3CXCZ

The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. marismortui
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cxcZ00
3CCMZ 1NJI2 1Q822 1VQ71 2QEX1 1VQ7Z 3CCEZ 1YJWZ 2QEXZ 1KD11 3CMA1 3CCR1 3G4S1 1YJN1 1M1K1 3CMAZ 3CCL1 1VQ91 3CD6Z 3G4SZ 1Q811 1VQN1 1M901 1KQSY 1YIT1 1VQNZ 1W2BY 1W2BZ 1YITZ 2QA41 3CC4Z 3CC21 1YI2Z 1KD12 1N8R1 1VQM1 3I56Z 3CC2Z 1M1K2 2OTJ1 1QVFY 1QVFZ 1Q812 1S721 1M902 2OTJZ 3CCU1 1VQO1 3CCJ1 3CC71 3G711 3CCUZ 3G71Z 3CCRZ 1N8R2 1YJNZ 3OW2Z 3CCLZ 1VQ9Z 1YIJ1 1VQP1 2OTL1 1VQ81 1YIJZ 3G6E1 1YHQ1 1VQ8Z 3CPWZ 3G6EZ 1YHQZ 2QA4Z 1Q7Y1 1KC81 1QVGZ 1VQMZ 1NJI1 1YJ91 1K731 3CXCY 3CXCZ 1VQ61 3CCQ1 1S72Z 1VQL1 1VQK1 1VQOZ 3CCJZ 3CC7Z 1VQ41 3CCS1 3OW2Y 3CCM1 1KC82 1JJ2Y 1JJ2Z 1K9M1 1K732 1VQPZ 1K8A1 2OTLZ 1Q861 3CPWY 3CME1 3CCE1 1YJW1 3CMEZ 1QVGY 1VQ51 3I551 3CCV1 3CD61 1VQ5Z 3I55Z 1Q821 3CCVZ 1YJ9Z 1K9M2 1VQ6Z 3CCQZ 1K8A2 1VQLZ 1Q862 1KQSZ 1VQKZ 3CC41 1YI21 1Q7Y2 1VQ4Z 3I561 3CCSZ
chains in the Genus database with same CATH superfamily
3S2HI 4E2WA 2JA8I 2JNYA 1FDIA 3NH5A 2VPYA 3KIHA 2QEXZ 2GTHA 3I4MI 3CMA1 1YJN1 1M1K1 2V45A 1S7MA 3QWUA 3G4SZ 3PO3I 3P5JB 1Q811 2E9HA 1M901 1KQSY 2LEXA 1VQNZ 2Q51A 4NBEA 1YITZ 2QRCB 3CC21 1YI2Z 5A2Qf 4A3MI 4QTTA 2OTJ1 3GCFA 1QVFY 2IZ3A 1QVFZ 3FKII 2E2HI 2JIOA 2NVYI 3GTOI 1USPA 3G71Z 3J7A4 3M3YI 2O53A 4NH1C 5IT9f 1YIJ1 3HOXI 5C44I 2E2II 1TWGI 4NBGA 4A3EI 1VQ8Z 2M48A 1YHQZ 2QA4Z 2QREB 3GTQI 1YJ91 2VPXA 3VMGA 2Y0SA 1TWCI 2YU9I 2RT9A 1VQOZ 5C4JI 3HOZI 3CC7Z 3GKQA 4BY1I 1JJ2Y 1JJ2Z 1K732 2F4MA 2ZAEB 2PK7A 1K8A1 2G2KA 3CPWY 3CME1 1RO2A 1ZB8A 3S1MI 4A3GI 1DL6A 2IV2X 3I551 3S1NI 2JA5I 3CCVZ 2HU9A 4MH4A 2K3RA 1VQ6Z 3CCQZ 4QTUA 4MXUA 1Z02A 3NDIA 1YI21 4DGLA 4RVDA 5FLMI 1VQ4Z 4TNUA 3CCSZ 4NBHA 3S17I 1Q822 3HOWI 5T67A 2J6AA 1VQ71 2R6MA 3S1QI 3GTPI 4RV9A 4BY7I 3CQZI 4S1TA 3IX0A 2DE5A 2AKLA 4A3FI 2QLVB 2JS4A 1W2BY 1W2BZ 1ML8A 2GTIA 2QA41 2RPRA 3CC4Z 2YADA 4RVFA 4HH4A 3I56Z 2EGTA 1R9TI 2R7ZI 4NBAA 2JIQA 2OZKA 3I4NI 2R93I 2JIMA 4BBSI 1Y1WI 3CCU1 1VQO1 4DK1A 3S14I 2O4HA 3CC71 1X3ZA 3RZOI 5C4XI 3CCLZ 2NVQI 2B63I 1ZH1A 3VMHA 3G6EZ 3H0GI 5IP7I 1Q7Y1 1K83I 