3CXCZ

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cxcZ00
1M902 1M901 1VQ51 3CPWY 3CCSZ 1YI21 1VQMZ 1Q862 3I561 1VQL1 1Q861 3CMA1 1VQOZ 1YIJ1 3CCMZ 1YJW1 1VQ91 3CXCZ 3CCL1 3G4S1 3OW2Y 1YHQ1 1VQ4Z 3CCS1 3CMEZ 1NJI2 3CC4Z 1NJI1 1VQM1 1VQ6Z 2QA4Z 1VQO1 1VQPZ 3CCM1 3CXCY 1VQK1 1M1K2 1K9M2 1M1K1 1N8R2 1K9M1 1VQ41 3CCJZ 1N8R1 3CC7Z 2OTJZ 1YJ9Z 3CME1 3CC41 1QVFZ 3G6EZ 1VQ7Z 1VQP1 1Q7Y2 2OTLZ 3CCVZ 1VQ8Z 3CCQZ 1YITZ 1S72Z 1KQSZ 3I55Z 3CCJ1 3CC71 2OTJ1 1K8A2 3G71Z 1YJ91 1K8A1 1QVFY 3G6E1 1VQ71 1Q822 2OTL1 1VQ81 3CCQ1 1Q821 1YIT1 2QEXZ 1YIJZ 1S721 1VQNZ 1KQSY 1YJWZ 3I551 1VQ61 2QA41 3CD6Z 3CCUZ 3G711 1YHQZ 1Q7Y1 1Q812 3CCEZ 1Q811 3CCRZ 1W2BY 3CC2Z 1YJNZ 1KD12 2QEX1 1QVGY 1KD11 1KC82 3CPWZ 1VQ5Z 1VQN1 1YI2Z 1KC81 1VQKZ 1JJ2Y 3CD61 3CCU1 3I56Z 1K732 1VQLZ 1W2BZ 3CMAZ 1K731 3CCE1 3CCV1 3CCR1 1QVGZ 1VQ9Z 3CCLZ 1JJ2Z 3G4SZ 3OW2Z 3CC21 1YJN1
chains in the Genus database with same CATH superfamily
1WCMI 1M902 1RQFA 2JMOA 1JWHC 5IT9b 5CM2M 2R93I 3I561 2V8KA 1VQOZ 2R6MA 1TWFI 4A3DI 3HOWI 4A3JI 2QRCB 3G4S1 2JR6A 1I3QI 3GTLI 4E2ZA 3Q87A 1USPA 2W04A 1TWHI 3NH8A 3HOXI 2JS4A 2E2HI 1VQ6Z 1RO4A 4E31A 1VQO1 3BG0B 4DGLA 1RO2A 2IZ4A 3IF8A 1VQK1 2F4MA 2WAQA 4MH4A 2V3VA 2NVTI 1N2FA 1M1K1 3S2HI 2BJOA 3VTNA 2OTJZ 4Y52I 3S16I 3MZKB 3NH5A 2JIMA 1TWAI 5T6BA 2JA6I 3IX0A 4NB8A 3J7A4 1K83I 1RO0A 4A3EI 2HF1A 2QR1B 1S72Z 2LIYA 4NB9A 3S17I 2OTJ1 1ML8A 1K8A2 4BY1I 2WB1A 3MZLB 1WJ2A 3S1QI 3P5JB 4A3II 1WIIA 2JA8I 2F4OA 2V8JA 1YIJZ 4E2XA 1S721 3HOYI 5C4JI 1YJWZ 2QA41 4MONA 5D1OA 2GTIA 4QTUA 1YHQZ 2O4HA 1Q812 2RPRA 4A3BI 5IP9I 2LFUA 5C3EI 1WZNA 2JIPA 5T64A 3CC2Z 3HOUI 1KD11 3D9XA 1KC81 2YADA 3VMHA 1VQLZ 1K731 1QVGZ 2QRDB 1FDOA 3GCFA 3CC21 1USPB 3CPWY 3S14I 2VPYA 3CQZI 1Q862 1Z01A 3F3PC 1VQL1 3S2DI 3D6WA 4RVFA 1Z03A 2OZKA 2I3CA 4S1TA 3F3FC 1NJI1 4NFRA 4MD9A 2M6NA 2RBLA 4AYBA 2JIQA 1I6HI 3S1NI 1YUAA 1YUKA 3CXCY 4NBFA 3GTKI 3I07A 1K9M2 4MXUA 4BBRI 1N8R2 2DE7A 2NVQI 5FLXf 1I50I 3CC7Z 4A3KI 3TDHB 1YJ9Z 3NDIA 4E33A 2J6AA 2JNYA 3CCVZ 4E32A 2E9HA 4BY7I 2K3RA 5D1OB 3LUSA 4DK1A 3J81b 5IT9f 3CC71 3G71Z 4HGYA 5C44I 1YJ91 4X6AI 