2K3RA

Pfu rpp21 structure and assignments
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
b'KERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCKKCHAFLVPGINARVRLRQKRMPHIVVKCLECGHIMRYPYIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 4
publication title Solution structure of Pyrococcus furiosus RPP21, a component of the archaeal RNase P holoenzyme, and interactions with its RPP29 protein partner.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 20
structure length 91
sequence length 91
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2008-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2k3rA01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2k3rA02
1EC5A 2B87A 4ASVA 1JM0A 1H0TA 1OVVA 3RGUA 4ZMDA 2LXCB 4GODA 4IOIH 4BXLA 1EDKA 3S1KA 1NVOA 1LP1A 2KI7B 1U7MA 4NPDA 1BDCA 1JMBA 4GOFA 1Y47A 2KZJA 3FXDA 4K35A 5DJTB 4NPFX 4ZNCA 2KIKA 2SPZA 2LXBA 4KJMA 2I8DA 1LP1B 3ZDMA 1EDLA 2OTKE 4MN4C 2RKLA 1BDDA 2WMMA 4HJGH 1EDJA 2LR2A 1U7JA 2M0BA 4EYYQ 4HB1A 4CPGA 4HKZH 2P58A 3QWOC 5C39A 2UWJE 4JBZA 4GOEA 3PH0A 1LT1A 2KUBA 3MZWB 1DEEG 2KS1B 1ZW0A 2KZIA 4WWIA 2K3RA 4ASWA 5CBOA 4K3AA 2QVAA 3MHVA 2JWDA 2HR3A 2B88A 2ZAEB 4NPEA 1MFTA 2M5AA 2QRXA 5EFWB 3FXEA 5DJUB 5CBNA 1X0TA 2B89A 1OVUA 1FC2C 1S3JA 1EDIA 1SS1A 1OVRA 1ZXGA 2B87B 2R44A 5K5GB 1H0TB 2Q1KA 1Q2NA 2M5AB
chains in the Genus database with same CATH superfamily
2HFED 3HD7A 2DW3A 1UIXA 2LEXA 3T97A 2YKQA 1DIPA 4QTTA 4Y99B 1OZHA 3M9HA 3F89A 3W68A 1T8ZA 2R32A 1N7SC 1L0NE 3G6EP 1SQBK 2JIRA 3A2AA 3P8CE 3HE4B 2YADA 1BCCD 1Q16A 5APQA 2QSIA 4A3EI 5FLXf 1KC82 2ZYDA 4NBHA 3BCCG 1Y47A 1LT9B 2A06G 3BG0B 1FZFA 1NTMG 4Y7NI 1X9VA 2W8ZA 3L74G 3CWBD 4C7NA 2WMMA 2WSSH 1UIIA 1U7JA 4NOZA 3L71D 3U1CA 1JUNA 5TISE 1K732 1S72P 1K05A 1VQO1 1YIJ1 3QWOC 3CC71 3PO3I 2IYPA 5CCGD 2UWJE 2OTLP 1QVGZ 3L72E 2JA6I 4A3MI 1FJPA 1ZN5A 2E74D 3H1HG 2Q3EA 3CMEP 1P84I 5BU5A 2NVYI 5IP9I 3E1RA 3NXSA 2E74C 1VQ6P 3MZLB 3MZKB 1JEKA 2ZJSE 5APSA 2WT7B 1YUKA 1NU1K 2IZ0A 3B5NC 1LTJB 1R5SA 3M06A 1H0TB 2FYUG 1SQVK 1Q2NA 4ZKPA 3CCE1 3CCUZ 2AEJA 4Z1MH 5KLVG 1OVVA 3CCJ1 3HRNA 1GTWA 1FZEA 3G4SZ 3OW2Z 1KFMA 2NPSA 4N3YB 1FAVA 5CJ0A 2I3CA 3CC4P 1W2EA 1YITZ 1OW7A 1HTLC 1VQ9Z 2WPSA 1KQSO 3I55P 1KYOD 3P8CD 4L76A 5KTBA 1L4AC 1S2EA 2XDJA 4TLFA 1FBMA 3U59A 5AW6B 2A45H 1N7LA 4TNUA 3CCL1 3RL0g 2HPCA 3I5CA 2LR2A 2IBZG 1VLAA 2F4MA 2RH0A 2RPRA 1VQ7Z 2OOXB 1WMKA 2FXMA 2GTHA 1PP9J 1PFTA 3TGUG 3G9RA 1ZR4A 4JBZA 4I6MC 2O1JA 4PD4H 2C9LY 3I56Z 2QJKB 2J59M 2YMYA 2QM8A 3H1LD 1KFNA 5CCHA 3AE5C 2IZ3A 1LJ2A 3L72D 2RT9A 2O53A 3BRVB 2JWDA 1WIIA 1G1JA 1SQQJ 4NB9A 1SQXG 3L70D 3U1AA 3WUUA 4O9BA 2PMZA 2E76D 5GTHE 3CX5H 4GIFA 5APVA 4OWFA 3HE5A 1WJ2A 2QIWA 1M902 1L0LJ 1NYHA 2Y0CA 2BCCD 4WY4D 2H43A 3Q3DA 1VQ5P 5APUA 1XTGB 1L1OC 1RE3C 3FX0A 3CCSZ 1SQPG 3T97B 3J81b 2Q9IA 5C39A 5BU8B 2LFUA 1HBWA 2V8JA 3CXHE 3H25A 1J1EB 3RGUA 4WY4C 3GF3A 4S1TA 1K8A1 2E7ZA 1RO2A 1QGKB 4A3BI 5T67A 4BXLA 3SWYA 3S1KA 1LP1A 1LTBC 4NH1C 1I6HI 1BDCA 4H13B 1KC8Q 1TWGI 2GUVA 1T6AA 3CCV1 3C9IA 2KLVA 5DJTB 1NTZK 2M3BA 3BCCJ 5IT9f 1YJNP 1M1K1 1VQ81 4HYTB 3VMGA 2JA8I 1PP9E 1X3ZA 2RMZA 1NTMJ 4HJGH 4PD4E 1IFPA 1ZRTE 1OFCX 1K73Q 1VQM1 3AECC 2HF1A 3VMZA 1JY3N 1QXFA 1AVYA 3NDJA 3RK2C 3EFFK 1SQQE 4YPCA 1Q861 3EEDA 2H8PD 3E7KA 1URQC 4WWIA 1T2KD 3CX5E 3K7AI 1VQOZ 3CMA1 2RBLA 1YIJZ 1RQUA 2PP6A 2O4HA 5AVTB 1R5LA 3VMXA 3CC7Z 1USPA 3H1KD 2QVAA 3H1HJ 1MFZA 3D9XA 1L0LE 3USSA 1ZP0C 2FFDB 2V7QH 1KN7A 3M0AA 1KD1Q 4BBSI 3S1NI 2P67A 2N1TA 3AE1C 4H0LD 1TWFI 3L37A 5AVQB 4E31A 1VQ4P 3GMAA 2R44A 3KQGA 1SQBD 4XFJA 3V5BA 3L36A 5KJ7D 3H6PA 3J80b 4H0LC 2FYUJ 4GDOA 5KKZB 1GW3A 2V4HA 3WMM0 4E2ZA 2YNYA 1HH0A 2IV2X 3CXHD 3BCCE 1SQPK 1KB9H 5KJ7C 3Q2YA 4OVNF 4X6AI 2A06E 4DZOA 3TDKA 2BJOA 3RK3E 4OH8B 3I07A 4B86A 2PAJA 3NH4A 1LTIC 3GTMI 3GG2A 2IFNA 1N7SA 2Q6QA 2I1KA 1NTME 2QJYC 3AEBC 3VOPA 4IL6H 3L74E 1IK9A 1RF1C 2W83C 1RF0C 3WUVA 1E79H 2LXBA 2M8RA 3VYIA 4KJMA 1HGVA 2HPCB 5D1OA 3IF4A 3CC2P 2JR6A 4W7YA 4A3II 3TSIA 3AEDC 3SSUA 3MGNA 2D2CC 1S5LH 3V2RA 2BEZF 2P10A 1IC2A 1ZRTD 3H1HE 4RVFA 2R5DA 1Y1VS 1N8R2 3KYQA 2OTJ1 1Y9BA 4UB8H 3KXDA 1Q811 1FDIA 3CQZI 1L0NK 5CBOA 2K3RA 1VQL1 1NAYA 2YU9I 3O8ZA 1NU1D 1VF5D 5H2FH 3MHVA 2HR3A 3EFGA 3A3YB 4NPEA 2RHBA 3HE5B 2HU9A 2W6JH 1ZB9A 3S1QI 2IZ1A 1SQXJ 4PV1D 1RHZB 5CCGA 1VF5C 1M90Q 3D70A 3C8VA 2FYUE 3FQMA 1LTGC 5KLVE 2YIUB 5AVSB 1HWTC 3HOYI 5CJ4A 1IZNB 2WQYC 2OYIA 1PIXA 1YI21 1FOSF 3GTGI 2Z5HA 4ZMDA 2KB7P 3H1IG 2VUGA 4GODA 3SWKA 1RLYA 1PPJG 3G4SP 2ZT9B 4NPDA 1GDTA 4DJGA 1RQFA 2YKPA 1NWQA 1YITP 3GTJI 2A06D 4RVHA 1TFIA 3VMHA 3CCM1 3L73G 1M56D 4PJ0H 3GHGB 3HTKB 1YHQ1 2IBZE 3O6QA 1LNQA 2OTKE 1KQLA 4L74A 3L74D 5B5EE 1Q822 5KLIC 1S1CX 3VP9A 2QA41 1BDDA 3RK3C 2C0XA 3TGUE 3IN6A 4LLHA 1SFCD 4UB8E 4I7ZB 2FXPA 1KB9I 4BBRI 1VQ7P 1AA6A 1FDOA 1NTKG 4UB6H 2POHA 2XKMA 3BASA 2XU6A 1SFCC 5GTIH 3H0GI 1YJ91 4IFFA 3IFUA 3JAMf 3NTNA 1BE3D 1P84H 1SQXE 2KZIA 4A3DI 