2K3RA

Pfu rpp21 structure and assignments
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
KERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCKKCHAFLVPGINARVRLRQKRMPHIVVKCLECGHIMRYPYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 4
publication title Solution structure of Pyrococcus furiosus RPP21, a component of the archaeal RNase P holoenzyme, and interactions with its RPP29 protein partner.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 20
structure length 91
sequence length 91
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2008-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2k3rA01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2k3rA02
2B87A 2KZIA 1LT1A 4JBZA 4ASVA 1FC2C 1EDJA 4K3AA 1U7MA 1JMBA 2HR3A 2JWDA 2KI7B 4HKZH 1OVVA 5CBOA 3FXEA 1EDLA 1MFTA 3RGUA 5C39A 1EC5A 5K5GB 2KZJA 2QVAA 2B87B 4GOFA 1OVUA 1H0TA 2M0BA 2M5AA 3FXDA 4GODA 1OVRA 3QWOC 4ZNCA 2K3RA 1X0TA 4IOIH 2B88A 5CBNA 4GOEA 2ZAEB 1BDDA 4EYYQ 4MN4C 5DJUB 4ZMDA 1JM0A 1ZXGA 3S1KA 1S3JA 2OTKE 1DEEG 2UWJE 1LP1A 2LR2A 4CPGA 4KJMA 4NPEA 2B89A 2M5AB 2QRXA 3PH0A 1NVOA 2SPZA 5DJTB 2KIKA 2KS1B 1SS1A 4WWIA 2KUBA 2RKLA 4K35A 4NPDA 4ASWA 2WMMA 4BXLA 4NPFX 2LXBA 1ZW0A 2P58A 3MHVA 3ZDMA 1U7JA 2Q1KA 4HB1A 1BDCA 1EDKA 3MZWB 1H0TB 4HJGH 2R44A 2I8DA 1EDIA 1Q2NA 1Y47A 5EFWB 1LP1B 2LXCB
chains in the Genus database with same CATH superfamily
2V7QJ 3GTMI 1EZVD 3GTKI 5C4XI 3CC21 1FC2C 1EZVE 1WJ2A 1PZQA 1KRLA 1W5CE 1QLED 2WQYC 2JR6A 3N4XA 1VQKP 2OTJP 2R6MA 1FZEA 3CPWZ 1RHZB 1FAVA 2QJKC 3H32A 1PGOA 2ZT9B 4RJTA 3B5NB 1VQ71 5T64A 5A2Qf 3RGUA 4DGLA 1N2DC 2BEZF 3VTPC 1QX8A 2WSFH 3E1RA 1FE6A 1VQ61 2ZVOB 3MGNA 1JNMA 2J5UA 3L75D 4MD9A 2IZ0A 2G3AA 2NVTI 4BBSI 2QIWA 4NBHA 3L75E 4IOIH 5AW1B 1HF9A 4MD7A 3GHGC 3D71A 5DJUB 1KQFB 1KZUB 3KZIH 3VMYA 4X6AI 4MRIA 3Q5SA 3GF3A 4C7NA 4L73A 2FYZA 3BASA 1ZOYC 2J58A 3I551 1GL2C 3A0BE 5M1BA 3S2DI 1RE4A 1CZQA 3V6IA 5AVWB 5AW5B 4BY1I 1VQOZ 3HOVI 2A45H 3J81b 1KYOI 2Z5HA 1OX3A 2SPZA 1LT9B 4A3DI 2C0XA 2QRDB 1VL2A 4OGQD 1BCCJ 1L4AB 4NPFX 3S16I 3O6QA 3HRNA 1H8AA 1KB9I 1FBMA 3H3VJ 1OMIA 1OFCX 2N1TB 2K5RA 2D2CD 2DE5A 5APWA 1Q16A 1CI6A 1KD11 3E7KA 1RO4A 1SQVD 2B87A 3G6EZ 1JJ2Z 3HE5A 5GTIH 1LT1A 3CCRZ 1SQVE 3KZIE 2W8ZA 3NDIA 1EDJA 1K83I 1AVOA 3F3FC 4WVZA 4IL6H 1X3WA 4AYCA 1Y8AA 5FLXb 1XTGB 5E79E 1YTZI 3M3YI 