3QWUA 2DE6A 1Q821 2QEXZ 2Y0SA 3VMIA 2B63I 1VQ61 4NBEA 4RVGA 4RVHA 2PM9A 2QREB 2AYDA 3G711 2OOXB 4NBDA 3GTPI 2HU9A 3M4OI 1NP6A 1X3WA 4CL1A 2IZ3A 2QEX1 4A3LI 1ZB9A 1VQ5Z 3CPWZ 1YI2Z 5D1PA 2JIOA 4MD7A 4NH1C 1W2BZ 2M48A 4RS4A 4NBAA 3K7AI 2VF1A 1JJ2Z 1RLYA 1M901 1VQ51 1YI21 2LEXA 2Q4ZA 4A3MI 1YIJ1 2AKLA 1Y1WI 1YJW1 3GTGI 3CXCZ 3IR7A 5C4XI 4BBSI 4NOZA 3OW2Y 3GTJI 1YHQ1 2VUGA 1VQ4Z 3FQMA 2RHBA 4EWCA 1X0TA 3S1MI 5AN9F 2E2II 3TE5B 2RT9A 3JAMb 3M3YI 2QLVB 3EEDA 1M1K2 2E2JI 1TWCI 2R7ZI 1WW9A 1VQ41 3EERA 3GTMS 1QF8A 3PO2I 2JA5I 2P3YA 3GKQA 1VQ7Z 2NVXI 1DL6A 2RIQA 1SIWA 2YU9I 5T67A 2OTLZ 1VQ8Z 3CCQZ 3J80b 1Q16A 3I55Z 4BXXI 3S15I 3T4NB 2G2KA 1K8A1 2VUMI 4DQYB 2W03A 1QVFY 3VMGA 2GU2A 1VQ71 1AA6A 3PO3I 3NFZA 2OTL1 3HKZA 1VQ81 3CCQ1 3RZOI 2E7ZA 1TWGI 1KQSY 1PFTA 3I551 2KI7B 2O53A 1Q7Y1 1Q811 3CCRZ 4A3CI 2PK7A 2JIRA 4A3FI 1YJNZ 1KD12 3RZDI 4RVDA 1QVGY 1KC82 3GTOI 2QKDA 1VQKZ 1Y1VS 3D2LA 4NBBA 3H0GI 1K732 2OOYB 4E2WA 3CMAZ 3CCV1 2Q51A 4NBGA 4A93I 1ZB8A 2V8IA 3CCR1 1QYPA 2H85A 2NAPA 1VQ9Z 3CCLZ 1RNIA 2VPZA 3IFUA 3FQQA 3OW2Z 3GTMI 1YJN1 3J81f 3MONA 3CCSZ 1R9TI 2K5RA 1VQMZ 1P9NA 1Q861 3CMA1 4MRIA 3NH4A 3CCMZ 4HGZA 1VQ91 3CCL1 1ZH1A 3BG1B 3I4NI 1FDIA 3CCS1 2EGTA 3CMEZ 1NJI2 3CC4Z 1KRLA 1VQM1 2R92I 2QA4Z 1VQPZ 3NDJA 3PO3S 3CCM1 3FKII 1TFIA 1K9M1 3CCJZ 1N8R1 3KIHA 4HH4A 1Z02A 1QXFA 3CME1 3CC41 1QVFZ 2ZAEB 3G6EZ 2VPWA 3ESWA 1VQP1 2JA7I 1Q7Y2 1X3ZA 1Y1VI 3S1RI 2PMZA 1YITZ 1KQSZ 1Y8CA 3CCJ1 4E2YA 1SFOI 1NUIA 5IP7I 4MD8A 3GTQI 2GTHA 1LQLA 2NVYI 3G6E1 3U50C 4TNUA 4NBHA 2JUBA 1Q822 1L1OC 1S7MA 5A2Qb 1YIT1 1VQNZ 3I4MI 3CD6Z 3CCUZ 5FLMI 3CCEZ 3JAMf 2IV2X 4Y7NI 1W2BY 5LL6f 1VQN1 5FLXb 2P28A 4RV9A 1JJ2Y 3CD61 2KPIA 3CCU1 4NBCA 2V45A 5A2Qf 3I56Z 3HOVI 2VPXA 3CCE1 4XX2A 4E30A 1VLAA 3HOZI 4QTTA 4A3GI 2DE5A 3H3VJ 3G4SZ 3KIFA 3J80f 3VB9A
chains in the Genus database with same CATH topology
