3CXCZ

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cxcZ00
3CCU1 3CCSZ 2QA41 1VQ8Z 1YI21 1QVFY 3CC2Z 3I55Z 1Q822 1VQK1 1W2BY 1YITZ 1VQL1 2QA4Z 1S721 3CMAZ 3CCM1 1Q7Y2 1Q811 1JJ2Z 3CMEZ 3CCLZ 3G4S1 1VQM1 1K8A2 1M901 1VQO1 1VQ61 1JJ2Y 3CCQ1 1VQKZ 3CCR1 1Q861 1QVFZ 1M1K2 1N8R1 1VQ71 3CC41 3G4SZ 3G71Z 1W2BZ 1KQSY 3CCE1 3CC71 3CCRZ 1YJNZ 1NJI2 1K9M2 3CCUZ 1VQ7Z 1QVGY 1VQ41 3CCV1 3CCJ1 1YJ91 1VQN1 1K732 1YIJ1 3G6E1 1YI2Z 1VQP1 1KC82 3CC7Z 3CPWY 1Q7Y1 2OTL1 1YHQ1 1KD12 1KQSZ 3CD61 1VQLZ 1K8A1 1S72Z 3CCMZ 1VQ4Z 2OTJZ 1VQNZ 3CCJZ 1YIJZ 3G6EZ 1M1K1 1QVGZ 1VQMZ 2OTLZ 1VQOZ 1VQ6Z 2OTJ1 3CCQZ 3CD6Z 3CPWZ 2QEX1 3OW2Y 1Q862 1NJI1 3CC4Z 1Q821 1VQ91 3CCEZ 3I551 1VQ51 1YIT1 1K731 1KC81 3CMA1 2QEXZ 3CME1 3CCL1 3CXCY 3CCVZ 1VQ9Z 3I561 1YJ9Z 1KD11 1Q812 1VQPZ 1YJW1 3OW2Z 1VQ5Z 1YHQZ 3CCS1 1M902 3G711 1VQ81 3I56Z 1K9M1 1YJWZ 1N8R2 3CC21 1YJN1 3CXCZ
chains in the Genus database with same CATH superfamily
4MD8A 2VPYA 3CCSZ 4BXXI 2V8JA 3VB9A 2RBLA 3I55Z 2BJOA 1W2BY 1N2FA 1S721 3CCM1 5T6BA 1QXFA 3RZDI 4A3CI 3CCLZ 2F4OA 2JA5I 1K8A2 1JJ2Y 3CCQ1 1VQKZ 3IR7A 3D2LA 1WIIA 3CC41 1W2BZ 1KQSY 3CC71 2W04A 4DQYB 1YJNZ 1NJI2 3CQZI 1VQ7Z 3I07A 2JIPA 2JA6I 3F3PC 3CCV1 1YJ91 2O4HA 2LFUA 1K732 1KC82 2OTL1 4A3DI 1YHQ1 3BG1B 1KQSZ 1K8A1 3NH5A 4RVDA 1S72Z 1I3QI 3CCMZ 2QR1B 3F3FC 1VQNZ 4A3EI 3S16I 1YIJZ 2E2JI 1TWCI 3J81f 5C44I 3CCQZ 1SIWA 2NVQI 3CD6Z 1YUAA 1Y1VS 3Q87A 1NJI1 3CC4Z 3QWUA 2P28A 2VPWA 1NP6A 2GU2A 4MONA 4NBHA 4RVGA 2EGTA 2K5RA 1Y8CA 1K731 1KC81 2NVYI 1WCMI 1LQLA 3NH8A 4TNUA 3CXCY 3CCVZ 1YJ9Z 4E33A 2YU9I 1Y1WI 1Z02A 1YHQZ 3I4NI 5AN9F 2JIOA 2R7ZI 3CCS1 2H85A 3G711 3S15I 2RIQA 3BG0B 1K9M1 1N8R2 3GKQA 3CXCZ 3S14I 2Q51A 3PO3S 1VQ8Z 4EWCA 2F4MA 3S1NI 4X6AI 4E2XA 3MZLB 1VQK1 1RO4A 1Z01A 3GCFA 3PO2I 1Q7Y2 3S2DI 4RVFA 4DK1A 2NAPA 4MXUA 4E2YA 1Q861 3LUSA 1TWHI 1N8R1 1VQ71 4HGYA 2NVTI 3G71Z 1X0TA 3GTPI 2PM9A 5FLXf 3J81b 2RPRA 1QYPA 1RO2A 1NUIA 2JMOA 3HOYI 5C4JI 2QKDA 4DGLA 3IX0A 4A3MI 1VQN1 2V8IA 1TWFI 1YIJ1 4RVHA 1Q7Y1 3KIHA 2HU9A 2M6NA 5IP7I 1KD12 3CD61 3MONA 3VTNA 2V3VA 3NFZA 3S1MI 2V45A 5T64A 2IZ3A 3GTJI 3HOWI 