3USSA 4I7ZB 1EZVG 5AW2B 4N6JA 3L74J 1JWHC 3CL3D 3V2NA 3G4S1 2JWAA 4A7PA 5C39A 2OYIB 1SQPK 2RBLA 1E79H 3S1NI 2I3CA 1NTMK 1OW8A 1JO5A 2OYHC 2ITAA 1YUAA 2P28A 1OVRA 3L35A 2Z4EA 4NB8A 1PGPA 2DE6A 3W67A 3TGUG 2E43A 5TJHA 1N8R1 1MUUA 3EEDA 4E32A 3H1KJ 4WY4D 4PD4I 3L75G 1I50I 3M06A 3Q87A 2GTIA 5GTIE 1NTKD 2OYOA 3G711 5AW0B 1KMIZ 1OW7A 1NTKE 1SQBD 4S1TA 4IL6E 1SQBE 2NPSC 3HUSC 2IV2X 1LGHB 3TDHB 2RKLA 3HE4A 4ASWA 3LW5H 2V4HA 2A06D 2RHBA 3D6YA 1K9M1 4BWNA 1TWHI 3GTLI 4R4LA 4E31A 2A06E 2Z5IA 5LL6f 3D6ZA 1K731 3SFEC 5EFWB 4E2XA 5CHXA 4I2LC 3VTNA 4Y52I 1MKMA 3AE9C 3IAOA 3EWKA 3KIHA 1KQSO 1NJI1 4K3AA 2GA1A 1TWGI 1HGVA 1YI2P 3QH9A 4PV1C 1K9M2 2OGUA 1SQVG 1LT9A 2JMOA 1RO2A 2O01J 1YYCA 2VPYA 3K7AI 1K732 1CSBA 1FZCB 2IBZE 2IFMA 3C1LA 1EC5A 1USDA 2IX7C 3S14I 4H0LB 1URQB 1VQ8Z 4NBAA 2JKVA 1DD4A 2Q5UA 3L72J 2N1TA 5CCHC 1SQXK 2P3YA 1VQO1 2KK7A 2MJZA 3FXDA 4NBFA 2B88A 2O4HA 4B86A 2HODA 2LKMA 4DT0A 2HFED 1DX7A 2AYDA 5C4JI 2P1JA 2W90A 3A5TA 3HD7B 1IZNB 1W2EA 1ZR4A 5C44I 1AFOA 2MKVA 1M57D 1X79B 2Y0DA 3G6E1 2JO1A 4BRYA 3CCR1 5BU8B 3BCCE 4EI2A 1VF5D 1NTKG 1YITP 2FKWB 3AEGC 1A02F 3CXCY 2HU9A 1PP9D 3T97B 4C7RA 3ZDMA 2P58A 1SQBG 3FWLA 2P67A 1PP9E 3V2QA 2RIQA 3IFMA 1TWFI 1VQMP 3CD6Z 3JCUH 2BASA 1EDKA 4RS4A 1M1K2 1T6AA 1R8EA 2C0WA 1DL6A 2A06G 2O01N 4LLHA 2GUVA 3I07A 3RZOI 1YIJP 1RF1B 3GTQI 2H89C 3BG1B 5IT9b 1G2CA 1SFCA 4NBGA 3EQ2A 1VQ5P 3AEDC 2P7JA 1RQVA 1GMJA 1AVYA 3CCQP 4HGYA 5AVQB 2H88C 4EWCA 3H1HJ 1NTZK 2QR1B 1GTWA 3FWNA 4GOFA 2IBZG 1YQ3C 3H0GI 2WSCH 2WITA 1YJ9Z 2IPPA 2FFDB 4QTUA 4ZNCA 1DIPA 2K3RA 2FYNC 3JCUE 5CBNA 4IFFA 3H1JD 1BSNA 3CC2P 1IK9A 3CCVZ 1S72Z 1RF0A 3H1JE 2Q3IA 1VQ9Z 2KPIA 1BE3D 2E74D 2JA8I 1WCMI 4NBDA 1DEEG 1BE3E 2FBWC 3CCLZ 1FZCA 1N2FA 1FJKA 2P10A 2VF1A 4OVNF 3OW2Z 4R4MA 3S17I 1URQA 2WPRA 4A3LI 5KJ7A 1USPB 1LTJA 3AEFC 4BXLA 1VQ7Z 1NAYA 2D2CB 3BCCG 2IYPA 1SQPJ 1M1JA 1NTMJ 5APTA 2M3BA 4HB1A 1N73B 4RVDA 1PPJD 3U1AA 1VQ6Z 3VB9A 4Y7NI 3H1LD 1PP9G 1PPJE 2IBZI 1HVVA 1NHLA 1YJNZ 1VQ81 3PO3S 3I55P 1VPCA 4ASVA 3V5BA 3T4NB 3PRJA 2BCCD 2M8RA 1ZR2A 4RO0A 2E75C 1OVVA 3TNUB 4CL1A 4H44D 3L70D 3T97A 2HF1A 3C9IA 2KZJA 4PV1D 5KLVD 2RT9A 3BG0B 3L73J 5KLVE 2IZ4A 2KOGA 2IZ1A 4NFRA 3I56Z 2M5AA 1JOCA 1L0NE 4E2ZA 3CC4Z 3II6A 1FZAA 1JY3O 4HGZA 2FXMA 3D2LA 4GT1A 1Q7Y1 2NVXI 3CCJ1 2V7QH 3HOWI 1RF1A 1N86A 5AN9F 3P7KA 1Y8CA 2VPZA 2JIRA 2R3CA 