3C1LA 4RO0A 2QEXZ 1IJDB 1YUAA 4BRYA 1K8A2 3IF8A 3CMAZ 2AXTE 2N1TB 2Q5UA 5FLMI 5EFWB 3MONA 1SQPE 3TK1A 1BSNA 1HUCA 1S3JA 4RVGA 3MUDC 5E79H 3T4NB 4EDFA 3Q5PA 1E5WA 2OYHC 1S9KE 2FYUD 4MD8A 3CCQP 2O3JA 5KLVD 2IYOA 4OGQB 2G8YA 3AE2C 2V8IA 2JMOA 2WWWA 1RE3A 3M91A 1WCMI 3JSVC 5AVYB 2N9BA 3CCRP 1QL1A 2JP3A 1NKNA 2J58A 4PJ0E 4WY4A 1VQN1 4A3KI 3H1JG 2ZVOB 1JTHA 1Z01A 3K5BA 3CL3D 2YO2A 4D6TJ 4L75A 3JCUH 2B9BA 1KMIZ 1GD2E 2OOYB 5AN9F 2QJPB 2OQQA 5KAFH 4HGZA 5B66H 3G71Z 4NBFA 5AVZB 2IBZD 2ZXXA 5GTIE 4RVDA 2ZYAA 1P84E 1PV3A 3TGUD 2QE7H 3VTNA 4A3FI 1N8RQ 2CPBA 1P9NA 1QYPA 1GK6A 2KS1B 3A5TA 4ASWA 2KSJA 1J2JB 2PGDA 3G6E1 4MONA 4Y99C 2WSEH 3OA7A 3CD6Z 2WSEJ 3H3VJ 1BGYD 1VQKZ 5CM2M 1GL2B 2XV5A 1G1IA 5FLXb 3V2NA 4IFDK 1DD3A 2IZ4A 1AV1A 1MKMA 2E74B 3IX0A 1LT9C 2JIOA 3NMDA 2OYIB 3KHUA 1ZXGA 3SFEC 2GM4A 1SQPD 3B5ND 1AFOA 3GW6A 3VTPC 5AW2B 1S721 1S9KD 4EI2A 5A2Qf 3PTZA 1SQQK 3FQQA 1W2BZ 3LIDA 1KD12 3H1IJ 1VQPP 3M0DA 1KYOI 2OTL1 1W2BO 3JCUE 1EXIA 4LGDE 1EZVG 5B66E 2YKOA 1L0LK 3L75D 1YJWZ 3CME1 1PGJA 5KJ7A 1SIWA 4A3LI 2R93I 3O6QB 2JS4A 1Q812 2GUSA 4QMAA 1JNMA 3L73J 1EDLA 3RZOI 1Q82Q 1K9M2 1X79B 3HUSA 1VQ61 1L4AD 1KILB 4MRIA 4IL6X 5C3EI 2WZ7A 1NHLA 1RF0A 4U3FG 5IP7I 5A2Qb 1KQSZ 1L0ND 2AXCA 1YHQZ 2M0BA 4KHXA 4CPGA 3R4YA 5C4XI 1KQFB 1KV4A 3TF5A 2RIQA 1S5LX 5AW1B 4GOEA 1NTKJ 3FGAD 1IK7A 3D6ZA 3AE6C 3KIFA 3PP5A 1OIPA 2QM7A 4BRYB 2BEQD 3CC41 1JY2P 1YJ9Z 1K8AQ 3SWFA 1NTMK 2JIQA 3I551 4CL1A 1FZCB 3GF7A 1WW9A 1W2BY 3EQ2A 3P32A 1Z56A 3N4XA 3H1IE 1T3UA 1N73C 1PPJE 3LUSA 3A0BH 1JOCA 2E76B 2OYOA 1PZQA 3QWUA 1GU4A 1PGQA 4R4MA 2JWAA 3S17I 1EQ7A 2VPYA 4NBCA 2Y0EA 4JQ0D 1NKZB 3L73E 2QLVB 1YQ3C 1JTHB 1KQSY 3HD7B 3TE5B 2QJKC 4AUWA 2M6NA 3VP8A 1JB0J 1TWAI 2PM9A 1JY3O 2KIKA 3H1JJ 2O01N 2JUBA 4JF7A 2YXRB 3HOVI 1AQTA 2FXOA 1VQNZ 3ITKA 4W7ZA 2FYUK 3MD0A 1I50I 3H32A 5KLVK 2DE6A 1NTKE 3TNUA 3VB9A 1QX8A 2JNYA 1VQ51 2C9NY 4C7RA 1A02F 1TWCI 5APWA 2FYNB 4RS4A 2L5GB 4C7NB 2O1KA 3I4NI 1S7MA 3GTKI 2DE7A 4AYBA 1HF9A 4K3AA 3KZIH 3RK2D 2WITA 3V6IA 1J1EC 1SFCA 2QEXP 1URQD 2P28A 2M5AA 2M48A 2V3VA 3TDHB 1RQVA 3A0BE 2ZFCA 1YJN1 3FXEA 5DJUB 4BY1I 5IT9b 1DL6A 1FC2C 1OVUA 3HOXI 1EDIA 1SS1A 1OW8A 1LQLA 3VMIA 5AVVB 3CXHI 3AE8C 3PO3S 4NBEA 2V7QJ 2E9HA 1M1JC 2O01H 2FYZA 3WU2H 2O01J 1M7LA 1HJ0A 3S2DI 2OYHA 2YMKA 4H0LB 3H1JE 1MZ9A 1SQXK 2H85A 2NVQI 1JMBA 2RN0A 4GOFA 3GTOI 5AW3B 1WRGA 1KC81 4GT1A 3FXDA 3D6YA 4ZNCA 1RE4C 3L73D 1RH5B 3KPEA 1LGHB 3HUSB 5M1BA 4WB4A 1DD4A 1Q81Q 2NPSB 1K9MQ 1DX7A 1R9TI 1QVFO 2Y0DA 3H1LG 2FFDC 4NBDA 3CMEZ 3CCEZ 4HH2A 3G71P 3CCJZ 4U3FJ 1VQ41 4D6TG 1HJBA 3L70G 1VQ6Z 2Q7CA 3KZIE 4AQRD 2D2CD 3M9QA 2KUBA 3KDPB 1GMJA 2QR1B 1NTZJ 2BCCG 3IAOA 4H44B 3RBZA 3B71A 2PRRA 1BSHA 3MP7B 1FU1A 2P3YA 2VF1A 4DT0A 4BXXI 1PP9D 1GW4A 1ZB8A 1IFNA 2B88A 4Y28J 3CD6P 4PD4D 3CCLZ 5AW8B 1VQKP 4Y52I 2E75B 4XX2A 1FZGA 1X0TA 3TYYA 2XZRA 3WU2E 4EOTA 3CC21 1SQQD 2VUMI 3S16I 2JEEA 2VPXA 3HE4A 1BCCJ 3BATA 2B87A 3CX5D 4PV1B 1N86A 1TWHI 1EZVE 1L0LD 1QVFY 2JR8A 2HG5D 1YQ4C 2AEFA 2PK7A 1WZNA 1RO0A 2MJZA 3CWBJ 1X3WA 3GCFA 2WAQA 2WPVB 1NOHA 3L71J 1KB9E 3B5NA 4DCKA 1YJWP 5AW7B 3CCUP 3RL0D 2WPRA 4U3FE 4ZKUA 1LP1B 1Y1WI 4IL6E 5L8RJ 2R3CA 2WPQA 2QKDA 2L91A 3S14I 3H1KG 5KLIB 3RL0C 3G3ZA 3BCCD 2E43A 1VQ9P 4HKZH 3RK3D 2Q51A 2P1JA 1CW5A 1QL2A 2YIUC 3FKII 1S5LE 2E2II 1NTMD 3VN0A 2KNCA 3CCVZ 2WT7A 1IFDA 1L4AA 2R92I 2NVXI 3G4S1 3NH8A 3GTQI 1I3QI 2E5TA 1MV8A 2WB1A 3S15I 2NZ2A 1SQBG 1JY2N 1EXJA 1VQ8Z 1YIT1 2K5RA 3L4FA 5H2FE 1GK4A 5AVUB 2NAPA 2H89C 2J5UA 3I56P 3KIHA 5CHXA 1M901 3H1HD 1VQMZ 1USPB 2J6AA 1NJI1 2MKVA 1OVRA 2HYNA 1J1DC 3GHGC 4NBAA 2V8KA 1YJNZ 3U50C 1KYOH 1ZR2A 1LWUC 2P7JA 3L35A 1PGOA 3RBXA 1QF8A 1VQ71 5AW0B 1DH3A 3PJSK 3S2HI 1N73A 2PFXA 3F3PC 4GKGA 1EZVD 4E2XA 2CK3H 3B8EB 4XA4A 1RNIA 1USDA 3JAMb 3VMYA 3CCSP 2E5YA 1M1K2 2V45A 2IBZI 1KB9D 1JCCA 5TISH 3F3FC 1MUUA 1ZMEC 1U57A 1YBKA 1N7SB 3H1LJ 1NU1G 4KT0J 3L72J 2N1TC 1NH4A 4RJTA 3CCQ1 1Q862 3L70J 4EWCA 1SQVG 5D1OB 3PH0A 4HGYA 3NFZA 5BVZA 2WSCH 4OGQC 4UB6E 3CCR1 3GTMS 1L2PA 2BCCJ 2KPIA 2QRDB 2WSFH 2WSFJ 3NFQA 2H88C 2M3EA 2ZAEB 2KP8A 3GTLI 1KILE 2IFMA 1N2DC 2IPPA 5APXA 2FKWB 2W6AA 4LC1A 1M57D 1KYOE 5C44I 3FWNA 2B89A 1ML8A 1DEBA 1AVOA 1N2FA 1VQOP 2B87B 1YIJP 1NUIA 1NTKK 3AE9C 2B63I 2Q3IA 3CC7P 1SQXD 2QJPC 3E1IA 2OTJZ 1URQA 2LXCB 4BWNA 2QG4A 1VQLZ 3B4SA 5E79E 3CC2Z 2KLUA 1Q7Y1 1EDKA 1KZUB 2G2KA 3N7NA 2IDBA 5TJHA 1Y8CA 1JO5A 1M1JA 1YTZI 3B5NB 3PRJA 3AE7C 3CXCZ 1W5CE 1ZH1A 1QLED 2WTYA 3H1LE 3OAKA 2JKVA 2K37A 1FOSE 1GL2D 4HH4A 1CSBA 1QVGO 2RKLA 1BE3G 3NDIA 3W67A 4D6TE 4L73A 3L70E 1RE4A 3NH5A 1AJYA 1EDJA 4A3CI 1CI6A 1JCDA 5CCGC 1YI2Z 3CCEP 5KAFE 1GL2C 4I1LA 3CCJP 1Y8AA 4HB1A 3J7A4 3H1KJ 1QEXA 2JA7I 2FFDA 2BCCE 3S1RI 2KNCB 1PL5A 4JYBA 3A7OA 1HGZA 2OYIC 1L4AB 2JIPA 1N8R1 1JMMA 1T3JA 2BASA 5GTHH 1RF1A 1WT6A 3EERA 3CCMZ 1VQP1 2FBWC 1NGMB 1ZLLA 5APYA 3BRTB 1OX3A 1SQBJ 1MFTA 3Q5RA 4MD7A 2QA4Z 4WBAA 3CCLP 1NTZG 1LTJC 1P84D 2C0WA 3OW2O 1KILD 