3J81f

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
69
structure length
69
Chain Sequence
KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHSTFATQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 2
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF00240 ubiquitin Ubiquitin family
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.660 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3j81f00
5A2Qf 3J81f 5FLXf 5IT9f 3J80f 3JAMf
chains in the Genus database with same CATH superfamily
4HH4A 1YIJZ 3NDIA 3CPWZ 1VQ6Z 3GTOI 3CQZI 4QTTA 2J6AA 2QKDA 3IF8A 1VQO1 2JA6I 3J81b 5C4JI 4NBEA 1Q7Y1 3CC21 4AYBA 1M902 4MD8A 2M6NA 4NBGA 3H0GI 4CL1A 1VQM1 4A3BI 3IX0A 4X6AI 2IZ3A 3GTJI 3CCS1 4MD9A 3PO3S 2QEX1 1L1OC 4NBCA 3S1NI 3LUSA 4A3GI 3CD6Z 1TWFI 1VQL1 4DK1A 1P9NA 1ZB9A 2M48A 4TNUA 1YI2Z 2JIQA 3I561 1W2BZ 1N2FA 4NBHA 5CM2M 1VQN1 1KD11 3CCJ1 2O4HA 3CME1 2V8JA 3NDJA 5FLXb 2LIYA 2E2JI 2QRDB 4BY7I 1ZB8A 4S1TA 3HOYI 5C44I 1KC81 4NFRA 3GTQI 2AYDA 2K3RA 1VLAA 2E7ZA 2RIQA 2JR6A 1RLYA 2Q4ZA 4MH4A 4HGYA 3U50C 2OTJZ 2NVXI 3HKZA 3JAMb 1QYPA 1K8A2 2V3VA 1K732 2BJOA 4MD7A 3CCQ1 1S721 4A93I 2HF1A 1VQP1 2OTLZ 4A3EI 3I55Z 2JIMA 3H3VJ 1DL6A 4XX2A 2VUGA 3KIHA 1VQ41 1RQFA 1VQ9Z 3S2HI 1Q16A 1YJ9Z 4A3JI 4A3DI 3CCRZ 4A3MI 1WIIA 1JWHC 3PO2I 3CCEZ 2B63I 1FDIA 1Y1VI 3GCFA 3G6EZ 1VQ5Z 3KIFA 2VPYA 2R7ZI 1I50I 3ESWA 3I4NI 4QTUA 5LL6f 2F4MA 4MXUA 2KPIA 4E30A 3CC71 1K9M2 3I07A 5T67A 2Y0SA 3CCU1 1TWHI 1WZNA 3HOVI 4DGLA 3G711 3J81f 1K83I 1KQSY 1ZH1A 3VB9A 1VQKZ 2NVYI 2RPRA 1YJNZ 2JA7I 1SFOI 2IV2X 1YHQ1 2JA8I 3GTPI 4Y7NI 2W03A 3BG1B 2ZAEB 1VQOZ 3S1RI 3FQQA 4E2XA 1AA6A 2RBLA 5FLXf 2QREB 1N8R1 1PFTA 4A3FI 2KI7B 2PM9A 4EWCA 1JJ2Z 1Z01A 2RT9A 3EEDA 1Q862 2V8IA 3D2LA 3CCSZ 3IR7A 1Q821 2V45A 3JAMf 2R92I 2GU2A 3D6WA 1YI21 1X0TA 1K731 3CCL1 1NJI2 1RO0A 4MRIA 3NFZA 1YIT1 1VQLZ 1ML8A 1M1K2 3VTNA 3GTKI 2JMOA 2JIOA 4RVFA 1VQ81 4E2YA 