1WCMI 1M902 1RQFA 2JMOA 1JWHC 5IT9b 5CM2M 2R93I 3I561 2V8KA 1VQOZ 2R6MA 1TWFI 4A3DI 3HOWI 4A3JI 2QRCB 3G4S1 2JR6A 1I3QI 3GTLI 4E2ZA 3Q87A 1USPA 2W04A 1TWHI 3NH8A 3HOXI 2JS4A 2E2HI 1VQ6Z 1RO4A 4E31A 1VQO1 3BG0B 4DGLA 1RO2A 2IZ4A 3IF8A 1VQK1 2F4MA 2WAQA 4MH4A 2NVTI 1N2FA 1M1K1 3S2HI 2BJOA 3VTNA 2OTJZ 4Y52I 3S16I 3MZKB 3NH5A 1TWAI 5T6BA 2JA6I 3IX0A 4NB8A 3J7A4 1K83I 1RO0A 4A3EI 2HF1A 2QR1B 1S72Z 2LIYA 4NB9A 3S17I 2OTJ1 1ML8A 1K8A2 4BY1I 2WB1A 3MZLB 3S1QI 3P5JB 4A3II 1WIIA 2JA8I 2F4OA 2V8JA 1YIJZ 4E2XA 1S721 3HOYI 5C4JI 1YJWZ 2QA41 4MONA 5D1OA 2GTIA 4QTUA 1YHQZ 2O4HA 1Q812 2RPRA 4A3BI 5IP9I 2LFUA 5C3EI 5T64A 3CC2Z 3HOUI 1KD11 3D9XA 1KC81 2YADA 3VMHA 1VQLZ 1K731 1QVGZ 2QRDB 3GCFA 3CC21 1USPB 3CPWY 3S14I 3CQZI 1Q862 1Z01A 3F3PC 1VQL1 3S2DI 3D6WA 4RVFA 1Z03A 2OZKA 2I3CA 4S1TA 3F3FC 1NJI1 4NFRA 4MD9A 2M6NA 2RBLA 4AYBA 1I6HI 3S1NI 1YUAA 1YUKA 3CXCY 4NBFA 3GTKI 3I07A 1K9M2 4MXUA 4BBRI 1N8R2 2DE7A 2NVQI 5FLXf 1I50I 3CC7Z 4A3KI 3TDHB 1YJ9Z 3NDIA 4E33A 2J6AA 2JNYA 3CCVZ 4E32A 2E9HA 4BY7I 2K3RA 5D1OB 3LUSA 4DK1A 3J81b 5IT9f 3CC71 3G71Z 4HGYA 5C44I 1YJ91 4X6AI 3QWUA 2DE6A 1Q821 2QEXZ 2Y0SA 3VMIA 2B63I 1VQ61 4NBEA 4RVGA 4RVHA 2PM9A 2QREB 3G711 2OOXB 4NBDA 3GTPI 2HU9A 3M4OI 1NP6A 1X3WA 4CL1A 2IZ3A 2QEX1 4A3LI 1ZB9A 1VQ5Z 3CPWZ 1YI2Z 5D1PA 4MD7A 4NH1C 1W2BZ 2M48A 4RS4A 4NBAA 3K7AI 2VF1A 1JJ2Z 1RLYA 1M901 1VQ51 1YI21 2Q4ZA 4A3MI 1YIJ1 2AKLA 1Y1WI 1YJW1 3GTGI 3CXCZ 5C4XI 4BBSI 4NOZA 3OW2Y 3GTJI 1YHQ1 2VUGA 1VQ4Z 3FQMA 2RHBA 4EWCA 1X0TA 3S1MI 5AN9F 2E2II 3TE5B 2RT9A 3JAMb 3M3YI 2QLVB 3EEDA 1M1K2 2E2JI 1TWCI 2R7ZI 1WW9A 1VQ41 3EERA 3GTMS 1QF8A 3PO2I 2JA5I 2P3YA 3GKQA 1VQ7Z 2NVXI 1DL6A 2RIQA 2YU9I 5T67A 2OTLZ 1VQ8Z 3CCQZ 3J80b 3I55Z 4BXXI 3S15I 3T4NB 2G2KA 1K8A1 2VUMI 4DQYB 2W03A 1QVFY 3VMGA 2GU2A 1VQ71 3PO3I 3NFZA 2OTL1 3HKZA 1VQ81 3CCQ1 3RZOI 1TWGI 1KQSY 1PFTA 3I551 2KI7B 2O53A 1Q7Y1 1Q811 3CCRZ 4A3CI 2PK7A 4A3FI 1YJNZ 1KD12 3RZDI 4RVDA 1QVGY 1KC82 3GTOI 2QKDA 1VQKZ 1Y1VS 4NBBA 3H0GI 1K732 2OOYB 4E2WA 3CMAZ 3CCV1 2Q51A 4NBGA 4A93I 1ZB8A 2V8IA 3CCR1 1QYPA 2H85A 1VQ9Z 3CCLZ 1RNIA 3IFUA 3FQQA 3OW2Z 3GTMI 1YJN1 3J81f 3MONA 3CCSZ 1R9TI 2K5RA 1VQMZ 1P9NA 1Q861 3CMA1 4MRIA 3NH4A 3CCMZ 4HGZA 1VQ91 3CCL1 1ZH1A 3BG1B 3I4NI 3CCS1 2EGTA 3CMEZ 1NJI2 3CC4Z 1KRLA 1VQM1 2R92I 2QA4Z 1VQPZ 3NDJA 3PO3S 3CCM1 3FKII 1TFIA 1K9M1 3CCJZ 1N8R1 3KIHA 4HH4A 