3J81f

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
69
structure length
69
Chain Sequence
KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHSTFATQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 2
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF00240 ubiquitin Ubiquitin family
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3j81f00
3J80f 3JAMf 3J81f 5IT9f 5FLXf 5A2Qf
chains in the Genus database with same CATH superfamily
3GTPI 2Y0SA 1X3ZA 1VLAA 2V8KA 3RZOI 2H85A 3NH8A 3CXCZ 4RVGA 1Y1VS 2RIQA 4MH4A 2JIPA 1I6HI 3G711 5C4XI 2OZKA 4NBGA 2O53A 1YHQ1 1W2BY 1RLYA 4NBEA 4E2WA 1VQ8Z 3IX0A 3CQZI 3CCJ1 2V45A 2QEX1 1RNIA 4MRIA 1VQ61 3KIHA 4NH1C 3TE5B 3CCE1 4A3JI 2QRCB 5T67A 2P3YA 1Z01A 4QTTA 3LUSA 1KC81 3CCJZ 1VQM1 3CME1 2JMOA 5FLXf 3I56Z 2BJOA 1TWFI 1JJ2Y 2HU9A 3G6E1 2Q4ZA 3CCSZ 1VQNZ 1X0TA 2WB1A 2QKDA 5FLXb 1RO2A 1Q16A 2E9HA 2DE7A 4MD7A 2IV2X 2KI7B 2RBLA 3I55Z 2E7ZA 3M4OI 3D6WA 4AYBA 2JA7I 2QEXZ 2ZAEB 3CCU1 1VQO1 1VQ41 4MONA 1VQ71 2QRDB 1YIT1 1WJ2A 3S14I 4BY1I 1ZB9A 2QLVB 4HH4A 5LL6f 3NFZA 2R7ZI 1TWGI 2WAQA 3GTGI 1YITZ 2QA4Z 2RPRA 1N8R2 1ZB8A 3VMHA 1NP6A 2W03A 5T64A 2B63I 2JA6I 2OOXB 4HGYA 1Q822 2R93I 3D2LA 1QXFA 3G4S1 2JIMA 1S721 1VQ51 2E2II 3CC7Z 1K83I 4MD8A 2VPXA 4MXUA 3S16I 2VUGA 3S17I 1YJN1 4E32A 4Y7NI 2E2HI 1N8R1 1Q7Y1 3CCQ1 1ML8A 4QTUA 1Q862 1QVGZ 1YI21 4DGLA 4RV9A 4A3II 1Q811 1YJNZ 3EEDA 2KPIA 3S15I 1VQMZ 2NVXI 3GTJI 3GTMI 2R6MA 2F4MA 2JA8I 4NBCA 3NH5A 3H0GI 1KRLA 1NUIA 3OW2Y 2DE6A 1NJI2 4E2ZA 1WIIA 2JNYA 5A2Qb 1TFIA 1FDIA 2GU2A 1K9M1 3TDHB 3VTNA 1P9NA 3CCR1 3CC4Z 1Y1VI 1S72Z 2K5RA 4EWCA 1Z02A 3F3FC 4A93I 1VQ4Z 3GCFA 3CCUZ 3S1QI 4S1TA 2NVTI 2JS4A 3VMGA 3KIFA 3IF8A 2IZ3A 4BBRI 4NFRA 4NOZA 4NB9A 3H3VJ 3MZKB 5D1OA 1I3QI 2GTIA 3CXCY 1K732 3VMIA 4A3EI 1YJ91 2PK7A 3CD6Z 3HOUI 3BG1B 2JUBA 3JAMb 1VQ7Z 5IP9I 1Y8CA 2M48A 1YUAA 2OTJZ 5IT9f 3GKQA 3PO3S 3CCM1 2VPWA 2R92I 