1LWUB 5GTHH 3CD61 4JF7A 4L76A 1J1DB 2UWJE 4WY4C 2W6AA 5AW6B 4W7ZA 3TSIA 2LR2A 1N7SB 2L5GB 2QA4P 2Y0CA 3ITKA 2E7ZA 1S5LH 1BE3G 3E1IA 5CJ0A 1ZMEC 1Q7Y2 3IN6A 1NU1D 1S7MA 3CXHE 3M0AA 2FYUG 4BY7I 3MHVA 1NU1E 1SQBK 1VQPZ 3CWBJ 4U7JA 1CW5A 1KQLA 1RE4C 3MUDA 3CC71 2YU9I 3MZWB 1SQXJ 5KLIC 3WUTA 3TDKA 1WIIA 3M0DA 1TWAI 5BU5A 3TYYA 3G71P 3A0HH 1YJ91 1PPJG 3VMIA 5GTHE 1JTHB 4DZOA 5CMZA 1HUCA 3CLQA 2E9HA 3CCV1 3Q5PA 1S721 3NH8A 3CI9A 4QMAA 3FXEA 2QJKB 2FY8A 1VQ91 3U1CA 4NBBA 1KD1Q 2HPCB 2JR8A 3AE6C 3GCFA 3Q2YA 1QVFO 1N73A 3CCL1 2NVYI 2R5BA 3HTKA 2G8YA 1PL5A 3H6PA 2JIOA 3IF4A 5KLVG 1NGMB 3RK2C 4YTPC 1OW6A 2V8JA 3GHGB 3HOXI 1L0NG 3GW6A 3BATA 3CCEZ 1JM0A 4PJ0E 1PIXA 5B66E 2E2II 2QKDA 1GK6A 1QVGO 3TNUA 1GL2B 3MP7B 3IX0A 5T67A 5KAFH 1K8A1 1YJN1 2B89A 1HWTC 2QRXA 4H13D 1NVOA 1R5SA 1N8RQ 1VQKZ 2KLUA 2YIUC 1VQOP 1BCCD 1KILA 4NPDA 1H88A 3CPWY 2JEEA 3SWFA 1BCCE 1ZN5A 3F89A 2YKQA 1NTZJ 1VF5C 3V4QA 1VQNZ 1RQUA 1K8A2 5AVXB 2XU6A 2OQQA 1H0TB 2FXOA 1NU1G 1EDIA 3V2RA 2XZRA 1LWUA 2JUBA 1IFNA 1QL1A 3I561 5KTBA 3PO2I 3TGUJ 3CC41 1SIWA 1N7SA 2I1KA 3G6EP 2JWDA 3KXDA 2JA6I 2W04A 2JA7I 2QM7A 1KQSY 2YNYA 5KAFE 3L74D 3P5JB 1YUKA 3J80b 4A93I 1K73Q 3L74E 1SQQK 3ABVC 3L71J 1UIXA 2QSIA 4A3EI 2E75D 2AXTH 3EERA 3CMEP 4W80A 1P84I 2YKOA 2VUMI 5AVUB 1NJIQ 2BJOA 5CM2M 3AE2C 2PFXA 2K9YA 1AA0A 3RL0D 1RQFA 2PP6A 1VQ4Z 5D1PA 2V3VA 3H1KD 4AQRD 2IDBA 3CXHI 1VQP1 3H1KE 3WUUA 3A2AA 2KB7P 2N1TC 2KNCB 1GU4A 2QG4A 1U57A 3ESWA 1X22A 3U59A 2O01H 4NPEA 2E74C 3R4YA 3PH0A 3S1QI 2Y9YA 2ZXEB 2E2JI 2NPSB 2Y0SA 2KIKA 3HUSB 3VP9A 3GF7A 3SFDC 1PFTA 2JA5I 3QWUA 5TISH 2FYUK 1G1IA 3AE5C 3AE7C 2ZVNB 4RV9A 2AXTE 3GTJI 3B5NA 4E33A 1L0LK 2JP3A 2NZ2A 2YO2A 4YPCA 3G3ZA 1BCCG 1S4XA 3V2PA 3CPWO 2Q3EA 2K9JB 4EOTA 4A3BI 1GL2A 2N9BA 4KT0J 3KQGA 1EZVI 2V45A 3VMHA 3HKZA 2M48A 1DEBA 5APXA 1FJPA 4PV1B 3CCE1 5AW7B 4U3FJ 2O1JA 4D6TJ 3PP5A 3L72D 3L74G 4H44C 1OVUA 1H0TA 2ZYGA 1S2EA 5TISE 3PO3I 1SQBJ 3GTGI 1YJWZ 1VQK1 1UIIA 4GOEA 2ZAEB 3AEBC 1SFCC 3KYQA 2M6NA 1L4AA 5AW8B 2QM8A 3RZDI 1L0NK 3I4NI 3CCUP 1ML8A 2CK3H 1ZXGA 3S1KA 4A3CI 3RK2D 1VQN1 3M9QA 2A45G 2WT7B 1ZB9A 1W2BZ 3H1KG 4N3YB 1X3ZA 3GMAA 2R3SA 2I1JA 3NMDA 1ZV8A 2HLOA 2DE7A 3CCSP 2PM9A 1YI2Z 4E2YA 4N78D 3NTNA 1FOSE 1SS1A 3V4WA 4K35A 1FS0E 1RF0C 4N78E 5KKZB 1YQ4C 2WMMA 1SLQA 2JJLA 3VMAA 3J81f 1IJDB 3CXCZ 1T3JA 1M1K1 3JAMb 1NWQA 1FZCC 