1Z02A 3CME1 3CC41 1QVFZ 2ZAEB 3G6EZ 3ESWA 1VQP1 2JA7I 1Q7Y2 1X3ZA 1Y1VI 3S1RI 2PMZA 1YITZ 1KQSZ 3CCJ1 4E2YA 1SFOI 1NUIA 5IP7I 4MD8A 3GTQI 2GTHA 1LQLA 2NVYI 3G6E1 3U50C 4TNUA 4NBHA 2JUBA 1Q822 1L1OC 1S7MA 5A2Qb 1YIT1 1VQNZ 3I4MI 3CD6Z 3CCUZ 5FLMI 3CCEZ 3JAMf 4Y7NI 1W2BY 5LL6f 1VQN1 5FLXb 2P28A 4RV9A 1JJ2Y 3CD61 2KPIA 3CCU1 4NBCA 5A2Qf 3I56Z 3HOVI 3CCE1 4XX2A 4E30A 1VLAA 3HOZI 4QTTA 4A3GI 2DE5A 3H3VJ 3G4SZ 3KIFA 3J80f 3VB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 2;  1M90 1;  1VQ5 1;  3CPW Y;  3CCS Z;  1YI2 1;  1VQM Z;  1Q86 2;  3I56 1;  1VQL 1;  1Q86 1;  3CMA 1;  1VQO Z;  1YIJ 1;  3CCM Z;  1YJW 1;  1VQ9 1;  3CXC Z;  3CCL 1;  3G4S 1;  3OW2 Y;  1YHQ 1;  1VQ4 Z;  3CCS 1;  3CME Z;  1NJI 2;  3CC4 Z;  1NJI 1;  1VQM 1;  1VQ6 Z;  2QA4 Z;  1VQO 1;  1VQP Z;  3CCM 1;  3CXC Y;  1VQK 1;  1M1K 2;  1K9M 2;  1M1K 1;  1N8R 2;  1K9M 1;  1VQ4 1;  3CCJ Z;  1N8R 1;  3CC7 Z;  2OTJ Z;  1YJ9 Z;  3CME 1;  3CC4 1;  1QVF Z;  3G6E Z;  1VQ7 Z;  1VQP 1;  1Q7Y 2;  2OTL Z;  3CCV Z;  1VQ8 Z;  3CCQ Z;  1YIT Z;  1S72 Z;  1KQS Z;  3I55 Z;  3CCJ 1;  3CC7 1;  2OTJ 1;  1K8A 2;  3G71 Z;  1YJ9 1;  1K8A 1;  1QVF Y;  3G6E 1;  1VQ7 1;  1Q82 2;  2OTL 1;  1VQ8 1;  3CCQ 1;  1Q82 1;  1YIT 1;  2QEX Z;  1YIJ Z;  1S72 1;  1VQN Z;  1KQS Y;  1YJW Z;  3I55 1;  1VQ6 1;  2QA4 1;  3CD6 Z;  3CCU Z;  3G71 1;  1YHQ Z;  1Q7Y 1;  1Q81 2;  3CCE Z;  1Q81 1;  3CCR Z;  1W2B Y;  3CC2 Z;  1YJN Z;  1KD1 2;  2QEX 1;  1QVG Y;  1KD1 1;  1KC8 2;  3CPW Z;  1VQ5 Z;  1VQN 1;  1YI2 Z;  1KC8 1;  1VQK Z;  1JJ2 Y;  3CD6 1;  3CCU 1;  3I56 Z;  1K73 2;  1VQL Z;  1W2B Z;  3CMA Z;  1K73 1;  3CCE 1;  3CCV 1;  3CCR 1;  1QVG Z;  1VQ9 Z;  3CCL Z;  1JJ2 Z;  3G4S Z;  3OW2 Z;  3CC2 1;  1YJN 1; 
#chains in the Genus database with same CATH topology
 1WCM I;  1M90 2;  1RQF A;  2JMO A;  1JWH C;  5IT9 b;  5CM2 M;  2R93 I;  3I56 1;  2V8K A;  1VQO Z;  2R6M A;  1TWF I;  4A3D I;  3HOW I;  4A3J I;  2QRC B;  3G4S 1;  2JR6 A;  1I3Q I;  3GTL I;  4E2Z A;  3Q87 A;  1USP A;  2W04 A;  1TWH I;  3NH8 A;  3HOX I;  2JS4 A;  2E2H I;  1VQ6 Z;  1RO4 A;  4E31 A;  1VQO 1;  3BG0 B;  