3J81f

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
69
structure length
69
Chain Sequence
b'KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHSTFATQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 2
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF00240 ubiquitin Ubiquitin family
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3j81f00
5A2Qf 5FLXf 5IT9f 3J81f 3JAMf 3J80f
chains in the Genus database with same CATH superfamily
3CCS1 1QYPA 3F3FC 1KD12 2F4MA 1X0TA 3S2HI 2J6AA 2V8JA 2R6MA 3BG1B 1Q7Y1 2NVQI 1JWHC 4E2YA 1YIJZ 2LFUA 3EERA 4BBRI 3Q87A 3GTKI 2OZKA 2JA7I 4MD8A 3IR7A 3BG0B 4BXXI 1QVFZ 1YJNZ 1Q16A 1K732 4QTTA 4DK1A 1WW9A 3CCJZ 2JA6I 1KQSY 2OTLZ 1K83I 1KRLA 3CCV1 3P5JB 1RO0A 1KD11 3FKII 2V45A 5A2Qb 2YU9I 4RVHA 3CMA1 1VQ61 2OTJZ 1RLYA 3D2LA 2JA5I 3S16I 1QVGY 2RIQA 3J81b 3CCMZ 2NVYI 3I55Z 3CC4Z 3CD61 4A93I 4BBSI 4CL1A 1Q822 1USPB 3HOYI 1WIIA 1YUKA 3HOZI 2W04A 1K731 4AYBA 1VQ81 1YI21 3M3YI 5IT9b 1VQN1 2V8IA 1ZB8A 1YHQ1 3J7A4 5FLXb 3CCL1 5D1OB 3H3VJ 3VMGA 3H0GI 2R93I 1RO4A 3G4SZ 2E2JI 2JIMA 4A3LI 3CXCZ 2LIYA 4A3EI 2VPWA 3LUSA 2VPZA 4E33A 2P3YA 2BJOA 2GTIA 3S14I 2VUGA 1YITZ 3IX0A 4Y52I 3VTNA 1Q821 3GTJI 2E9HA 1VQL1 1I50I 1YJ91 4NOZA 1S7MA 3CCE1 1TWHI 3PO2I 4MRIA 3PO3I 3OW2Y 3S17I 1K8A2 1VQ5Z 3G6E1 3TDHB 1JJ2Y 3NH4A 1VQMZ 1W2BZ 1L1OC 4A3FI 2QRCB 4E2ZA 4X6AI 2HF1A 3D9XA 3CME1 3JAMf 3J80f 2E7ZA 2YADA 2JIRA 3CC71 5C4JI 3RZDI 5C4XI 4MH4A 2NVXI 1X3ZA 1M1K2 4RVGA 2R7ZI 2VPYA 3CCQ1 2QRDB 1Y1VS 1ZH1A 4DQYB 1K9M2 2GTHA 5FLMI 3CCUZ 1K8A1 1VQKZ 3HOWI 2V3VA 2Y0SA 3IFUA 1S72Z 1FDIA 2IZ3A 1VQ91 1RNIA 4E2WA 3CCSZ 5T6BA 4EWCA 1YJW1 3S15I 3CPWZ 1VQ71 4HGZA 4NBCA 2EGTA 1VQ41 3PO3S 3FQQA 2RT9A 3CC21 4RVFA 1TWCI 3CQZI 2B63I 4NBBA 2DE6A 4A3MI 2HU9A 2QEX1 1Q812 1WJ2A 1ZB9A 1Z02A 1NJI2 5LL6f 3KIHA 3J81f 3GTOI 3CCVZ 1Q862 3CMAZ 1Y1VI 1VQ6Z 3S1RI 1Y1WI 1I3QI 1VQP1 1FDOA 1TWAI 4DGLA 2AYDA 