4NBBA 2AKLA 2QRCB 3GKQA 1YJW1 1WCMI 3M4OI 1QVFY 1I3QI 4NBAA 3J7A4 3VMGA 1R9TI 3FKII 3TE5B 5AN9F 3HOZI 3S2DI 2JNYA 2R93I 3I551 3OW2Y 3CC4Z 1KD12 1VQPZ 3NH4A 3S16I 3HOUI 1YUKA 1FDOA 1Y1VS 2E9HA 3F3PC 3J80b 1S7MA 3RZOI 1KC82 2JIRA 1VQ71 1VQ4Z 2Q51A 2E2II 3TDHB 1K9M1 1WW9A 1YJ91 1QVGY 3HOXI 1Q811 3CCV1 4BBSI 2I3CA 3CPWY 2EGTA 3G6E1 3CCM1 5D1OA 1VQ51 2QA41 5D1OB 3GTMI 3CMA1 3MZLB 1TFIA 3G4S1 4A3CI 5T64A 1YUAA 4NBDA 1QF8A 2NVQI 4RVDA 1LQLA 3OW2Z 1M901 2WAQA 3CC7Z 1QXFA 3NH8A 3F3FC 2WB1A 1Z03A 2NAPA 3G71Z 3D9XA 3M3YI 1Y1WI 2OZKA 1VQK1 1YIJ1 2GTIA 1VQ61 1X3ZA 1KRLA 3HOWI 1W2BY 1QVGZ 1I6HI 2W04A 2VUMI 1Q861 5T6BA 1YHQZ 2H85A 1SIWA 4A3LI 5A2Qb 1NJI1 2JIPA 5IT9b 3CC2Z 2VPWA 4E2ZA 4A3KI 2YADA 1M1K1 2YU9I 1VQMZ 2VPXA 2F4OA 5C4XI 2DE7A 4NB9A 4RVHA 3CD61 4BBRI 2QEXZ 1KQSZ 1K8A1 5IP9I 4HGZA 4E32A 3I56Z 3S1MI 2OOYB 1Q7Y2 1VQNZ 3CCJZ 1TWAI 3CMEZ 4RS4A 3CCLZ 2VF1A 4E33A 3EERA 2LEXA 1YITZ 2PK7A 2QR1B 1RO2A 2JUBA 2NVTI 4BXXI 2VPZA 3PO3I 2O53A 2OTJ1 4RV9A 5IP7I 4E2WA 1X3WA 3CXCY 4NH1C 1VQ8Z 3J80f 1N8R2 2HU9A 5FLMI 3RZDI 5D1PA 2JA5I 3S14I 2OTL1 3CCQZ 1YJWZ 2LFUA 3P5JB 1S72Z 2GTHA 2P28A 3QWUA 2K5RA 1Q822 4DQYB 1RNIA 4RVGA 3K7AI 4MONA 3CC41 1NP6A 3NH5A 1TWCI 1NUIA 3MZKB 1VQ91 2QLVB 3GTMS 2JS4A 2E2HI 2DE5A 3VMIA 1TWGI 4A3II 1VQ7Z 3MONA 3CCR1 1Z02A 3CCE1 3S17I 4E31A 2G2KA 2P3YA 1QVFZ 3CXCZ 2OOXB 3CCVZ 1USPA 1WJ2A 2R6MA 2V8KA 2IZ4A 1USPB 3T4NB 3I4MI 3CCMZ 2QA4Z 3VMHA 2DE6A 3CMAZ 3G4SZ 4NB8A 2PMZA 3CCUZ 2RHBA 4BY1I 5C3EI 3IFUA 5A2Qf 3S15I 4NBFA 3Q87A 1JJ2Y 1Q812 5IT9f 3FQMA 1YJN1 3GTLI 1Y8CA 4NOZA 3S1QI 4Y52I 3GTGI 3BG0B 1RO4A
chains in the Genus database with same CATH topology