1Q2NA 2OYIA 1VQLP 1JY3P 3CD6P 1X8YA 4H0LC 3AECC 2KZIA 1URQC 3CX5H 2B9BA 5KJ7C 1QYPA 4E30A 3CCJZ 2ZT9D 4EDFA 1LTJC 1AQ5A 3J80f 4TNUA 2WAQA 1U7MA 3M9BA 1LTAC 4DQYB 1VQ41 4GKGA 3J7A4 1T3UA 1M1JC 3L37A 3S1RI 4M3LA 1S1CX 3HUSA 1Y1VI 1LTIC 3S15I 2OZKA 2A45I 1JY2N 5K5GB 1K04A 1OWAA 1Q81Q 5FLXf 2QJYC 3Q3DA 2QREB 1IFJA 1JEKA 3LUSA 2W83C 1BSHA 1OXZA 4DOJA 4XX2A 1NO4A 3BCCJ 3D6WA 2FYNB 1Q82Q 2OTLZ 1G1JA 3CC7Z 3OJAB 1WRGA 3CX5D 3HOYI 3CX5E 3CQZI 4O9BA 3D9XA 1S72P 4NH1C 5H2FH 2JNYA 1JCDA 1VQ9P 4Y99C 3SWYA 3OA7A 1FDOA 3CCMZ 1XTCC 1H89A 1RY3A 4LC1A 3FKII 1NUIA 3GG2A 3CCLP 5DJTB 1NKZB 2N1TD 2Y9ZA 4MH4A 5T6BA 2KUBA 5CCHA 1GU5A 1SQQJ 1VLAA 4H13C 1SQPD 4C46A 1VQ5Z 1LTGC 1NTMD 3AE8C 1SQPE 1YHQZ 2K88A 3EFGA 1VQ7P 2R44A 4XE5B 1RNIA 4OGQB 4EIJA 1LP1B 5CCGA 2NAPA 1JCCA 1NH4A 1FZGA 1VQ6P 4DK1A 2WT7A 1ZP0C 2WPQA 3TF5A 1BGYD 5A2Qb 3L36A 2CPSA 3PLNA 1YJW1 5FLMI 1BGYE 3Q5RA 3GLMA 4HKZH 1ZRTD 5AVTB 3R2PA 5H2FE 2E75B 1M90Q 1ZRTE 2N9YB 1L1OC 3H1LE 3FX0A 3HD7A 3M0DC 2KP8A 2H43A 2QEXZ 3L73D 2QVAA 3KIFA 1HH0A 1Z03A 2VRSA 1KB9H 3L73E 2QRCB 1NP6A 1A02J 3VMGA 1IO4A 2O3JA 2YKPA 5CJ4A 1QVFY 2FYUJ 1YI21 1SQVK 3RK3C 3EFFK 2BCCE 1R9TI 4IL6X 1L0LJ 1Y1WI 3KHUA 2J6AA 3L70E 2XV5A 1I3QI 2HG5D 3RL0C 2LIYA 1SFCD 2QJPC 1GDTA 4WY4B 2POHA 3P8CD 4NBEA 2YXRB 3B8EB 1HJ0A 1QVGY 3H1IJ 3P8CE 3F5HA 5BVZA 1J1EB 2LFUA 2F4MA 1Z56A 3CWBD 3IR9A 1AV1A 3CWBE 3H1JG 1T8ZA 3I5CA 4JYBA 4BXXI 3G4SP 1SQXD 2I8DA 2WB1A 1VQPP 1SQXE 3JSVC 2WPVB 5KLIB 1SQPG 4DJGA 3KPEA 1NTKK 1E5WA 1Y1VS 5C3EI 2ZXXA 1MV8A 1N7LA 1P9NA 2FFDA 1L0NJ 1KILC 1HGZA 5D1OB 3NFQA 4H0LD 1URQD 2OTL1 5KJ7D 2WSEJ 1M8OB 3BVHA 1BGYG 4DCKA 1WW9A 3W68A 3TK1A 5IT9f 3CX5I 2QA4Z 1OIPA 1Q861 2B87B 3HE5B 1Z01A 3AEAC 3AE1C 2O53A 4QTTA 3H1LG 3CCM1 1WT6A 4AUWA 2G2KA 1Z02A 2OOXB 1USPA 3C8VA 3CMAZ 3L73G 2WWWA 4MN4C 2LEXA 3OW2O 2E76C 2RPRA 3JC22 1IFPA 2P2UA 2ZFCA 1VQ51 1S5LE 3NDJA 3IR7A 2BCCG 4UB8H 1YHQ1 1S3JA 2BEQD 1GW3A 1Q862 1KC81 4JPZB 2IZ3A 3L70G 4A3KI 5IP7I 3IF8A 3A7OA 4A3II 3HOUI 3A0BH 2AXCA 4WB4A 1FU1A 2YIUB 1L2PA 1ZW0A 1AJYA 1NTZD 3A0HE 2Q1KA 2OOYB 1KC82 3O8ZA 3IFUA 1VF5B 1NTZE 3VP8A 3WMM0 1BDCA 1HTLC 1RE3A 2F4OA 4GIFA 2R93I 3Q1MA 2QEX1 3CWBG 1VQNP 4JBZA 2J59M 2OTJZ 3TGUD 1NAFA 1SQXG 4WY4A 1IC2A 2E5TA 3TGUE 3FQQA 2HR3A 1DD3A 3HE4B 4UB8E 3SSUA 3BRTB 2H7HA 2ZT9C 3B5NC 1LJ2A 1EDLA 3HOZI 1KQSZ 3L71D 3VMXA 1NKNA 3L71E 