3J81f

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
69
structure length
69
Chain Sequence
KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHSTFATQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 2
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF00240 ubiquitin Ubiquitin family
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3j81f00
5FLXf 3J80f 3JAMf 5A2Qf 5IT9f 3J81f
chains in the Genus database with same CATH superfamily
2M48A 4E33A 3I551 3U50C 1RO2A 1NJI2 3GTKI 1M901 1YIJZ 1YJNZ 3NFZA 4EWCA 2R6MA 3NH4A 2VPYA 5T64A 2OTL1 1SIWA 1WCMI 2OOXB 1VQ9Z 1VQ41 2VUMI 1Z03A 2NAPA 5A2Qf 3PO3I 1VQLZ 1KC81 3VB9A 1YI21 5FLXb 4BY7I 1Q812 3T4NB 3VMIA 4RVFA 3HOWI 3CCUZ 3CCJZ 3D9XA 3EEDA 1QXFA 1QVFZ 5FLMI 2RT9A 1VQ4Z 1YJ91 2F4OA 2V45A 5IT9f 3EERA 1Q862 3S1MI 3CCVZ 4X6AI 2E7ZA 1QVGZ 1YIT1 2PMZA 3M3YI 3HOXI 1LQLA 2JA5I 4DK1A 1S7MA 2OTJ1 2JIRA 3MZLB 3D2LA 3S1RI 3I4NI 1AA6A 4A3GI 1VLAA 2EGTA 4NBAA 1Q821 2Q4ZA 1S721 2QEX1 2R7ZI 3IR7A 3OW2Z 3PO3S 2RBLA 2VPZA 4E2WA 3CCQZ 2O4HA 2O53A 2OOYB 2JUBA 1VQ71 1WIIA 1K8A2 1YUKA 3CC71 2QRCB 2DE7A 3Q87A 3CCE1 2H85A 2JIMA 3CC41 2RIQA 1TWGI 3G71Z 1M902 1JJ2Y 5T67A 4MRIA 3CXCY 1VQ61 1Y1WI 3I561 2P3YA 1KQSY 2IV2X 2W03A 1K83I 1FDOA 2DE5A 3K7AI 4MH4A 1Z01A 1KC82 4DQYB 1VQ8Z 3NDIA 2NVXI 3LUSA 5D1PA 1VQ6Z 1Y1VI 3RZOI 2NVTI 3IFUA 1R9TI 2HU9A 2RPRA 2NVYI 1RO0A 4BBSI 1YIJ1 1YJN1 3CPWY 3CPWZ 2P28A 5D1OB 3IF8A 1K9M1 1VQ91 3CMAZ 2GU2A 3S1NI 3J81f 4RVDA 1VQL1 3I07A 3GTGI 2JA7I 1M1K1 3CCU1 3CCJ1 3CCM1 2PM9A 2G2KA 2E2II 4A3DI 2KPIA 3GTMI 4NBBA 1VQOZ 2V3VA 4NOZA 1YUAA 3G6EZ 3HOYI 5C4JI 1RLYA 3CCV1 4NH1C 1RNIA 3ESWA 2VF1A 3QWUA 2QRDB 3CCMZ 1TWHI 2R93I 3IX0A 2LFUA 1Y1VS 5C3EI 4MD8A 2RHBA 1TFIA 4DGLA 2HF1A 3BG1B 3J7A4 3J80f 1FDIA 4NB9A 3FQQA 5IP7I 3S16I 3HKZA 3KIHA 2LEXA 4E30A 5D1OA 4E2YA 1YHQZ 1I6HI 3F3FC 2QR1B 1X0TA 3CCQ1 2QKDA 4Y52I 2JA6I 2OZKA 2W04A 3CME1 1WJ2A 