1X8YA 3CXHH 1FZBA 1FS0E 5AW9B 2Q1KA 1EC5A 3CXCY 1JM0A 2R5BA 1OW6A 1KILC 1ZOYC 1N73B 3VMAA 2AKLA 2EGTA 1QVGY 4IOIH 2JIMA 1Y1VI 5AVWB 2Y0SA 1H88A 3IR9A 1BCCG 3HOZI 1FE6A 3JC22 1LTTC 3A0HH 3RZDI 2LKMA 2NVTI 4K35A 1M1KQ 2AYDA 3PHLA 1AA0A 3H1KE 2QRCB 3J81f 4WY4B 3CWBG 1Q821 1LTAC 2GTIA 3P5JB 3L71G 4D6TD 2AEMA 1FZCC 1NU1J 2G3AA 1Q90D 1BGYG 1Q86Q 2HLOA 1YYCA 2KK7A 1SQBE 1LT1A 3OW2Y 3MZWB 1SQVJ 1NJI2 3CCVP 4N78E 2E76C 1Z02A 3F5HA 3CCQZ 1K83I 2P2UA 1K04A 4MXUA 4RKUJ 3MIWA 3HD7D 1SP4A 4EIJA 1VQ8P 3S4RA 2QRXA 2W6BA 1PFIA 4IFMA 2E2HI 4RV9A 3Q87A 1KTMA 3CCRZ 4BY7I 1SVFA 1X22A 3HD7C 1VDFA 5CBNA 3RK2B 1M8OB 3AEGC 1VQMP 3V4QA 4DGLA 4H13D 1URQB 2F4OA 3CI9A 4E2YA 2E2JI 3L75G 1OMIA 1H89A 1AQ5A 3A0HE 3G6EZ 3CMAP 4H13C 3GHGA 3HTKA 2K1AA 1M1JB 2W90A 2KI7B 5T64A 1LWUA 3L74J 1XTCC 4A7PA 3M9BA 2FYNC 1L0NG 2Y9YA 5KAIH 4NFRA 3R2PA 2Z4EA 1HVVA 2IX7C 2N9YB 2QEX1 2W04A 3H1ID 4MH4A 1FJKA 4WVZA 3HOUI 1NU1E 3MUDA 1PPJD 2I8DA 3S1MI 3CPWZ 3BG1B 1CI6B 3J80f 3CPWO 1NP6A 1BE3J 2JDIH 1NAFA 2H7HA 2A45I 1SQVE 1S72Z 4JYCA 4EYYQ 3M3YI 1JWHC 2OARA 2ZXEB 1T2KC 5AVXB 2Q4ZA 2OTLZ 2QJYB 2OGUA 1QVFZ 5AW4B 4W80A 1RF1B 1DEEG 2K9JA 3PLNA 4PD4I 1PGPA 3LW5H 3L72G 3LW5J 3UIAA 3M0DC 4E30A 4N78D 4NBGA 3S9OA 1K731 3MTUE 1Q7Y2 1NTKD 3PO2I 2D2CB 5KLVJ 3P8MC 1VQPZ 2I1JA 3QH9A 2NPSD 2JJLA 3IR7A 1G2CA 3Q1MA 3CX5I 3LIEA 2KXPB 3IFMA 4I2LC 1A02J 2HODA 5KKZC 3HUSC 5K5GB 3G711 2NPSC 1YTZT 2K9YA 4TT3H 4ASVA 5T6BA 2OTJP 3V2PA 3AEFC 2XNDH 3GKQA 3AE4C 5KAIE 4N6JA 1VQLP 3P7KA 1JJ2Z 3CPWY 4DK1A 1KD11 3CC4Z 2FY8A 4H44D 1VF5B 3FWLA 3I55Z 1LTSC 2NRGA 4A3GI 5B5EH 4A93I 3I4MI 1NO4A 1BE3E 4NPFX 3ABVC 1LT9A 4H44C 3TGUJ 2R6MA 3CD61 3GTPI 3D2LA 2GU2A 4XE5B 1VQK1 1D7MA 2E75D 5CCHD 2ZVNB 1K9M1 1IFMA 5C4JI 1IFJA 2KS1A 4E33A 5AW5B 2E42A 1YI2P 4RESB 1JY2O 3H1JD 3WUTA 2E75C 1SLQA 5CCHC 2JO1A 3RL0B 2ZYGA 2R7ZI 1SQVD 3GLMA 1RY3A 1BGYJ 1GL2A 5APTA 3CLQA 1NJIQ 3M4OI 3H32B 3TNUB 4MD9A 4NBBA 2AXTH 4PV1C 1FZAA 3BVHA 1KQGB 1RO4A 4YXWH 3CCMP 1NTZE 4YTPC 3AEEC 3RK3B 1GZLA 4YXDC 1SQPJ 1YHQP 2K88A 3SFDC 3HOWI 1YJW1 2QA4P 3CCU1 1JJ2Y 1VQ5Z 2WVRA 1R8EA 2GA1A 2ZT9D 1H8AA 1SFCB 5CMZA 4DQYB 3V2QA 4AYCA 1LTJA 4U7JA 2M5AB 1ZV8A 1H0TA 4E32A 1OXZA 1YJ9P 2ITAA 3L75J 1J1DB 1EZVI 2ZT9C 1VQ91 1BCCE 2OZKA 2R3SA 4R4LA 1S4XA 1LWUB 1NVOA 3ESWA 1U7MA 3AEAC 2KYVA 1SFOI 1KILA 3V4WA 3OJAB 4E2WA 1KORA 1Z03A 2KZJA 5D1PA 1L0NJ 2W27A 3CWBE 2A45G 2SPZA 2KOGA 2OYHB 2LIYA 2W03A 4NB8A 3ZDMA 4C46A 2QREB 2XNXA 3L71E 4MN4C 4I7ZC 1GU5A 2VPWA 1BGYE 3I561 1IFIA 1PP9G 4JPZB 1USEA 1KRLA 1TU3F 1OWAA 3II6A 2KSEA 2P58A 1JY3P 2VPZA 2Z5IA 2K9JB 2N1TD 2YXQB 1FZCA 1ZW0A 1FDMA 1CZQA 1VQNP 3AE3C 4U3FD 1SQQG 4A3JI 5LL6f 2JA5I 2Y9ZA 3D71A 3D6WA 1Q7YQ 4OGQD 3CCS1 1L0LG 1NTZD 3Q5SA 4QTUA 2DE5A 1G2CB 1VPCA 2CPSA 5AVRB 3HKZA 3L75E 1VQ4Z 2HODB 4DOJA 1IO4A 2WSCJ 1N7SD 4M3LA 2VRSA 3EWKA 1VL2A 2YO3A
chains in the Genus database with same CATH topology
3VMIA 1EC5A 3CXCY 1JM0A 1YI21 3GTGI 3PO3S 4ZMDA 4NBEA 2E9HA 4QTTA 2VUGA 4GODA 2AKLA 2EGTA 1RLYA 3S2DI 1QVGY 4IOIH 1Y1VI 2Y0SA 4NPDA 2YADA 2H85A 2NVQI 3HOZI 1JMBA 4A3EI 1RQFA 5FLXf 1KC82 4GOFA 4NBHA 3GTOI 3RZDI 3GTJI 1KC81 2NVTI 1Y47A 3FXDA 4K35A 4RVHA 1TFIA 3VMHA 4ZNCA 3CCM1 3BG0B 1YHQ1 4Y7NI 2QRCB 2OTKE 1R9TI 3J81f 1Q822 2QA41 4NBDA 3CMEZ 1BDDA 2WMMA 1Q821 3CCEZ 1U7JA 4NOZA 3CCJZ 2GTIA 3P5JB 1VQ41 1K732 4BBRI 1VQO1 1VQ6Z 1YIJ1 3QWOC 3CC71 3PO3I 2UWJE 1QVGZ 3H0GI 1YJ91 3OW2Y 1LT1A 2KUBA 4A3MI 2JA6I 3MZWB 3IFUA 3JAMf 2QR1B 1NJI2 2KZIA 1Z02A 3CCQZ 1K83I 2P3YA 4A3DI 2VF1A 4MXUA 4BXXI 2QEXZ 1ZB8A 2NVYI 2B88A 1YUAA 1K8A2 5IP9I 3IF8A 2QRXA 3CCLZ 3MZLB 3CMAZ 3MZKB 4RV9A 2E2HI 3Q87A 3CCRZ 4BY7I 1YUKA 5FLMI 5EFWB 4Y52I 3MONA 4XX2A 5CBNA 1X0TA 3CC21 1S3JA 4RVGA 2VUMI 3S16I 3T4NB 4DGLA 1H0TB 4MD8A 2F4OA 2E2JI 4E2YA 1Q2NA 3CCE1 3CCUZ 2B87A 1OVVA 2V8IA 3CCJ1 2JMOA 1TWHI 3G4SZ 1WCMI 3G6EZ 1QVFY 3OW2Z 2PK7A 2KI7B 1RO0A 5T64A 2I3CA 1X3WA 1YITZ 3GCFA 1VQ9Z 2WAQA 1VQN1 4A3KI 4NFRA 1Z01A 2QEX1 2W04A 4MH4A 2OOYB 5AN9F 3HOUI 4HGZA 2I8DA 1LP1B 3S1MI 3CPWZ 3BG1B 1Y1WI 4TNUA 3CCL1 3G71Z 3J80f 4NBFA 2QKDA 1NP6A 2LR2A 3S14I 4RVDA 1VLAA 2F4MA 1S72Z 2RPRA 1VQ7Z 4EYYQ 2OOXB 2GTHA 3M3YI 1JWHC 4HKZH 1PFTA 2Q4ZA 2OTLZ 3VTNA 2Q51A 4A3FI 4JBZA 3FKII 3I56Z 1P9NA 2E2II 1QVFZ 1QYPA 3CCVZ 1DEEG 2KS1B 4ASWA 2R92I 2NVXI 3G4S1 3NH8A 3GTQI 1I3QI 3G6E1 2IZ3A 2RT9A 2WB1A 3S15I 2O53A 4MONA 2JWDA 1WIIA 4NB9A 1VQ8Z 3CD6Z 4E30A 3H3VJ 4NBGA 1YIT1 2PMZA 1VQKZ 1K731 5CM2M 1Q7Y2 3PO2I 5FLXb 2K5RA 1VQPZ 2IZ4A 1M902 3KIHA 1M901 3IX0A 1VQMZ 1USPB 2J6AA 1NJI1 1L1OC 1ZXGA 1OVRA 5K5GB 3CCSZ 4NBAA 3J81b 3G711 5C39A 2V8KA 4ASVA 2LFUA 2V8JA 5T6BA 1YJNZ 3U50C 3RGUA 1S721 4S1TA 1QF8A 3GKQA 1K8A1 1RO2A 1VQ71 4A3BI 5T67A 5A2Qf 3S2HI 4BXLA 1KD12 3FQQA 1W2BZ 3S1KA 1JJ2Z 3CPWY 2OTL1 3F3PC 4DK1A 1LP1A 1KD11 3CC4Z 4NH1C 1I6HI 1BDCA 4E2XA 1TWGI 3CCV1 3I55Z 4A3GI 1RNIA 3JAMb 1YJWZ 5DJTB 3CME1 3I4MI 4A93I 4NPFX 2R93I 1M1K2 4A3LI 5IT9f 1M1K1 2JS4A 2R6MA 1Q812 