3I4NI 5D1PA 3RZOI 2DE5A 5T67A 3I561 2QR1B 2WB1A 3CCR1 2RHBA 5C44I 3VMIA 3CD6Z 5FLXf 2QKDA 2G2KA 2OOXB 3GTGI 3T4NB 4A3KI 1WCMI 3HKZA 1Q811 1R9TI 2JMOA 1VQ8Z 1PFTA 1NJI1 4BY1I 1VQNZ 1KC82 4NBDA 3S2DI 1YHQZ 4MD9A 1KQSZ 2JS4A 2LEXA 4A3II 1Q861 3CCLZ 3F3PC 1USPA 2RBLA 2E2HI 2Q51A 1M902 5IP7I 4E31A 1QVFY 3G711 2IV2X 1QVGZ 4A3DI 1VQO1 2QA41 3VMHA 3S1MI 5D1OA 1P9NA 4NFRA 1VQLZ 1Z01A 3NFZA 1YJ9Z 3I4MI 4NBAA 4S1TA 3CCEZ 2GU2A 4NBGA 1N8R2 2DE7A 2NAPA 1KC81 1YIJ1 1LQLA 3GTPI 3KIFA 3G6EZ 3NH5A 2KI7B 2I3CA 2O53A 3GTLI 3ESWA 3MONA 3VB9A 5T64A 4QTUA 2JUBA 3NDIA 4HGYA 4NB8A 2M48A 1M901 4HH4A 2P28A 3CMEZ 1VLAA 3HOUI 1WZNA 2RPRA 2NVTI 2JNYA 3GTMS 3CC7Z 1YJN1 4XX2A 4E32A 4BY7I 5C3EI 4RVDA 3U50C 4MONA 3MZKB 3CCJ1 1NP6A 2OTL1 3NDJA 2OOYB 3CCQZ 3D6WA 4NB9A 2V8KA 2K3RA 1M1K1 1I6HI 1SFOI 2JIPA 1Z03A 1N8R1 1AA6A 2OTJ1 2PMZA 3OW2Z 3CXCY 1TWFI 2Q4ZA 3IF8A 4A3GI 1K9M1 1JJ2Z 1VQ9Z 3CCM1 2JIOA 5A2Qf 3I551 4A3JI 3CC41 3MZLB 4NH1C 1YJWZ 1TWGI 3TE5B 2PM9A 4NBEA 2JIQA 1VQ7Z 2W03A 5IP9I 1RQFA 5AN9F 3FQMA 3QWUA 1NUIA 1VQ4Z 4NBFA 3GTQI 3EEDA 1W2BY 3CC2Z 2JR6A 1DL6A 2K5RA 2WAQA 5IT9f 3G4S1 4A3CI 2QEXZ 4RS4A 1SIWA 3GKQA 2R92I 1QF8A 3GTMI 4E2XA 3HOVI 2F4OA 4Y7NI 3HOXI 1YIT1 3M4OI 2AKLA 1YI2Z 2VUMI 2VPXA 4MXUA 1RO2A 4RV9A 1VQPZ 2VF1A 3S1QI 1VQ51 2E2II 1YUAA 3I56Z 4A3BI 3CCRZ 2QLVB 1ML8A 1VQM1 4E30A 2QREB 2ZAEB 2M6NA 3I07A 3CPWY 3GCFA 2KPIA 1Y8CA 1Q7Y2 2H85A 2PK7A 3NH8A 3K7AI 4MD7A 5CM2M 3S1NI 3JAMb 3J80b 3CCU1 4TNUA 2O4HA 4NBHA 3G71Z 1TFIA 1X3WA 1QXFA 1VQK1 1N2FA 1S721 1VQOZ 2IZ4A 2JA8I 2QA4Z
chains in the Genus database with same CATH topology
3CCS1 1QYPA 3F3FC 1KD12 2F4MA 1X0TA 3S2HI 2J6AA 2V8JA 2R6MA 3BG1B 1Q7Y1 2NVQI 1JWHC 4E2YA 1YIJZ 2LFUA 3EERA 4BBRI 3Q87A 3GTKI 2OZKA 2JA7I 4MD8A 3BG0B 4BXXI 1QVFZ 1YJNZ 1K732 4QTTA 4DK1A 1WW9A 3CCJZ 2JA6I 1KQSY 2OTLZ 1K83I 1KRLA 3CCV1 3P5JB 1RO0A 1KD11 3FKII 5A2Qb 2YU9I 4RVHA 3CMA1 1VQ61 