4QTUA 4E2ZA 4NBHA 4BBRI 1N2FA 3CCL1 1QYPA 1ZH1A 4NBCA 4XX2A 1TWFI 1P9NA 4NBFA 3GTMS 3G711 1X3ZA 4E2XA 3S1QI 4CL1A 1L1OC 1YJWZ 3CMEZ 1Q16A 1SFOI 3JAMb 1K9M2 4BXXI 3TDHB 5FLXf 4QTTA 3H3VJ 3CCLZ 1VQ81 1Y8CA 1VQNZ 3KIFA 1JJ2Z 2E2HI 4A3II 1VQMZ 3CXCZ 2V8IA 2ZAEB 2JIOA 3S2HI 1I3QI 3PO2I 1KQSZ 1WZNA 2JR6A 3M4OI 4MD7A 2F4MA 2JMOA 4MD9A 1WW9A 1RO4A 2Y0SA 5A2Qb 3CMA1 4E31A 1X3WA 1PFTA 3HOVI 3MZKB 4HH4A 4A3JI 3F3PC 3S17I 2QLVB 4MXUA 2GTHA 4NBDA 2K3RA 1VQKZ 4NFRA 3CC2Z 5IT9b 1RQFA 1VQO1 2K5RA 3FQMA 3G6E1 1VQPZ 4NBGA 4RVHA 2NVQI 3BG0B 4A3KI 4BY1I 1Z02A 3GKQA 2AYDA 3CQZI 1Q822 1W2BY 3HOZI 3VMHA 2GTIA 3CCRZ 1DL6A 4A93I 3HOUI 2J6AA 3G4SZ 4A3LI 3NH8A 4A3BI 3NH5A 4A3CI 5C44I 5AN9F 1Q7Y1 1KD11 2JIPA 1ZB9A 4E32A 5T6BA 2PK7A 3S14I 3VMGA 3VTNA 1YHQ1 3I4MI 1JWHC 2VUGA 1VQ5Z 3I55Z 3D6WA 4NB8A 3RZDI 1K731 4A3MI 2AKLA 1USPB 1NP6A 1ML8A 1NUIA 1QVFY 5LL6f 2OTLZ 4RVGA 2IZ4A 3S2DI 3GTQI 1N8R1 1QF8A 1YJW1 2B63I 1YI2Z 3P5JB 1QVGY 4A3EI 3GTOI 2M6NA 2DE6A 3CCS1 1VQN1 1TWCI 2LIYA 1NJI1 1YJ9Z 5IP9I 1VQM1 2QREB 2YU9I 2KI7B 4HGYA 2V8KA 1YITZ 3FKII 3GTPI 2JIQA 4AYBA 2OTJZ 3CCSZ 1I50I 3J81b 4RS4A 5C4XI 1M1K2 3OW2Y 3CD61 1Q811 2JS4A 3MONA 2R92I 2E2JI 4RV9A 1S72Z 3TE5B 2QEXZ 3GTJI 4MONA 1USPA 2QA41 1Q861 1VQK1 2V8JA 2VPXA 3CC21 2BJOA 3CD6Z 1Q7Y2 1KD12 1TWAI 1VQP1 4NBEA 1VQ7Z 3CC7Z 3CCEZ 2JA8I 3GCFA 3NDJA 5CM2M 3S15I 3CC4Z 2QA4Z 4TNUA 2WB1A 4HGZA 2YADA 1K732 3CCR1 1KRLA 2E9HA 3I56Z 2JNYA 2IZ3A 1ZB8A 3G4S1 3J80b 4A3FI 3GTLI 4S1TA 3JAMf 1N8R2 2WAQA 1K8A1 1W2BZ 2I3CA 2VPWA 2Q51A 3H0GI 1VQ51 4Y7NI
chains in the Genus database with same CATH topology
2M48A 4E33A 3I551 3U50C 1RO2A 1NJI2 3GTKI 1M901 1YIJZ 1YJNZ 3NFZA 4EWCA 2R6MA 3NH4A 5T64A 2OTL1 1WCMI 2OOXB 1VQ9Z 1VQ41 2VUMI 1Z03A 5A2Qf 3PO3I 1VQLZ 1KC81 3VB9A 1YI21 5FLXb 4BY7I 1Q812 3T4NB 3VMIA 4RVFA 3HOWI 3CCUZ 3CCJZ 3D9XA 3EEDA 1QVFZ 5FLMI 2RT9A 1VQ4Z 1YJ91 2F4OA 5IT9f 3EERA 1Q862 3S1MI 