1VQ81 3VMGA 3CD61 3GTPI 2GU2A 1EDLA 2JA8I 3RZOI 1K9M2 1X3ZA 1VQ61 3F3FC 1VQK1 4MRIA 1K9M1 5C3EI 4HJGH 5C4JI 4E33A 5IP7I 5A2Qb 1KQSZ 1YHQZ 2M0BA 1VQM1 4CPGA 2HF1A 5C4XI 3CCQ1 3NDJA 1Q862 2R7ZI 4EWCA 2RIQA 5D1OB 1Q861 4GOEA 3PH0A 3EEDA 4HGYA 3NFZA 3M4OI 4WWIA 3K7AI 3CMA1 1VQOZ 4MD9A 2RBLA 1YIJZ 2O4HA 3CCR1 4NBBA 3GTMS 3KIFA 2KPIA 3CC7Z 1RO4A 1USPA 2QRDB 2QVAA 3D9XA 3CC41 1YJ9Z 2ZAEB 3GTLI 3I551 4CL1A 3HOWI 1YJW1 4BBSI 1WW9A 3CCU1 3S1NI 1W2BY 1JJ2Y 5C44I 1VQ5Z 2B89A 1TWFI 4E31A 1ML8A 1N2FA 2R44A 2B87B 4DQYB 1NUIA 2B63I 3LUSA 2M5AB 2OTJZ 3J80b 1H0TA 3QWUA 2LXCB 4E32A 1VQLZ 1VQ91 4E2ZA 2OZKA 3CC2Z 1Q7Y1 1EDKA 2G2KA 1NVOA 3S17I 4X6AI 3ESWA 1U7MA 1SFOI 4NBCA 2BJOA 3I07A 4E2WA 2QLVB 1Z03A 3NH4A 1KQSY 3GTMI 3TE5B 3CXCZ 2KZJA 1ZH1A 2M6NA 1TWAI 5D1PA 2PM9A 2KIKA 2SPZA 2W03A 2LIYA 2JUBA 4NB8A 2LXBA 4HH4A 4KJMA 3ZDMA 3HOVI 2QREB 5D1OA 4MN4C 2RKLA 1VQNZ 3NDIA 2JR6A 3NH5A 1EDJA 1I50I 4A3II 4A3CI 3I561 2DE6A 1YI2Z 3VB9A 2JNYA 1VQ51 4HB1A 3J7A4 2JA7I 1KRLA 2P58A 1TWCI 4RVFA 3S1RI 1Y1VS 1N8R2 2OTJ1 4RS4A 1N8R1 3I4NI 1S7MA 1Q811 3GTKI 3CQZI 1ZW0A 5CBOA 2DE7A 2K3RA 4AYBA 1VQL1 4K3AA 2YU9I 3EERA 3CCMZ 1VQP1 4A3JI 3MHVA 5LL6f 2JA5I 2HR3A 2P28A 3D6WA 4NPEA 2RHBA 1MFTA 2HU9A 4MD7A 2M5AA 1ZB9A 3S1QI 2M48A 2QA4Z 3TDHB 3CCS1 4QTUA 2DE5A 1YJN1 3FXEA 3HKZA 5DJUB 3FQMA 1VQ4Z 4BY1I 5IT9b 1DL6A 1OVUA 1FC2C 3HOXI 1EDIA 1SS1A 3HOYI 1LQLA 2Q1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EC5 A;  2B87 A;  4ASV A;  1JM0 A;  1H0T A;  1OVV A;  3RGU A;  4ZMD A;  2LXC B;  4GOD A;  4IOI H;  4BXL A;  1EDK A;  3S1K A;  1NVO A;  1LP1 A;  2KI7 B;  1U7M A;  4NPD A;  1BDC A;  1JMB A;  4GOF A;  1Y47 A;  2KZJ A;  3FXD A;  4K35 A;  5DJT B;  4NPF X;  4ZNC A;  2KIK A;  2SPZ A;  2LXB A;  4KJM A;  2I8D A;  1LP1 B;  3ZDM A;  1EDL A;  2OTK E;  4MN4 C;  2RKL A;  1BDD A;  2WMM A;  4HJG H;  1EDJ A;  2LR2 A;  1U7J A;  2M0B A;  4EYY Q;  4HB1 A;  4CPG A;  4HKZ H;  2P58 A;  3QWO C;  5C39 A;  2UWJ E;  4JBZ A;  4GOE A;  3PH0 A;  1LT1 A;  2KUB A;  3MZW B;  1DEE G;  2KS1 B;  1ZW0 A;  2KZI A;  4WWI A;  2K3R A;  4ASW A;  5CBO A;  4K3A A;  2QVA A;  3MHV A;  2JWD A;  2HR3 A;  2B88 A;  2ZAE B;  4NPE A;  1MFT A;  2M5A A;  2QRX A;  5EFW B;  3FXE A;  5DJU B;  5CBN A;  1X0T A;  2B89 A;  1OVU A;  1FC2 C;  1S3J A;  1EDI A;  1SS1 A;  1OVR A;  1ZXG A;  2B87 B;  2R44 A;  5K5G B;  1H0T B;  2Q1K A;  1Q2N A;  2M5A B; 
#chains in the Genus database with same CATH topology
 2HFE D;  3HD7 A;  2DW3 A;  1UIX A;  2LEX A;  3T97 A;  2YKQ A;  1DIP A;  4QTT A;  4Y99 B;  1OZH A;  3M9H A;  3F89 A;  3W68 A;  1T8Z A;  2R32 A;  1N7S C;  1L0N E;  3G6E P;  1SQB K;  2JIR A;  3A2A A;  3P8C E;  3HE4 B;  2YAD A;  1BCC D;  1Q16 A;  5APQ A;  2QSI A;  4A3E I;  5FLX f;  1KC8 2;  2ZYD A;  4NBH A;  3BCC G;  1Y47 A;  1LT9 B;  2A06 G;  3BG0 B;  1FZF A;  1NTM G;  4Y7N I;  1X9V A;  2W8Z A;  3L74 G;  3CWB D;  4C7N A;  2WMM A;  2WSS H;  1UII A;  1U7J A;  4NOZ A;  3L71 D;  3U1C A;  1JUN A;  5TIS E;  1K73 2;  1S72 P;  1K05 A;  1VQO 1;  1YIJ 1;  3QWO C;  3CC7 1;  3PO3 I;  2IYP A;  5CCG D;  2UWJ E;  2OTL P;  1QVG Z;  3L72 E;  2JA6 I;  4A3M I;  1FJP A;  1ZN5 A;  2E74 D;  3H1H G;  2Q3E A;  3CME P;  1P84 I;  5BU5 A;  2NVY I;  5IP9 I;  3E1R A;  3NXS A;  2E74 C;  1VQ6 P;  3MZL B;  3MZK B;  1JEK A;  2ZJS E;  5APS A;  2WT7 B;  1YUK A;  1NU1 K;  2IZ0 A;  3B5N C;  1LTJ B;  1R5S A;  3M06 A;  1H0T B;  2FYU G;  1SQV K;  1Q2N A;  4ZKP A;  3CCE 1;  3CCU Z;  2AEJ A;  4Z1M H;  5KLV G;  1OVV A;  3CCJ 1;  3HRN A;  1GTW A;  1FZE A;  3G4S Z;  3OW2 Z;  1KFM A;  2NPS A;  4N3Y B;  1FAV A;  5CJ0 A;  2I3C A;  3CC4 P;  1W2E A;  1YIT Z;  1OW7 A;  1HTL C;  1VQ9 Z;  2WPS A;  1KQS O;  3I55 P;  1KYO D;  3P8C D;  4L76 A;  5KTB A;  1L4A C;  1S2E A;  2XDJ A;  4TLF A;  1FBM A;  3U59 A;  5AW6 B;  2A45 H;  1N7L A;  4TNU A;  3CCL 1;  3RL0 g;  2HPC A;  3I5C A;  2LR2 A;  2IBZ G;  1VLA A;  2F4M A;  2RH0 A;  2RPR A;  1VQ7 Z;  2OOX B;  1WMK A;  2FXM A;  2GTH A;  1PP9 J;  1PFT A;  3TGU G;  3G9R A;  1ZR4 A;  4JBZ A;  4I6M C;  2O1J A;  4PD4 H;  2C9L Y;  3I56 Z;  2QJK B;  2J59 M;  2YMY A;  2QM8 A;  3H1L D;  1KFN A;  5CCH A;  3AE5 C;  2IZ3 A;  1LJ2 A;  3L72 D;  2RT9 A;  2O53 A;  3BRV B;  2JWD A;  1WII A;  1G1J A;  1SQQ J;  4NB9 A;  1SQX G;  3L70 D;  3U1A A;  3WUU A;  4O9B A;  2PMZ A;  2E76 D;  5GTH E;  3CX5 H;  4GIF A;  5APV A;  4OWF A;  3HE5 A;  1WJ2 A;  2QIW A;  1M90 2;  1L0L J;  1NYH A;  2Y0C A;  2BCC D;  4WY4 D;  2H43 A;  3Q3D A;  1VQ5 P;  5APU A;  1XTG B;  1L1O C;  1RE3 C;  3FX0 A;  3CCS Z;  1SQP G;  3T97 B;  3J81 b;  2Q9I A;  5C39 A;  5BU8 B;  2LFU A;  1HBW A;  2V8J A;  3CXH E;  3H25 A;  1J1E B;  3RGU A;  4WY4 C;  3GF3 A;  4S1T A;  1K8A 1;  2E7Z A;  1RO2 A;  1QGK B;  4A3B I;  5T67 A;  4BXL A;  3SWY A;  3S1K A;  1LP1 A;  1LTB C;  4NH1 C;  1I6H I;  1BDC A;  4H13 B;  1KC8 Q;  1TWG I;  2GUV A;  1T6A A;  3CCV 1;  3C9I A;  2KLV A;  5DJT B;  