2QKDA 1USPB 2WB1A 1VQMZ 5CM2M 1NJI1 4CL1A 1K731 2M6NA 1QF8A 1VQ61 3CCQ1 4A3LI 3VB9A 3K7AI 3GTMS 3U50C 1S72Z 2PMZA 3FQQA 5IP9I 1WW9A 2RBLA 3CCJZ 2WAQA 1VQ41 4A3CI 4A3KI 2DE6A 2VPZA 3CCS1 3TE5B 3J81f 1RQFA 3BG1B 1PFTA 5LL6f 1VQPZ 4NBCA 3I07A 2V8IA 2V3VA 2RHBA 1QXFA 2KPIA 1VQ51 4A3II 1WCMI 2NVXI 2QRDB 1Q821 2V8JA 4X6AI 4E2XA 3MONA 3JAMb 2I3CA 5T6BA 1I3QI 4HGZA 3CC41 2BJOA 1Q7Y2 5T64A 3I561 1NJI2 1RLYA 4XX2A 4E31A 3MZLB 2QEX1 3J80b 2JIRA 3CCEZ 1YJWZ 4MRIA 2VF1A 2OOXB 3G4S1 4DQYB 5IT9b 3CMAZ 3CCL1 5D1OA 1L1OC 2R92I 4E30A 1NUIA 1VQN1 1YIT1 4NBFA 3NDJA 3Q87A 1SFOI 1KD12 1VQM1 3CC2Z 3D2LA 2NVTI 3EERA 1S721 2OTJZ 4Y52I 3CCJ1 3G711 1WIIA 1LQLA 3CCRZ 1N8R2 1Q16A 2LIYA 4NB9A 3OW2Z 2OOYB 1VQ9Z 1VQP1 1VQ81 4A3JI 4NFRA 1YIJZ 1YHQ1 2JIPA 2V8KA 2W03A 4RS4A 4RVHA 3HKZA 1RNIA 3H3VJ 1QVGZ 1RO4A 2HF1A 2JA6I 5FLXb 1X0TA 1ZB9A 4BBRI 1SIWA 3IR7A 1YUKA 4NB8A 2P28A 1KC82 3S15I 5D1PA 3T4NB 1X3WA 2QR1B 2OTLZ 3BG0B 2W04A 3CCE1 3VMIA 5AN9F 1YJW1 4E33A 3CMEZ 3GTGI 1Z03A 3CCV1 3I55Z 1K9M2 1N2FA 4MD7A 1VQLZ 1TWAI 1Q862 1KQSZ 1KRLA 3IF8A 1VQKZ 2VPWA 3JAMf 4A3DI 2PM9A 4MD8A 4A93I 4AYBA 1AA6A 1VLAA 3CCMZ 1I50I 3S1RI 3TDHB 1TWFI 4MONA 3HOVI 2H85A 4EWCA 2F4OA 3S16I 1VQ7Z 4E2ZA 3VTNA 1KD11 4NBDA 1YUAA 4E32A 3CCR1 3GTJI 3J80f 3GTMI 3M4OI 3CD6Z 1VQ91 4NBBA 5C3EI 4E2YA 1Y1VS 5A2Qb 4BXXI 1P9NA 3MZKB 1NP6A 1Z01A 3FQMA 1N8R1 2NAPA 1M1K2 5D1OB 1RO0A 1Q812 2RIQA 1M902 1JWHC 1FDOA 2JA7I 2VUGA 4HGYA 3CCUZ 2E7ZA 3J81b 2VUMI 1YJNZ 1Y1VI 2OTL1 1I6HI 1Y8CA 3G6E1 3LUSA 3CPWZ 2JMOA 2P3YA 2JR6A 3EEDA 1KC81 3HOYI 4Y7NI 4RVGA 2Q4ZA 3CXCY 3CXCZ 4A3BI 3F3PC 1VQL1 5FLXf 1VQK1 3D6WA 4MD9A 3RZDI 3S2DI 3OW2Y 1WZNA 3CCM1 3IFUA 3KIFA 1K9M1 3NFZA 2IZ4A 1TWHI 3NH8A 1Q861 3PO2I 4NOZA 1QYPA 3HOUI 1WJ2A 1QVGY 2LFUA 2JUBA 3ESWA 3NH4A 2E2JI 2KI7B 3CD61 1TFIA 2GU2A 1VQ5Z 2K5RA 2AYDA 3GTLI 1YJ9Z 3PO3S 3GTKI 3F3FC 2DE7A 1K8A2 3D9XA
chains in the Genus database with same CATH topology