1QXFA 4I1LA 1QEXA 5E79H 4XFJA 1YTZT 1AQTA 3L75J 3CCRP 3M91A 1K9MQ 2PK7A 2V8IA 4TLFA 1HBWA 2NRGA 5L8RJ 1TU3F 1GD2E 2GUSA 5D1OA 3NFZA 1LNQA 1T2KC 1VQ4P 2OARA 2OTKE 3RK3D 4UB6H 2OYHB 3RK3E 4KJMA 2JIQA 1NYHA 2E74B 4IFDK 1LT9C 4RKUJ 1QGKB 5APQA 1M7LA 3M4OI 3S9OA 3FGAD 1L4AC 1WZNA 1JTHA 3OAKA 3NXSA 2WSFJ 2HODB 1RH5B 4Z1MH 1U7JA 5AVVB 1JJ2Y 4RVHA 2HPCA 2PGDA 1JY2P 4IFMA 4A3FI 3CMEZ 1EXIA 1QF8A 1OZHA 2QA41 1KD12 2LXCB 1NTZG 2L91A 2YMKA 1SQVJ 3LIDA 4BRYB 5AW4B 1SP4A 1R5LA 2RMZA 3S4RA 1LTBC 3AE4C 2QLVB 1JMBA 3RL0g 3CMA1 4I7ZC 1S9KD 1FOSF 3GHGA 4UB6E 1D7MA 1S9KE 1M1KQ 4NOZA 1TWCI 1KILD 4U3FD 2OYIC 2VPXA 2FXPA 2JIMA 4D6TD 1PV3A 1KILE 4U3FE 3MZLB 4D6TE 3MONA 4L75A 1MZ9A 1AA6A 4H44B 3L71G 2WPSA 1PGQA 2JS4A 3BRVB 2W03A 4I6MC 1G2CB 1N8R2 1SFCB 1N7SD 2K1AA 1YJWP 2R7ZI 4A3MI 3GTMS 1PFIA 1NTKJ 3L72E 2E76D 2KXPB 4CPGA 1IK7A 1VQ8P 5AVZB 2YMYA 5KLVK 2OTJ1 1M56D 3UIAA 2KS1B 4YXDC 1K05A 2XKMA 3M9HA 2IYOA 3PTZA 3MD0A 2AEMA 3B4SA 2IBZD 1MFZA 2GM4A 4ZKPA 4Y28J 5AVYB 3LIEA 1DH3A 2RH0A 4YXWH 1GW4A 4WBAA 2OYHA 1EQ7A 1KV4A 5AVSB 1WMKA 2XNDH 4HH2A 1S5LX 2PAJA 1NJI2 2YXQB 3H25A 1LTJB 4NBCA 2KI7B 2E5YA 2R5DA 2VUGA 4BBRI 1FDIA 3CCUZ 3CCJP 1LQLA 1M1JB 1SFOI 1IFIA 5CBOA 3S2HI 2ZJSE 1VDFA 1NU1K 5AVRB 2NVQI 4JYCA 5CCGC 1W2BY 2H85A 5AW9B 1GZLA 2KNCA 2QJYB 3B5ND 3LW5J 1TFIA 3CCSZ 4U3FG 3MZKB 2W6BA 3BCCD 4L74A 1I6HI 4D6TG 2NPSA 1GL2D 1X9VA 2WZ7A 5KKZC 1FDMA 4OWFA 3H1HD 1RO0A 1ZH1A 3HD7C 3H1HE 1VQLZ 2OTLP 2KSEA 3CC7P 1QL2A 3TE5B 1JMMA 2QE7H 1JY2O 3CME1 1YITZ 2E42A 4ZKUA 2K9JA 4Y99B 2M5AB 4HH4A 1T2KD 1Q90D 3KDPB 3WU2H 1LTTC 2JDIH 3L72G 1ZLLA 1YJ9P 3MIWA 1VQMZ 3PJSK 3CCMP 1SQQD 1PP9J 3RBXA 1SQQE 4H13B 2WSSH 3CCVP 4MXUA 3L4FA 3AE3C 2B63I 1L4AD 1KFMA 3MTUE 3S1MI 1YIJZ 1YHQP 1Q7YQ 2R32A 2Q6QA 1J2JB 3K5BA 1KQGB 1PGJA 1RF1C 2Q9IA 3NH4A 3VOPA 1FZBA 3CCQZ 4E2WA 1NTME 2DW3A 2KS1A 2H8PD 4LGDE 2KYVA 3VN0A 5B5EH 1KORA 3I4MI 5APSA 3WU2E 3SWKA 1LTSC 1Y9BA 5APUA 4W7YA 4TT3H 2GTHA 2M0BA 1YJNP 2E2HI 1ZB8A 1KN7A 4NB9A 2FFDC 3CC2Z 2FYUD 2QEXP 2AKLA 3QWOC 3VMZA 3A3YB 1KYOH 2FYUE 1W2BO 3MUDC 2XDJA 3D70A 3RK3B 4EYYQ 1L0LD 3H1JJ 1QVFZ 4ZMDA 1L0LE 2W27A 4MONA 1BE3J 3RL0B 2Q4ZA 3OW2Y 5KAIH 1Q86Q 2NPSD 2WSEH 1RLYA 4OGQC 2QJPB 3HTKB 5IP9I 3H1HG 3H1ID 4MD8A 2YO3A 4KHXA 3I56P 1Q811 3H1IE 3VYIA 1USEA 2JIPA 3CC4P 3H32B 3P32A 2VPWA 1QVGZ 5APVA 2D2CC 1P84H 5B5EE 3CCU1 1BGYJ 4RESB 