1NTZ K;  2M3B A;  3BCC J;  5IT9 f;  1YJN P;  1M1K 1;  1VQ8 1;  4HYT B;  3VMG A;  2JA8 I;  1PP9 E;  1X3Z A;  2RMZ A;  1NTM J;  4HJG H;  4PD4 E;  1IFP A;  1ZRT E;  1OFC X;  1K73 Q;  1VQM 1;  3AEC C;  2HF1 A;  3VMZ A;  1JY3 N;  1QXF A;  1AVY A;  3NDJ A;  3RK2 C;  3EFF K;  1SQQ E;  4YPC A;  1Q86 1;  3EED A;  2H8P D;  3E7K A;  1URQ C;  4WWI A;  1T2K D;  3CX5 E;  3K7A I;  1VQO Z;  3CMA 1;  2RBL A;  1YIJ Z;  1RQU A;  2PP6 A;  2O4H A;  5AVT B;  1R5L A;  3VMX A;  3CC7 Z;  1USP A;  3H1K D;  2QVA A;  3H1H J;  1MFZ A;  3D9X A;  1L0L E;  3USS A;  1ZP0 C;  2FFD B;  2V7Q H;  1KN7 A;  3M0A A;  1KD1 Q;  4BBS I;  3S1N I;  2P67 A;  2N1T A;  3AE1 C;  4H0L D;  1TWF I;  3L37 A;  5AVQ B;  4E31 A;  1VQ4 P;  3GMA A;  2R44 A;  3KQG A;  1SQB D;  4XFJ A;  3V5B A;  3L36 A;  5KJ7 D;  3H6P A;  3J80 b;  4H0L C;  2FYU J;  4GDO A;  5KKZ B;  1GW3 A;  2V4H A;  3WMM 0;  4E2Z A;  2YNY A;  1HH0 A;  2IV2 X;  3CXH D;  3BCC E;  1SQP K;  1KB9 H;  5KJ7 C;  3Q2Y A;  4OVN F;  4X6A I;  2A06 E;  4DZO A;  3TDK A;  2BJO A;  3RK3 E;  4OH8 B;  3I07 A;  4B86 A;  2PAJ A;  3NH4 A;  1LTI C;  3GTM I;  3GG2 A;  2IFN A;  1N7S A;  2Q6Q A;  2I1K A;  1NTM E;  2QJY C;  3AEB C;  3VOP A;  4IL6 H;  3L74 E;  1IK9 A;  1RF1 C;  2W83 C;  1RF0 C;  3WUV A;  1E79 H;  2LXB A;  2M8R A;  3VYI A;  4KJM A;  1HGV A;  2HPC B;  5D1O A;  3IF4 A;  3CC2 P;  2JR6 A;  4W7Y A;  4A3I I;  3TSI A;  3AED C;  3SSU A;  3MGN A;  2D2C C;  1S5L H;  3V2R A;  2BEZ F;  2P10 A;  1IC2 A;  1ZRT D;  3H1H E;  4RVF A;  2R5D A;  1Y1V S;  1N8R 2;  3KYQ A;  2OTJ 1;  1Y9B A;  4UB8 H;  3KXD A;  1Q81 1;  1FDI A;  3CQZ I;  1L0N K;  5CBO A;  2K3R A;  1VQL 1;  1NAY A;  2YU9 I;  3O8Z A;  1NU1 D;  1VF5 D;  5H2F H;  3MHV A;  2HR3 A;  3EFG A;  3A3Y B;  4NPE A;  2RHB A;  3HE5 B;  2HU9 A;  2W6J H;  1ZB9 A;  3S1Q I;  2IZ1 A;  1SQX J;  4PV1 D;  1RHZ B;  5CCG A;  1VF5 C;  1M90 Q;  3D70 A;  3C8V A;  2FYU E;  3FQM A;  1LTG C;  5KLV E;  2YIU B;  5AVS B;  1HWT C;  3HOY I;  5CJ4 A;  1IZN B;  2WQY C;  2OYI A;  1PIX A;  1YI2 1;  1FOS F;  3GTG I;  2Z5H A;  4ZMD A;  2KB7 P;  3H1I G;  2VUG A;  4GOD A;  3SWK A;  1RLY A;  1PPJ G;  3G4S P;  2ZT9 B;  4NPD A;  1GDT A;  4DJG A;  1RQF A;  2YKP A;  1NWQ A;  1YIT P;  3GTJ I;  2A06 D;  4RVH A;  1TFI A;  3VMH A;  3CCM 1;  3L73 G;  1M56 D;  4PJ0 H;  3GHG B;  3HTK B;  1YHQ 1;  2IBZ E;  3O6Q A;  1LNQ A;  2OTK E;  1KQL A;  4L74 A;  3L74 D;  5B5E E;  1Q82 2;  5KLI C;  1S1C X;  3VP9 A;  2QA4 1;  1BDD A;  3RK3 C;  2C0X A;  3TGU E;  3IN6 A;  4LLH A;  1SFC D;  4UB8 E;  4I7Z B;  2FXP A;  1KB9 I;  4BBR I;  1VQ7 P;  1AA6 A;  1FDO A;  1NTK G;  4UB6 H;  2POH A;  2XKM A;  3BAS A;  2XU6 A;  1SFC C;  5GTI H;  3H0G I;  1YJ9 1;  4IFF A;  3IFU A;  3JAM f;  3NTN A;  1BE3 D;  1P84 H;  1SQX E;  2KZI A;  4A3D I;  3C1L A;  4RO0 A;  2QEX Z;  1IJD B;  1YUA A;  4BRY A;  1K8A 2;  3IF8 A;  3CMA Z;  2AXT E;  2N1T B;  2Q5U A;  5FLM I;  5EFW B;  3MON A;  1SQP E;  3TK1 A;  1BSN A;  1HUC A;  1S3J A;  4RVG A;  3MUD C;  5E79 H;  3T4N B;  4EDF A;  3Q5P A;  1E5W A;  2OYH C;  1S9K E;  2FYU D;  4MD8 A;  3CCQ P;  2O3J A;  5KLV D;  2IYO A;  4OGQ B;  2G8Y A;  3AE2 C;  2V8I A;  2JMO A;  2WWW A;  1RE3 A;  3M91 A;  1WCM I;  3JSV C;  5AVY B;  2N9B A;  3CCR P;  1QL1 A;  2JP3 A;  1NKN A;  2J58 A;  4PJ0 E;  4WY4 A;  1VQN 1;  4A3K I;  3H1J G;  2ZVO B;  1JTH A;  1Z01 A;  3K5B A;  3CL3 D;  2YO2 A;  4D6T J;  4L75 A;  3JCU H;  2B9B A;  1KMI Z;  1GD2 E;  2OOY B;  5AN9 F;  2QJP B;  2OQQ A;  5KAF H;  4HGZ A;  5B66 H;  3G71 Z;  4NBF A;  5AVZ B;  2IBZ D;  2ZXX A;  5GTI E;  4RVD A;  2ZYA A;  1P84 E;  1PV3 A;  3TGU D;  2QE7 H;  3VTN A;  4A3F I;  1N8R Q;  2CPB A;  1P9N A;  1QYP A;  1GK6 A;  2KS1 B;  3A5T A;  4ASW A;  2KSJ A;  1J2J B;  2PGD A;  3G6E 1;  4MON A;  4Y99 C;  2WSE H;  3OA7 A;  3CD6 Z;  2WSE J;  3H3V J;  1BGY D;  1VQK Z;  5CM2 M;  1GL2 B;  2XV5 A;  1G1I A;  5FLX b;  3V2N A;  4IFD K;  1DD3 A;  2IZ4 A;  1AV1 A;  1MKM A;  2E74 B;  3IX0 A;  1LT9 C;  2JIO A;  3NMD A;  2OYI B;  3KHU A;  1ZXG A;  3SFE C;  2GM4 A;  1SQP D;  3B5N D;  1AFO A;  3GW6 A;  3VTP C;  5AW2 B;  1S72 1;  1S9K D;  4EI2 A;  5A2Q f;  3PTZ A;  1SQQ K;  3FQQ A;  1W2B Z;  3LID A;  1KD1 2;  3H1I J;  1VQP P;  3M0D A;  1KYO I;  2OTL 1;  1W2B O;  3JCU E;  1EXI A;  4LGD E;  1EZV G;  5B66 E;  2YKO A;  1L0L K;  3L75 D;  1YJW Z;  3CME 1;  1PGJ A;  5KJ7 A;  1SIW A;  4A3L I;  2R93 I;  3O6Q B;  2JS4 A;  1Q81 2;  2GUS A;  4QMA A;  1JNM A;  3L73 J;  1EDL A;  3RZO I;  1Q82 Q;  1K9M 2;  1X79 B;  3HUS A;  1VQ6 1;  1L4A D;  1KIL B;  4MRI A;  4IL6 X;  5C3E I;  2WZ7 A;  1NHL A;  1RF0 A;  4U3F G;  5IP7 I;  5A2Q b;  1KQS Z;  1L0N D;  2AXC A;  1YHQ Z;  2M0B A;  4KHX A;  4CPG A;  3R4Y A;  5C4X I;  1KQF B;  1KV4 A;  3TF5 A;  2RIQ A;  1S5L X;  5AW1 B;  4GOE A;  1NTK J;  3FGA D;  1IK7 A;  3D6Z A;  3AE6 C;  3KIF A;  3PP5 A;  1OIP A;  2QM7 A;  4BRY B;  2BEQ D;  3CC4 1;  1JY2 P;  1YJ9 Z;  1K8A Q;  