3S2HI 4E2WA 2JA8I 2JNYA 3NH5A 3KIHA 2QEXZ 2GTHA 3I4MI 3CMA1 1YJN1 1M1K1 1S7MA 3QWUA 3G4SZ 3PO3I 3P5JB 1Q811 2E9HA 1M901 1KQSY 1VQNZ 2Q51A 4NBEA 1YITZ 2QRCB 3CC21 1YI2Z 5A2Qf 4A3MI 4QTTA 2OTJ1 3GCFA 1QVFY 2IZ3A 1QVFZ 3FKII 2E2HI 2NVYI 3GTOI 1USPA 3G71Z 3J7A4 3M3YI 2O53A 4NH1C 5IT9f 1YIJ1 3HOXI 5C44I 2E2II 1TWGI 4NBGA 4A3EI 1VQ8Z 2M48A 1YHQZ 2QA4Z 2QREB 3GTQI 1YJ91 3VMGA 2Y0SA 1TWCI 2YU9I 2RT9A 1VQOZ 5C4JI 3HOZI 3CC7Z 3GKQA 4BY1I 1JJ2Y 1JJ2Z 1K732 2F4MA 2ZAEB 2PK7A 1K8A1 2G2KA 3CPWY 3CME1 1RO2A 1ZB8A 3S1MI 4A3GI 1DL6A 3I551 3S1NI 2JA5I 3CCVZ 2HU9A 4MH4A 2K3RA 1VQ6Z 3CCQZ 4QTUA 4MXUA 1Z02A 3NDIA 1YI21 4DGLA 4RVDA 5FLMI 1VQ4Z 4TNUA 3CCSZ 4NBHA 3S17I 1Q822 3HOWI 5T67A 2J6AA 1VQ71 2R6MA 3S1QI 3GTPI 4RV9A 4BY7I 3CQZI 4S1TA 3IX0A 2DE5A 2AKLA 4A3FI 2QLVB 2JS4A 1W2BY 1W2BZ 1ML8A 2GTIA 2QA41 2RPRA 3CC4Z 2YADA 4RVFA 4HH4A 3I56Z 2EGTA 1R9TI 2R7ZI 4NBAA 2OZKA 3I4NI 2R93I 4BBSI 1Y1WI 3CCU1 1VQO1 4DK1A 3S14I 2O4HA 3CC71 1X3ZA 3RZOI 5C4XI 3CCLZ 2NVQI 2B63I 1ZH1A 3VMHA 3G6EZ 3H0GI 5IP7I 1Q7Y1 1K83I 2QKDA 1USPB 2WB1A 1VQMZ 5CM2M 1NJI1 4CL1A 1K731 2M6NA 1QF8A 1VQ61 3CCQ1 4A3LI 3VB9A 3K7AI 3GTMS 3U50C 1S72Z 2PMZA 3FQQA 5IP9I 1WW9A 2RBLA 3CCJZ 2WAQA 1VQ41 4A3CI 4A3KI 2DE6A 3CCS1 3TE5B 3J81f 1RQFA 3BG1B 1PFTA 5LL6f 1VQPZ 4NBCA 3I07A 2V8IA 2RHBA 2KPIA 1VQ51 4A3II 1WCMI 2NVXI 2QRDB 1Q821 2V8JA 4X6AI 4E2XA 3MONA 3JAMb 2I3CA 5T6BA 1I3QI 4HGZA 3CC41 2BJOA 1Q7Y2 5T64A 3I561 1NJI2 1RLYA 4XX2A 4E31A 3MZLB 2QEX1 3J80b 3CCEZ 1YJWZ 4MRIA 2VF1A 2OOXB 3G4S1 4DQYB 5IT9b 3CMAZ 3CCL1 5D1OA 1L1OC 2R92I 4E30A 1NUIA 1VQN1 1YIT1 4NBFA 3NDJA 3Q87A 1SFOI 1KD12 1VQM1 3CC2Z 2NVTI 3EERA 1S721 2OTJZ 4Y52I 3CCJ1 3G711 1WIIA 1LQLA 3CCRZ 1N8R2 4NB9A 2LIYA 3OW2Z 2OOYB 1VQ9Z 1VQP1 1VQ81 4A3JI 4NFRA 1YIJZ 1YHQ1 2V8KA 2W03A 4RS4A 4RVHA 3HKZA 1RNIA 3H3VJ 1QVGZ 1RO4A 2HF1A 2JA6I 5FLXb 1X0TA 1ZB9A 4BBRI 1YUKA 4NB8A 2P28A 1KC82 3S15I 5D1PA 3T4NB 1X3WA 2QR1B 2OTLZ 3BG0B 2W04A 3CCE1 3VMIA 5AN9F 1YJW1 4E33A 3CMEZ 3GTGI 1Z03A 3CCV1 3I55Z 1K9M2 1N2FA 4MD7A 1VQLZ 1TWAI 1Q862 1KQSZ 1KRLA 3IF8A 1VQKZ 3JAMf 4A3DI 2PM9A 4MD8A 4A93I 4AYBA 1VLAA 3CCMZ 1I50I 3S1RI 3TDHB 1TWFI 4MONA 3HOVI 2H85A 4EWCA 2F4OA 3S16I 1VQ7Z 4E2ZA 3VTNA 1KD11 4NBDA 1YUAA 4E32A 3CCR1 3GTJI 3J80f 3GTMI 3M4OI 3CD6Z 1VQ91 4NBBA 5C3EI 4E2YA 1Y1VS 5A2Qb 4BXXI 1P9NA 3MZKB 