3FKII 4RVDA 4E2YA 2NAPA 3J80f 4MD9A 1M1K2 3MZLB 1RO0A 3CCV1 1YIJ1 3K7AI 5C44I 3GTQI 1R9TI 4NBBA 1SFOI 3S2HI 2V8JA 1S7MA 3CC71 1W2BZ 1L1OC 2QR1B 2OTL1 1ZH1A 1NJI1 2QREB 4RVHA 1K731 3GTMS 2AKLA 1VQ81 1K9M2 3CD61 2OOYB 3IR7A 5C4JI 1N2FA 4X6AI 3F3PC 2GTHA 1FDOA 1QVFZ 4A3LI 1Q861 3VB9A 3BG0B 1USPA 3NDIA 1TWHI 3QWUA 4A3FI 3J81f 3J81b 5D1PA 5AN9F 2NVYI 4NBDA 3HOWI 1PFTA 3M3YI 4E31A 4E33A 2M6NA 1X3WA 1YJW1 4DK1A 3CCRZ 3CC41 2JIOA 3EERA 3I4MI 5D1OB 4NBHA 1VQN1 3CMAZ 1KC82 3NDJA 1QVGY 1M902 1VQL1 3GTLI 2NVQI 2W04A 3ESWA 1K8A2 1Z03A 1KQSZ 2VPYA 1VQOZ 5IP7I 3S1MI 3CCEZ 4E30A 1M1K1 4DQYB 1M901 4RS4A 2OTJ1 1TWAI 1VQLZ 1QF8A 3CCQZ 1WW9A 3CMA1 2YADA 1YI2Z 2DE5A 1YIJZ 4A3CI 2RHBA 3HOVI 3IFUA 4A3GI 2LEXA 1AA6A 1YJWZ 2Q51A 2VF1A 3HKZA 1LQLA 3S1RI 5FLMI 3MONA 3J80b 1QYPA 1Y1WI 1WCMI 4CL1A 4E2XA 2VUMI 1KQSY 1VQ5Z 4TNUA 5IT9b 2LIYA 4NBAA 2RT9A 3GTKI 4NB8A 3JAMf 3FQQA 2E2JI 3I4NI 4XX2A 1YHQZ 3T4NB 3PO3I 3CCS1 4BXXI 2LFUA 2JR6A 1VQ91 4A3DI 2G2KA 3FQMA 1USPB 1K8A1 1KD12 2YU9I 1YUKA 2OTLZ 2EGTA 3U50C 3GTOI 2PM9A 3I551 3CCL1 1RQFA 3D9XA 3CC2Z 4Y52I 1SIWA 2V3VA 2K3RA 3NH4A 3I07A 2PMZA 1WZNA 2O4HA 1TWCI 3CMEZ 3P5JB 3Q87A 3I561 3G6EZ 4HGZA 4A3KI 3CPWY 5A2Qf 1Q7Y2 1KD11 3HOXI 2I3CA 2JIQA 4A3BI 1JWHC 1VQP1 4A3MI 1VQPZ 3J7A4 3CPWZ 3G4SZ 5CM2M 2JA5I 2AYDA 3RZDI 1VQ6Z 1YJ9Z 3PO2I 3S2DI 1I50I 1RO4A 1VQ9Z 4RVFA 1JJ2Z 3HOYI 2P28A 2F4OA 2QA41 2HF1A 3CCVZ 4NBFA 3CC21 2J6AA 2IZ4A 1Q812 2VPZA 1QVFY 3G71Z 1Q821 2V8IA 4BY7I 3CCLZ 3OW2Z 5T6BA 5C3EI 3HOZI 1DL6A 3CCMZ 4BBSI 1VQKZ 1VQK1 3S1NI 2JIRA
chains in the Genus database with same CATH topology
3GTPI 2Y0SA 1X3ZA 1VLAA 2V8KA 3RZOI 2H85A 3NH8A 3CXCZ 4RVGA 1Y1VS 2RIQA 4MH4A 1I6HI 3G711 5C4XI 2OZKA 4NBGA 2O53A 1YHQ1 1W2BY 1RLYA 4NBEA 4E2WA 1VQ8Z 3IX0A 3CQZI 3CCJ1 2QEX1 1RNIA 4MRIA 1VQ61 3KIHA 4NH1C 3TE5B 3CCE1 4A3JI 2QRCB 5T67A 2P3YA 1Z01A 4QTTA 3LUSA 1KC81 3CCJZ 1VQM1 3CME1 2JMOA 5FLXf 