2OTJ1 1X3ZA 3NH4A 4A3JI 4A93I 1X3WA 3HOVI 2DE6A 4A3LI 3HOXI 3M4OI 3FQQA 1AA6A 4E32A 3CMA1 2QEXZ 2JR6A 2I3CA 2AKLA 2JA7I 1ZB8A 1Z03A 1VQ9Z 1KD11 5CM2M 1Q812 1VQ5Z 3S1QI 3NDIA 1VQ81 2PK7A 1YJWZ 3D9XA 4MD7A 2OTJZ 2O53A 1I50I 2JIRA 4CL1A 4BY1I 3M3YI 3J80f 4Y7NI 2WB1A 3KIFA 1YI21 4NB9A 1QVFY 1S7MA 4NH1C 3CC2Z 5FLXb 4MRIA 1Q822 1KRLA 4BBRI 3S2HI 4HGZA 1VQL1 1RNIA 2QA4Z 1Q811 3CMAZ 4RS4A 4AYBA 4NBGA 2R6MA 2DE5A 4E30A 1VQM1 1VQO1 1I6HI 3PO3I 2K3RA 1QVFZ 3G4SZ 3FKII 5A2Qf 3S17I 3H0GI 3CCRZ 1JWHC 2GTHA 3JAMf 4NBDA 4NB8A 5IT9f 4QTTA 1QVGY 1RQFA 2E7ZA 2RT9A 4QTUA 3CPWY 1YI2Z 3TDHB 1VQP1 2VPZA 1VQLZ 2LEXA 4NFRA 1VQ4Z 1WW9A 3CCJZ 4BY7I 1FDOA 4S1TA 3G6EZ 1QVGZ 1VQMZ 3HOUI 1VQOZ 4E2ZA 3NDJA 3CPWZ 2VUMI 2QEX1 3TE5B 3GTMS 2JNYA 2JIMA 1VQ91 1ML8A 3EEDA 3VMGA 1VQ51 2LIYA 2ZAEB 1YIT1 1R9TI 3GTKI 3VMHA 2G2KA 4NBBA 3J80b 3CME1 3IF8A 2YADA 1VQPZ 1YJW1 2QREB 2QLVB 2OZKA 4BBSI 1M902 2JA8I 2V8KA 5IP9I 2M48A 2KI7B 1SFOI 3I56Z 2NVXI 2R93I 3CC21 4RV9A 3CCU1 5T67A 2E2II 5C3EI 2QA41 3H3VJ 3EERA 4A3KI 1TWGI 2QRDB 5D1OA 3T4NB 1Y1VI 1RO0A 5A2Qb 4HH4A 1WJ2A 1ZH1A 2P3YA 1VLAA 3JAMb 1YITZ 1WZNA 2E9HA 5IT9b 1JJ2Z 5C4XI 2E2HI 2Q4ZA 3CMEZ 1USPA 3G4S1 2B63I 1M901 3IFUA 1VQ61 4E31A 2KPIA 5LL6f 3CCR1 2AYDA 1PFTA 3GTLI 3I4MI 1M1K2 2VPXA 2OOXB 1TWAI 5FLMI 3CCE1 4NBEA 3RZOI 1DL6A 2PMZA 2IV2X 3CCUZ 2GTIA 4NBFA 1K9M2 3J7A4 2J6AA 1YUKA 1VQ41 2HF1A 4A3BI 2DE7A 3CCJ1 3U50C 2Y0SA 2JIQA 3G6E1 3CC7Z 3GTQI 2RHBA 4MD9A 3P5JB 4A3FI 4NBAA 3D6WA 2W03A 4E2WA 3S1RI 1L1OC 1M1K1 2OTLZ 4A3II 2VUGA 1VQ6Z 2OOYB 2IZ4A 4NBCA 3OW2Y 1Q862 3ESWA 1Q821 2JUBA 1ZB9A 3CCEZ 1P9NA 3HOZI 3I551 1TFIA 2VF1A 1K83I 2R92I 3FQMA 3CCL1 1Q16A 4Y52I 3MZKB 3I561 1RLYA 3K7AI 5D1OB 2WAQA 3OW2Z 3GTMI 4XX2A 1FDIA 3GTGI 4A3GI 1QF8A 2JS4A 3HKZA 1USPB 4MH4A 5D1PA 3VMIA 3GTOI 4NOZA 1YJN1 2QRCB
chains in the Genus database with same CATH topology