1NP6A 1Z01A 3FQMA 1N8R1 1M1K2 5D1OB 1RO0A 1Q812 2RIQA 1M902 1JWHC 2JA7I 2VUGA 4HGYA 3CCUZ 3J81b 2VUMI 1YJNZ 1Y1VI 2OTL1 1I6HI 3G6E1 3LUSA 3CPWZ 2JMOA 2P3YA 2JR6A 3EEDA 1KC81 3HOYI 4Y7NI 4RVGA 2Q4ZA 3CXCY 3CXCZ 4A3BI 3F3PC 1VQL1 5FLXf 1VQK1 3D6WA 4MD9A 3RZDI 3S2DI 3OW2Y 3CCM1 3IFUA 3KIFA 1K9M1 3NFZA 2IZ4A 1TWHI 3NH8A 1Q861 3PO2I 4NOZA 1QYPA 3HOUI 1QVGY 2LFUA 2JUBA 3ESWA 3NH4A 2E2JI 2KI7B 3CD61 1TFIA 2GU2A 1VQ5Z 2K5RA 3GTLI 1YJ9Z 3PO3S 3GTKI 3F3FC 2DE7A 1K8A2 3D9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM Z;  1NJI 2;  1Q82 2;  1VQ7 1;  2QEX 1;  1VQ7 Z;  3CCE Z;  1YJW Z;  2QEX Z;  1KD1 1;  3CMA 1;  3CCR 1;  3G4S 1;  1YJN 1;  1M1K 1;  3CMA Z;  3CCL 1;  1VQ9 1;  3CD6 Z;  3G4S Z;  1Q81 1;  1VQN 1;  1M90 1;  1KQS Y;  1YIT 1;  1VQN Z;  1W2B Y;  1W2B Z;  1YIT Z;  2QA4 1;  3CC4 Z;  3CC2 1;  1YI2 Z;  1KD1 2;  1N8R 1;  1VQM 1;  3I56 Z;  3CC2 Z;  1M1K 2;  2OTJ 1;  1QVF Y;  1QVF Z;  1Q81 2;  1S72 1;  1M90 2;  2OTJ Z;  3CCU 1;  1VQO 1;  3CCJ 1;  3CC7 1;  3G71 1;  3CCU Z;  3G71 Z;  3CCR Z;  1N8R 2;  1YJN Z;  3OW2 Z;  3CCL Z;  1VQ9 Z;  1YIJ 1;  1VQP 1;  2OTL 1;  1VQ8 1;  1YIJ Z;  3G6E 1;  1YHQ 1;  1VQ8 Z;  3CPW Z;  3G6E Z;  1YHQ Z;  2QA4 Z;  1Q7Y 1;  1KC8 1;  1QVG Z;  1VQM Z;  1NJI 1;  1YJ9 1;  1K73 1;  3CXC Y;  3CXC Z;  1VQ6 1;  3CCQ 1;  1S72 Z;  1VQL 1;  1VQK 1;  1VQO Z;  3CCJ Z;  3CC7 Z;  1VQ4 1;  3CCS 1;  3OW2 Y;  3CCM 1;  1KC8 2;  1JJ2 Y;  1JJ2 Z;  1K9M 1;  1K73 2;  1VQP Z;  1K8A 1;  2OTL Z;  1Q86 1;  3CPW Y;  3CME 1;  3CCE 1;  1YJW 1;  3CME Z;  1QVG Y;  1VQ5 1;  3I55 1;  3CCV 1;  3CD6 1;  1VQ5 Z;  3I55 Z;  1Q82 1;  3CCV Z;  1YJ9 Z;  1K9M 2;  1VQ6 Z;  3CCQ Z;  1K8A 2;  1VQL Z;  1Q86 2;  1KQS Z;  1VQK Z;  3CC4 1;  1YI2 1;  1Q7Y 2;  1VQ4 Z;  3I56 1;  3CCS Z; 
#chains in the Genus database with same CATH topology