3CCVZ 4X6AI 1QVGZ 1YIT1 2PMZA 3M3YI 3HOXI 1LQLA 2JA5I 4DK1A 1S7MA 2OTJ1 3MZLB 3S1RI 3I4NI 4A3GI 1VLAA 2EGTA 4NBAA 1Q821 2Q4ZA 1S721 2QEX1 2R7ZI 3OW2Z 3PO3S 2RBLA 4E2WA 3CCQZ 2O4HA 2O53A 2OOYB 2JUBA 1VQ71 1WIIA 1K8A2 1YUKA 3CC71 2QRCB 2DE7A 3Q87A 3CCE1 2H85A 3CC41 2RIQA 1TWGI 3G71Z 1M902 1JJ2Y 5T67A 4MRIA 3CXCY 1VQ61 1Y1WI 3I561 2P3YA 1KQSY 2W03A 1K83I 2DE5A 3K7AI 4MH4A 1Z01A 1KC82 4DQYB 1VQ8Z 3NDIA 2NVXI 3LUSA 5D1PA 1VQ6Z 1Y1VI 3RZOI 2NVTI 3IFUA 1R9TI 2HU9A 2RPRA 2NVYI 1RO0A 4BBSI 1YIJ1 1YJN1 3CPWY 3CPWZ 2P28A 5D1OB 3IF8A 1K9M1 1VQ91 3CMAZ 2GU2A 3S1NI 3J81f 4RVDA 1VQL1 3I07A 3GTGI 2JA7I 1M1K1 3CCU1 3CCJ1 3CCM1 2PM9A 2G2KA 2E2II 4A3DI 2KPIA 3GTMI 4NBBA 1VQOZ 4NOZA 1YUAA 3G6EZ 3HOYI 5C4JI 1RLYA 3CCV1 4NH1C 1RNIA 3ESWA 2VF1A 3QWUA 2QRDB 3CCMZ 1TWHI 2R93I 3IX0A 2LFUA 1Y1VS 5C3EI 4MD8A 2RHBA 1TFIA 4DGLA 2HF1A 3BG1B 3J7A4 3J80f 4NB9A 3FQQA 5IP7I 3S16I 3HKZA 3KIHA 4E30A 5D1OA 4E2YA 1YHQZ 1I6HI 3F3FC 2QR1B 1X0TA 3CCQ1 2QKDA 4Y52I 2JA6I 2OZKA 2W04A 3CME1 4QTUA 4E2ZA 4NBHA 4BBRI 1N2FA 3CCL1 1QYPA 1ZH1A 4NBCA 4XX2A 1TWFI 1P9NA 4NBFA 3GTMS 3G711 1X3ZA 4E2XA 3S1QI 4CL1A 1L1OC 1YJWZ 3CMEZ 1SFOI 3JAMb 1K9M2 4BXXI 3TDHB 5FLXf 4QTTA 3H3VJ 3CCLZ 1VQ81 1VQNZ 3KIFA 1JJ2Z 2E2HI 4A3II 1VQMZ 3CXCZ 2V8IA 2ZAEB 3S2HI 1I3QI 3PO2I 1KQSZ 3M4OI 2JR6A 4MD7A 2F4MA 2JMOA 4MD9A 1WW9A 1RO4A 2Y0SA 5A2Qb 3CMA1 4E31A 1X3WA 1PFTA 3HOVI 3MZKB 4HH4A 4A3JI 3F3PC 3S17I 2QLVB 4MXUA 2GTHA 4NBDA 2K3RA 1VQKZ 4NFRA 3CC2Z 5IT9b 1RQFA 1VQO1 2K5RA 3FQMA 3G6E1 1VQPZ 4NBGA 4RVHA 2NVQI 3BG0B 4A3KI 4BY1I 1Z02A 3GKQA 3CQZI 1Q822 1W2BY 3HOZI 3VMHA 2GTIA 3CCRZ 1DL6A 4A93I 3HOUI 2J6AA 3G4SZ 4A3LI 3NH8A 4A3BI 3NH5A 4A3CI 5C44I 5AN9F 1Q7Y1 1KD11 1ZB9A 4E32A 5T6BA 2PK7A 3S14I 3VMGA 3VTNA 1YHQ1 3I4MI 1JWHC 2VUGA 1VQ5Z 3I55Z 3D6WA 4NB8A 3RZDI 1K731 4A3MI 2AKLA 1USPB 1NP6A 1ML8A 1NUIA 1QVFY 5LL6f 2OTLZ 4RVGA 2IZ4A 3S2DI 3GTQI 1N8R1 1QF8A 1YJW1 2B63I 