2OTJZ 1RLYA 2JA5I 3S16I 1QVGY 2RIQA 3J81b 3CCMZ 2NVYI 3I55Z 3CC4Z 3CD61 4A93I 4BBSI 4CL1A 1Q822 1USPB 3HOYI 1WIIA 1YUKA 3HOZI 2W04A 1K731 4AYBA 1VQ81 1YI21 3M3YI 5IT9b 1VQN1 2V8IA 1ZB8A 1YHQ1 3J7A4 5FLXb 3CCL1 5D1OB 3H3VJ 3VMGA 3H0GI 2R93I 1RO4A 3G4SZ 2E2JI 4A3LI 3CXCZ 2LIYA 4A3EI 3LUSA 4E33A 2P3YA 2BJOA 2GTIA 3S14I 2VUGA 1YITZ 3IX0A 4Y52I 3VTNA 1Q821 3GTJI 2E9HA 1VQL1 1I50I 1YJ91 4NOZA 1S7MA 3CCE1 1TWHI 3PO2I 4MRIA 3PO3I 3OW2Y 3S17I 1K8A2 1VQ5Z 3G6E1 3TDHB 1JJ2Y 3NH4A 1VQMZ 1W2BZ 1L1OC 4A3FI 2QRCB 4E2ZA 4X6AI 2HF1A 3D9XA 3CME1 3JAMf 3J80f 2YADA 3CC71 5C4JI 3RZDI 5C4XI 4MH4A 2NVXI 1X3ZA 1M1K2 4RVGA 2R7ZI 3CCQ1 2QRDB 1Y1VS 1ZH1A 4DQYB 1K9M2 2GTHA 5FLMI 3CCUZ 1K8A1 1VQKZ 3HOWI 2Y0SA 3IFUA 1S72Z 2IZ3A 1VQ91 1RNIA 4E2WA 3CCSZ 5T6BA 4EWCA 1YJW1 3S15I 3CPWZ 1VQ71 4HGZA 4NBCA 2EGTA 1VQ41 3PO3S 3FQQA 2RT9A 3CC21 4RVFA 1TWCI 3CQZI 2B63I 4NBBA 2DE6A 4A3MI 2HU9A 2QEX1 1Q812 1ZB9A 1Z02A 1NJI2 5LL6f 3KIHA 3J81f 3GTOI 3CCVZ 1Q862 3CMAZ 1Y1VI 1VQ6Z 3S1RI 1Y1WI 1I3QI 1VQP1 1TWAI 4DGLA 3I4NI 5D1PA 3RZOI 2DE5A 5T67A 3I561 2QR1B 2WB1A 3CCR1 2RHBA 5C44I 3VMIA 3CD6Z 5FLXf 2QKDA 2G2KA 2OOXB 3GTGI 3T4NB 4A3KI 1WCMI 3HKZA 1Q811 1R9TI 2JMOA 1VQ8Z 1PFTA 1NJI1 4BY1I 1VQNZ 1KC82 4NBDA 3S2DI 1YHQZ 4MD9A 1KQSZ 2JS4A 4A3II 1Q861 3CCLZ 3F3PC 1USPA 2RBLA 2E2HI 2Q51A 1M902 5IP7I 4E31A 1QVFY 3G711 1QVGZ 4A3DI 1VQO1 2QA41 3VMHA 3S1MI 5D1OA 1P9NA 4NFRA 1VQLZ 1Z01A 3NFZA 1YJ9Z 3I4MI 4NBAA 4S1TA 3CCEZ 2GU2A 4NBGA 1N8R2 2DE7A 1KC81 1YIJ1 1LQLA 3GTPI 3KIFA 3G6EZ 3NH5A 2KI7B 2I3CA 2O53A 3GTLI 3ESWA 3MONA 3VB9A 5T64A 4QTUA 2JUBA 3NDIA 4HGYA 4NB8A 2M48A 1M901 4HH4A 2P28A 3CMEZ 1VLAA 3HOUI 2RPRA 2NVTI 2JNYA 3GTMS 3CC7Z 1YJN1 4XX2A 4E32A 4BY7I 5C3EI 4RVDA 3U50C 4MONA 3MZKB 3CCJ1 1NP6A 2OTL1 3NDJA 2OOYB 3CCQZ 3D6WA 4NB9A 2V8KA 2K3RA 1M1K1 1I6HI 1SFOI 1Z03A 1N8R1 2OTJ1 2PMZA 3OW2Z 3CXCY 1TWFI 2Q4ZA 3IF8A 4A3GI 1K9M1 1JJ2Z 1VQ9Z 3CCM1 5A2Qf 