 3S2H I;  4E2W A;  2JA8 I;  2JNY A;  1FDI A;  3NH5 A;  2VPY A;  3KIH A;  2QEX Z;  2GTH A;  3I4M I;  3CMA 1;  1YJN 1;  1M1K 1;  2V45 A;  1S7M A;  3QWU A;  3G4S Z;  3PO3 I;  3P5J B;  1Q81 1;  2E9H A;  1M90 1;  1KQS Y;  2LEX A;  1VQN Z;  2Q51 A;  4NBE A;  1YIT Z;  2QRC B;  3CC2 1;  1YI2 Z;  5A2Q f;  4A3M I;  4QTT A;  2OTJ 1;  3GCF A;  1QVF Y;  2IZ3 A;  1QVF Z;  3FKI I;  2E2H I;  2JIO A;  2NVY I;  3GTO I;  1USP A;  3G71 Z;  3J7A 4;  3M3Y I;  2O53 A;  4NH1 C;  5IT9 f;  1YIJ 1;  3HOX I;  5C44 I;  2E2I I;  1TWG I;  4NBG A;  4A3E I;  1VQ8 Z;  2M48 A;  1YHQ Z;  2QA4 Z;  2QRE B;  3GTQ I;  1YJ9 1;  2VPX A;  3VMG A;  2Y0S A;  1TWC I;  2YU9 I;  2RT9 A;  1VQO Z;  5C4J I;  3HOZ I;  3CC7 Z;  3GKQ A;  4BY1 I;  1JJ2 Y;  1JJ2 Z;  1K73 2;  2F4M A;  2ZAE B;  2PK7 A;  1K8A 1;  2G2K A;  3CPW Y;  3CME 1;  1RO2 A;  1ZB8 A;  3S1M I;  4A3G I;  1DL6 A;  2IV2 X;  3I55 1;  3S1N I;  2JA5 I;  3CCV Z;  2HU9 A;  4MH4 A;  2K3R A;  1VQ6 Z;  3CCQ Z;  4QTU A;  4MXU A;  1Z02 A;  3NDI A;  1YI2 1;  4DGL A;  4RVD A;  5FLM I;  1VQ4 Z;  4TNU A;  3CCS Z;  4NBH A;  3S17 I;  1Q82 2;  3HOW I;  5T67 A;  2J6A A;  1VQ7 1;  2R6M A;  3S1Q I;  3GTP I;  4RV9 A;  4BY7 I;  3CQZ I;  4S1T A;  3IX0 A;  2DE5 A;  2AKL A;  4A3F I;  2QLV B;  2JS4 A;  1W2B Y;  1W2B Z;  1ML8 A;  2GTI A;  2QA4 1;  2RPR A;  3CC4 Z;  2YAD A;  4RVF A;  4HH4 A;  3I56 Z;  2EGT A;  1R9T I;  2R7Z I;  4NBA A;  2JIQ A;  2OZK A;  3I4N I;  2R93 I;  2JIM A;  4BBS I;  1Y1W I;  3CCU 1;  1VQO 1;  4DK1 A;  3S14 I;  2O4H A;  3CC7 1;  1X3Z A;  3RZO I;  5C4X I;  3CCL Z;  2NVQ I;  2B63 I;  1ZH1 A;  3VMH A;  3G6E Z;  3H0G I;  5IP7 I;  1Q7Y 1;  1K83 I;  2QKD A;  1USP B;  2WB1 A;  1VQM Z;  5CM2 M;  1NJI 1;  4CL1 A;  1K73 1;  2M6N A;  1QF8 A;  1VQ6 1;  3CCQ 1;  4A3L I;  3VB9 A;  3K7A I;  3GTM S;  3U50 C;  1S72 Z;  2PMZ A;  3FQQ A;  5IP9 I;  1WW9 A;  2RBL A;  3CCJ Z;  2WAQ A;  1VQ4 1;  4A3C I;  4A3K I;  2DE6 A;  2VPZ A;  3CCS 1;  3TE5 B;  3J81 f;  1RQF A;  3BG1 B;  1PFT A;  5LL6 f;  1VQP Z;  4NBC A;  3I07 A;  2V8I A;  2V3V A;  2RHB A;  1QXF A;  2KPI A;  1VQ5 1;  4A3I I;  1WCM I;  2NVX I;  2QRD B;  1Q82 1;  2V8J A;  4X6A I;  4E2X A;  3MON A;  3JAM b;  2I3C A;  5T6B A;  1I3Q I;  4HGZ A;  3CC4 1;  2BJO A;  1Q7Y 2;  5T64 A;  3I56 1;  1NJI 2;  1RLY A;  4XX2 A;  4E31 A;  3MZL B;  2QEX 1;  3J80 b;  2JIR A;  3CCE Z;  1YJW Z;  4MRI A;  2VF1 A;  2OOX B;  3G4S 1;  4DQY B;  5IT9 b;  