1YI2Z 3P5JB 1QVGY 4A3EI 3GTOI 2M6NA 2DE6A 3CCS1 1VQN1 1TWCI 2LIYA 1NJI1 1YJ9Z 5IP9I 1VQM1 2QREB 2YU9I 2KI7B 4HGYA 2V8KA 1YITZ 3FKII 3GTPI 4AYBA 2OTJZ 3CCSZ 1I50I 3J81b 4RS4A 5C4XI 1M1K2 3OW2Y 3CD61 1Q811 2JS4A 3MONA 2R92I 2E2JI 4RV9A 1S72Z 3TE5B 2QEXZ 3GTJI 4MONA 1USPA 2QA41 1Q861 1VQK1 2V8JA 3CC21 2BJOA 3CD6Z 1Q7Y2 1KD12 1TWAI 1VQP1 4NBEA 1VQ7Z 3CC7Z 3CCEZ 2JA8I 3GCFA 3NDJA 5CM2M 3S15I 3CC4Z 2QA4Z 4TNUA 2WB1A 4HGZA 2YADA 1K732 3CCR1 1KRLA 2E9HA 3I56Z 2JNYA 2IZ3A 1ZB8A 3G4S1 3J80b 4A3FI 3GTLI 4S1TA 3JAMf 1N8R2 2WAQA 1K8A1 1W2BZ 2I3CA 2Q51A 3H0GI 1VQ51 4Y7NI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX f;  3J80 f;  3JAM f;  5A2Q f;  5IT9 f;  3J81 f; 
#chains in the Genus database with same CATH topology
 2M48 A;  4E33 A;  3I55 1;  3U50 C;  1RO2 A;  1NJI 2;  3GTK I;  1M90 1;  1YIJ Z;  1YJN Z;  3NFZ A;  4EWC A;  2R6M A;  3NH4 A;  2VPY A;  5T64 A;  2OTL 1;  1SIW A;  1WCM I;  2OOX B;  1VQ9 Z;  1VQ4 1;  2VUM I;  1Z03 A;  2NAP A;  5A2Q f;  3PO3 I;  1VQL Z;  1KC8 1;  3VB9 A;  1YI2 1;  5FLX b;  4BY7 I;  1Q81 2;  3T4N B;  3VMI A;  4RVF A;  3HOW I;  3CCU Z;  3CCJ Z;  3D9X A;  3EED A;  1QXF A;  1QVF Z;  5FLM I;  2RT9 A;  1VQ4 Z;  1YJ9 1;  2F4O A;  2V45 A;  5IT9 f;  3EER A;  1Q86 2;  3S1M I;  3CCV Z;  4X6A I;  2E7Z A;  1QVG Z;  1YIT 1;  2PMZ A;  3M3Y I;  3HOX I;  1LQL A;  2JA5 I;  4DK1 A;  1S7M A;  2OTJ 1;  2JIR A;  3MZL B;  3D2L A;  3S1R I;  3I4N I;  1AA6 A;  4A3G I;  1VLA A;  2EGT A;  4NBA A;  1Q82 1;  2Q4Z A;  1S72 1;  2QEX 1;  2R7Z I;  3IR7 A;  3OW2 Z;  3PO3 S;  2RBL A;  2VPZ A;  4E2W A;  3CCQ Z;  2O4H A;  2O53 A;  2OOY B;  2JUB A;  1VQ7 1;  1WII A;  1K8A 2;  1YUK A;  3CC7 1;  2QRC B;  2DE7 A;  3Q87 A;  3CCE 1;  2H85 A;  2JIM A;  3CC4 1;  2RIQ A;  1TWG I;  3G71 Z;  1M90 2;  1JJ2 Y;  5T67 A;  4MRI A;  3CXC Y;  1VQ6 1;  1Y1W I;  3I56 1;  2P3Y A;  1KQS Y;  2IV2 X;  2W03 A;  1K83 I;  1FDO A;  