4HH4A 1YIJZ 3NDIA 3CPWZ 1VQ6Z 3GTOI 3CQZI 4QTTA 2J6AA 2QKDA 3IF8A 1VQO1 2JA6I 3J81b 5C4JI 4NBEA 1Q7Y1 3CC21 4AYBA 1M902 4MD8A 2M6NA 4NBGA 3H0GI 4CL1A 1VQM1 4A3BI 3IX0A 4X6AI 2IZ3A 3GTJI 3CCS1 4MD9A 3PO3S 2QEX1 1L1OC 4NBCA 3S1NI 3LUSA 4A3GI 3CD6Z 1TWFI 1VQL1 4DK1A 1P9NA 1ZB9A 2M48A 4TNUA 1YI2Z 3I561 1W2BZ 1N2FA 4NBHA 5CM2M 1VQN1 1KD11 3CCJ1 2O4HA 3CME1 2V8JA 3NDJA 5FLXb 2LIYA 2E2JI 2QRDB 4BY7I 1ZB8A 4S1TA 3HOYI 5C44I 1KC81 4NFRA 3GTQI 2K3RA 1VLAA 2RIQA 2JR6A 1RLYA 2Q4ZA 4MH4A 4HGYA 3U50C 2OTJZ 2NVXI 3HKZA 3JAMb 1QYPA 1K8A2 1K732 2BJOA 4MD7A 3CCQ1 1S721 4A93I 2HF1A 1VQP1 2OTLZ 4A3EI 3I55Z 3H3VJ 1DL6A 4XX2A 2VUGA 3KIHA 1VQ41 1RQFA 1VQ9Z 3S2HI 1YJ9Z 4A3JI 4A3DI 3CCRZ 4A3MI 1WIIA 1JWHC 3PO2I 3CCEZ 2B63I 1Y1VI 3GCFA 3G6EZ 1VQ5Z 3KIFA 2R7ZI 1I50I 3ESWA 3I4NI 4QTUA 5LL6f 2F4MA 4MXUA 2KPIA 4E30A 3CC71 1K9M2 3I07A 5T67A 2Y0SA 3CCU1 1TWHI 3HOVI 4DGLA 3G711 3J81f 1K83I 1KQSY 1ZH1A 3VB9A 1VQKZ 2NVYI 2RPRA 1YJNZ 2JA7I 1SFOI 1YHQ1 2JA8I 3GTPI 4Y7NI 2W03A 3BG1B 2ZAEB 1VQOZ 3S1RI 3FQQA 4E2XA 2RBLA 5FLXf 2QREB 1N8R1 1PFTA 4A3FI 2KI7B 2PM9A 4EWCA 1JJ2Z 1Z01A 2RT9A 3EEDA 1Q862 2V8IA 3CCSZ 1Q821 3JAMf 2R92I 2GU2A 3D6WA 1YI21 1X0TA 1K731 3CCL1 1NJI2 1RO0A 4MRIA 3NFZA 1YIT1 1VQLZ 1ML8A 1M1K2 3VTNA 3GTKI 2JMOA 4RVFA 1VQ81 4E2YA 4NBBA 2AKLA 2QRCB 3GKQA 1YJW1 1WCMI 3M4OI 1QVFY 1I3QI 4NBAA 3J7A4 3VMGA 1R9TI 3FKII 3TE5B 5AN9F 3HOZI 3S2DI 2JNYA 2R93I 3I551 3OW2Y 3CC4Z 1KD12 1VQPZ 3NH4A 3S16I 3HOUI 1YUKA 1Y1VS 2E9HA 3F3PC 3J80b 1S7MA 3RZOI 1KC82 1VQ71 1VQ4Z 2Q51A 2E2II 3TDHB 1K9M1 1WW9A 1YJ91 1QVGY 3HOXI 1Q811 3CCV1 4BBSI 2I3CA 3CPWY 2EGTA 3G6E1 3CCM1 5D1OA 1VQ51 2QA41 5D1OB 3GTMI 3CMA1 3MZLB 1TFIA 3G4S1 4A3CI 5T64A 1YUAA 4NBDA 1QF8A 2NVQI 4RVDA 1LQLA 3OW2Z 1M901 2WAQA 3CC7Z 3NH8A 3F3FC 2WB1A 1Z03A 3G71Z 3D9XA 3M3YI 1Y1WI 2OZKA 1VQK1 1YIJ1 2GTIA 1VQ61 1X3ZA 1KRLA 3HOWI 1W2BY 1QVGZ 1I6HI 2W04A 2VUMI 1Q861 5T6BA 1YHQZ 2H85A 4A3LI 5A2Qb 1NJI1 5IT9b 3CC2Z 4E2ZA 4A3KI 2YADA 1M1K1 2YU9I 1VQMZ 5C4XI 2F4OA 2DE7A 4NB9A 4RVHA 3CD61 4BBRI 2QEXZ 1KQSZ 1K8A1 5IP9I 4HGZA 4E32A 3I56Z 3S1MI 2OOYB 1Q7Y2 1VQNZ 3CCJZ 1TWAI 3CMEZ 4RS4A 3CCLZ 2VF1A 4E33A 3EERA 1YITZ 2PK7A 2QR1B 1RO2A 2JUBA 