3I56Z 2BJOA 1TWFI 1JJ2Y 2HU9A 3G6E1 2Q4ZA 3CCSZ 1VQNZ 1X0TA 2WB1A 2QKDA 5FLXb 1RO2A 2E9HA 2DE7A 4MD7A 2KI7B 2RBLA 3I55Z 3M4OI 3D6WA 4AYBA 2JA7I 2QEXZ 2ZAEB 3CCU1 1VQO1 1VQ41 4MONA 1VQ71 2QRDB 1YIT1 3S14I 4BY1I 1ZB9A 2QLVB 4HH4A 5LL6f 3NFZA 2R7ZI 1TWGI 2WAQA 3GTGI 1YITZ 2QA4Z 2RPRA 1N8R2 1ZB8A 3VMHA 1NP6A 2W03A 5T64A 2B63I 2JA6I 2OOXB 4HGYA 1Q822 2R93I 3G4S1 1S721 1VQ51 2E2II 3CC7Z 1K83I 4MD8A 4MXUA 3S16I 2VUGA 3S17I 1YJN1 4E32A 4Y7NI 2E2HI 1N8R1 1Q7Y1 3CCQ1 1ML8A 4QTUA 1Q862 1QVGZ 1YI21 4DGLA 4RV9A 4A3II 1Q811 1YJNZ 3EEDA 2KPIA 3S15I 1VQMZ 2NVXI 3GTJI 3GTMI 2R6MA 2F4MA 2JA8I 4NBCA 3NH5A 3H0GI 1KRLA 1NUIA 3OW2Y 2DE6A 1NJI2 4E2ZA 1WIIA 2JNYA 5A2Qb 1TFIA 2GU2A 1K9M1 3TDHB 3VTNA 1P9NA 3CCR1 3CC4Z 1Y1VI 1S72Z 2K5RA 4EWCA 1Z02A 3F3FC 4A93I 1VQ4Z 3GCFA 3CCUZ 3S1QI 4S1TA 2NVTI 2JS4A 3VMGA 3KIFA 3IF8A 2IZ3A 4BBRI 4NFRA 4NOZA 4NB9A 3H3VJ 3MZKB 5D1OA 1I3QI 2GTIA 3CXCY 1K732 3VMIA 4A3EI 1YJ91 2PK7A 3CD6Z 3HOUI 3BG1B 2JUBA 3JAMb 1VQ7Z 5IP9I 2M48A 1YUAA 2OTJZ 5IT9f 3GKQA 3PO3S 3CCM1 2R92I 3FKII 4RVDA 4E2YA 3J80f 1M1K2 4MD9A 3MZLB 1RO0A 3CCV1 1YIJ1 3K7AI 5C44I 3GTQI 1R9TI 4NBBA 1SFOI 3S2HI 2V8JA 1S7MA 3CC71 1W2BZ 1L1OC 2QR1B 2OTL1 1ZH1A 1NJI1 2QREB 4RVHA 1K731 3GTMS 2AKLA 1VQ81 1K9M2 3CD61 2OOYB 5C4JI 1N2FA 4X6AI 3F3PC 2GTHA 1QVFZ 4A3LI 1Q861 3VB9A 3BG0B 1USPA 3NDIA 1TWHI 3QWUA 4A3FI 3J81f 3J81b 5D1PA 5AN9F 2NVYI 4NBDA 3HOWI 1PFTA 3M3YI 4E31A 4E33A 2M6NA 1X3WA 1YJW1 4DK1A 3CCRZ 3CC41 3EERA 3I4MI 5D1OB 4NBHA 1VQN1 3CMAZ 1KC82 3NDJA 1QVGY 1M902 1VQL1 3GTLI 2NVQI 2W04A 3ESWA 1K8A2 1Z03A 1KQSZ 1VQOZ 5IP7I 3S1MI 3CCEZ 4E30A 1M1K1 4DQYB 1M901 4RS4A 2OTJ1 1TWAI 1VQLZ 1QF8A 3CCQZ 1WW9A 3CMA1 2YADA 1YI2Z 2DE5A 1YIJZ 4A3CI 2RHBA 3HOVI 3IFUA 4A3GI 1YJWZ 2Q51A 2VF1A 3HKZA 1LQLA 3S1RI 5FLMI 3MONA 3J80b 1QYPA 1Y1WI 1WCMI 4CL1A 4E2XA 2VUMI 1KQSY 1VQ5Z 4TNUA 5IT9b 2LIYA 4NBAA 2RT9A 3GTKI 4NB8A 3JAMf 3FQQA 2E2JI 3I4NI 