4MD8A 3CCSZ 4BXXI 2V8JA 3VB9A 2RBLA 3I55Z 2BJOA 1W2BY 1N2FA 1S721 3CCM1 5T6BA 3RZDI 4A3CI 3CCLZ 2F4OA 2JA5I 1K8A2 1JJ2Y 3CCQ1 1VQKZ 1WIIA 3CC41 1W2BZ 1KQSY 3CC71 2W04A 4DQYB 1YJNZ 1NJI2 3CQZI 1VQ7Z 3I07A 2JA6I 3F3PC 3CCV1 1YJ91 2O4HA 2LFUA 1K732 1KC82 2OTL1 4A3DI 1YHQ1 3BG1B 1KQSZ 1K8A1 3NH5A 4RVDA 1S72Z 1I3QI 3CCMZ 2QR1B 3F3FC 1VQNZ 4A3EI 3S16I 1YIJZ 2E2JI 1TWCI 3J81f 5C44I 3CCQZ 2NVQI 3CD6Z 1YUAA 1Y1VS 3Q87A 1NJI1 3CC4Z 3QWUA 2P28A 1NP6A 2GU2A 4MONA 4NBHA 4RVGA 2EGTA 2K5RA 1K731 1KC81 2NVYI 1WCMI 1LQLA 3NH8A 4TNUA 3CXCY 3CCVZ 1YJ9Z 4E33A 2YU9I 1Y1WI 1Z02A 1YHQZ 3I4NI 5AN9F 2R7ZI 3CCS1 2H85A 3G711 3S15I 2RIQA 3BG0B 1K9M1 1N8R2 3GKQA 3CXCZ 3S14I 2Q51A 3PO3S 1VQ8Z 4EWCA 2F4MA 3S1NI 4X6AI 4E2XA 3MZLB 1VQK1 1RO4A 1Z01A 3GCFA 3PO2I 1Q7Y2 3S2DI 4RVFA 4DK1A 4MXUA 4E2YA 1Q861 3LUSA 1TWHI 1N8R1 1VQ71 4HGYA 2NVTI 3G71Z 1X0TA 3GTPI 2PM9A 5FLXf 3J81b 2RPRA 1RO2A 1QYPA 1NUIA 2JMOA 3HOYI 5C4JI 2QKDA 4DGLA 3IX0A 4A3MI 1VQN1 2V8IA 1TWFI 1YIJ1 4RVHA 1Q7Y1 3KIHA 2HU9A 2M6NA 5IP7I 1KD12 3CD61 3MONA 3VTNA 3NFZA 3S1MI 5T64A 2IZ3A 3GTJI 3HOWI 2OTJ1 1X3ZA 3NH4A 4A3JI 4A93I 1X3WA 3HOVI 2DE6A 4A3LI 3HOXI 3M4OI 3FQQA 4E32A 3CMA1 2QEXZ 2JR6A 2I3CA 2AKLA 2JA7I 1ZB8A 1Z03A 1VQ9Z 1KD11 5CM2M 1Q812 1VQ5Z 3S1QI 3NDIA 1VQ81 2PK7A 1YJWZ 3D9XA 4MD7A 2OTJZ 2O53A 1I50I 4CL1A 4BY1I 3M3YI 3J80f 4Y7NI 2WB1A 3KIFA 1YI21 4NB9A 1QVFY 1S7MA 4NH1C 3CC2Z 5FLXb 4MRIA 1Q822 1KRLA 4BBRI 3S2HI 4HGZA 1VQL1 1RNIA 2QA4Z 1Q811 3CMAZ 4RS4A 4AYBA 4NBGA 2R6MA 2DE5A 4E30A 1VQM1 1VQO1 1I6HI 3PO3I 2K3RA 1QVFZ 3G4SZ 3FKII 5A2Qf 3S17I 3H0GI 3CCRZ 1JWHC 2GTHA 3JAMf 4NBDA 4NB8A 5IT9f 4QTTA 1QVGY 1RQFA 2RT9A 4QTUA 3CPWY 1YI2Z 3TDHB 1VQP1 1VQLZ 4NFRA 1VQ4Z 1WW9A 3CCJZ 4BY7I 4S1TA 3G6EZ 1QVGZ 1VQMZ 3HOUI 1VQOZ 4E2ZA 3NDJA 3CPWZ 2VUMI 2QEX1 3TE5B 3GTMS 2JNYA 1VQ91 1ML8A 3EEDA 3VMGA 1VQ51 2LIYA 2ZAEB 1YIT1 1R9TI 3GTKI 3VMHA 2G2KA 4NBBA 3J80b 3CME1 3IF8A 2YADA 1VQPZ 1YJW1 2QREB 2QLVB 2OZKA 4BBSI 1M902 2JA8I 2V8KA 5IP9I 2M48A 2KI7B 1SFOI 3I56Z 2NVXI 2R93I 3CC21 4RV9A 3CCU1 5T67A 2E2II 5C3EI 2QA41 3H3VJ 3EERA 4A3KI 1TWGI 2QRDB 5D1OA 3T4NB 1Y1VI 1RO0A 5A2Qb 4HH4A 1ZH1A 2P3YA 1VLAA 3JAMb 1YITZ 2E9HA 5IT9b 1JJ2Z 5C4XI 2E2HI 2Q4ZA 3CMEZ 1USPA 3G4S1 2B63I 1M901 3IFUA 1VQ61 4E31A 2KPIA 5LL6f 3CCR1 1PFTA 3GTLI 3I4MI 1M1K2 2OOXB 1TWAI 5FLMI 3CCE1 4NBEA 3RZOI 1DL6A 2PMZA 1K9M2 3CCUZ 2GTIA 