2NVTI 4BXXI 3PO3I 2O53A 2OTJ1 4RV9A 5IP7I 4E2WA 1X3WA 3CXCY 4NH1C 1VQ8Z 3J80f 1N8R2 2HU9A 5FLMI 3RZDI 5D1PA 2JA5I 3S14I 2OTL1 3CCQZ 1YJWZ 2LFUA 3P5JB 1S72Z 2GTHA 2P28A 3QWUA 2K5RA 1Q822 4DQYB 1RNIA 4RVGA 3K7AI 4MONA 3CC41 1NP6A 3NH5A 1TWCI 1NUIA 3MZKB 1VQ91 2QLVB 3GTMS 2JS4A 2E2HI 2DE5A 3VMIA 1TWGI 4A3II 1VQ7Z 3MONA 1Z02A 3CCR1 3CCE1 3S17I 4E31A 2G2KA 2P3YA 1QVFZ 3CXCZ 2OOXB 3CCVZ 1USPA 2R6MA 2V8KA 2IZ4A 1USPB 3T4NB 3I4MI 3CCMZ 2QA4Z 3VMHA 2DE6A 3CMAZ 3G4SZ 4NB8A 2PMZA 3CCUZ 2RHBA 4BY1I 5C3EI 3IFUA 5A2Qf 3S15I 4NBFA 3Q87A 1JJ2Y 1Q812 5IT9f 3FQMA 1YJN1 3GTLI 4NOZA 3S1QI 4Y52I 3GTGI 3BG0B 1RO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q f;  3J81 f;  5FLX f;  5IT9 f;  3J80 f;  3JAM f; 
#chains in the Genus database with same CATH topology
 4HH4 A;  1YIJ Z;  3NDI A;  3CPW Z;  1VQ6 Z;  3GTO I;  3CQZ I;  4QTT A;  2J6A A;  2QKD A;  3IF8 A;  1VQO 1;  2JA6 I;  3J81 b;  5C4J I;  4NBE A;  1Q7Y 1;  3CC2 1;  4AYB A;  1M90 2;  4MD8 A;  2M6N A;  4NBG A;  3H0G I;  4CL1 A;  1VQM 1;  4A3B I;  3IX0 A;  4X6A I;  2IZ3 A;  3GTJ I;  3CCS 1;  4MD9 A;  3PO3 S;  2QEX 1;  1L1O C;  4NBC A;  3S1N I;  3LUS A;  4A3G I;  3CD6 Z;  1TWF I;  1VQL 1;  4DK1 A;  1P9N A;  1ZB9 A;  2M48 A;  4TNU A;  1YI2 Z;  2JIQ A;  3I56 1;  1W2B Z;  1N2F A;  4NBH A;  5CM2 M;  1VQN 1;  1KD1 1;  3CCJ 1;  2O4H A;  3CME 1;  2V8J A;  3NDJ A;  5FLX b;  2LIY A;  2E2J I;  2QRD B;  4BY7 I;  1ZB8 A;  4S1T A;  3HOY I;  5C44 I;  1KC8 1;  4NFR A;  3GTQ I;  2AYD A;  2K3R A;  1VLA A;  2E7Z A;  2RIQ A;  2JR6 A;  1RLY A;  2Q4Z A;  4MH4 A;  4HGY A;  3U50 C;  2OTJ Z;  2NVX I;  3HKZ A;  3JAM b;  1QYP A;  1K8A 2;  2V3V A;  1K73 2;  2BJO A;  4MD7 A;  3CCQ 1;  1S72 1;  4A93 I;  2HF1 A;  1VQP 1;  2OTL Z;  4A3E I;  3I55 Z;  2JIM A;  3H3V J;  1DL6 A;  4XX2 A;  2VUG A;  3KIH A;  1VQ4 1;  1RQF A;  1VQ9 Z;  3S2H I;  1Q16 A;  1YJ9 Z;  4A3J I;  4A3D I;  3CCR Z;  4A3M I;  