4XX2A 1YHQZ 3T4NB 3PO3I 3CCS1 4BXXI 2LFUA 2JR6A 1VQ91 4A3DI 2G2KA 3FQMA 1USPB 1K8A1 1KD12 2YU9I 1YUKA 2OTLZ 2EGTA 3U50C 3GTOI 2PM9A 3I551 3CCL1 1RQFA 3D9XA 3CC2Z 4Y52I 2K3RA 3NH4A 3I07A 2PMZA 2O4HA 1TWCI 3CMEZ 3P5JB 3Q87A 3I561 3G6EZ 4HGZA 4A3KI 3CPWY 5A2Qf 1Q7Y2 1KD11 3HOXI 2I3CA 4A3BI 1JWHC 1VQP1 4A3MI 1VQPZ 3J7A4 3CPWZ 3G4SZ 5CM2M 2JA5I 3RZDI 1VQ6Z 1YJ9Z 3PO2I 3S2DI 1I50I 1RO4A 1VQ9Z 4RVFA 1JJ2Z 3HOYI 2P28A 2F4OA 2QA41 2HF1A 3CCVZ 4NBFA 3CC21 2J6AA 2IZ4A 1Q812 1QVFY 3G71Z 1Q821 2V8IA 4BY7I 3CCLZ 3OW2Z 5T6BA 5C3EI 3HOZI 1DL6A 3CCMZ 4BBSI 1VQKZ 1VQK1 3S1NI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 f;  3JAM f;  3J81 f;  5IT9 f;  5FLX f;  5A2Q f; 
#chains in the Genus database with same CATH topology
 3GTP I;  2Y0S A;  1X3Z A;  1VLA A;  2V8K A;  3RZO I;  2H85 A;  3NH8 A;  3CXC Z;  4RVG A;  1Y1V S;  2RIQ A;  4MH4 A;  2JIP A;  1I6H I;  3G71 1;  5C4X I;  2OZK A;  4NBG A;  2O53 A;  1YHQ 1;  1W2B Y;  1RLY A;  4NBE A;  4E2W A;  1VQ8 Z;  3IX0 A;  3CQZ I;  3CCJ 1;  2V45 A;  2QEX 1;  1RNI A;  4MRI A;  1VQ6 1;  3KIH A;  4NH1 C;  3TE5 B;  3CCE 1;  4A3J I;  2QRC B;  5T67 A;  2P3Y A;  1Z01 A;  4QTT A;  3LUS A;  1KC8 1;  3CCJ Z;  1VQM 1;  3CME 1;  2JMO A;  5FLX f;  3I56 Z;  2BJO A;  1TWF I;  1JJ2 Y;  2HU9 A;  3G6E 1;  2Q4Z A;  3CCS Z;  1VQN Z;  1X0T A;  2WB1 A;  2QKD A;  5FLX b;  1RO2 A;  1Q16 A;  2E9H A;  2DE7 A;  4MD7 A;  2IV2 X;  2KI7 B;  2RBL A;  3I55 Z;  2E7Z A;  3M4O I;  3D6W A;  4AYB A;  2JA7 I;  2QEX Z;  2ZAE B;  3CCU 1;  1VQO 1;  1VQ4 1;  4MON A;  1VQ7 1;  2QRD B;  1YIT 1;  1WJ2 A;  3S14 I;  4BY1 I;  1ZB9 A;  2QLV B;  4HH4 A;  5LL6 f;  3NFZ A;  2R7Z I;  1TWG I;  2WAQ A;  3GTG I;  1YIT Z;  2QA4 Z;  2RPR A;  1N8R 2;  1ZB8 A;  3VMH A;  1NP6 A;  2W03 A;  5T64 A;  2B63 I;  2JA6 I;  2OOX B;  4HGY A;  1Q82 2;  2R93 I;  3D2L A;  1QXF A;  3G4S 1;  2JIM A;  1S72 1;  1VQ5 1;  2E2I I;  3CC7 Z;  