4NBFA 3J7A4 2J6AA 1YUKA 1VQ41 2HF1A 4A3BI 2DE7A 3CCJ1 3U50C 2Y0SA 3G6E1 3CC7Z 3GTQI 2RHBA 4MD9A 3P5JB 4A3FI 4NBAA 3D6WA 2W03A 4E2WA 3S1RI 1L1OC 1M1K1 2OTLZ 4A3II 2VUGA 1VQ6Z 2OOYB 2IZ4A 4NBCA 3OW2Y 1Q862 3ESWA 1Q821 2JUBA 1ZB9A 3CCEZ 1P9NA 3HOZI 3I551 1TFIA 2VF1A 1K83I 2R92I 3FQMA 3CCL1 4Y52I 3MZKB 3I561 1RLYA 3K7AI 5D1OB 2WAQA 3OW2Z 3GTMI 4XX2A 3GTGI 4A3GI 1QF8A 2JS4A 3HKZA 1USPB 4MH4A 5D1PA 3VMIA 3GTOI 4NOZA 1YJN1 2QRCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU 1;  3CCS Z;  2QA4 1;  1VQ8 Z;  1YI2 1;  1QVF Y;  3CC2 Z;  3I55 Z;  1Q82 2;  1VQK 1;  1W2B Y;  1YIT Z;  1VQL 1;  2QA4 Z;  1S72 1;  3CMA Z;  3CCM 1;  1Q7Y 2;  1Q81 1;  1JJ2 Z;  3CME Z;  3CCL Z;  3G4S 1;  1VQM 1;  1K8A 2;  1M90 1;  1VQO 1;  1VQ6 1;  1JJ2 Y;  3CCQ 1;  1VQK Z;  3CCR 1;  1Q86 1;  1QVF Z;  1M1K 2;  1N8R 1;  1VQ7 1;  3CC4 1;  3G4S Z;  3G71 Z;  1W2B Z;  1KQS Y;  3CCE 1;  3CC7 1;  3CCR Z;  1YJN Z;  1NJI 2;  1K9M 2;  3CCU Z;  1VQ7 Z;  1QVG Y;  1VQ4 1;  3CCV 1;  3CCJ 1;  1YJ9 1;  1VQN 1;  1K73 2;  1YIJ 1;  3G6E 1;  1YI2 Z;  1VQP 1;  1KC8 2;  3CC7 Z;  3CPW Y;  1Q7Y 1;  2OTL 1;  1YHQ 1;  1KD1 2;  1KQS Z;  3CD6 1;  1VQL Z;  1K8A 1;  1S72 Z;  3CCM Z;  1VQ4 Z;  2OTJ Z;  1VQN Z;  3CCJ Z;  1YIJ Z;  3G6E Z;  1M1K 1;  1QVG Z;  1VQM Z;  2OTL Z;  1VQO Z;  1VQ6 Z;  2OTJ 1;  3CCQ Z;  3CD6 Z;  3CPW Z;  2QEX 1;  3OW2 Y;  1Q86 2;  1NJI 1;  3CC4 Z;  1Q82 1;  1VQ9 1;  3CCE Z;  3I55 1;  1VQ5 1;  1YIT 1;  1K73 1;  1KC8 1;  3CMA 1;  2QEX Z;  3CME 1;  3CCL 1;  3CXC Y;  3CCV Z;  1VQ9 Z;  3I56 1;  1YJ9 Z;  1KD1 1;  1Q81 2;  1VQP Z;  1YJW 1;  3OW2 Z;  1VQ5 Z;  1YHQ Z;  3CCS 1;  1M90 2;  3G71 1;  1VQ8 1;  3I56 Z;  1K9M 1;  1YJW Z;  1N8R 2;  3CC2 1;  1YJN 1;  3CXC Z; 
#chains in the Genus database with same CATH topology
 4MD8 A;  2VPY A;  3CCS Z;  4BXX I;  2V8J A;  3VB9 A;  2RBL A;  3I55 Z;  2BJO A;  1W2B Y;  1N2F A;  1S72 1;  3CCM 1;  5T6B A;  1QXF A;  3RZD I;  4A3C I;  3CCL Z;  2F4O A;  2JA5 I;  1K8A 2;  1JJ2 Y;  3CCQ 1;  1VQK Z;  3IR7 A;  3D2L A;  1WII A;  3CC4 1;  1W2B Z;  1KQS Y;  3CC7 1;  2W04 A;  4DQY B;  1YJN Z;  1NJI 2;  