1WII A;  1JWH C;  3PO2 I;  3CCE Z;  2B63 I;  1FDI A;  1Y1V I;  3GCF A;  3G6E Z;  1VQ5 Z;  3KIF A;  2VPY A;  2R7Z I;  1I50 I;  3ESW A;  3I4N I;  4QTU A;  5LL6 f;  2F4M A;  4MXU A;  2KPI A;  4E30 A;  3CC7 1;  1K9M 2;  3I07 A;  5T67 A;  2Y0S A;  3CCU 1;  1TWH I;  1WZN A;  3HOV I;  4DGL A;  3G71 1;  3J81 f;  1K83 I;  1KQS Y;  1ZH1 A;  3VB9 A;  1VQK Z;  2NVY I;  2RPR A;  1YJN Z;  2JA7 I;  1SFO I;  2IV2 X;  1YHQ 1;  2JA8 I;  3GTP I;  4Y7N I;  2W03 A;  3BG1 B;  2ZAE B;  1VQO Z;  3S1R I;  3FQQ A;  4E2X A;  1AA6 A;  2RBL A;  5FLX f;  2QRE B;  1N8R 1;  1PFT A;  4A3F I;  2KI7 B;  2PM9 A;  4EWC A;  1JJ2 Z;  1Z01 A;  2RT9 A;  3EED A;  1Q86 2;  2V8I A;  3D2L A;  3CCS Z;  3IR7 A;  1Q82 1;  2V45 A;  3JAM f;  2R92 I;  2GU2 A;  3D6W A;  1YI2 1;  1X0T A;  1K73 1;  3CCL 1;  1NJI 2;  1RO0 A;  4MRI A;  3NFZ A;  1YIT 1;  1VQL Z;  1ML8 A;  1M1K 2;  3VTN A;  3GTK I;  2JMO A;  2JIO A;  4RVF A;  1VQ8 1;  4E2Y A;  4NBB A;  2AKL A;  2QRC B;  3GKQ A;  1YJW 1;  1WCM I;  3M4O I;  1QVF Y;  1I3Q I;  4NBA A;  3J7A 4;  3VMG A;  1R9T I;  3FKI I;  3TE5 B;  5AN9 F;  3HOZ I;  3S2D I;  2JNY A;  2R93 I;  3I55 1;  3OW2 Y;  3CC4 Z;  1KD1 2;  1VQP Z;  3NH4 A;  3S16 I;  3HOU I;  1YUK A;  1FDO A;  1Y1V S;  2E9H A;  3F3P C;  3J80 b;  1S7M A;  3RZO I;  1KC8 2;  2JIR A;  1VQ7 1;  1VQ4 Z;  2Q51 A;  2E2I I;  3TDH B;  1K9M 1;  1WW9 A;  1YJ9 1;  1QVG Y;  3HOX I;  1Q81 1;  3CCV 1;  4BBS I;  2I3C A;  3CPW Y;  2EGT A;  3G6E 1;  3CCM 1;  5D1O A;  1VQ5 1;  2QA4 1;  5D1O B;  3GTM I;  3CMA 1;  3MZL B;  1TFI A;  3G4S 1;  4A3C I;  5T64 A;  1YUA A;  4NBD A;  1QF8 A;  2NVQ I;  4RVD A;  1LQL A;  3OW2 Z;  1M90 1;  2WAQ A;  3CC7 Z;  1QXF A;  3NH8 A;  3F3F C;  2WB1 A;  1Z03 A;  2NAP A;  3G71 Z;  3D9X A;  3M3Y I;  1Y1W I;  2OZK A;  1VQK 1;  1YIJ 1;  2GTI A;  1VQ6 1;  1X3Z A;  1KRL A;  3HOW I;  1W2B Y;  1QVG Z;  1I6H I;  2W04 A;  2VUM I;  1Q86 1;  5T6B A;  1YHQ Z;  