3I551 4A3JI 3CC41 3MZLB 4NH1C 1YJWZ 1TWGI 3TE5B 2PM9A 4NBEA 1VQ7Z 2W03A 5IP9I 1RQFA 5AN9F 3FQMA 3QWUA 1NUIA 1VQ4Z 4NBFA 3GTQI 3EEDA 1W2BY 3CC2Z 2JR6A 1DL6A 2K5RA 2WAQA 5IT9f 3G4S1 4A3CI 2QEXZ 4RS4A 3GKQA 2R92I 1QF8A 3GTMI 4E2XA 3HOVI 2F4OA 4Y7NI 3HOXI 1YIT1 3M4OI 2AKLA 1YI2Z 2VUMI 4MXUA 1RO2A 4RV9A 1VQPZ 2VF1A 3S1QI 1VQ51 2E2II 1YUAA 3I56Z 4A3BI 3CCRZ 2QLVB 1ML8A 1VQM1 4E30A 2QREB 2ZAEB 2M6NA 3I07A 3CPWY 3GCFA 2KPIA 1Q7Y2 2H85A 2PK7A 3NH8A 3K7AI 4MD7A 5CM2M 3S1NI 3JAMb 3J80b 3CCU1 4TNUA 2O4HA 4NBHA 3G71Z 1TFIA 1X3WA 1VQK1 1N2FA 1S721 1VQOZ 2IZ4A 2JA8I 2QA4Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q f;  5FLX f;  5IT9 f;  3J81 f;  3JAM f;  3J80 f; 
#chains in the Genus database with same CATH topology
 3CCS 1;  1QYP A;  3F3F C;  1KD1 2;  2F4M A;  1X0T A;  3S2H I;  2J6A A;  2V8J A;  2R6M A;  3BG1 B;  1Q7Y 1;  2NVQ I;  1JWH C;  4E2Y A;  1YIJ Z;  2LFU A;  3EER A;  4BBR I;  3Q87 A;  3GTK I;  2OZK A;  2JA7 I;  4MD8 A;  3IR7 A;  3BG0 B;  4BXX I;  1QVF Z;  1YJN Z;  1Q16 A;  1K73 2;  4QTT A;  4DK1 A;  1WW9 A;  3CCJ Z;  2JA6 I;  1KQS Y;  2OTL Z;  1K83 I;  1KRL A;  3CCV 1;  3P5J B;  1RO0 A;  1KD1 1;  3FKI I;  2V45 A;  5A2Q b;  2YU9 I;  4RVH A;  3CMA 1;  1VQ6 1;  2OTJ Z;  1RLY A;  3D2L A;  2JA5 I;  3S16 I;  1QVG Y;  2RIQ A;  3J81 b;  3CCM Z;  2NVY I;  3I55 Z;  3CC4 Z;  3CD6 1;  4A93 I;  4BBS I;  4CL1 A;  1Q82 2;  1USP B;  3HOY I;  1WII A;  1YUK A;  3HOZ I;  2W04 A;  1K73 1;  4AYB A;  1VQ8 1;  1YI2 1;  3M3Y I;  5IT9 b;  1VQN 1;  2V8I A;  1ZB8 A;  1YHQ 1;  3J7A 4;  5FLX b;  3CCL 1;  5D1O B;  3H3V J;  3VMG A;  3H0G I;  2R93 I;  1RO4 A;  3G4S Z;  2E2J I;  2JIM A;  4A3L I;  3CXC Z;  2LIY A;  4A3E I;  2VPW A;  3LUS A;  2VPZ A;  4E33 A;  2P3Y A;  2BJO A;  2GTI A;  3S14 I;  2VUG A;  1YIT Z;  3IX0 A;  4Y52 I;  3VTN A;  1Q82 1;  3GTJ I;  2E9H A;  1VQL 1;  1I50 I;  1YJ9 1;  4NOZ A;  1S7M A;  3CCE 1;  