3CQZ I;  1VQ7 Z;  3I07 A;  2JIP A;  2JA6 I;  3F3P C;  3CCV 1;  1YJ9 1;  2O4H A;  2LFU A;  1K73 2;  1KC8 2;  2OTL 1;  4A3D I;  1YHQ 1;  3BG1 B;  1KQS Z;  1K8A 1;  3NH5 A;  4RVD A;  1S72 Z;  1I3Q I;  3CCM Z;  2QR1 B;  3F3F C;  1VQN Z;  4A3E I;  3S16 I;  1YIJ Z;  2E2J I;  1TWC I;  3J81 f;  5C44 I;  3CCQ Z;  1SIW A;  2NVQ I;  3CD6 Z;  1YUA A;  1Y1V S;  3Q87 A;  1NJI 1;  3CC4 Z;  3QWU A;  2P28 A;  2VPW A;  1NP6 A;  2GU2 A;  4MON A;  4NBH A;  4RVG A;  2EGT A;  2K5R A;  1Y8C A;  1K73 1;  1KC8 1;  2NVY I;  1WCM I;  1LQL A;  3NH8 A;  4TNU A;  3CXC Y;  3CCV Z;  1YJ9 Z;  4E33 A;  2YU9 I;  1Y1W I;  1Z02 A;  1YHQ Z;  3I4N I;  5AN9 F;  2JIO A;  2R7Z I;  3CCS 1;  2H85 A;  3G71 1;  3S15 I;  2RIQ A;  3BG0 B;  1K9M 1;  1N8R 2;  3GKQ A;  3CXC Z;  3S14 I;  2Q51 A;  3PO3 S;  1VQ8 Z;  4EWC A;  2F4M A;  3S1N I;  4X6A I;  4E2X A;  3MZL B;  1VQK 1;  1RO4 A;  1Z01 A;  3GCF A;  3PO2 I;  1Q7Y 2;  3S2D I;  4RVF A;  4DK1 A;  2NAP A;  4MXU A;  4E2Y A;  1Q86 1;  3LUS A;  1TWH I;  1N8R 1;  1VQ7 1;  4HGY A;  2NVT I;  3G71 Z;  1X0T A;  3GTP I;  2PM9 A;  5FLX f;  3J81 b;  2RPR A;  1QYP A;  1RO2 A;  1NUI A;  2JMO A;  3HOY I;  5C4J I;  2QKD A;  4DGL A;  3IX0 A;  4A3M I;  1VQN 1;  2V8I A;  1TWF I;  1YIJ 1;  4RVH A;  1Q7Y 1;  3KIH A;  2HU9 A;  2M6N A;  5IP7 I;  1KD1 2;  3CD6 1;  3MON A;  3VTN A;  2V3V A;  3NFZ A;  3S1M I;  2V45 A;  5T64 A;  2IZ3 A;  3GTJ I;  3HOW I;  2OTJ 1;  1X3Z A;  3NH4 A;  4A3J I;  4A93 I;  1X3W A;  3HOV I;  2DE6 A;  4A3L I;  3HOX I;  3M4O I;  3FQQ A;  1AA6 A;  4E32 A;  3CMA 1;  2QEX Z;  2JR6 A;  2I3C A;  2AKL A;  2JA7 I;  1ZB8 A;  1Z03 A;  1VQ9 Z;  1KD1 1;  5CM2 M;  1Q81 2;  1VQ5 Z;  3S1Q I;  3NDI A;  1VQ8 1;  2PK7 A;  1YJW Z;  3D9X A;  4MD7 A;  2OTJ Z;  2O53 A;  1I50 I;  2JIR A;  4CL1 A;  4BY1 I;  3M3Y I;  3J80 f;  4Y7N I;  2WB1 A;  3KIF A;  1YI2 1;  4NB9 A;  1QVF Y;  1S7M A;  4NH1 C;  3CC2 Z;  5FLX b;  4MRI A;  1Q82 2;  1KRL A;  4BBR I;  3S2H I;  4HGZ A;  1VQL 1;  1RNI A;  2QA4 Z;  1Q81 1;  3CMA Z;  4RS4 A;  4AYB A;  4NBG A;  2R6M A;  2DE5 A;  4E30 A;  1VQM 1;  1VQO 1;  1I6H I;  3PO3 I;  2K3R A;  