1K83 I;  4MD8 A;  2VPX A;  4MXU A;  3S16 I;  2VUG A;  3S17 I;  1YJN 1;  4E32 A;  4Y7N I;  2E2H I;  1N8R 1;  1Q7Y 1;  3CCQ 1;  1ML8 A;  4QTU A;  1Q86 2;  1QVG Z;  1YI2 1;  4DGL A;  4RV9 A;  4A3I I;  1Q81 1;  1YJN Z;  3EED A;  2KPI A;  3S15 I;  1VQM Z;  2NVX I;  3GTJ I;  3GTM I;  2R6M A;  2F4M A;  2JA8 I;  4NBC A;  3NH5 A;  3H0G I;  1KRL A;  1NUI A;  3OW2 Y;  2DE6 A;  1NJI 2;  4E2Z A;  1WII A;  2JNY A;  5A2Q b;  1TFI A;  1FDI A;  2GU2 A;  1K9M 1;  3TDH B;  3VTN A;  1P9N A;  3CCR 1;  3CC4 Z;  1Y1V I;  1S72 Z;  2K5R A;  4EWC A;  1Z02 A;  3F3F C;  4A93 I;  1VQ4 Z;  3GCF A;  3CCU Z;  3S1Q I;  4S1T A;  2NVT I;  2JS4 A;  3VMG A;  3KIF A;  3IF8 A;  2IZ3 A;  4BBR I;  4NFR A;  4NOZ A;  4NB9 A;  3H3V J;  3MZK B;  5D1O A;  1I3Q I;  2GTI A;  3CXC Y;  1K73 2;  3VMI A;  4A3E I;  1YJ9 1;  2PK7 A;  3CD6 Z;  3HOU I;  3BG1 B;  2JUB A;  3JAM b;  1VQ7 Z;  5IP9 I;  1Y8C A;  2M48 A;  1YUA A;  2OTJ Z;  5IT9 f;  3GKQ A;  3PO3 S;  3CCM 1;  2VPW A;  2R92 I;  3FKI I;  4RVD A;  4E2Y A;  2NAP A;  3J80 f;  4MD9 A;  1M1K 2;  3MZL B;  1RO0 A;  3CCV 1;  1YIJ 1;  3K7A I;  5C44 I;  3GTQ I;  1R9T I;  4NBB A;  1SFO I;  3S2H I;  2V8J A;  1S7M A;  3CC7 1;  1W2B Z;  1L1O C;  2QR1 B;  2OTL 1;  1ZH1 A;  1NJI 1;  2QRE B;  4RVH A;  1K73 1;  3GTM S;  2AKL A;  1VQ8 1;  1K9M 2;  3CD6 1;  2OOY B;  3IR7 A;  5C4J I;  1N2F A;  4X6A I;  3F3P C;  2GTH A;  1FDO A;  1QVF Z;  4A3L I;  1Q86 1;  3VB9 A;  3BG0 B;  1USP A;  3NDI A;  1TWH I;  3QWU A;  4A3F I;  3J81 f;  3J81 b;  5D1P A;  5AN9 F;  2NVY I;  4NBD A;  3HOW I;  1PFT A;  3M3Y I;  4E31 A;  4E33 A;  2M6N A;  1X3W A;  1YJW 1;  4DK1 A;  3CCR Z;  3CC4 1;  2JIO A;  3EER A;  3I4M I;  5D1O B;  4NBH A;  1VQN 1;  3CMA Z;  1KC8 2;  3NDJ A;  1QVG Y;  1M90 2;  1VQL 1;  3GTL I;  2NVQ I;  2W04 A;  3ESW A;  1K8A 2;  1Z03 A;  1KQS Z;  2VPY A;  1VQO Z;  5IP7 I;  3S1M I;  3CCE Z;  4E30 A;  1M1K 1;  4DQY B;  1M90 