1TWH I;  3PO2 I;  4MRI A;  3PO3 I;  3OW2 Y;  3S17 I;  1K8A 2;  1VQ5 Z;  3G6E 1;  3TDH B;  1JJ2 Y;  3NH4 A;  1VQM Z;  1W2B Z;  1L1O C;  4A3F I;  2QRC B;  4E2Z A;  4X6A I;  2HF1 A;  3D9X A;  3CME 1;  3JAM f;  3J80 f;  2E7Z A;  2YAD A;  2JIR A;  3CC7 1;  5C4J I;  3RZD I;  5C4X I;  4MH4 A;  2NVX I;  1X3Z A;  1M1K 2;  4RVG A;  2R7Z I;  2VPY A;  3CCQ 1;  2QRD B;  1Y1V S;  1ZH1 A;  4DQY B;  1K9M 2;  2GTH A;  5FLM I;  3CCU Z;  1K8A 1;  1VQK Z;  3HOW I;  2V3V A;  2Y0S A;  3IFU A;  1S72 Z;  1FDI A;  2IZ3 A;  1VQ9 1;  1RNI A;  4E2W A;  3CCS Z;  5T6B A;  4EWC A;  1YJW 1;  3S15 I;  3CPW Z;  1VQ7 1;  4HGZ A;  4NBC A;  2EGT A;  1VQ4 1;  3PO3 S;  3FQQ A;  2RT9 A;  3CC2 1;  4RVF A;  1TWC I;  3CQZ I;  2B63 I;  4NBB A;  2DE6 A;  4A3M I;  2HU9 A;  2QEX 1;  1Q81 2;  1WJ2 A;  1ZB9 A;  1Z02 A;  1NJI 2;  5LL6 f;  3KIH A;  3J81 f;  3GTO I;  3CCV Z;  1Q86 2;  3CMA Z;  1Y1V I;  1VQ6 Z;  3S1R I;  1Y1W I;  1I3Q I;  1VQP 1;  1FDO A;  1TWA I;  4DGL A;  2AYD A;  3I4N I;  5D1P A;  3RZO I;  2DE5 A;  5T67 A;  3I56 1;  2QR1 B;  2WB1 A;  3CCR 1;  2RHB A;  5C44 I;  3VMI A;  3CD6 Z;  5FLX f;  2QKD A;  2G2K A;  2OOX B;  3GTG I;  3T4N B;  4A3K I;  1WCM I;  3HKZ A;  1Q81 1;  1R9T I;  2JMO A;  1VQ8 Z;  1PFT A;  1NJI 1;  4BY1 I;  1VQN Z;  1KC8 2;  4NBD A;  3S2D I;  1YHQ Z;  4MD9 A;  1KQS Z;  2JS4 A;  2LEX A;  4A3I I;  1Q86 1;  3CCL Z;  3F3P C;  1USP A;  2RBL A;  2E2H I;  2Q51 A;  1M90 2;  5IP7 I;  4E31 A;  1QVF Y;  3G71 1;  2IV2 X;  1QVG Z;  4A3D I;  1VQO 1;  2QA4 1;  3VMH A;  3S1M I;  5D1O A;  1P9N A;  4NFR A;  1VQL Z;  1Z01 A;  3NFZ A;  1YJ9 Z;  3I4M I;  4NBA A;  4S1T A;  3CCE Z;  2GU2 A;  4NBG A;  1N8R 2;  2DE7 A;  2NAP A;  1KC8 1;  1YIJ 1;  1LQL A;  3GTP I;  3KIF A;  3G6E Z;  3NH5 A;  2KI7 B;  2I3C A;  2O53 A;  3GTL I;  3ESW A;  3MON A;  3VB9 A;  5T64 A;  4QTU A;  2JUB A;  3NDI A;  4HGY A;  4NB8 A;  2M48 A;  1M90 1;  4HH4 A;  