2H85 A;  1SIW A;  4A3L I;  5A2Q b;  1NJI 1;  2JIP A;  5IT9 b;  3CC2 Z;  2VPW A;  4E2Z A;  4A3K I;  2YAD A;  1M1K 1;  2YU9 I;  1VQM Z;  2VPX A;  2F4O A;  5C4X I;  2DE7 A;  4NB9 A;  4RVH A;  3CD6 1;  4BBR I;  2QEX Z;  1KQS Z;  1K8A 1;  5IP9 I;  4HGZ A;  4E32 A;  3I56 Z;  3S1M I;  2OOY B;  1Q7Y 2;  1VQN Z;  3CCJ Z;  1TWA I;  3CME Z;  4RS4 A;  3CCL Z;  2VF1 A;  4E33 A;  3EER A;  2LEX A;  1YIT Z;  2PK7 A;  2QR1 B;  1RO2 A;  2JUB A;  2NVT I;  4BXX I;  2VPZ A;  3PO3 I;  2O53 A;  2OTJ 1;  4RV9 A;  5IP7 I;  4E2W A;  1X3W A;  3CXC Y;  4NH1 C;  1VQ8 Z;  3J80 f;  1N8R 2;  2HU9 A;  5FLM I;  3RZD I;  5D1P A;  2JA5 I;  3S14 I;  2OTL 1;  3CCQ Z;  1YJW Z;  2LFU A;  3P5J B;  1S72 Z;  2GTH A;  2P28 A;  3QWU A;  2K5R A;  1Q82 2;  4DQY B;  1RNI A;  4RVG A;  3K7A I;  4MON A;  3CC4 1;  1NP6 A;  3NH5 A;  1TWC I;  1NUI A;  3MZK B;  1VQ9 1;  2QLV B;  3GTM S;  2JS4 A;  2E2H I;  2DE5 A;  3VMI A;  1TWG I;  4A3I I;  1VQ7 Z;  3MON A;  3CCR 1;  1Z02 A;  3CCE 1;  3S17 I;  4E31 A;  2G2K A;  2P3Y A;  1QVF Z;  3CXC Z;  2OOX B;  3CCV Z;  1USP A;  1WJ2 A;  2R6M A;  2V8K A;  2IZ4 A;  1USP B;  3T4N B;  3I4M I;  3CCM Z;  2QA4 Z;  3VMH A;  2DE6 A;  3CMA Z;  3G4S Z;  4NB8 A;  2PMZ A;  3CCU Z;  2RHB A;  4BY1 I;  5C3E I;  3IFU A;  5A2Q f;  3S15 I;  4NBF A;  3Q87 A;  1JJ2 Y;  1Q81 2;  5IT9 f;  3FQM A;  1YJN 1;  3GTL I;  1Y8C A;  4NOZ A;  3S1Q I;  4Y52 I;  3GTG I;  3BG0 B;  1RO4 A; 
#chains in the Genus database with same CATH homology
 4HH4 A;  1YIJ Z;  3NDI A;  3CPW Z;  1VQ6 Z;  3GTO I;  3CQZ I;  4QTT A;  2J6A A;  2QKD A;  3IF8 A;  1VQO 1;  2JA6 I;  3J81 b;  5C4J I;  4NBE A;  1Q7Y 1;  3CC2 1;  4AYB A;  1M90 2;  4MD8 A;  2M6N A;  4NBG A;  3H0G I;  4CL1 A;  1VQM 1;  4A3B I;  3IX0 A;  4X6A I;  2IZ3 A;  3GTJ I;  3CCS 1;  4MD9 A;  3PO3 S;  2QEX 1;  1L1O C;  4NBC A;  3S1N I;  3LUS A;  4A3G I;  3CD6 Z;  1TWF I;  1VQL 1;  4DK1 A;  1P9N A;  1ZB9 