4DGL A;  1RO2 A;  2IZ4 A;  3IF8 A;  1VQK 1;  2F4M A;  2WAQ A;  4MH4 A;  2V3V A;  2NVT I;  1N2F A;  1M1K 1;  3S2H I;  2BJO A;  3VTN A;  2OTJ Z;  4Y52 I;  3S16 I;  3MZK B;  3NH5 A;  2JIM A;  1TWA I;  5T6B A;  2JA6 I;  3IX0 A;  4NB8 A;  3J7A 4;  1K83 I;  1RO0 A;  4A3E I;  2HF1 A;  2QR1 B;  1S72 Z;  2LIY A;  4NB9 A;  3S17 I;  2OTJ 1;  1ML8 A;  1K8A 2;  4BY1 I;  2WB1 A;  3MZL B;  1WJ2 A;  3S1Q I;  3P5J B;  4A3I I;  1WII A;  2JA8 I;  2F4O A;  2V8J A;  1YIJ Z;  4E2X A;  1S72 1;  3HOY I;  5C4J I;  1YJW Z;  2QA4 1;  4MON A;  5D1O A;  2GTI A;  4QTU A;  1YHQ Z;  2O4H A;  1Q81 2;  2RPR A;  4A3B I;  5IP9 I;  2LFU A;  5C3E I;  1WZN A;  2JIP A;  5T64 A;  3CC2 Z;  3HOU I;  1KD1 1;  3D9X A;  1KC8 1;  2YAD A;  3VMH A;  1VQL Z;  1K73 1;  1QVG Z;  2QRD B;  1FDO A;  3GCF A;  3CC2 1;  1USP B;  3CPW Y;  3S14 I;  2VPY A;  3CQZ I;  1Q86 2;  1Z01 A;  3F3P C;  1VQL 1;  3S2D I;  3D6W A;  4RVF A;  1Z03 A;  2OZK A;  2I3C A;  4S1T A;  3F3F C;  1NJI 1;  4NFR A;  4MD9 A;  2M6N A;  2RBL A;  4AYB A;  2JIQ A;  1I6H I;  3S1N I;  1YUA A;  1YUK A;  3CXC Y;  4NBF A;  3GTK I;  3I07 A;  1K9M 2;  4MXU A;  4BBR I;  1N8R 2;  2DE7 A;  2NVQ I;  5FLX f;  1I50 I;  3CC7 Z;  4A3K I;  3TDH B;  1YJ9 Z;  3NDI A;  4E33 A;  2J6A A;  2JNY A;  3CCV Z;  4E32 A;  2E9H A;  4BY7 I;  2K3R A;  5D1O B;  3LUS A;  4DK1 A;  3J81 b;  5IT9 f;  3CC7 1;  3G71 Z;  4HGY A;  5C44 I;  1YJ9 1;  4X6A I;  3QWU A;  2DE6 A;  1Q82 1;  2QEX Z;  2Y0S A;  3VMI A;  2B63 I;  1VQ6 1;  4NBE A;  4RVG A;  4RVH A;  2PM9 A;  2QRE B;  2AYD A;  3G71 1;  2OOX B;  4NBD A;  3GTP I;  2HU9 A;  3M4O I;  1NP6 A;  1X3W A;  4CL1 A;  2IZ3 A;  2QEX 1;  4A3L I;  1ZB9 A;  1VQ5 Z;  3CPW Z;  1YI2 Z;  5D1P A;  2JIO A;  4MD7 A;  4NH1 C;  1W2B Z;  2M48 A;  4RS4 A;  4NBA A;  3K7A I;  2VF1 A;  1JJ2 Z;  1RLY A;  1M90 1;  1VQ5 1;  1YI2 1;  2LEX A;  2Q4Z A;  4A3M I;  1YIJ 1;  2AKL A;  1Y1W I;  1YJW 1;  3GTG I;  3CXC Z;  3IR7 A;  5C4X I;  4BBS I;  4NOZ A;  3OW2 Y;  3GTJ I;  1YHQ 1;  2VUG A;  1VQ4 Z;  3FQM A;  2RHB A;  4EWC A;  1X0T A;  3S1M I;  5AN9 F;  2E2I I;  3TE5 B;  2RT9 A;  3JAM b;  3M3Y I;  