2P28 A;  3CME Z;  1VLA A;  3HOU I;  1WZN A;  2RPR A;  2NVT I;  2JNY A;  3GTM S;  3CC7 Z;  1YJN 1;  4XX2 A;  4E32 A;  4BY7 I;  5C3E I;  4RVD A;  3U50 C;  4MON A;  3MZK B;  3CCJ 1;  1NP6 A;  2OTL 1;  3NDJ A;  2OOY B;  3CCQ Z;  3D6W A;  4NB9 A;  2V8K A;  2K3R A;  1M1K 1;  1I6H I;  1SFO I;  2JIP A;  1Z03 A;  1N8R 1;  1AA6 A;  2OTJ 1;  2PMZ A;  3OW2 Z;  3CXC Y;  1TWF I;  2Q4Z A;  3IF8 A;  4A3G I;  1K9M 1;  1JJ2 Z;  1VQ9 Z;  3CCM 1;  2JIO A;  5A2Q f;  3I55 1;  4A3J I;  3CC4 1;  3MZL B;  4NH1 C;  1YJW Z;  1TWG I;  3TE5 B;  2PM9 A;  4NBE A;  2JIQ A;  1VQ7 Z;  2W03 A;  5IP9 I;  1RQF A;  5AN9 F;  3FQM A;  3QWU A;  1NUI A;  1VQ4 Z;  4NBF A;  3GTQ I;  3EED A;  1W2B Y;  3CC2 Z;  2JR6 A;  1DL6 A;  2K5R A;  2WAQ A;  5IT9 f;  3G4S 1;  4A3C I;  2QEX Z;  4RS4 A;  1SIW A;  3GKQ A;  2R92 I;  1QF8 A;  3GTM I;  4E2X A;  3HOV I;  2F4O A;  4Y7N I;  3HOX I;  1YIT 1;  3M4O I;  2AKL A;  1YI2 Z;  2VUM I;  2VPX A;  4MXU A;  1RO2 A;  4RV9 A;  1VQP Z;  2VF1 A;  3S1Q I;  1VQ5 1;  2E2I I;  1YUA A;  3I56 Z;  4A3B I;  3CCR Z;  2QLV B;  1ML8 A;  1VQM 1;  4E30 A;  2QRE B;  2ZAE B;  2M6N A;  3I07 A;  3CPW Y;  3GCF A;  2KPI A;  1Y8C A;  1Q7Y 2;  2H85 A;  2PK7 A;  3NH8 A;  3K7A I;  4MD7 A;  5CM2 M;  3S1N I;  3JAM b;  3J80 b;  3CCU 1;  4TNU A;  2O4H A;  4NBH A;  3G71 Z;  1TFI A;  1X3W A;  1QXF A;  1VQK 1;  1N2F A;  1S72 1;  1VQO Z;  2IZ4 A;  2JA8 I;  2QA4 Z; 
#chains in the Genus database with same CATH homology
 3CCS 1;  1QYP A;  3F3F C;  1KD1 2;  2F4M A;  1X0T A;  3S2H I;  2J6A A;  2V8J A;  2R6M A;  3BG1 B;  1Q7Y 1;  2NVQ I;  1JWH C;  4E2Y A;  1YIJ Z;  2LFU A;  3EER A;  4BBR I;  3Q87 A;  3GTK I;  2OZK A;  2JA7 I;  4MD8 A;  3BG0 B;  4BXX I;  1QVF Z;  1YJN Z;  1K73 2;  4QTT A;  4DK1 A;  1WW9 A;  3CCJ Z;  2JA6 I;  1KQS Y;  2OTL Z;  1K83 I;  1KRL A;  3CCV 1;  3P5J B;  1RO0 A;  1KD1 1;  3FKI I;  5A2Q b;  2YU9 I;  4RVH A;  3CMA 1;  1VQ6 