3SWF A;  1NTM K;  2JIQ A;  3I55 1;  4CL1 A;  1FZC B;  3GF7 A;  1WW9 A;  1W2B Y;  3EQ2 A;  3P32 A;  1Z56 A;  3N4X A;  3H1I E;  1T3U A;  1N73 C;  1PPJ E;  3LUS A;  3A0B H;  1JOC A;  2E76 B;  2OYO A;  1PZQ A;  3QWU A;  1GU4 A;  1PGQ A;  4R4M A;  2JWA A;  3S17 I;  1EQ7 A;  2VPY A;  4NBC A;  2Y0E A;  4JQ0 D;  1NKZ B;  3L73 E;  2QLV B;  1YQ3 C;  1JTH B;  1KQS Y;  3HD7 B;  3TE5 B;  2QJK C;  4AUW A;  2M6N A;  3VP8 A;  1JB0 J;  1TWA I;  2PM9 A;  1JY3 O;  2KIK A;  3H1J J;  2O01 N;  2JUB A;  4JF7 A;  2YXR B;  3HOV I;  1AQT A;  2FXO A;  1VQN Z;  3ITK A;  4W7Z A;  2FYU K;  3MD0 A;  1I50 I;  3H32 A;  5KLV K;  2DE6 A;  1NTK E;  3TNU A;  3VB9 A;  1QX8 A;  2JNY A;  1VQ5 1;  2C9N Y;  4C7R A;  1A02 F;  1TWC I;  5APW A;  2FYN B;  4RS4 A;  2L5G B;  4C7N B;  2O1K A;  3I4N I;  1S7M A;  3GTK I;  2DE7 A;  4AYB A;  1HF9 A;  4K3A A;  3KZI H;  3RK2 D;  2WIT A;  3V6I A;  1J1E C;  1SFC A;  2QEX P;  1URQ D;  2P28 A;  2M5A A;  2M48 A;  2V3V A;  3TDH B;  1RQV A;  3A0B E;  2ZFC A;  1YJN 1;  3FXE A;  5DJU B;  4BY1 I;  5IT9 b;  1DL6 A;  1FC2 C;  1OVU A;  3HOX I;  1EDI A;  1SS1 A;  1OW8 A;  1LQL A;  3VMI A;  5AVV B;  3CXH I;  3AE8 C;  3PO3 S;  4NBE A;  2V7Q J;  2E9H A;  1M1J C;  2O01 H;  2FYZ A;  3WU2 H;  2O01 J;  1M7L A;  1HJ0 A;  3S2D I;  2OYH A;  2YMK A;  4H0L B;  3H1J E;  1MZ9 A;  1SQX K;  2H85 A;  2NVQ I;  1JMB A;  2RN0 A;  4GOF A;  3GTO I;  5AW3 B;  1WRG A;  1KC8 1;  4GT1 A;  3FXD A;  3D6Y A;  4ZNC A;  1RE4 C;  3L73 D;  1RH5 B;  3KPE A;  1LGH B;  3HUS B;  5M1B A;  4WB4 A;  1DD4 A;  1Q81 Q;  2NPS B;  1K9M Q;  1DX7 A;  1R9T I;  1QVF O;  2Y0D A;  3H1L G;  2FFD C;  4NBD A;  3CME Z;  3CCE Z;  4HH2 A;  3G71 P;  3CCJ Z;  4U3F J;  1VQ4 1;  4D6T G;  1HJB A;  3L70 G;  1VQ6 Z;  2Q7C A;  3KZI E;  4AQR D;  2D2C D;  3M9Q A;  2KUB A;  3KDP B;  1GMJ A;  2QR1 B;  1NTZ J;  2BCC G;  3IAO A;  4H44 B;  3RBZ A;  3B71 A;  2PRR A;  1BSH A;  3MP7 B;  1FU1 A;  2P3Y A;  2VF1 A;  4DT0 A;  4BXX I;  1PP9 D;  1GW4 A;  1ZB8 A;  1IFN A;  2B88 A;  4Y28 J;  3CD6 P;  4PD4 D;  3CCL Z;  5AW8 B;  1VQK P;  4Y52 I;  2E75 B;  4XX2 A;  1FZG A;  1X0T A;  3TYY A;  2XZR A;  3WU2 E;  4EOT A;  3CC2 1;  1SQQ D;  2VUM I;  3S16 I;  2JEE A;  2VPX A;  3HE4 A;  1BCC J;  3BAT A;  2B87 A;  3CX5 D;  4PV1 B;  1N86 A;  1TWH I;  1EZV E;  1L0L D;  1QVF Y;  2JR8 A;  2HG5 D;  1YQ4 C;  2AEF A;  2PK7 A;  1WZN A;  1RO0 A;  2MJZ A;  3CWB J;  1X3W A;  3GCF A;  2WAQ A;  2WPV B;  1NOH A;  3L71 J;  1KB9 E;  3B5N A;  4DCK A;  1YJW P;  5AW7 B;  3CCU P;  3RL0 D;  2WPR A;  4U3F E;  4ZKU A;  1LP1 B;  1Y1W I;  4IL6 E;  5L8R J;  2R3C A;  2WPQ A;  2QKD A;  2L91 A;  3S14 I;  3H1K G;  5KLI B;  3RL0 C;  3G3Z A;  3BCC D;  2E43 A;  1VQ9 P;  4HKZ H;  3RK3 D;  2Q51 A;  2P1J A;  1CW5 A;  1QL2 A;  2YIU C;  3FKI I;  1S5L E;  2E2I I;  1NTM D;  3VN0 A;  2KNC A;  3CCV Z;  2WT7 A;  1IFD A;  1L4A A;  2R92 I;  2NVX I;  3G4S 1;  3NH8 A;  3GTQ I;  1I3Q I;  2E5T A;  1MV8 A;  2WB1 A;  3S15 I;  2NZ2 A;  1SQB G;  1JY2 N;  1EXJ A;  1VQ8 Z;  1YIT 1;  2K5R A;  3L4F A;  5H2F E;  1GK4 A;  5AVU B;  2NAP A;  2H89 C;  2J5U A;  3I56 P;  3KIH A;  5CHX A;  1M90 1;  3H1H D;  1VQM Z;  1USP B;  2J6A A;  1NJI 1;  2MKV A;  1OVR A;  2HYN A;  1J1D C;  3GHG C;  4NBA A;  2V8K A;  1YJN Z;  3U50 C;  1KYO H;  1ZR2 A;  1LWU C;  2P7J A;  3L35 A;  1PGO A;  3RBX A;  1QF8 A;  1VQ7 1;  5AW0 B;  1DH3 A;  3PJS K;  3S2H I;  1N73 A;  2PFX A;  3F3P C;  4GKG A;  1EZV D;  4E2X A;  2CK3 H;  3B8E B;  4XA4 A;  1RNI A;  1USD A;  3JAM b;  3VMY A;  3CCS P;  2E5Y A;  1M1K 2;  2V45 A;  2IBZ I;  1KB9 D;  1JCC A;  5TIS H;  3F3F C;  1MUU A;  1ZME C;  1U57 A;  1YBK A;  1N7S B;  3H1L J;  1NU1 G;  4KT0 J;  3L72 J;  2N1T C;  1NH4 A;  4RJT A;  3CCQ 1;  1Q86 2;  3L70 J;  4EWC A;  1SQV G;  5D1O B;  3PH0 A;  4HGY A;  3NFZ A;  5BVZ A;  2WSC H;  4OGQ C;  4UB6 E;  3CCR 1;  3GTM S;  1L2P A;  2BCC J;  2KPI A;  2QRD B;  2WSF H;  2WSF J;  3NFQ A;  2H88 C;  2M3E A;  2ZAE B;  2KP8 A;  3GTL I;  1KIL E;  2IFM A;  1N2D C;  2IPP A;  5APX A;  2FKW B;  2W6A A;  4LC1 A;  1M57 D;  1KYO E;  5C44 I;  3FWN A;  2B89 A;  1ML8 A;  1DEB A;  1AVO A;  1N2F A;  1VQO P;  2B87 B;  1YIJ P;  1NUI A;  1NTK K;  3AE9 C;  2B63 I;  2Q3I A;  3CC7 P;  1SQX D;  2QJP C;  3E1I A;  2OTJ Z;  1URQ A;  2LXC B;  4BWN A;  2QG4 A;  1VQL Z;  3B4S A;  5E79 E;  3CC2 Z;  2KLU A;  1Q7Y 1;  1EDK A;  1KZU B;  2G2K A;  3N7N A;  2IDB A;  5TJH A;  1Y8C A;  1JO5 A;  1M1J A;  1YTZ I;  3B5N B;  3PRJ A;  3AE7 C;  3CXC Z;  1W5C E;  1ZH1 A;  1QLE D;  2WTY A;  3H1L E;  3OAK A;  2JKV A;  2K37 A;  1FOS E;  1GL2 D;  4HH4 A;  1CSB A;  1QVG O;  2RKL A;  1BE3 G;  3NDI A;  3W67 A;  4D6T E;  4L73 A;  3L70 E;  1RE4 A;  3NH5 A;  1AJY A;  1EDJ A;  4A3C I;  1CI6 A;  1JCD A;  5CCG C;  1YI2 Z;  3CCE P;  5KAF E;  1GL2 C;  4I1L A;  3CCJ P;  1Y8A A;  4HB1 A;  3J7A 4;  3H1K J;  1QEX A;  2JA7 I;  2FFD A;  2BCC E;  3S1R I;  2KNC B;  1PL5 A;  4JYB