2DE5 A;  3K7A I;  4MH4 A;  1Z01 A;  1KC8 2;  4DQY B;  1VQ8 Z;  3NDI A;  2NVX I;  3LUS A;  5D1P A;  1VQ6 Z;  1Y1V I;  3RZO I;  2NVT I;  3IFU A;  1R9T I;  2HU9 A;  2RPR A;  2NVY I;  1RO0 A;  4BBS I;  1YIJ 1;  1YJN 1;  3CPW Y;  3CPW Z;  2P28 A;  5D1O B;  3IF8 A;  1K9M 1;  1VQ9 1;  3CMA Z;  2GU2 A;  3S1N I;  3J81 f;  4RVD A;  1VQL 1;  3I07 A;  3GTG I;  2JA7 I;  1M1K 1;  3CCU 1;  3CCJ 1;  3CCM 1;  2PM9 A;  2G2K A;  2E2I I;  4A3D I;  2KPI A;  3GTM I;  4NBB A;  1VQO Z;  2V3V A;  4NOZ A;  1YUA A;  3G6E Z;  3HOY I;  5C4J I;  1RLY A;  3CCV 1;  4NH1 C;  1RNI A;  3ESW A;  2VF1 A;  3QWU A;  2QRD B;  3CCM Z;  1TWH I;  2R93 I;  3IX0 A;  2LFU A;  1Y1V S;  5C3E I;  4MD8 A;  2RHB A;  1TFI A;  4DGL A;  2HF1 A;  3BG1 B;  3J7A 4;  3J80 f;  1FDI A;  4NB9 A;  3FQQ A;  5IP7 I;  3S16 I;  3HKZ A;  3KIH A;  2LEX A;  4E30 A;  5D1O A;  4E2Y A;  1YHQ Z;  1I6H I;  3F3F C;  2QR1 B;  1X0T A;  3CCQ 1;  2QKD A;  4Y52 I;  2JA6 I;  2OZK A;  2W04 A;  3CME 1;  1WJ2 A;  4QTU A;  4E2Z A;  4NBH A;  4BBR I;  1N2F A;  3CCL 1;  1QYP A;  1ZH1 A;  4NBC A;  4XX2 A;  1TWF I;  1P9N A;  4NBF A;  3GTM S;  3G71 1;  1X3Z A;  4E2X A;  3S1Q I;  4CL1 A;  1L1O C;  1YJW Z;  3CME Z;  1Q16 A;  1SFO I;  3JAM b;  1K9M 2;  4BXX I;  3TDH B;  5FLX f;  4QTT A;  3H3V J;  3CCL Z;  1VQ8 1;  1Y8C A;  1VQN Z;  3KIF A;  1JJ2 Z;  2E2H I;  4A3I I;  1VQM Z;  3CXC Z;  2V8I A;  2ZAE B;  2JIO A;  3S2H I;  1I3Q I;  3PO2 I;  1KQS Z;  1WZN A;  2JR6 A;  3M4O I;  4MD7 A;  2F4M A;  2JMO A;  4MD9 A;  1WW9 A;  1RO4 A;  2Y0S A;  5A2Q b;  3CMA 1;  4E31 A;  1X3W A;  1PFT A;  3HOV I;  3MZK B;  4HH4 A;  4A3J I;  3F3P C;  3S17 I;  2QLV B;  4MXU A;  2GTH A;  4NBD A;  2K3R A;  1VQK Z;  4NFR A;  3CC2 Z;  5IT9 b;  1RQF A;  1VQO 1;  2K5R A;  3FQM A;  3G6E 1;  1VQP Z;  4NBG A;  4RVH A;  2NVQ I;  3BG0 B;  4A3K I;  4BY1 I;  1Z02 A;  3GKQ A;  2AYD A;  3CQZ I;  1Q82 2;  1W2B Y;  3HOZ I;  3VMH