2QLV B;  3EED A;  1M1K 2;  2E2J I;  1TWC I;  2R7Z I;  1WW9 A;  1VQ4 1;  3EER A;  3GTM S;  1QF8 A;  3PO2 I;  2JA5 I;  2P3Y A;  3GKQ A;  1VQ7 Z;  2NVX I;  1DL6 A;  2RIQ A;  1SIW A;  2YU9 I;  5T67 A;  2OTL Z;  1VQ8 Z;  3CCQ Z;  3J80 b;  1Q16 A;  3I55 Z;  4BXX I;  3S15 I;  3T4N B;  2G2K A;  1K8A 1;  2VUM I;  4DQY B;  2W03 A;  1QVF Y;  3VMG A;  2GU2 A;  1VQ7 1;  1AA6 A;  3PO3 I;  3NFZ A;  2OTL 1;  3HKZ A;  1VQ8 1;  3CCQ 1;  3RZO I;  2E7Z A;  1TWG I;  1KQS Y;  1PFT A;  3I55 1;  2KI7 B;  2O53 A;  1Q7Y 1;  1Q81 1;  3CCR Z;  4A3C I;  2PK7 A;  2JIR A;  4A3F I;  1YJN Z;  1KD1 2;  3RZD I;  4RVD A;  1QVG Y;  1KC8 2;  3GTO I;  2QKD A;  1VQK Z;  1Y1V S;  3D2L A;  4NBB A;  3H0G I;  1K73 2;  2OOY B;  4E2W A;  3CMA Z;  3CCV 1;  2Q51 A;  4NBG A;  4A93 I;  1ZB8 A;  2V8I A;  3CCR 1;  1QYP A;  2H85 A;  2NAP A;  1VQ9 Z;  3CCL Z;  1RNI A;  2VPZ A;  3IFU A;  3FQQ A;  3OW2 Z;  3GTM I;  1YJN 1;  3J81 f;  3MON A;  3CCS Z;  1R9T I;  2K5R A;  1VQM Z;  1P9N A;  1Q86 1;  3CMA 1;  4MRI A;  3NH4 A;  3CCM Z;  4HGZ A;  1VQ9 1;  3CCL 1;  1ZH1 A;  3BG1 B;  3I4N I;  1FDI A;  3CCS 1;  2EGT A;  3CME Z;  1NJI 2;  3CC4 Z;  1KRL A;  1VQM 1;  2R92 I;  2QA4 Z;  1VQP Z;  3NDJ A;  3PO3 S;  3CCM 1;  3FKI I;  1TFI A;  1K9M 1;  3CCJ Z;  1N8R 1;  3KIH A;  4HH4 A;  1Z02 A;  1QXF A;  3CME 1;  3CC4 1;  1QVF Z;  2ZAE B;  3G6E Z;  2VPW A;  3ESW A;  1VQP 1;  2JA7 I;  1Q7Y 2;  1X3Z A;  1Y1V I;  3S1R I;  2PMZ A;  1YIT Z;  1KQS Z;  1Y8C A;  3CCJ 1;  4E2Y A;  1SFO I;  1NUI A;  5IP7 I;  4MD8 A;  3GTQ I;  2GTH A;  1LQL A;  2NVY I;  3G6E 1;  3U50 C;  4TNU A;  4NBH A;  2JUB A;  1Q82 2;  1L1O C;  1S7M A;  5A2Q b;  1YIT 1;  1VQN Z;  3I4M I;  3CD6 Z;  3CCU Z;  5FLM I;  3CCE Z;  3JAM f;  2IV2 X;  4Y7N I;  1W2B Y;  5LL6 f;  1VQN 1;  5FLX b;  2P28 A;  4RV9 A;  1JJ2 Y;  3CD6 1;  2KPI A;  3CCU 1;  4NBC A;  2V45 A;  5A2Q f;  3I56 Z;  3HOV I;  2VPX A;  3CCE 1;  4XX2 A;  4E30 A;  1VLA A;  3HOZ I;  4QTT A;  4A3G I;  2DE5 A;  3H3V J;  3G4S Z;  3KIF A;  3J80 f;  3VB9 A; 
#chains in the Genus database with same CATH homology