A;  2M48 A;  4TNU A;  1YI2 Z;  3I56 1;  1W2B Z;  1N2F A;  4NBH A;  5CM2 M;  1VQN 1;  1KD1 1;  3CCJ 1;  2O4H A;  3CME 1;  2V8J A;  3NDJ A;  5FLX b;  2LIY A;  2E2J I;  2QRD B;  4BY7 I;  1ZB8 A;  4S1T A;  3HOY I;  5C44 I;  1KC8 1;  4NFR A;  3GTQ I;  2K3R A;  1VLA A;  2RIQ A;  2JR6 A;  1RLY A;  2Q4Z A;  4MH4 A;  4HGY A;  3U50 C;  2OTJ Z;  2NVX I;  3HKZ A;  3JAM b;  1QYP A;  1K8A 2;  1K73 2;  2BJO A;  4MD7 A;  3CCQ 1;  1S72 1;  4A93 I;  2HF1 A;  1VQP 1;  2OTL Z;  4A3E I;  3I55 Z;  3H3V J;  1DL6 A;  4XX2 A;  2VUG A;  3KIH A;  1VQ4 1;  1RQF A;  1VQ9 Z;  3S2H I;  1YJ9 Z;  4A3J I;  4A3D I;  3CCR Z;  4A3M I;  1WII A;  1JWH C;  3PO2 I;  3CCE Z;  2B63 I;  1Y1V I;  3GCF A;  3G6E Z;  1VQ5 Z;  3KIF A;  2R7Z I;  1I50 I;  3ESW A;  3I4N I;  4QTU A;  5LL6 f;  2F4M A;  4MXU A;  2KPI A;  4E30 A;  3CC7 1;  1K9M 2;  3I07 A;  5T67 A;  2Y0S A;  3CCU 1;  1TWH I;  3HOV I;  4DGL A;  3G71 1;  3J81 f;  1K83 I;  1KQS Y;  1ZH1 A;  3VB9 A;  1VQK Z;  2NVY I;  2RPR A;  1YJN Z;  2JA7 I;  1SFO I;  1YHQ 1;  2JA8 I;  3GTP I;  4Y7N I;  2W03 A;  3BG1 B;  2ZAE B;  1VQO Z;  3S1R I;  3FQQ A;  4E2X A;  2RBL A;  5FLX f;  2QRE B;  1N8R 1;  1PFT A;  4A3F I;  2KI7 B;  2PM9 A;  4EWC A;  1JJ2 Z;  1Z01 A;  2RT9 A;  3EED A;  1Q86 2;  2V8I A;  3CCS Z;  1Q82 1;  3JAM f;  2R92 I;  2GU2 A;  3D6W A;  1YI2 1;  1X0T A;  1K73 1;  3CCL 1;  1NJI 2;  1RO0 A;  4MRI A;  3NFZ A;  1YIT 1;  1VQL Z;  1ML8 A;  1M1K 2;  3VTN A;  3GTK I;  2JMO A;  4RVF A;  1VQ8 1;  4E2Y A;  4NBB A;  2AKL A;  2QRC B;  3GKQ A;  1YJW 1;  1WCM I;  3M4O I;  1QVF Y;  1I3Q I;  4NBA A;  3J7A 4;  3VMG A;  1R9T I;  3FKI I;  3TE5 B;  5AN9 F;  3HOZ I;  3S2D I;  2JNY A;  2R93 I;  3I55 1;  3OW2 Y;  3CC4 Z;  1KD1 2;  1VQP Z;  3NH4 A;  3S16 I;  3HOU I;  1YUK A;  1Y1V S;  2E9H A;  3F3P C;  3J80 b;  1S7M A;  3RZO I;  1KC8 2;  1VQ7 1;  1VQ4 Z;  2Q51 A;  2E2I I;  3TDH B;  1K9M 1;  1WW9 A;  1YJ9 1;  1QVG