A;  2GTI A;  3CCR Z;  1DL6 A;  4A93 I;  3HOU I;  2J6A A;  3G4S Z;  4A3L I;  3NH8 A;  4A3B I;  3NH5 A;  4A3C I;  5C44 I;  5AN9 F;  1Q7Y 1;  1KD1 1;  2JIP A;  1ZB9 A;  4E32 A;  5T6B A;  2PK7 A;  3S14 I;  3VMG A;  3VTN A;  1YHQ 1;  3I4M I;  1JWH C;  2VUG A;  1VQ5 Z;  3I55 Z;  3D6W A;  4NB8 A;  3RZD I;  1K73 1;  4A3M I;  2AKL A;  1USP B;  1NP6 A;  1ML8 A;  1NUI A;  1QVF Y;  5LL6 f;  2OTL Z;  4RVG A;  2IZ4 A;  3S2D I;  3GTQ I;  1N8R 1;  1QF8 A;  1YJW 1;  2B63 I;  1YI2 Z;  3P5J B;  1QVG Y;  4A3E I;  3GTO I;  2M6N A;  2DE6 A;  3CCS 1;  1VQN 1;  1TWC I;  2LIY A;  1NJI 1;  1YJ9 Z;  5IP9 I;  1VQM 1;  2QRE B;  2YU9 I;  2KI7 B;  4HGY A;  2V8K A;  1YIT Z;  3FKI I;  3GTP I;  2JIQ A;  4AYB A;  2OTJ Z;  3CCS Z;  1I50 I;  3J81 b;  4RS4 A;  5C4X I;  1M1K 2;  3OW2 Y;  3CD6 1;  1Q81 1;  2JS4 A;  3MON A;  2R92 I;  2E2J I;  4RV9 A;  1S72 Z;  3TE5 B;  2QEX Z;  3GTJ I;  4MON A;  1USP A;  2QA4 1;  1Q86 1;  1VQK 1;  2V8J A;  2VPX A;  3CC2 1;  2BJO A;  3CD6 Z;  1Q7Y 2;  1KD1 2;  1TWA I;  1VQP 1;  4NBE A;  1VQ7 Z;  3CC7 Z;  3CCE Z;  2JA8 I;  3GCF A;  3NDJ A;  5CM2 M;  3S15 I;  3CC4 Z;  2QA4 Z;  4TNU A;  2WB1 A;  4HGZ A;  2YAD A;  1K73 2;  3CCR 1;  1KRL A;  2E9H A;  3I56 Z;  2JNY A;  2IZ3 A;  1ZB8 A;  3G4S 1;  3J80 b;  4A3F I;  3GTL I;  4S1T A;  3JAM f;  1N8R 2;  2WAQ A;  1K8A 1;  1W2B Z;  2I3C A;  2VPW A;  2Q51 A;  3H0G I;  1VQ5 1;  4Y7N I; 
#chains in the Genus database with same CATH homology
 2M48 A;  4E33 A;  3I55 1;  3U50 C;  1RO2 A;  1NJI 2;  3GTK I;  1M90 1;  1YIJ Z;  1YJN Z;  3NFZ A;  4EWC A;  2R6M A;  3NH4 A;  5T64 A;  2OTL 1;  1WCM I;  2OOX B;  1VQ9 Z;  1VQ4 1;  2VUM I;  1Z03 A;  5A2Q f;  3PO3 I;  1VQL Z;  1KC8 1;  3VB9 A;  1YI2 1;  5FLX b;  4BY7 I;  1Q81 2;  3T4N B;  3VMI A;  4RVF A;  3HOW I;  3CCU Z;  3CCJ Z;  3D9X A;  3EED A;  1QVF Z;  5FLM I;  2RT9 A;  1VQ4 Z;  1YJ9 1;  2F4O A;  5IT9 f;  3EER A;  1Q86 