1;  4RS4 A;  2OTJ 1;  1TWA I;  1VQL Z;  1QF8 A;  3CCQ Z;  1WW9 A;  3CMA 1;  2YAD A;  1YI2 Z;  2DE5 A;  1YIJ Z;  4A3C I;  2RHB A;  3HOV I;  3IFU A;  4A3G I;  2LEX A;  1AA6 A;  1YJW Z;  2Q51 A;  2VF1 A;  3HKZ A;  1LQL A;  3S1R I;  5FLM I;  3MON A;  3J80 b;  1QYP A;  1Y1W I;  1WCM I;  4CL1 A;  4E2X A;  2VUM I;  1KQS Y;  1VQ5 Z;  4TNU A;  5IT9 b;  2LIY A;  4NBA A;  2RT9 A;  3GTK I;  4NB8 A;  3JAM f;  3FQQ A;  2E2J I;  3I4N I;  4XX2 A;  1YHQ Z;  3T4N B;  3PO3 I;  3CCS 1;  4BXX I;  2LFU A;  2JR6 A;  1VQ9 1;  4A3D I;  2G2K A;  3FQM A;  1USP B;  1K8A 1;  1KD1 2;  2YU9 I;  1YUK A;  2OTL Z;  2EGT A;  3U50 C;  3GTO I;  2PM9 A;  3I55 1;  3CCL 1;  1RQF A;  3D9X A;  3CC2 Z;  4Y52 I;  1SIW A;  2V3V A;  2K3R A;  3NH4 A;  3I07 A;  2PMZ A;  1WZN A;  2O4H A;  1TWC I;  3CME Z;  3P5J B;  3Q87 A;  3I56 1;  3G6E Z;  4HGZ A;  4A3K I;  3CPW Y;  5A2Q f;  1Q7Y 2;  1KD1 1;  3HOX I;  2I3C A;  2JIQ A;  4A3B I;  1JWH C;  1VQP 1;  4A3M I;  1VQP Z;  3J7A 4;  3CPW Z;  3G4S Z;  5CM2 M;  2JA5 I;  2AYD A;  3RZD I;  1VQ6 Z;  1YJ9 Z;  3PO2 I;  3S2D I;  1I50 I;  1RO4 A;  1VQ9 Z;  4RVF A;  1JJ2 Z;  3HOY I;  2P28 A;  2F4O A;  2QA4 1;  2HF1 A;  3CCV Z;  4NBF A;  3CC2 1;  2J6A A;  2IZ4 A;  1Q81 2;  2VPZ A;  1QVF Y;  3G71 Z;  1Q82 1;  2V8I A;  4BY7 I;  3CCL Z;  3OW2 Z;  5T6B A;  5C3E I;  3HOZ I;  1DL6 A;  3CCM Z;  4BBS I;  1VQK Z;  1VQK 1;  3S1N I;  2JIR A; 
#chains in the Genus database with same CATH homology
 3GTP I;  2Y0S A;  1X3Z A;  1VLA A;  2V8K A;  3RZO I;  2H85 A;  3NH8 A;  3CXC Z;  4RVG A;  1Y1V S;  2RIQ A;  4MH4 A;  1I6H I;  3G71 1;  5C4X I;  2OZK A;  4NBG A;  2O53 A;  1YHQ 1;  1W2B Y;  1RLY A;  4NBE A;  4E2W A;  1VQ8 Z;  3IX0 A;  3CQZ I;  3CCJ 1;  2QEX 1;  1RNI A;  4MRI A;  1VQ6 1;  3KIH A;  4NH1 C;  3TE5 B;  3CCE 1;  4A3J I;  2QRC B;  5T67 A;  2P3Y A;  1Z01 A;  4QTT A;  3LUS A;  1KC8 1;  3CCJ Z;  1VQM 1;  3CME 1;  2JMO