Y;  3HOX I;  1Q81 1;  3CCV 1;  4BBS I;  2I3C A;  3CPW Y;  2EGT A;  3G6E 1;  3CCM 1;  5D1O A;  1VQ5 1;  2QA4 1;  5D1O B;  3GTM I;  3CMA 1;  3MZL B;  1TFI A;  3G4S 1;  4A3C I;  5T64 A;  1YUA A;  4NBD A;  1QF8 A;  2NVQ I;  4RVD A;  1LQL A;  3OW2 Z;  1M90 1;  2WAQ A;  3CC7 Z;  3NH8 A;  3F3F C;  2WB1 A;  1Z03 A;  3G71 Z;  3D9X A;  3M3Y I;  1Y1W I;  2OZK A;  1VQK 1;  1YIJ 1;  2GTI A;  1VQ6 1;  1X3Z A;  1KRL A;  3HOW I;  1W2B Y;  1QVG Z;  1I6H I;  2W04 A;  2VUM I;  1Q86 1;  5T6B A;  1YHQ Z;  2H85 A;  4A3L I;  5A2Q b;  1NJI 1;  5IT9 b;  3CC2 Z;  4E2Z A;  4A3K I;  2YAD A;  1M1K 1;  2YU9 I;  1VQM Z;  5C4X I;  2F4O A;  2DE7 A;  4NB9 A;  4RVH A;  3CD6 1;  4BBR I;  2QEX Z;  1KQS Z;  1K8A 1;  5IP9 I;  4HGZ A;  4E32 A;  3I56 Z;  3S1M I;  2OOY B;  1Q7Y 2;  1VQN Z;  3CCJ Z;  1TWA I;  3CME Z;  4RS4 A;  3CCL Z;  2VF1 A;  4E33 A;  3EER A;  1YIT Z;  2PK7 A;  2QR1 B;  1RO2 A;  2JUB A;  2NVT I;  4BXX I;  3PO3 I;  2O53 A;  2OTJ 1;  4RV9 A;  5IP7 I;  4E2W A;  1X3W A;  3CXC Y;  4NH1 C;  1VQ8 Z;  3J80 f;  1N8R 2;  2HU9 A;  5FLM I;  3RZD I;  5D1P A;  2JA5 I;  3S14 I;  2OTL 1;  3CCQ Z;  1YJW Z;  2LFU A;  3P5J B;  1S72 Z;  2GTH A;  2P28 A;  3QWU A;  2K5R A;  1Q82 2;  4DQY B;  1RNI A;  4RVG A;  3K7A I;  4MON A;  3CC4 1;  1NP6 A;  3NH5 A;  1TWC I;  1NUI A;  3MZK B;  1VQ9 1;  2QLV B;  3GTM S;  2JS4 A;  2E2H I;  2DE5 A;  3VMI A;  1TWG I;  4A3I I;  1VQ7 Z;  3MON A;  1Z02 A;  3CCR 1;  3CCE 1;  3S17 I;  4E31 A;  2G2K A;  2P3Y A;  1QVF Z;  3CXC Z;  2OOX B;  3CCV Z;  1USP A;  2R6M A;  2V8K A;  2IZ4 A;  1USP B;  3T4N B;  3I4M I;  3CCM Z;  2QA4 Z;  3VMH A;  2DE6 A;  3CMA Z;  3G4S Z;  4NB8 A;  2PMZ A;  3CCU Z;  2RHB A;  4BY1 I;  5C3E I;  3IFU A;  5A2Q f;  3S15 I;  4NBF A;  3Q87 A;  1JJ2 Y;  1Q81 2;  5IT9 f;  3FQM A;  1YJN 1;  3GTL I;  4NOZ A;  3S1Q I;  4Y52 I;  3GTG I;  3BG0 B;  1RO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...