2;  3S1M I;  3CCV Z;  4X6A I;  1QVG Z;  1YIT 1;  2PMZ A;  3M3Y I;  3HOX I;  1LQL A;  2JA5 I;  4DK1 A;  1S7M A;  2OTJ 1;  3MZL B;  3S1R I;  3I4N I;  4A3G I;  1VLA A;  2EGT A;  4NBA A;  1Q82 1;  2Q4Z A;  1S72 1;  2QEX 1;  2R7Z I;  3OW2 Z;  3PO3 S;  2RBL A;  4E2W A;  3CCQ Z;  2O4H A;  2O53 A;  2OOY B;  2JUB A;  1VQ7 1;  1WII A;  1K8A 2;  1YUK A;  3CC7 1;  2QRC B;  2DE7 A;  3Q87 A;  3CCE 1;  2H85 A;  3CC4 1;  2RIQ A;  1TWG I;  3G71 Z;  1M90 2;  1JJ2 Y;  5T67 A;  4MRI A;  3CXC Y;  1VQ6 1;  1Y1W I;  3I56 1;  2P3Y A;  1KQS Y;  2W03 A;  1K83 I;  2DE5 A;  3K7A I;  4MH4 A;  1Z01 A;  1KC8 2;  4DQY B;  1VQ8 Z;  3NDI A;  2NVX I;  3LUS A;  5D1P A;  1VQ6 Z;  1Y1V I;  3RZO I;  2NVT I;  3IFU A;  1R9T I;  2HU9 A;  2RPR A;  2NVY I;  1RO0 A;  4BBS I;  1YIJ 1;  1YJN 1;  3CPW Y;  3CPW Z;  2P28 A;  5D1O B;  3IF8 A;  1K9M 1;  1VQ9 1;  3CMA Z;  2GU2 A;  3S1N I;  3J81 f;  4RVD A;  1VQL 1;  3I07 A;  3GTG I;  2JA7 I;  1M1K 1;  3CCU 1;  3CCJ 1;  3CCM 1;  2PM9 A;  2G2K A;  2E2I I;  4A3D I;  2KPI A;  3GTM I;  4NBB A;  1VQO Z;  4NOZ A;  1YUA A;  3G6E Z;  3HOY I;  5C4J I;  1RLY A;  3CCV 1;  4NH1 C;  1RNI A;  3ESW A;  2VF1 A;  3QWU A;  2QRD B;  3CCM Z;  1TWH I;  2R93 I;  3IX0 A;  2LFU A;  1Y1V S;  5C3E I;  4MD8 A;  2RHB A;  1TFI A;  4DGL A;  2HF1 A;  3BG1 B;  3J7A 4;  3J80 f;  4NB9 A;  3FQQ A;  5IP7 I;  3S16 I;  3HKZ A;  3KIH A;  4E30 A;  5D1O A;  4E2Y A;  1YHQ Z;  1I6H I;  3F3F C;  2QR1 B;  1X0T A;  3CCQ 1;  2QKD A;  4Y52 I;  2JA6 I;  2OZK A;  2W04 A;  3CME 1;  4QTU A;  4E2Z A;  4NBH A;  4BBR I;  1N2F A;  3CCL 1;  1QYP A;  1ZH1 A;  4NBC A;  4XX2 A;  1TWF I;  1P9N A;  4NBF A;  3GTM S;  3G71 1;  1X3Z A;  4E2X A;  3S1Q I;  4CL1 A;  1L1O C;  1YJW Z;  3CME Z;  1SFO I;  3JAM b;  1K9M 2;  4BXX I;  3TDH B;  5FLX f;  4QTT A;  3H3V J;  3CCL Z;  1VQ8 1;  1VQN Z;  3KIF A;  1JJ2 Z;  2E2H I;  4A3I I;  1VQM Z;  3CXC Z;  2V8I A;  2ZAE