A;  5FLX f;  3I56 Z;  2BJO A;  1TWF I;  1JJ2 Y;  2HU9 A;  3G6E 1;  2Q4Z A;  3CCS Z;  1VQN Z;  1X0T A;  2WB1 A;  2QKD A;  5FLX b;  1RO2 A;  2E9H A;  2DE7 A;  4MD7 A;  2KI7 B;  2RBL A;  3I55 Z;  3M4O I;  3D6W A;  4AYB A;  2JA7 I;  2QEX Z;  2ZAE B;  3CCU 1;  1VQO 1;  1VQ4 1;  4MON A;  1VQ7 1;  2QRD B;  1YIT 1;  3S14 I;  4BY1 I;  1ZB9 A;  2QLV B;  4HH4 A;  5LL6 f;  3NFZ A;  2R7Z I;  1TWG I;  2WAQ A;  3GTG I;  1YIT Z;  2QA4 Z;  2RPR A;  1N8R 2;  1ZB8 A;  3VMH A;  1NP6 A;  2W03 A;  5T64 A;  2B63 I;  2JA6 I;  2OOX B;  4HGY A;  1Q82 2;  2R93 I;  3G4S 1;  1S72 1;  1VQ5 1;  2E2I I;  3CC7 Z;  1K83 I;  4MD8 A;  4MXU A;  3S16 I;  2VUG A;  3S17 I;  1YJN 1;  4E32 A;  4Y7N I;  2E2H I;  1N8R 1;  1Q7Y 1;  3CCQ 1;  1ML8 A;  4QTU A;  1Q86 2;  1QVG Z;  1YI2 1;  4DGL A;  4RV9 A;  4A3I I;  1Q81 1;  1YJN Z;  3EED A;  2KPI A;  3S15 I;  1VQM Z;  2NVX I;  3GTJ I;  3GTM I;  2R6M A;  2F4M A;  2JA8 I;  4NBC A;  3NH5 A;  3H0G I;  1KRL A;  1NUI A;  3OW2 Y;  2DE6 A;  1NJI 2;  4E2Z A;  1WII A;  2JNY A;  5A2Q b;  1TFI A;  2GU2 A;  1K9M 1;  3TDH B;  3VTN A;  1P9N A;  3CCR 1;  3CC4 Z;  1Y1V I;  1S72 Z;  2K5R A;  4EWC A;  1Z02 A;  3F3F C;  4A93 I;  1VQ4 Z;  3GCF A;  3CCU Z;  3S1Q I;  4S1T A;  2NVT I;  2JS4 A;  3VMG A;  3KIF A;  3IF8 A;  2IZ3 A;  4BBR I;  4NFR A;  4NOZ A;  4NB9 A;  3H3V J;  3MZK B;  5D1O A;  1I3Q I;  2GTI A;  3CXC Y;  1K73 2;  3VMI A;  4A3E I;  1YJ9 1;  2PK7 A;  3CD6 Z;  3HOU I;  3BG1 B;  2JUB A;  3JAM b;  1VQ7 Z;  5IP9 I;  2M48 A;  1YUA A;  2OTJ Z;  5IT9 f;  3GKQ A;  3PO3 S;  3CCM 1;  2R92 I;  3FKI I;  4RVD A;  4E2Y A;  3J80 f;  1M1K 2;  4MD9 A;  3MZL B;  1RO0 A;  3CCV 1;  1YIJ 1;  3K7A I;  5C44 I;  3GTQ I;  1R9T I;  4NBB A;  1SFO I;  3S2H I;  2V8J A;  1S7M A;  3CC7 1;  1W2B Z;  1L1O C;  2QR1 B;  2OTL 1;  1ZH1 A;  1NJI 1;  2QRE B;  4RVH A;  1K73 1;  3GTM S;  2AKL A;  1VQ8 1;  1K9M 2;  3CD6 1;  2OOY B;  5C4J