3CMA Z;  3CCL 1;  5D1O A;  1L1O C;  2R92 I;  4E30 A;  1NUI A;  1VQN 1;  1YIT 1;  4NBF A;  3NDJ A;  3Q87 A;  1SFO I;  1KD1 2;  1VQM 1;  3CC2 Z;  3D2L A;  2NVT I;  3EER A;  1S72 1;  2OTJ Z;  4Y52 I;  3CCJ 1;  3G71 1;  1WII A;  1LQL A;  3CCR Z;  1N8R 2;  1Q16 A;  2LIY A;  4NB9 A;  3OW2 Z;  2OOY B;  1VQ9 Z;  1VQP 1;  1VQ8 1;  4A3J I;  4NFR A;  1YIJ Z;  1YHQ 1;  2JIP A;  2V8K A;  2W03 A;  4RS4 A;  4RVH A;  3HKZ A;  1RNI A;  3H3V J;  1QVG Z;  1RO4 A;  2HF1 A;  2JA6 I;  5FLX b;  1X0T A;  1ZB9 A;  4BBR I;  1SIW A;  3IR7 A;  1YUK A;  4NB8 A;  2P28 A;  1KC8 2;  3S15 I;  5D1P A;  3T4N B;  1X3W A;  2QR1 B;  2OTL Z;  3BG0 B;  2W04 A;  3CCE 1;  3VMI A;  5AN9 F;  1YJW 1;  4E33 A;  3CME Z;  3GTG I;  1Z03 A;  3CCV 1;  3I55 Z;  1K9M 2;  1N2F A;  4MD7 A;  1VQL Z;  1TWA I;  1Q86 2;  1KQS Z;  1KRL A;  3IF8 A;  1VQK Z;  2VPW A;  3JAM f;  4A3D I;  2PM9 A;  4MD8 A;  4A93 I;  4AYB A;  1AA6 A;  1VLA A;  3CCM Z;  1I50 I;  3S1R I;  3TDH B;  1TWF I;  4MON A;  3HOV I;  2H85 A;  4EWC A;  2F4O A;  3S16 I;  1VQ7 Z;  4E2Z A;  3VTN A;  1KD1 1;  4NBD A;  1YUA A;  4E32 A;  3CCR 1;  3GTJ I;  3J80 f;  3GTM I;  3M4O I;  3CD6 Z;  1VQ9 1;  4NBB A;  5C3E I;  4E2Y A;  1Y1V S;  5A2Q b;  4BXX I;  1P9N A;  3MZK B;  1NP6 A;  1Z01 A;  3FQM A;  1N8R 1;  2NAP A;  1M1K 2;  5D1O B;  1RO0 A;  1Q81 2;  2RIQ A;  1M90 2;  1JWH C;  1FDO A;  2JA7 I;  2VUG A;  4HGY A;  3CCU Z;  2E7Z A;  3J81 b;  2VUM I;  1YJN Z;  1Y1V I;  2OTL 1;  1I6H I;  1Y8C A;  3G6E 1;  3LUS A;  3CPW Z;  2JMO A;  2P3Y A;  2JR6 A;  3EED A;  1KC8 1;  3HOY I;  4Y7N I;  4RVG A;  2Q4Z A;  3CXC Y;  3CXC Z;  4A3B I;  3F3P C;  1VQL 1;  5FLX f;  1VQK 1;  3D6W A;  4MD9 A;  3RZD I;  3S2D I;  3OW2 Y;  1WZN A;  3CCM 1;  3IFU A;  3KIF A;  1K9M 1;  3NFZ A;  2IZ4 A;  1TWH I;  3NH8 A;  1Q86 1;  3PO2 I;  4NOZ A;  1QYP A;  3HOU I;  1WJ2 A;  1QVG Y;  2LFU A;  2JUB A;  3ESW A;  3NH4 A;  2E2J I;  2KI7 B;  3CD6 1;  1TFI A;  2GU2 A;  1VQ5 Z;  2K5R A;  2AYD A;  3GTL I;  1YJ9 Z;  3PO3 S;  3GTK I;  3F3F C;  2DE7 A;  1K8A 2;  3D9X A; 
#chains in the Genus database with same CATH homology