1;  2OTJ Z;  1RLY A;  2JA5 I;  3S16 I;  1QVG Y;  2RIQ A;  3J81 b;  3CCM Z;  2NVY I;  3I55 Z;  3CC4 Z;  3CD6 1;  4A93 I;  4BBS I;  4CL1 A;  1Q82 2;  1USP B;  3HOY I;  1WII A;  1YUK A;  3HOZ I;  2W04 A;  1K73 1;  4AYB A;  1VQ8 1;  1YI2 1;  3M3Y I;  5IT9 b;  1VQN 1;  2V8I A;  1ZB8 A;  1YHQ 1;  3J7A 4;  5FLX b;  3CCL 1;  5D1O B;  3H3V J;  3VMG A;  3H0G I;  2R93 I;  1RO4 A;  3G4S Z;  2E2J I;  4A3L I;  3CXC Z;  2LIY A;  4A3E I;  3LUS A;  4E33 A;  2P3Y A;  2BJO A;  2GTI A;  3S14 I;  2VUG A;  1YIT Z;  3IX0 A;  4Y52 I;  3VTN A;  1Q82 1;  3GTJ I;  2E9H A;  1VQL 1;  1I50 I;  1YJ9 1;  4NOZ A;  1S7M A;  3CCE 1;  1TWH I;  3PO2 I;  4MRI A;  3PO3 I;  3OW2 Y;  3S17 I;  1K8A 2;  1VQ5 Z;  3G6E 1;  3TDH B;  1JJ2 Y;  3NH4 A;  1VQM Z;  1W2B Z;  1L1O C;  4A3F I;  2QRC B;  4E2Z A;  4X6A I;  2HF1 A;  3D9X A;  3CME 1;  3JAM f;  3J80 f;  2YAD A;  3CC7 1;  5C4J I;  3RZD I;  5C4X I;  4MH4 A;  2NVX I;  1X3Z A;  1M1K 2;  4RVG A;  2R7Z I;  3CCQ 1;  2QRD B;  1Y1V S;  1ZH1 A;  4DQY B;  1K9M 2;  2GTH A;  5FLM I;  3CCU Z;  1K8A 1;  1VQK Z;  3HOW I;  2Y0S A;  3IFU A;  1S72 Z;  2IZ3 A;  1VQ9 1;  1RNI A;  4E2W A;  3CCS Z;  5T6B A;  4EWC A;  1YJW 1;  3S15 I;  3CPW Z;  1VQ7 1;  4HGZ A;  4NBC A;  2EGT A;  1VQ4 1;  3PO3 S;  3FQQ A;  2RT9 A;  3CC2 1;  4RVF A;  1TWC I;  3CQZ I;  2B63 I;  4NBB A;  2DE6 A;  4A3M I;  2HU9 A;  2QEX 1;  1Q81 2;  1ZB9 A;  1Z02 A;  1NJI 2;  5LL6 f;  3KIH A;  3J81 f;  3GTO I;  3CCV Z;  1Q86 2;  3CMA Z;  1Y1V I;  1VQ6 Z;  3S1R I;  1Y1W I;  1I3Q I;  1VQP 1;  1TWA I;  4DGL A;  3I4N I;  5D1P A;  3RZO I;  2DE5 A;  5T67 A;  3I56 1;  2QR1 B;  2WB1 A;  3CCR 1;  2RHB A;  5C44 I;  3VMI A;  3CD6 Z;  5FLX f;  2QKD A;  2G2K A;  2OOX B;  3GTG I;  3T4N B;  4A3K I;  1WCM I;  3HKZ A;  1Q81 1;  1R9T I;  2JMO A;  1VQ8 Z;  1PFT A;  1NJI 1;  4BY1 I;  1VQN Z;  1KC8 2;  4NBD A;  3S2D I;  1YHQ Z;  4MD9 A;  1KQS Z;  2JS4 A;  4A3I