y;  1YHQ 1;  1RLY A;  1X0T A;  4NOZ A;  1VQP 1;  2M48 A;  3CQZ I;  4AYB A;  3I07 A;  3GTQ I;  3VB9 A;  1KD1 2;  2RBL A;  2Q51 A;  4A93 I;  2RIQ A;  5D1O B;  1TWG I;  1VQN 1;  4MON A;  1I50 I;  5C4X I;  2E2I I;  3F3P C;  4A3C I;  2F4O A;  1WII A;  4NBH A;  3G6E 1;  4RVF A;  3MON A;  3CCR Z;  4QTU A;  3CC2 1;  3JAM b;  2YU9 I;  3M3Y I;  2K5R A;  3D6W A;  4S1T A;  5FLM I;  3PO3 S;  2P28 A;  3NH8 A;  2JUB A;  4A3I I;  5IP7 I;  1YI2 Z;  4RVD A;  3GTJ I;  1USP B;  5CM2 M;  1R9T I;  1JJ2 Z;  2KI7 B;  3G71 1;  2QA4 Z;  2NVT I;  3CC4 Z;  3GTG I;  1M90 2;  2K3R A;  4EWC A;  3FQM A;  2NVQ I;  3J80 f;  3FQQ A;  1QF8 A;  3CCS Z;  1VQ4 1;  2PM9 A;  3CCR 1;  1VQK Z;  1I6H I;  1YJW 1;  1VQ5 Z;  5IT9 b;  4RVH A;  1VLA A;  1YJN Z;  3CCM Z;  1Y1W I;  3S16 I;  2YAD A;  1KQS Y;  1Y1V I;  1PFT A;  2OOX B;  4E30 A;  4HH4 A;  1YI2 1;  1YUA A;  3CCQ Z;  1ZH1 A;  1ZB9 A;  1VQ6 Z;  5A2Q f;  4DK1 A;  2QA4 1;  1VQ9 1;  3CC4 1;  3OW2 Y;  2GU2 A;  3CCS 1;  2R92 I;  3FKI I;  2H85 A;  1VQK 1;  1Q7Y 1;  3S1N I;  2M6N A;  3GTM I;  3HKZ A;  1YJN 1;  3CCM 1;  4NBF A;  2J6A A;  3IF8 A;  1Z03 A;  4E2X A;  2QR1 B;  3S1M I;  4BY7 I;  2E9H A;  2I3C A;  3CCQ 1;  2G2K A;  4A3L I;  2QRE B;  5C44 I;  1VQ6 1;  2JNY A;  1Q7Y 2;  4HGZ A;  1VQ7 Z;  4XX2 A;  4E2Y A;  5LL6 f;  5A2Q b;  1W2B Z;  2W03 A;  4NBC A;  3F3F C;  1YIT Z;  1X3Z A;  1YUK A;  2JA8 I;  4A3D I;  3GTL I;  2IZ4 A;  3S14 I;  1KQS Z;  1VQ8 Z;  1K73 1;  1RQF A;  2DE7 A;  4CL1 A;  2E2J I;  3S1Q I;  1TWA I;  2QRD B;  3NFZ A;  1VQL Z;  1VQ7 1;  3CD6 Z;  3OW2 Z;  3I56 Z;  1M90 1;  3KIH A;  2PMZ A;  3EED A;  5T64 A;  2OZK A;  1DL6 A;  2RT9 A;  1Z02 A;  1K73 2;  2JMO A;  4A3J I;  2DE5 A;  3HOV I;  3PO2 I;  4MD9 A;  1VQ8 1;  1ZB8 A;  1JWH C;  1YJ9 Z;  5AN9 F;  3NDJ A;  4NBD A;  3RZO I;  1TFI A;  1W2B Y;  2VF1 A;  5FLX f;  3CCL Z;  2OTJ Z;  2NVY I;  3J7A 4;  4NBB A;  1QYP A;  2QEX Z;  1M1K 1;  3IFU A;  2R93 I;  1KRL A;  1TWH I;  2Q4Z A;  3NH5 A;  3BG1 B;  4BBR I;  3D9X A;  3QWU A;  3HOX I;  3CPW Z;  1TWF I;  1VQO Z;  3GTO I;  4NB9 A;  4TNU A;  4MH4 A;  3Q87 A;  2AKL A;  5C3E I;  4A3M I;  1S72 Z;  1Q82 2;  3CCL 1;  1M1K 2;  2OTJ 1;  3K7A I;  2O53 A;  1VQM Z;  2KPI A;  3EER A;  1VQ5 1;  4E33 A;  1YIJ Z;  4MXU A;  5T6B A;  1K8A 2;  5D1P A;  3J80 b;  1Z01 A;  2WB1 A;  3PO3 I;  4RVG A;  5C4J I;  3CMA Z;  2GTH A;  1SFO I;  5IP9 I;  3CCE Z;  3CCU Z;  3CCJ Z;  2BJO A;  4MD7 A;  3TE5 B;  2R6M A;  3I4M I;  4E2Z A;  3GCF A;  3H3V J;  2RPR A;  1VQM 1;  2ZAE B;  1NP6 A;  4A3F I;  1KC8 1;  4BY1 I;  4A3G I;  4E2W A;  1NUI A;  3I55 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...