A;  3A7O A;  1HGZ A;  2OYI C;  1L4A B;  2JIP A;  1N8R 1;  1JMM A;  1T3J A;  2BAS A;  5GTH H;  1RF1 A;  1WT6 A;  3EER A;  3CCM Z;  1VQP 1;  2FBW C;  1NGM B;  1ZLL A;  5APY A;  3BRT B;  1OX3 A;  1SQB J;  1MFT A;  3Q5R A;  4MD7 A;  2QA4 Z;  4WBA A;  3CCL P;  1NTZ G;  1LTJ C;  1P84 D;  2C0W A;  3OW2 O;  1KIL D;  1X8Y A;  3CXH H;  1FZB A;  1FS0 E;  5AW9 B;  2Q1K A;  1EC5 A;  3CXC Y;  1JM0 A;  2R5B A;  1OW6 A;  1KIL C;  1ZOY C;  1N73 B;  3VMA A;  2AKL A;  2EGT A;  1QVG Y;  4IOI H;  2JIM A;  1Y1V I;  5AVW B;  2Y0S A;  1H88 A;  3IR9 A;  1BCC G;  3HOZ I;  1FE6 A;  3JC2 2;  1LTT C;  3A0H H;  3RZD I;  2LKM A;  2NVT I;  4K35 A;  1M1K Q;  2AYD A;  3PHL A;  1AA0 A;  3H1K E;  2QRC B;  3J81 f;  4WY4 B;  3CWB G;  1Q82 1;  1LTA C;  2GTI A;  3P5J B;  3L71 G;  4D6T D;  2AEM A;  1FZC C;  1NU1 J;  2G3A A;  1Q90 D;  1BGY G;  1Q86 Q;  2HLO A;  1YYC A;  2KK7 A;  1SQB E;  1LT1 A;  3OW2 Y;  3MZW B;  1SQV J;  1NJI 2;  3CCV P;  4N78 E;  2E76 C;  1Z02 A;  3F5H A;  3CCQ Z;  1K83 I;  2P2U A;  1K04 A;  4MXU A;  4RKU J;  3MIW A;  3HD7 D;  1SP4 A;  4EIJ A;  1VQ8 P;  3S4R A;  2QRX A;  2W6B A;  1PFI A;  4IFM A;  2E2H I;  4RV9 A;  3Q87 A;  1KTM A;  3CCR Z;  4BY7 I;  1SVF A;  1X22 A;  3HD7 C;  1VDF A;  5CBN A;  3RK2 B;  1M8O B;  3AEG C;  1VQM P;  3V4Q A;  4DGL A;  4H13 D;  1URQ B;  2F4O A;  3CI9 A;  4E2Y A;  2E2J I;  3L75 G;  1OMI A;  1H89 A;  1AQ5 A;  3A0H E;  3G6E Z;  3CMA P;  4H13 C;  3GHG A;  3HTK A;  2K1A A;  1M1J B;  2W90 A;  2KI7 B;  5T64 A;  1LWU A;  3L74 J;  1XTC C;  4A7P A;  3M9B A;  2FYN C;  1L0N G;  2Y9Y A;  5KAI H;  4NFR A;  3R2P A;  2Z4E A;  1HVV A;  2IX7 C;  2N9Y B;  2QEX 1;  2W04 A;  3H1I D;  4MH4 A;  1FJK A;  4WVZ A;  3HOU I;  1NU1 E;  3MUD A;  1PPJ D;  2I8D A;  3S1M I;  3CPW Z;  3BG1 B;  1CI6 B;  3J80 f;  3CPW O;  1NP6 A;  1BE3 J;  2JDI H;  1NAF A;  2H7H A;  2A45 I;  1SQV E;  1S72 Z;  4JYC A;  4EYY Q;  3M3Y I;  1JWH C;  2OAR A;  2ZXE B;  1T2K C;  5AVX B;  2Q4Z A;  2OTL Z;  2QJY B;  2OGU A;  1QVF Z;  5AW4 B;  4W80 A;  1RF1 B;  1DEE G;  2K9J A;  3PLN A;  4PD4 I;  1PGP A;  3LW5 H;  3L72 G;  3LW5 J;  3UIA A;  3M0D C;  4E30 A;  4N78 D;  4NBG A;  3S9O A;  1K73 1;  3MTU E;  1Q7Y 2;  1NTK D;  3PO2 I;  2D2C B;  5KLV J;  3P8M C;  1VQP Z;  2I1J A;  3QH9 A;  2NPS D;  2JJL A;  3IR7 A;  1G2C A;  3Q1M A;  3CX5 I;  3LIE A;  2KXP B;  3IFM A;  4I2L C;  1A02 J;  2HOD A;  5KKZ C;  3HUS C;  5K5G B;  3G71 1;  2NPS C;  1YTZ T;  2K9Y A;  4TT3 H;  4ASV A;  5T6B A;  2OTJ P;  3V2P A;  3AEF C;  2XND H;  3GKQ A;  3AE4 C;  5KAI E;  4N6J A;  1VQL P;  3P7K A;  1JJ2 Z;  3CPW Y;  4DK1 A;  1KD1 1;  3CC4 Z;  2FY8 A;  4H44 D;  1VF5 B;  3FWL A;  3I55 Z;  1LTS C;  2NRG A;  4A3G I;  5B5E H;  4A93 I;  3I4M I;  1NO4 A;  1BE3 E;  4NPF X;  3ABV C;  1LT9 A;  4H44 C;  3TGU J;  2R6M A;  3CD6 1;  3GTP I;  3D2L A;  2GU2 A;  4XE5 B;  1VQK 1;  1D7M A;  2E75 D;  5CCH D;  2ZVN B;  1K9M 1;  1IFM A;  5C4J I;  1IFJ A;  2KS1 A;  4E33 A;  5AW5 B;  2E42 A;  1YI2 P;  4RES B;  1JY2 O;  3H1J D;  3WUT A;  2E75 C;  1SLQ A;  5CCH C;  2JO1 A;  3RL0 B;  2ZYG A;  2R7Z I;  1SQV D;  3GLM A;  1RY3 A;  1BGY J;  1GL2 A;  5APT A;  3CLQ A;  1NJI Q;  3M4O I;  3H32 B;  3TNU B;  4MD9 A;  4NBB A;  2AXT H;  4PV1 C;  1FZA A;  3BVH A;  1KQG B;  1RO4 A;  4YXW H;  3CCM P;  1NTZ E;  4YTP C;  3AEE C;  3RK3 B;  1GZL A;  4YXD C;  1SQP J;  1YHQ P;  2K88 A;  3SFD C;  3HOW I;  1YJW 1;  2QA4 P;  3CCU 1;  1JJ2 Y;  1VQ5 Z;  2WVR A;  1R8E A;  2GA1 A;  2ZT9 D;  1H8A A;  1SFC B;  5CMZ A;  4DQY B;  3V2Q A;  4AYC A;  1LTJ A;  4U7J A;  2M5A B;  1ZV8 A;  1H0T A;  4E32 A;  1OXZ A;  1YJ9 P;  2ITA A;  3L75 J;  1J1D B;  1EZV I;  2ZT9 C;  1VQ9 1;  1BCC E;  2OZK A;  2R3S A;  4R4L A;  1S4X A;  1LWU B;  1NVO A;  3ESW A;  1U7M A;  3AEA C;  2KYV A;  1SFO I;  1KIL A;  3V4W A;  3OJA B;  4E2W A;  1KOR A;  1Z03 A;  2KZJ A;  5D1P A;  1L0N J;  2W27 A;  3CWB E;  2A45 G;  2SPZ A;  2KOG A;  2OYH B;  2LIY A;  2W03 A;  4NB8 A;  3ZDM A;  4C46 A;  2QRE B;  2XNX A;  3L71 E;  4MN4 C;  4I7Z C;  1GU5 A;  2VPW A;  1BGY E;  3I56 1;  1IFI A;  1PP9 G;  4JPZ B;  1USE A;  1KRL A;  1TU3 F;  1OWA A;  3II6 A;  2KSE A;  2P58 A;  1JY3 P;  2VPZ A;  2Z5I A;  2K9J B;  2N1T D;  2YXQ B;  1FZC A;  1ZW0 A;  1FDM A;  1CZQ A;  1VQN P;  3AE3 C;  4U3F D;  1SQQ G;  4A3J I;  5LL6 f;  2JA5 I;  2Y9Z A;  3D71 A;  3D6W A;  1Q7Y Q;  4OGQ D;  3CCS 1;  1L0L G;  1NTZ D;  3Q5S A;  4QTU A;  2DE5 A;  1G2C B;  1VPC A;  2CPS A;  5AVR B;  3HKZ A;  3L75 E;  1VQ4 Z;  2HOD B;  4DOJ A;  1IO4 A;  2WSC J;  1N7S D;  4M3L A;  2VRS A;  3EWK A;  1VL2 A;  2YO3 A; 
#chains in the Genus database with same CATH homology