I;  1Q86 1;  3CCL Z;  3F3P C;  1USP A;  2RBL A;  2E2H I;  2Q51 A;  1M90 2;  5IP7 I;  4E31 A;  1QVF Y;  3G71 1;  1QVG Z;  4A3D I;  1VQO 1;  2QA4 1;  3VMH A;  3S1M I;  5D1O A;  1P9N A;  4NFR A;  1VQL Z;  1Z01 A;  3NFZ A;  1YJ9 Z;  3I4M I;  4NBA A;  4S1T A;  3CCE Z;  2GU2 A;  4NBG A;  1N8R 2;  2DE7 A;  1KC8 1;  1YIJ 1;  1LQL A;  3GTP I;  3KIF A;  3G6E Z;  3NH5 A;  2KI7 B;  2I3C A;  2O53 A;  3GTL I;  3ESW A;  3MON A;  3VB9 A;  5T64 A;  4QTU A;  2JUB A;  3NDI A;  4HGY A;  4NB8 A;  2M48 A;  1M90 1;  4HH4 A;  2P28 A;  3CME Z;  1VLA A;  3HOU I;  2RPR A;  2NVT I;  2JNY A;  3GTM S;  3CC7 Z;  1YJN 1;  4XX2 A;  4E32 A;  4BY7 I;  5C3E I;  4RVD A;  3U50 C;  4MON A;  3MZK B;  3CCJ 1;  1NP6 A;  2OTL 1;  3NDJ A;  2OOY B;  3CCQ Z;  3D6W A;  4NB9 A;  2V8K A;  2K3R A;  1M1K 1;  1I6H I;  1SFO I;  1Z03 A;  1N8R 1;  2OTJ 1;  2PMZ A;  3OW2 Z;  3CXC Y;  1TWF I;  2Q4Z A;  3IF8 A;  4A3G I;  1K9M 1;  1JJ2 Z;  1VQ9 Z;  3CCM 1;  5A2Q f;  3I55 1;  4A3J I;  3CC4 1;  3MZL B;  4NH1 C;  1YJW Z;  1TWG I;  3TE5 B;  2PM9 A;  4NBE A;  1VQ7 Z;  2W03 A;  5IP9 I;  1RQF A;  5AN9 F;  3FQM A;  3QWU A;  1NUI A;  1VQ4 Z;  4NBF A;  3GTQ I;  3EED A;  1W2B Y;  3CC2 Z;  2JR6 A;  1DL6 A;  2K5R A;  2WAQ A;  5IT9 f;  3G4S 1;  4A3C I;  2QEX Z;  4RS4 A;  3GKQ A;  2R92 I;  1QF8 A;  3GTM I;  4E2X A;  3HOV I;  2F4O A;  4Y7N I;  3HOX I;  1YIT 1;  3M4O I;  2AKL A;  1YI2 Z;  2VUM I;  4MXU A;  1RO2 A;  4RV9 A;  1VQP Z;  2VF1 A;  3S1Q I;  1VQ5 1;  2E2I I;  1YUA A;  3I56 Z;  4A3B I;  3CCR Z;  2QLV B;  1ML8 A;  1VQM 1;  4E30 A;  2QRE B;  2ZAE B;  2M6N A;  3I07 A;  3CPW Y;  3GCF A;  2KPI A;  1Q7Y 2;  2H85 A;  2PK7 A;  3NH8 A;  3K7A I;  4MD7 A;  5CM2 M;  3S1N I;  3JAM b;  3J80 b;  3CCU 1;  4TNU A;  2O4H A;  4NBH A;  3G71 Z;  1TFI A;  1X3W A;  1VQK 1;  1N2F A;  1S72 1;  1VQO Z;  2IZ4 A;  2JA8 I;  2QA4 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...