B;  3S2H I;  1I3Q I;  3PO2 I;  1KQS Z;  3M4O I;  2JR6 A;  4MD7 A;  2F4M A;  2JMO A;  4MD9 A;  1WW9 A;  1RO4 A;  2Y0S A;  5A2Q b;  3CMA 1;  4E31 A;  1X3W A;  1PFT A;  3HOV I;  3MZK B;  4HH4 A;  4A3J I;  3F3P C;  3S17 I;  2QLV B;  4MXU A;  2GTH A;  4NBD A;  2K3R A;  1VQK Z;  4NFR A;  3CC2 Z;  5IT9 b;  1RQF A;  1VQO 1;  2K5R A;  3FQM A;  3G6E 1;  1VQP Z;  4NBG A;  4RVH A;  2NVQ I;  3BG0 B;  4A3K I;  4BY1 I;  1Z02 A;  3GKQ A;  3CQZ I;  1Q82 2;  1W2B Y;  3HOZ I;  3VMH A;  2GTI A;  3CCR Z;  1DL6 A;  4A93 I;  3HOU I;  2J6A A;  3G4S Z;  4A3L I;  3NH8 A;  4A3B I;  3NH5 A;  4A3C I;  5C44 I;  5AN9 F;  1Q7Y 1;  1KD1 1;  1ZB9 A;  4E32 A;  5T6B A;  2PK7 A;  3S14 I;  3VMG A;  3VTN A;  1YHQ 1;  3I4M I;  1JWH C;  2VUG A;  1VQ5 Z;  3I55 Z;  3D6W A;  4NB8 A;  3RZD I;  1K73 1;  4A3M I;  2AKL A;  1USP B;  1NP6 A;  1ML8 A;  1NUI A;  1QVF Y;  5LL6 f;  2OTL Z;  4RVG A;  2IZ4 A;  3S2D I;  3GTQ I;  1N8R 1;  1QF8 A;  1YJW 1;  2B63 I;  1YI2 Z;  3P5J B;  1QVG Y;  4A3E I;  3GTO I;  2M6N A;  2DE6 A;  3CCS 1;  1VQN 1;  1TWC I;  2LIY A;  1NJI 1;  1YJ9 Z;  5IP9 I;  1VQM 1;  2QRE B;  2YU9 I;  2KI7 B;  4HGY A;  2V8K A;  1YIT Z;  3FKI I;  3GTP I;  4AYB A;  2OTJ Z;  3CCS Z;  1I50 I;  3J81 b;  4RS4 A;  5C4X I;  1M1K 2;  3OW2 Y;  3CD6 1;  1Q81 1;  2JS4 A;  3MON A;  2R92 I;  2E2J I;  4RV9 A;  1S72 Z;  3TE5 B;  2QEX Z;  3GTJ I;  4MON A;  1USP A;  2QA4 1;  1Q86 1;  1VQK 1;  2V8J A;  3CC2 1;  2BJO A;  3CD6 Z;  1Q7Y 2;  1KD1 2;  1TWA I;  1VQP 1;  4NBE A;  1VQ7 Z;  3CC7 Z;  3CCE Z;  2JA8 I;  3GCF A;  3NDJ A;  5CM2 M;  3S15 I;  3CC4 Z;  2QA4 Z;  4TNU A;  2WB1 A;  4HGZ A;  2YAD A;  1K73 2;  3CCR 1;  1KRL A;  2E9H A;  3I56 Z;  2JNY A;  2IZ3 A;  1ZB8 A;  3G4S 1;  3J80 b;  4A3F I;  3GTL I;  4S1T A;  3JAM f;  1N8R 2;  2WAQ A;  1K8A 1;  1W2B Z;  2I3C A;  2Q51 A;  3H0G I;  1VQ5 1;  4Y7N I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...