 1WCM I;  1M90 2;  1RQF A;  2JMO A;  1JWH C;  5IT9 b;  5CM2 M;  2R93 I;  3I56 1;  2V8K A;  1VQO Z;  2R6M A;  1TWF I;  4A3D I;  3HOW I;  4A3J I;  2QRC B;  3G4S 1;  2JR6 A;  1I3Q I;  3GTL I;  4E2Z A;  3Q87 A;  1USP A;  2W04 A;  1TWH I;  3NH8 A;  3HOX I;  2JS4 A;  2E2H I;  1VQ6 Z;  1RO4 A;  4E31 A;  1VQO 1;  3BG0 B;  4DGL A;  1RO2 A;  2IZ4 A;  3IF8 A;  1VQK 1;  2F4M A;  2WAQ A;  4MH4 A;  2NVT I;  1N2F A;  1M1K 1;  3S2H I;  2BJO A;  3VTN A;  2OTJ Z;  4Y52 I;  3S16 I;  3MZK B;  3NH5 A;  1TWA I;  5T6B A;  2JA6 I;  3IX0 A;  4NB8 A;  3J7A 4;  1K83 I;  1RO0 A;  4A3E I;  2HF1 A;  2QR1 B;  1S72 Z;  2LIY A;  4NB9 A;  3S17 I;  2OTJ 1;  1ML8 A;  1K8A 2;  4BY1 I;  2WB1 A;  3MZL B;  3S1Q I;  3P5J B;  4A3I I;  1WII A;  2JA8 I;  2F4O A;  2V8J A;  1YIJ Z;  4E2X A;  1S72 1;  3HOY I;  5C4J I;  1YJW Z;  2QA4 1;  4MON A;  5D1O A;  2GTI A;  4QTU A;  1YHQ Z;  2O4H A;  1Q81 2;  2RPR A;  4A3B I;  5IP9 I;  2LFU A;  5C3E I;  5T64 A;  3CC2 Z;  3HOU I;  1KD1 1;  3D9X A;  1KC8 1;  2YAD A;  3VMH A;  1VQL Z;  1K73 1;  1QVG Z;  2QRD B;  3GCF A;  3CC2 1;  1USP B;  3CPW Y;  3S14 I;  3CQZ I;  1Q86 2;  1Z01 A;  3F3P C;  1VQL 1;  3S2D I;  3D6W A;  4RVF A;  1Z03 A;  2OZK A;  2I3C A;  4S1T A;  3F3F C;  1NJI 1;  4NFR A;  4MD9 A;  2M6N A;  2RBL A;  4AYB A;  1I6H I;  3S1N I;  1YUA A;  1YUK A;  3CXC Y;  4NBF A;  3GTK I;  3I07 A;  1K9M 2;  4MXU A;  4BBR I;  1N8R 2;  2DE7 A;  2NVQ I;  5FLX f;  1I50 I;  3CC7 Z;  4A3K I;  3TDH B;  1YJ9 Z;  3NDI A;  4E33 A;  2J6A A;  2JNY A;  3CCV Z;  4E32 A;  2E9H A;  4BY7 I;  2K3R A;  5D1O B;  3LUS A;  4DK1 A;  3J81 b;  5IT9 f;  3CC7 1;  3G71 Z;  4HGY A;  5C44 I;  1YJ9 1;  4X6A I;  3QWU A;  2DE6 A;  1Q82 1;  2QEX Z;  2Y0S A;  3VMI A;  2B63 I;  1VQ6 1;  4NBE A;  4RVG A;  4RVH A;  2PM9 A;  2QRE B;  3G71 1;  2OOX B;  4NBD A;  3GTP I;  2HU9 A;  3M4O I;  1NP6 A;  1X3W A;  4CL1 A;  2IZ3 A;  2QEX 1;  4A3L I;  1ZB9 A;  1VQ5 Z;  3CPW Z;  1YI2 Z;  5D1P A;  4MD7 A;  4NH1 C;  1W2B Z;  2M48 A;  4RS4 A;  4NBA A;  3K7A I;  2VF1 A;  1JJ2 Z;  1RLY A;  1M90 1;  1VQ5 1;  1YI2 1;  2Q4Z A;  4A3M I;  1YIJ 1;  2AKL A;  1Y1W I;  1YJW 1;  3GTG I;  3CXC