4JQ0D 1N73C 1KC8Q 2PRRA 2WSCJ 3I55Z 3GKQA 2K37A 5AW3B 1Q821 1GK4A 4GDOA 1SQQG 1KYOD 3H1LJ 3P8MC 2ZYDA 3CXHH 1FZFA 1KYOE 2ZYAA 1JY3N 1Q812 3CCS1 3FQMA 1JUNA 2IFNA 1L0ND 4XA4A 3JAMf 4RVGA 3F3PC 4C7NB 1KB9D 1KILB 1IFDA 3RBZA 2V8KA 2BCCJ 5KAIE 1KB9E 2R92I 2RN0A 1K8AQ 3B71A 1RE3C 1Q822 4OH8B 5APYA 1MFTA 2AEFA 1YBKA 3L70J 5CCHD 2C9NY 4PD4H 1JB0J 2Q7CA 1VQL1 1NTMG 5KLVJ 2WTYA 1P84D 1YIT1 2CPBA 1NOHA 2YADA 4A3JI 3G9RA 1P84E 4GODA 2C9LY 3O6QB 5CCGD 1X0TA 3N7NA 1VQM1 1J1EC 1BDDA 1HJBA 1SVFA 3CXHD 1LWUC 1KTMA 2E76B 3WUVA 4HYTB 2O1KA 2Y0EA 3G4SZ 1CI6B 2M3EA 3CMAP 1J1DC 1EXJA 3NH5A 2W6JH 2PMZA 1L0LG 1N7SC 4AYBA 1YIJ1 1LP1A 1M901 3GTOI 2HYNA 2Q51A 1KFNA 2EGTA 3AEEC 4PJ0H 3HD7D 5B66H 4RVFA 3U50C 3RK2B 4A3GI 2WVRA 3GTPI 4PD4D 2AEJA 2KSJA 4WWIA 1NU1J 4PD4E 2KLVA 2LXBA 3CCQ1 3H1IG 3CCEP 3PHLA 3G71Z 4HJGH 1M902 1Y47A 2XNXA 1IFMA 2GU2A
chains in the Genus database with same CATH topology
1VQ81 3PO3S 2KZIA 3GTMI 3GTKI 4ASVA 1QYPA 4E30A 5C4XI 3T4NB 1FC2C 3CC21 3CCJZ 3J80f 1KRLA 2WAQA 4TNUA 1U7MA 2QLVB 1JMBA 4DQYB 2JR6A 3CMA1 1VQ41 2R6MA 3J7A4 3S1RI 3CPWZ 1OVVA 4CL1A 1Y1VI 3S15I 2OZKA 4NOZA 1TWCI 2HF1A 5T64A 5A2Qf 1VQ71 3RGUA 4DGLA 5K5GB 2KZJA 2RT9A 5FLXf 3MZLB 2QREB 3BG0B 3LUSA 3MONA 1VQ61 2IZ4A 4NFRA 3I56Z 2M5AA 4MD9A 4E2ZA 3CC4Z 2NVTI 4HGZA 4BBSI 4NBHA 4XX2A 4IOIH 4MD7A 2JS4A 3D6WA 1Q7Y1 2NVXI 3CCJ1 2W03A 5DJUB 2OTLZ 3HOWI 3CC7Z 1N8R2 4X6AI 4MRIA 5AN9F 2R7ZI 3HOYI 3CD61 3I551 3CQZI 4A3MI 3D9XA 3GTMS 3S2DI 4NH1C 2UWJE 2JNYA 2LR2A 4BY1I 4CPGA 1VQOZ 3HOVI 3CCMZ 3J81b 3FKII 2OTJ1 1NUIA 1Q7Y2 2SPZA 5DJTB 2KS1B 4MH4A 4A3DI 2QRDB 5T6BA 2KUBA 1S7MA 4NPFX 4BY7I 3MHVA 1VLAA 3S16I 1VQ5Z 1VQPZ 1YHQZ 3H3VJ 3CC71 2YU9I 3MZWB 2K5RA 2R44A 2DE5A 1RNIA 1KD11 1LP1B 1WIIA 1RO4A 1TWAI 2B87A 3G6EZ 1JJ2Z 1LT1A 3CCRZ 4DK1A 1YJ91 3NDIA 1EDJA 1K83I 3VMIA 1NJI2 5A2Qb 4NBCA 3F3FC 5FLMI 1YJW1 2KI7B 2VUGA 1X3WA 4BBRI 5FLXb 3CCUZ 4HKZH 3M3YI 2E9HA 3CCV1 1LQLA 1S721 3NH8A 1SFOI 5CBOA 3FXEA 1JWHC 3S2HI 1VQ91 3G4S1 1L1OC 4NBBA 5C39A 2RBLA 3GCFA 2NVQI 3S1NI 2I3CA 2QEXZ 1W2BY 2H85A 2QVAA 3KIFA 3CCL1 1Z03A 2NVYI 2QRCB 1TFIA 3CCSZ 1YUAA 1NP6A 3VMGA 2P28A 1OVRA 3MZKB 1QVFY 1I6HI 4NB8A 1YI21 2DE6A 1R9TI 2V8JA 3HOXI 1N8R1 3EEDA 4E32A 3CCEZ 1JM0A 1Y1WI 2J6AA 1I3QI 1I50I 2E2II 1RO0A 2QKDA 3Q87A 2GTIA 1ZH1A 2LIYA 1VQLZ 3IX0A 5T67A 3G711 3TE5B 1K8A1 3CME1 1YITZ 