I;  1N2F A;  4X6A I;  3F3P C;  2GTH A;  1QVF Z;  4A3L I;  1Q86 1;  3VB9 A;  3BG0 B;  1USP A;  3NDI A;  1TWH I;  3QWU A;  4A3F I;  3J81 f;  3J81 b;  5D1P A;  5AN9 F;  2NVY I;  4NBD A;  3HOW I;  1PFT A;  3M3Y I;  4E31 A;  4E33 A;  2M6N A;  1X3W A;  1YJW 1;  4DK1 A;  3CCR Z;  3CC4 1;  3EER A;  3I4M I;  5D1O B;  4NBH A;  1VQN 1;  3CMA Z;  1KC8 2;  3NDJ A;  1QVG Y;  1M90 2;  1VQL 1;  3GTL I;  2NVQ I;  2W04 A;  3ESW A;  1K8A 2;  1Z03 A;  1KQS Z;  1VQO Z;  5IP7 I;  3S1M I;  3CCE Z;  4E30 A;  1M1K 1;  4DQY B;  1M90 1;  4RS4 A;  2OTJ 1;  1TWA I;  1VQL Z;  1QF8 A;  3CCQ Z;  1WW9 A;  3CMA 1;  2YAD A;  1YI2 Z;  2DE5 A;  1YIJ Z;  4A3C I;  2RHB A;  3HOV I;  3IFU A;  4A3G I;  1YJW Z;  2Q51 A;  2VF1 A;  3HKZ A;  1LQL A;  3S1R I;  5FLM I;  3MON A;  3J80 b;  1QYP A;  1Y1W I;  1WCM I;  4CL1 A;  4E2X A;  2VUM I;  1KQS Y;  1VQ5 Z;  4TNU A;  5IT9 b;  2LIY A;  4NBA A;  2RT9 A;  3GTK I;  4NB8 A;  3JAM f;  3FQQ A;  2E2J I;  3I4N I;  4XX2 A;  1YHQ Z;  3T4N B;  3PO3 I;  3CCS 1;  4BXX I;  2LFU A;  2JR6 A;  1VQ9 1;  4A3D I;  2G2K A;  3FQM A;  1USP B;  1K8A 1;  1KD1 2;  2YU9 I;  1YUK A;  2OTL Z;  2EGT A;  3U50 C;  3GTO I;  2PM9 A;  3I55 1;  3CCL 1;  1RQF A;  3D9X A;  3CC2 Z;  4Y52 I;  2K3R A;  3NH4 A;  3I07 A;  2PMZ A;  2O4H A;  1TWC I;  3CME Z;  3P5J B;  3Q87 A;  3I56 1;  3G6E Z;  4HGZ A;  4A3K I;  3CPW Y;  5A2Q f;  1Q7Y 2;  1KD1 1;  3HOX I;  2I3C A;  4A3B I;  1JWH C;  1VQP 1;  4A3M I;  1VQP Z;  3J7A 4;  3CPW Z;  3G4S Z;  5CM2 M;  2JA5 I;  3RZD I;  1VQ6 Z;  1YJ9 Z;  3PO2 I;  3S2D I;  1I50 I;  1RO4 A;  1VQ9 Z;  4RVF A;  1JJ2 Z;  3HOY I;  2P28 A;  2F4O A;  2QA4 1;  2HF1 A;  3CCV Z;  4NBF A;  3CC2 1;  2J6A A;  2IZ4 A;  1Q81 2;  1QVF Y;  3G71 Z;  1Q82 1;  2V8I A;  4BY7 I;  3CCL Z;  3OW2 Z;  5T6B A;  5C3E I;  3HOZ I;  1DL6 A;  3CCM Z;  4BBS I;  1VQK Z;  1VQK 1;  3S1N I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...