1QVF Z;  3G4S Z;  3FKI I;  5A2Q f;  3S17 I;  3H0G I;  3CCR Z;  1JWH C;  2GTH A;  3JAM f;  4NBD A;  4NB8 A;  5IT9 f;  4QTT A;  1QVG Y;  1RQF A;  2E7Z A;  2RT9 A;  4QTU A;  3CPW Y;  1YI2 Z;  3TDH B;  1VQP 1;  2VPZ A;  1VQL Z;  2LEX A;  4NFR A;  1VQ4 Z;  1WW9 A;  3CCJ Z;  4BY7 I;  1FDO A;  4S1T A;  3G6E Z;  1QVG Z;  1VQM Z;  3HOU I;  1VQO Z;  4E2Z A;  3NDJ A;  3CPW Z;  2VUM I;  2QEX 1;  3TE5 B;  3GTM S;  2JNY A;  2JIM A;  1VQ9 1;  1ML8 A;  3EED A;  3VMG A;  1VQ5 1;  2LIY A;  2ZAE B;  1YIT 1;  1R9T I;  3GTK I;  3VMH A;  2G2K A;  4NBB A;  3J80 b;  3CME 1;  3IF8 A;  2YAD A;  1VQP Z;  1YJW 1;  2QRE B;  2QLV B;  2OZK A;  4BBS I;  1M90 2;  2JA8 I;  2V8K A;  5IP9 I;  2M48 A;  2KI7 B;  1SFO I;  3I56 Z;  2NVX I;  2R93 I;  3CC2 1;  4RV9 A;  3CCU 1;  5T67 A;  2E2I I;  5C3E I;  2QA4 1;  3H3V J;  3EER A;  4A3K I;  1TWG I;  2QRD B;  5D1O A;  3T4N B;  1Y1V I;  1RO0 A;  5A2Q b;  4HH4 A;  1WJ2 A;  1ZH1 A;  2P3Y A;  1VLA A;  3JAM b;  1YIT Z;  1WZN A;  2E9H A;  5IT9 b;  1JJ2 Z;  5C4X I;  2E2H I;  2Q4Z A;  3CME Z;  1USP A;  3G4S 1;  2B63 I;  1M90 1;  3IFU A;  1VQ6 1;  4E31 A;  2KPI A;  5LL6 f;  3CCR 1;  2AYD A;  1PFT A;  3GTL I;  3I4M I;  1M1K 2;  2VPX A;  2OOX B;  1TWA I;  5FLM I;  3CCE 1;  4NBE A;  3RZO I;  1DL6 A;  2PMZ A;  2IV2 X;  3CCU Z;  2GTI A;  4NBF A;  1K9M 2;  3J7A 4;  2J6A A;  1YUK A;  1VQ4 1;  2HF1 A;  4A3B I;  2DE7 A;  3CCJ 1;  3U50 C;  2Y0S A;  2JIQ A;  3G6E 1;  3CC7 Z;  3GTQ I;  2RHB A;  4MD9 A;  3P5J B;  4A3F I;  4NBA A;  3D6W A;  2W03 A;  4E2W A;  3S1R I;  1L1O C;  1M1K 1;  2OTL Z;  4A3I I;  2VUG A;  1VQ6 Z;  2OOY B;  2IZ4 A;  4NBC A;  3OW2 Y;  1Q86 2;  3ESW A;  1Q82 1;  2JUB A;  1ZB9 A;  3CCE Z;  1P9N A;  3HOZ I;  3I55 1;  1TFI A;  2VF1 A;  1K83 I;  2R92 I;  3FQM A;  3CCL 1;  1Q16 A;  4Y52 I;  3MZK B;  3I56 1;  1RLY A;  3K7A I;  5D1O B;  2WAQ A;  3OW2 Z;  3GTM I;  4XX2 A;  1FDI A;  3GTG I;  4A3G I;  1QF8 A;  2JS4 A;  3HKZ A;  1USP B;  4MH4 A;  5D1P A;  3VMI A;  3GTO I;  4NOZ A;  1YJN 1;  2QRC B; 
#chains in the Genus database with same CATH homology