Z;  5C4X I;  4BBS I;  4NOZ A;  3OW2 Y;  3GTJ I;  1YHQ 1;  2VUG A;  1VQ4 Z;  3FQM A;  2RHB A;  4EWC A;  1X0T A;  3S1M I;  5AN9 F;  2E2I I;  3TE5 B;  2RT9 A;  3JAM b;  3M3Y I;  2QLV B;  3EED A;  1M1K 2;  2E2J I;  1TWC I;  2R7Z I;  1WW9 A;  1VQ4 1;  3EER A;  3GTM S;  1QF8 A;  3PO2 I;  2JA5 I;  2P3Y A;  3GKQ A;  1VQ7 Z;  2NVX I;  1DL6 A;  2RIQ A;  2YU9 I;  5T67 A;  2OTL Z;  1VQ8 Z;  3CCQ Z;  3J80 b;  3I55 Z;  4BXX I;  3S15 I;  3T4N B;  2G2K A;  1K8A 1;  2VUM I;  4DQY B;  2W03 A;  1QVF Y;  3VMG A;  2GU2 A;  1VQ7 1;  3PO3 I;  3NFZ A;  2OTL 1;  3HKZ A;  1VQ8 1;  3CCQ 1;  3RZO I;  1TWG I;  1KQS Y;  1PFT A;  3I55 1;  2KI7 B;  2O53 A;  1Q7Y 1;  1Q81 1;  3CCR Z;  4A3C I;  2PK7 A;  4A3F I;  1YJN Z;  1KD1 2;  3RZD I;  4RVD A;  1QVG Y;  1KC8 2;  3GTO I;  2QKD A;  1VQK Z;  1Y1V S;  4NBB A;  3H0G I;  1K73 2;  2OOY B;  4E2W A;  3CMA Z;  3CCV 1;  2Q51 A;  4NBG A;  4A93 I;  1ZB8 A;  2V8I A;  3CCR 1;  1QYP A;  2H85 A;  1VQ9 Z;  3CCL Z;  1RNI A;  3IFU A;  3FQQ A;  3OW2 Z;  3GTM I;  1YJN 1;  3J81 f;  3MON A;  3CCS Z;  1R9T I;  2K5R A;  1VQM Z;  1P9N A;  1Q86 1;  3CMA 1;  4MRI A;  3NH4 A;  3CCM Z;  4HGZ A;  1VQ9 1;  3CCL 1;  1ZH1 A;  3BG1 B;  3I4N I;  3CCS 1;  2EGT A;  3CME Z;  1NJI 2;  3CC4 Z;  1KRL A;  1VQM 1;  2R92 I;  2QA4 Z;  1VQP Z;  3NDJ A;  3PO3 S;  3CCM 1;  3FKI I;  1TFI A;  1K9M 1;  3CCJ Z;  1N8R 1;  3KIH A;  4HH4 A;  1Z02 A;  3CME 1;  3CC4 1;  1QVF Z;  2ZAE B;  3G6E Z;  3ESW A;  1VQP 1;  2JA7 I;  1Q7Y 2;  1X3Z A;  1Y1V I;  3S1R I;  2PMZ A;  1YIT Z;  1KQS Z;  3CCJ 1;  4E2Y A;  1SFO I;  1NUI A;  5IP7 I;  4MD8 A;  3GTQ I;  2GTH A;  1LQL A;  2NVY I;  3G6E 1;  3U50 C;  4TNU A;  4NBH A;  2JUB A;  1Q82 2;  1L1O C;  1S7M A;  5A2Q b;  1YIT 1;  1VQN Z;  3I4M I;  3CD6 Z;  3CCU Z;  5FLM I;  3CCE Z;  3JAM f;  4Y7N I;  1W2B Y;  5LL6 f;  1VQN 1;  5FLX b;  2P28 A;  4RV9 A;  1JJ2 Y;  3CD6 1;  2KPI A;  3CCU 1;  4NBC A;  5A2Q f;  3I56 Z;  3HOV I;  3CCE 1;  4XX2 A;  4E30 A;  1VLA A;  3HOZ I;  4QTT A;  4A3G I;  2DE5 A;  3H3V J;  3G4S Z;  3KIF A;  3J80 f;  3VB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...