 3S2H I;  4E2W A;  2JA8 I;  2JNY A;  3NH5 A;  3KIH A;  2QEX Z;  2GTH A;  3I4M I;  3CMA 1;  1YJN 1;  1M1K 1;  1S7M A;  3QWU A;  3G4S Z;  3PO3 I;  3P5J B;  1Q81 1;  2E9H A;  1M90 1;  1KQS Y;  1VQN Z;  2Q51 A;  4NBE A;  1YIT Z;  2QRC B;  3CC2 1;  1YI2 Z;  5A2Q f;  4A3M I;  4QTT A;  2OTJ 1;  3GCF A;  1QVF Y;  2IZ3 A;  1QVF Z;  3FKI I;  2E2H I;  2NVY I;  3GTO I;  1USP A;  3G71 Z;  3J7A 4;  3M3Y I;  2O53 A;  4NH1 C;  5IT9 f;  1YIJ 1;  3HOX I;  5C44 I;  2E2I I;  1TWG I;  4NBG A;  4A3E I;  1VQ8 Z;  2M48 A;  1YHQ Z;  2QA4 Z;  2QRE B;  3GTQ I;  1YJ9 1;  3VMG A;  2Y0S A;  1TWC I;  2YU9 I;  2RT9 A;  1VQO Z;  5C4J I;  3HOZ I;  3CC7 Z;  3GKQ A;  4BY1 I;  1JJ2 Y;  1JJ2 Z;  1K73 2;  2F4M A;  2ZAE B;  2PK7 A;  1K8A 1;  2G2K A;  3CPW Y;  3CME 1;  1RO2 A;  1ZB8 A;  3S1M I;  4A3G I;  1DL6 A;  3I55 1;  3S1N I;  2JA5 I;  3CCV Z;  2HU9 A;  4MH4 A;  2K3R A;  1VQ6 Z;  3CCQ Z;  4QTU A;  4MXU A;  1Z02 A;  3NDI A;  1YI2 1;  4DGL A;  4RVD A;  5FLM I;  1VQ4 Z;  4TNU A;  3CCS Z;  4NBH A;  3S17 I;  1Q82 2;  3HOW I;  5T67 A;  2J6A A;  1VQ7 1;  2R6M A;  3S1Q I;  3GTP I;  4RV9 A;  4BY7 I;  3CQZ I;  4S1T A;  3IX0 A;  2DE5 A;  2AKL A;  4A3F I;  2QLV B;  2JS4 A;  1W2B Y;  1W2B Z;  1ML8 A;  2GTI A;  2QA4 1;  2RPR A;  3CC4 Z;  2YAD A;  4RVF A;  4HH4 A;  3I56 Z;  2EGT A;  1R9T I;  2R7Z I;  4NBA A;  2OZK A;  3I4N I;  2R93 I;  4BBS I;  1Y1W I;  3CCU 1;  1VQO 1;  4DK1 A;  3S14 I;  2O4H A;  3CC7 1;  1X3Z A;  3RZO I;  5C4X I;  3CCL Z;  2NVQ I;  2B63 I;  1ZH1 A;  3VMH A;  3G6E Z;  3H0G I;  5IP7 I;  1Q7Y 1;  1K83 I;  2QKD A;  1USP B;  2WB1 A;  1VQM Z;  5CM2 M;  1NJI 1;  4CL1 A;  1K73 1;  2M6N A;  1QF8 A;  1VQ6 1;  3CCQ 1;  4A3L I;  3VB9 A;  3K7A I;  3GTM S;  3U50 C;  1S72 Z;  2PMZ A;  3FQQ A;  5IP9 I;  1WW9 A;  2RBL A;  3CCJ Z;  2WAQ A;  1VQ4 1;  4A3C I;  4A3K I;  2DE6 A;  3CCS 1;  3TE5 B;  3J81 f;  1RQF A;  3BG1 B;  1PFT A;  5LL6 f;  1VQP Z;  4NBC A;  3I07 A;  2V8I A;  2RHB A;  2KPI A;  1VQ5 1;  4A3I I;  1WCM I;  2NVX I;  2QRD B;  1Q82 1;  2V8J A;  4X6A I;  4E2X A;  3MON A;  3JAM b;  2I3C A;  5T6B A;  1I3Q I;  4HGZ A;  3CC4 1;  2BJO A;  1Q7Y 2;  5T64 