1YJN1 4S1TA 4NBEA 2B89A 2M5AB 4HH4A 2QRXA 1QVGY 1NVOA 2LFUA 2F4MA 1VQMZ 1VQKZ 3TDHB 2RKLA 4NPDA 4ASWA 3CPWY 2RHBA 1K9M1 1TWHI 3GTLI 4E31A 4MXUA 1VQNZ 4BXXI 5LL6f 1K8A2 2B63I 1H0TB 1K731 2I8DA 1EDIA 2WB1A 3S1MI 5EFWB 4E2XA 1YIJZ 3VTNA 4Y52I 2JUBA 3I561 1Y1VS 5C3EI 3PO2I 3KIHA 1P9NA 3NH4A 3CC41 1NJI1 4K3AA 1TWGI 2JA6I 2JWDA 2W04A 2JA7I 1K9M2 5D1OB 3CCQZ 1KQSY 4E2WA 2OTL1 2JMOA 3P5JB 1YUKA 3J80b 1RO2A 3K7AI 1K732 4A93I 1EC5A 1WW9A 3I4MI 3S14I 5IT9f 2QA4Z 1VQ8Z 4NBAA 4A3EI 1Q861 2B87B 1Z01A 3EERA 2GTHA 2O53A 2M0BA 4QTTA 2E2HI 2VUMI 1ZB8A 2BJOA 2P3YA 1VQO1 3CCM1 4NB9A 3CC2Z 3FXDA 4NBFA 5CM2M 2G2KA 1Z02A 2AKLA 3QWOC 2OOXB 1USPA 1RQFA 2B88A 3CMAZ 1VQ4Z 2O4HA 4EYYQ 5D1PA 4MN4C 1QVFZ 2RPRA 4ZMDA 1VQ51 1VQP1 3NDJA 5C4JI 1YHQ1 1S3JA 4MONA 2Q4ZA 3OW2Y 1Q862 1KC81 2IZ3A 5C44I 4A3KI 1RLYA 3ESWA 5IP7I 3G6E1 5IP9I 4NPEA 3IF8A 4A3II 3HOUI 4MD8A 3CCR1 3PH0A 3S1QI 1Q811 2E2JI 2Y0SA 2KIKA 1QVGZ 3CXCY 2HU9A 1PFTA 1ZW0A 2P58A 3ZDMA 2JA5I 3CCU1 3QWUA 2RIQA 2Q1KA 1TWFI 2OOYB 1KC82 3CD6Z 3IFUA 4RV9A 3I55Z 1BDCA 3GKQA 3GTJI 1EDKA 4RS4A 4E33A 1Q821 2F4OA 1M1K2 2R93I 2QEX1 1DL6A 4A3BI 1Q812 4JBZA 3CCS1 2OTJZ 3I07A 3VMHA 3FQMA 3RZOI 3JAMf 4RVGA 3GTQI 3HKZA 2M48A 3F3PC 3FQQA 3BG1B 2HR3A 2V8KA 5IT9b 2R92I 3CCE1 4NBGA 1Q822 1EDLA 1MFTA 3HOZI 1KQSZ 4HGYA 1VQL1 4EWCA 2QR1B 4GOFA 1YIT1 1OVUA 1H0TA 2YADA 4A3JI 3H0GI 1YJ9Z 4GODA 3PO3I 2PK7A 4QTUA 4ZNCA 2K3RA 2V8IA 1YJWZ 3GTGI 1X0TA 1VQM1 1VQK1 5CBNA 4GOEA 2ZAEB 1BDDA 2M6NA 3CCVZ 1S72Z 3I4NI 3RZDI 1VQ9Z 2KPIA 1ML8A 3G4SZ 5D1OA 1ZXGA 3S1KA 3NFZA 4A3CI 2OTKE 1VQN1 2JA8I 1WCMI 3NH5A 4NBDA 1DEEG 2PMZA 3CCLZ 4AYBA 1ZB9A 1YIJ1 1W2BZ 1LP1A 1N2FA 1M901 1X3ZA 2VF1A 4KJMA 3GTOI 3OW2Z 2Q51A 2EGTA 3S17I 4RVFA 3U50C 2DE7A 4A3GI 4A3LI 2PM9A 3GTPI 1YI2Z 1USPB 4E2YA 3M4OI 1SS1A 4WWIA 4K35A 2WMMA 4BXLA 1VQ7Z 2LXBA 3CCQ1 3J81f 1U7JA 3CXCZ 4HB1A 4RVDA 1JJ2Y 1VQ6Z 1M1K1 4RVHA 3G71Z 3JAMb 4HJGH 3VB9A 4A3FI 4Y7NI 1M902 1Q2NA 1Y47A 3CMEZ 1QF8A 1YJNZ 2QA41 1KD12 2LXCB 2GU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B87 A;  2KZI A;  1LT1 A;  4JBZ A;  4ASV A;  1FC2 C;  1EDJ A;  4K3A A;  1U7M A;  1JMB A;  2HR3 A;  2JWD A;  2KI7 B;  4HKZ H;  1OVV A;  5CBO A;  3FXE A;  1EDL A;  1MFT A;  3RGU A;  5C39 A;  1EC5 A;  5K5G B;  2KZJ A;  2QVA A;  2B87 B;  4GOF A;  1OVU A;  1H0T A;  2M0B A;  2M5A A;  3FXD A;  4GOD