 3VMI A;  1EC5 A;  3CXC Y;  1JM0 A;  1YI2 1;  3GTG I;  3PO3 S;  4ZMD A;  4NBE A;  2E9H A;  4QTT A;  2VUG A;  4GOD A;  2AKL A;  2EGT A;  1RLY A;  3S2D I;  1QVG Y;  4IOI H;  1Y1V I;  2Y0S A;  4NPD A;  2YAD A;  2H85 A;  2NVQ I;  3HOZ I;  1JMB A;  4A3E I;  1RQF A;  5FLX f;  1KC8 2;  4GOF A;  4NBH A;  3GTO I;  3RZD I;  3GTJ I;  1KC8 1;  2NVT I;  1Y47 A;  3FXD A;  4K35 A;  4RVH A;  1TFI A;  3VMH A;  4ZNC A;  3CCM 1;  3BG0 B;  1YHQ 1;  4Y7N I;  2QRC B;  2OTK E;  1R9T I;  3J81 f;  1Q82 2;  2QA4 1;  4NBD A;  3CME Z;  1BDD A;  2WMM A;  1Q82 1;  3CCE Z;  1U7J A;  4NOZ A;  3CCJ Z;  2GTI A;  3P5J B;  1VQ4 1;  1K73 2;  4BBR I;  1VQO 1;  1VQ6 Z;  1YIJ 1;  3QWO C;  3CC7 1;  3PO3 I;  2UWJ E;  1QVG Z;  3H0G I;  1YJ9 1;  3OW2 Y;  1LT1 A;  2KUB A;  4A3M I;  2JA6 I;  3MZW B;  3IFU A;  3JAM f;  2QR1 B;  1NJI 2;  2KZI A;  1Z02 A;  3CCQ Z;  1K83 I;  2P3Y A;  4A3D I;  2VF1 A;  4MXU A;  4BXX I;  2QEX Z;  1ZB8 A;  2NVY I;  2B88 A;  1YUA A;  1K8A 2;  5IP9 I;  3IF8 A;  2QRX A;  3CCL Z;  3MZL B;  3CMA Z;  3MZK B;  4RV9 A;  2E2H I;  3Q87 A;  3CCR Z;  4BY7 I;  1YUK A;  5FLM I;  5EFW B;  4Y52 I;  3MON A;  4XX2 A;  5CBN A;  1X0T A;  3CC2 1;  1S3J A;  4RVG A;  2VUM I;  3S16 I;  3T4N B;  4DGL A;  1H0T B;  4MD8 A;  2F4O A;  2E2J I;  4E2Y A;  1Q2N A;  3CCE 1;  3CCU Z;  2B87 A;  1OVV A;  2V8I A;  3CCJ 1;  2JMO A;  1TWH I;  3G4S Z;  1WCM I;  3G6E Z;  1QVF Y;  3OW2 Z;  2PK7 A;  2KI7 B;  1RO0 A;  5T64 A;  2I3C A;  1X3W A;  1YIT Z;  3GCF A;  1VQ9 Z;  2WAQ A;  1VQN 1;  4A3K I;  4NFR A;  1Z01 A;  2QEX 1;  2W04 A;  4MH4 A;  2OOY B;  5AN9 F;  3HOU I;  4HGZ A;  2I8D A;  1LP1 B;  3S1M I;  3CPW Z;  3BG1 B;  1Y1W I;  4TNU A;  3CCL 1;  3G71 Z;  3J80 f;  4NBF A;  2QKD A;  1NP6 A;  2LR2 A;  3S14 I;  4RVD A;  1VLA A;  2F4M A;  1S72 Z;  2RPR A;  1VQ7 Z;  4EYY Q;  2OOX B;  2GTH A;  3M3Y I;  1JWH C;  4HKZ H;  1PFT A;  2Q4Z A;  2OTL Z;  3VTN A;  2Q51 A;  4A3F I;  4JBZ A;  3FKI I;  3I56 Z;  1P9N A;  2E2I I;  1QVF Z;  1QYP A;  3CCV Z;  1DEE G;  2KS1 B;  4ASW A;  2R92 I;  2NVX I;  3G4S 1;  3NH8 A;  3GTQ I;  1I3Q I;  3G6E 1;  2IZ3 A;  2RT9 A;  2WB1 A;  3S15 I;  2O53 A;  4MON A;  2JWD A;  1WII A;  4NB9 A;  1VQ8 Z;  3CD6 Z;  4E30 A;  3H3V J;  4NBG A;  1YIT 1;  2PMZ A;  1VQK Z;  1K73 1;  5CM2 M;  1Q7Y 2;  3PO2 I;  5FLX b;  2K5R A;  1VQP Z;  2IZ4 A;  1M90 2;  3KIH A;  1M90 1;  3IX0 A;  1VQM Z;  1USP B;  2J6A A;  1NJI 1;  1L1O C;  1ZXG A;  1OVR A;  5K5G B;  3CCS Z;  4NBA A;  3J81 b;  3G71 1;  5C39 A;  2V8K A;  4ASV A;  2LFU A;  2V8J A;  5T6B A;  1YJN Z;  3U50 C;  3RGU A;  1S72 1;  4S1T A;  1QF8 A;  3GKQ A;  1K8A 1;  1RO2 A;  1VQ7 1;  4A3B I;  5T67 A;  5A2Q f;  3S2H I;  4BXL A;  1KD1 2;  3FQQ A;  1W2B Z;  3S1K A;  1JJ2 Z;  3CPW Y;  2OTL 1;  3F3P C;  4DK1 A;  1LP1 A;  1KD1 1;  3CC4 Z;  4NH1 C;  1I6H I;  1BDC A;  4E2X A;  1TWG I;  3CCV 1;  3I55 Z;  4A3G I;  1RNI A;  3JAM b;  1YJW Z;  5DJT B;  3CME 1;  3I4M I;  4A93 I;  4NPF X;  2R93 I;  1M1K 2;  4A3L I;  5IT9 f;  1M1K 1;  2JS4 A;  2R6M A;  1Q81 2;  1VQ8 1;  3VMG A;  3CD6 1;  3GTP I;  2GU2 A;  1EDL A;  2JA8 I;  3RZO I;  1K9M 2;  1X3Z A;  1VQ6 1;  3F3F C;  1VQK 1;  4MRI A;  1K9M 1;  5C3E I;  4HJG H;  5C4J I;  4E33 A;  5IP7 I;  5A2Q b;  1KQS Z;  1YHQ Z;  2M0B A;  1VQM 1;  4CPG A;  2HF1 A;  5C4X I;  3CCQ 1;  3NDJ A;  1Q86 2;  2R7Z I;  4EWC A;  2RIQ A;  5D1O B;  1Q86 1;  4GOE A;  3PH0 A;  3EED A;  4HGY A;  3NFZ A;  3M4O I;  4WWI A;  3K7A I;  3CMA 1;  1VQO Z;  4MD9 A;  2RBL A;  1YIJ Z;  2O4H A;  3CCR 1;  4NBB A;  3GTM S;  3KIF A;  2KPI A;  3CC7 Z;  1RO4 A;  1USP A;  2QRD B;  2QVA A;  3D9X A;  3CC4 1;  1YJ9 Z;  2ZAE B;  3GTL I;  3I55 1;  4CL1 A;  3HOW I;  1YJW 1;  4BBS I;  1WW9 A;  3CCU 1;  3S1N I;  1W2B Y;  1JJ2 Y;  5C44 I;  1VQ5 Z;  2B89 A;  1TWF I;  4E31 A;  1ML8 A;  1N2F A;  2R44 A;  2B87 B;  4DQY B;  1NUI A;  2B63 I;  3LUS A;  2M5A B;  2OTJ Z;  3J80 b;  1H0T A;  3QWU A;  2LXC B;  4E32 A;  1VQL Z;  1VQ9 1;  4E2Z A;  2OZK A;  3CC2 Z;  1Q7Y 1;  1EDK A;  2G2K A;  1NVO A;  3S17 I;  4X6A I;  3ESW A;  1U7M A;  1SFO I;  4NBC A;  2BJO A;  3I07 A;  4E2W A;  2QLV B;  1Z03 A;  3NH4 A;  1KQS Y;  3GTM I;  3TE5 B;  3CXC Z;  2KZJ A;  1ZH1 A;  2M6N A;  1TWA I;  5D1P A;  2PM9 A;  2KIK A;  2SPZ A;  2W03 A;  2LIY A;  2JUB A;  4NB8 A;  2LXB A;  4HH4 A;  4KJM A;  3ZDM A;  3HOV I;  2QRE B;  5D1O A;  4MN4 C;  2RKL A;  1VQN Z;  3NDI A;  2JR6 A;  3NH5 A;  1EDJ A;  1I50 I;  4A3I I;  4A3C I;  3I56 1;  2DE6 A;  1YI2 Z;  3VB9 A;  2JNY A;  1VQ5 1;  4HB1 A;  3J7A 4;  2JA7 I;  1KRL A;  2P58 A;  1TWC I;  4RVF A;  3S1R I;  1Y1V S;  1N8R 2;  2OTJ 1;  4RS4 A;  1N8R 1;  3I4N I;  1S7M A;  1Q81 1;  3GTK I;  3CQZ I;  1ZW0 A;  5CBO A;  2DE7 A;  2K3R A;  4AYB A;  1VQL 1;  4K3A A;  2YU9 I;  3EER A;  3CCM Z;  1VQP 1;  4A3J I;  3MHV A;  5LL6 f;  2JA5 I;  2HR3 A;  2P28 A;  3D6W A;  4NPE A;  2RHB A;  1MFT A;  2HU9 A;  4MD7 A;  2M5A A;  1ZB9 A;  3S1Q I;  2M48 A;  2QA4 Z;  3TDH B;  3CCS 1;  4QTU A;  2DE5 A;  1YJN 1;  3FXE A;  3HKZ A;  5DJU B;  3FQM A;  1VQ4 Z;  4BY1 I;  5IT9 b;  1DL6 A;  1OVU A;  1FC2 C;  3HOX I;  1EDI A;  1SS1 A;  3HOY I;  1LQL A;  2Q1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...