A;  3I56 1;  1NJI 2;  1RLY A;  4XX2 A;  4E31 A;  3MZL B;  2QEX 1;  3J80 b;  3CCE Z;  1YJW Z;  4MRI A;  2VF1 A;  2OOX B;  3G4S 1;  4DQY B;  5IT9 b;  3CMA Z;  3CCL 1;  5D1O A;  1L1O C;  2R92 I;  4E30 A;  1NUI A;  1VQN 1;  1YIT 1;  4NBF A;  3NDJ A;  3Q87 A;  1SFO I;  1KD1 2;  1VQM 1;  3CC2 Z;  2NVT I;  3EER A;  1S72 1;  2OTJ Z;  4Y52 I;  3CCJ 1;  3G71 1;  1WII A;  1LQL A;  3CCR Z;  1N8R 2;  4NB9 A;  2LIY A;  3OW2 Z;  2OOY B;  1VQ9 Z;  1VQP 1;  1VQ8 1;  4A3J I;  4NFR A;  1YIJ Z;  1YHQ 1;  2V8K A;  2W03 A;  4RS4 A;  4RVH A;  3HKZ A;  1RNI A;  3H3V J;  1QVG Z;  1RO4 A;  2HF1 A;  2JA6 I;  5FLX b;  1X0T A;  1ZB9 A;  4BBR I;  1YUK A;  4NB8 A;  2P28 A;  1KC8 2;  3S15 I;  5D1P A;  3T4N B;  1X3W A;  2QR1 B;  2OTL Z;  3BG0 B;  2W04 A;  3CCE 1;  3VMI A;  5AN9 F;  1YJW 1;  4E33 A;  3CME Z;  3GTG I;  1Z03 A;  3CCV 1;  3I55 Z;  1K9M 2;  1N2F A;  4MD7 A;  1VQL Z;  1TWA I;  1Q86 2;  1KQS Z;  1KRL A;  3IF8 A;  1VQK Z;  3JAM f;  4A3D I;  2PM9 A;  4MD8 A;  4A93 I;  4AYB A;  1VLA A;  3CCM Z;  1I50 I;  3S1R I;  3TDH B;  1TWF I;  4MON A;  3HOV I;  2H85 A;  4EWC A;  2F4O A;  3S16 I;  1VQ7 Z;  4E2Z A;  3VTN A;  1KD1 1;  4NBD A;  1YUA A;  4E32 A;  3CCR 1;  3GTJ I;  3J80 f;  3GTM I;  3M4O I;  3CD6 Z;  1VQ9 1;  4NBB A;  5C3E I;  4E2Y A;  1Y1V S;  5A2Q b;  4BXX I;  1P9N A;  3MZK B;  1NP6 A;  1Z01 A;  3FQM A;  1N8R 1;  1M1K 2;  5D1O B;  1RO0 A;  1Q81 2;  2RIQ A;  1M90 2;  1JWH C;  2JA7 I;  2VUG A;  4HGY A;  3CCU Z;  3J81 b;  2VUM I;  1YJN Z;  1Y1V I;  2OTL 1;  1I6H I;  3G6E 1;  3LUS A;  3CPW Z;  2JMO A;  2P3Y A;  2JR6 A;  3EED A;  1KC8 1;  3HOY I;  4Y7N I;  4RVG A;  2Q4Z A;  3CXC Y;  3CXC Z;  4A3B I;  3F3P C;  1VQL 1;  5FLX f;  1VQK 1;  3D6W A;  4MD9 A;  3RZD I;  3S2D I;  3OW2 Y;  3CCM 1;  3IFU A;  3KIF A;  1K9M 1;  3NFZ A;  2IZ4 A;  1TWH I;  3NH8 A;  1Q86 1;  3PO2 I;  4NOZ A;  1QYP A;  3HOU I;  1QVG Y;  2LFU A;  2JUB A;  3ESW A;  3NH4 A;  2E2J I;  2KI7 B;  3CD6 1;  1TFI A;  2GU2 A;  1VQ5 Z;  2K5R A;  3GTL I;  1YJ9 Z;  3PO3 S;  3GTK I;  3F3F C;  2DE7 A;  1K8A 2;  3D9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...