 4MD8 A;  3CCS Z;  4BXX I;  2V8J A;  3VB9 A;  2RBL A;  3I55 Z;  2BJO A;  1W2B Y;  1N2F A;  1S72 1;  3CCM 1;  5T6B A;  3RZD I;  4A3C I;  3CCL Z;  2F4O A;  2JA5 I;  1K8A 2;  1JJ2 Y;  3CCQ 1;  1VQK Z;  1WII A;  3CC4 1;  1W2B Z;  1KQS Y;  3CC7 1;  2W04 A;  4DQY B;  1YJN Z;  1NJI 2;  3CQZ I;  1VQ7 Z;  3I07 A;  2JA6 I;  3F3P C;  3CCV 1;  1YJ9 1;  2O4H A;  2LFU A;  1K73 2;  1KC8 2;  2OTL 1;  4A3D I;  1YHQ 1;  3BG1 B;  1KQS Z;  1K8A 1;  3NH5 A;  4RVD A;  1S72 Z;  1I3Q I;  3CCM Z;  2QR1 B;  3F3F C;  1VQN Z;  4A3E I;  3S16 I;  1YIJ Z;  2E2J I;  1TWC I;  3J81 f;  5C44 I;  3CCQ Z;  2NVQ I;  3CD6 Z;  1YUA A;  1Y1V S;  3Q87 A;  1NJI 1;  3CC4 Z;  3QWU A;  2P28 A;  1NP6 A;  2GU2 A;  4MON A;  4NBH A;  4RVG A;  2EGT A;  2K5R A;  1K73 1;  1KC8 1;  2NVY I;  1WCM I;  1LQL A;  3NH8 A;  4TNU A;  3CXC Y;  3CCV Z;  1YJ9 Z;  4E33 A;  2YU9 I;  1Y1W I;  1Z02 A;  1YHQ Z;  3I4N I;  5AN9 F;  2R7Z I;  3CCS 1;  2H85 A;  3G71 1;  3S15 I;  2RIQ A;  3BG0 B;  1K9M 1;  1N8R 2;  3GKQ A;  3CXC Z;  3S14 I;  2Q51 A;  3PO3 S;  1VQ8 Z;  4EWC A;  2F4M A;  3S1N I;  4X6A I;  4E2X A;  3MZL B;  1VQK 1;  1RO4 A;  1Z01 A;  3GCF A;  3PO2 I;  1Q7Y 2;  3S2D I;  4RVF A;  4DK1 A;  4MXU A;  4E2Y A;  1Q86 1;  3LUS A;  1TWH I;  1N8R 1;  1VQ7 1;  4HGY A;  2NVT I;  3G71 Z;  1X0T A;  3GTP I;  2PM9 A;  5FLX f;  3J81 b;  2RPR A;  1RO2 A;  1QYP A;  1NUI A;  2JMO A;  3HOY I;  5C4J I;  2QKD A;  4DGL A;  3IX0 A;  4A3M I;  1VQN 1;  2V8I A;  1TWF I;  1YIJ 1;  4RVH A;  1Q7Y 1;  3KIH A;  2HU9 A;  2M6N A;  5IP7 I;  1KD1 2;  3CD6 1;  3MON A;  3VTN A;  3NFZ A;  3S1M I;  5T64 A;  2IZ3 A;  3GTJ I;  3HOW I;  2OTJ 1;  1X3Z A;  3NH4 A;  4A3J I;  4A93 I;  1X3W A;  3HOV I;  2DE6 A;  4A3L I;  3HOX I;  3M4O I;  3FQQ A;  4E32 A;  3CMA 1;  2QEX Z;  2JR6 A;  2I3C A;  2AKL A;  2JA7 I;  1ZB8 A;  1Z03 A;  1VQ9 Z;  1KD1 1;  5CM2 M;  1Q81 2;  1VQ5 Z;  3S1Q I;  3NDI A;  1VQ8 1;  2PK7 A;  1YJW Z;  3D9X A;  4MD7 A;  2OTJ Z;  2O53 A;  1I50 I;  4CL1 A;  4BY1 I;  3M3Y I;  3J80 f;  4Y7N I;  2WB1 A;  3KIF A;  1YI2 1;  4NB9 A;  1QVF Y;  1S7M A;  4NH1 C;  3CC2 Z;  5FLX b;  4MRI A;  1Q82 2;  1KRL A;  4BBR I;  3S2H I;  4HGZ A;  1VQL 1;  1RNI A;  2QA4 Z;  1Q81 1;  3CMA Z;  4RS4 A;  4AYB A;  4NBG A;  2R6M A;  2DE5 A;  4E30 A;  1VQM 1;  1VQO 1;  1I6H I;  3PO3 I;  2K3R A;  1QVF Z;  3G4S Z;  3FKI I;  5A2Q f;  3S17 I;  3H0G I;  3CCR Z;  1JWH C;  2GTH A;  3JAM f;  4NBD A;  4NB8 A;  5IT9 f;  4QTT A;  1QVG Y;  1RQF A;  2RT9 A;  4QTU A;  3CPW Y;  1YI2 Z;  3TDH B;  1VQP 1;  1VQL Z;  4NFR A;  1VQ4 Z;  1WW9 A;  3CCJ Z;  4BY7 I;  4S1T A;  3G6E Z;  1QVG Z;  1VQM Z;  3HOU I;  1VQO Z;  4E2Z A;  3NDJ A;  3CPW Z;  2VUM I;  2QEX 1;  3TE5 B;  3GTM S;  2JNY A;  1VQ9 1;  1ML8 A;  3EED A;  3VMG A;  1VQ5 1;  2LIY A;  2ZAE B;  1YIT 1;  1R9T I;  3GTK I;  3VMH A;  2G2K A;  4NBB A;  3J80 b;  3CME 1;  3IF8 A;  2YAD A;  1VQP Z;  1YJW 1;  2QRE B;  2QLV B;  2OZK A;  4BBS I;  1M90 2;  2JA8 I;  2V8K A;  5IP9 I;  2M48 A;  2KI7 B;  1SFO I;  3I56 Z;  2NVX I;  2R93 I;  3CC2 1;  4RV9 A;  3CCU 1;  5T67 A;  2E2I I;  5C3E I;  2QA4 1;  3H3V J;  3EER A;  4A3K I;  1TWG I;  2QRD B;  5D1O A;  3T4N B;  1Y1V I;  1RO0 A;  5A2Q b;  4HH4 A;  1ZH1 A;  2P3Y A;  1VLA A;  3JAM b;  1YIT Z;  2E9H A;  5IT9 b;  1JJ2 Z;  5C4X I;  2E2H I;  2Q4Z A;  3CME Z;  1USP A;  3G4S 1;  2B63 I;  1M90 1;  3IFU A;  1VQ6 1;  4E31 A;  2KPI A;  5LL6 f;  3CCR 1;  1PFT A;  3GTL I;  3I4M I;  1M1K 2;  2OOX B;  1TWA I;  5FLM I;  3CCE 1;  4NBE A;  3RZO I;  1DL6 A;  2PMZ A;  1K9M 2;  3CCU Z;  2GTI A;  4NBF A;  3J7A 4;  2J6A A;  1YUK A;  1VQ4 1;  2HF1 A;  4A3B I;  2DE7 A;  3CCJ 1;  3U50 C;  2Y0S A;  3G6E 1;  3CC7 Z;  3GTQ I;  2RHB A;  4MD9 A;  3P5J B;  4A3F I;  4NBA A;  3D6W A;  2W03 A;  4E2W A;  3S1R I;  1L1O C;  1M1K 1;  2OTL Z;  4A3I I;  2VUG A;  1VQ6 Z;  2OOY B;  2IZ4 A;  4NBC A;  3OW2 Y;  1Q86 2;  3ESW A;  1Q82 1;  2JUB A;  1ZB9 A;  3CCE Z;  1P9N A;  3HOZ I;  3I55 1;  1TFI A;  2VF1 A;  1K83 I;  2R92 I;  3FQM A;  3CCL 1;  4Y52 I;  3MZK B;  3I56 1;  1RLY A;  3K7A I;  5D1O B;  2WAQ A;  3OW2 Z;  3GTM I;  4XX2 A;  3GTG I;  4A3G I;  1QF8 A;  2JS4 A;  3HKZ A;  1USP B;  4MH4 A;  5D1P A;  3VMI A;  3GTO I;  4NOZ A;  1YJN 1;  2QRC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...