A;  1OVR A;  3QWO C;  4ZNC A;  2K3R A;  1X0T A;  4IOI H;  2B88 A;  5CBN A;  4GOE A;  2ZAE B;  1BDD A;  4EYY Q;  4MN4 C;  5DJU B;  4ZMD A;  1JM0 A;  1ZXG A;  3S1K A;  1S3J A;  2OTK E;  1DEE G;  2UWJ E;  1LP1 A;  2LR2 A;  4CPG A;  4KJM A;  4NPE A;  2B89 A;  2M5A B;  2QRX A;  3PH0 A;  1NVO A;  2SPZ A;  5DJT B;  2KIK A;  2KS1 B;  1SS1 A;  4WWI A;  2KUB A;  2RKL A;  4K35 A;  4NPD A;  4ASW A;  2WMM A;  4BXL A;  4NPF X;  2LXB A;  1ZW0 A;  2P58 A;  3MHV A;  3ZDM A;  1U7J A;  2Q1K A;  4HB1 A;  1BDC A;  1EDK A;  3MZW B;  1H0T B;  4HJG H;  2R44 A;  2I8D A;  1EDI A;  1Q2N A;  1Y47 A;  5EFW B;  1LP1 B;  2LXC B; 
#chains in the Genus database with same CATH topology
 2V7Q J;  3GTM I;  1EZV D;  3GTK I;  5C4X I;  3CC2 1;  1FC2 C;  1EZV E;  1WJ2 A;  1PZQ A;  1KRL A;  1W5C E;  1QLE D;  2WQY C;  2JR6 A;  3N4X A;  1VQK P;  2OTJ P;  2R6M A;  1FZE A;  3CPW Z;  1RHZ B;  1FAV A;  2QJK C;  3H32 A;  1PGO A;  2ZT9 B;  4RJT A;  3B5N B;  1VQ7 1;  5T64 A;  5A2Q f;  3RGU A;  4DGL A;  1N2D C;  2BEZ F;  3VTP C;  1QX8 A;  2WSF H;  3E1R A;  1FE6 A;  1VQ6 1;  2ZVO B;  3MGN A;  1JNM A;  2J5U A;  3L75 D;  4MD9 A;  2IZ0 A;  2G3A A;  2NVT I;  4BBS I;  2QIW A;  4NBH A;  3L75 E;  4IOI H;  5AW1 B;  1HF9 A;  4MD7 A;  3GHG C;  3D71 A;  5DJU B;  1KQF B;  1KZU B;  3KZI H;  3VMY A;  4X6A I;  4MRI A;  3Q5S A;  3GF3 A;  4C7N A;  4L73 A;  2FYZ A;  3BAS A;  1ZOY C;  2J58 A;  3I55 1;  1GL2 C;  3A0B E;  5M1B A;  3S2D I;  1RE4 A;  1CZQ A;  3V6I A;  5AVW B;  5AW5 B;  4BY1 I;  1VQO Z;  3HOV I;  2A45 H;  3J81 b;  1KYO I;  2Z5H A;  1OX3 A;  2SPZ A;  1LT9 B;  4A3D I;  2C0X A;  2QRD B;  1VL2 A;  4OGQ D;  1BCC J;  1L4A B;  4NPF X;  3S16 I;  3O6Q A;  3HRN A;  1H8A A;  1KB9 I;  1FBM A;  3H3V J;  1OMI A;  1OFC X;  2N1T B;  2K5R A;  2D2C D;  2DE5 A;  5APW A;  1Q16 A;  1CI6 A;  1KD1 1;  3E7K A;  1RO4 A;  1SQV D;  2B87 A;  3G6E Z;  1JJ2 Z;  3HE5 A;  5GTI H;  1LT1 A;  3CCR Z;  1SQV E;  3KZI E;  2W8Z A;  3NDI A;  1EDJ A;  1K83 I;  1AVO A;  3F3F C;  4WVZ A;  4IL6 H;  1X3W A;  4AYC A;  1Y8A A;  5FLX b;  1XTG B;  5E79 E;  1YTZ I;  3M3Y I;  3USS A;  4I7Z B;  1EZV G;  5AW2 B;  4N6J A;  3L74 J;  1JWH C;  3CL3 D;  3V2N A;  3G4S 1;  2JWA A;  4A7P A;  5C39 A;  2OYI B;  1SQP K;  2RBL A;  1E79 H;  3S1N I;  2I3C A;  1NTM K;  1OW8 A;  1JO5 A;  2OYH C;  2ITA A;  1YUA A;  2P28 A;  1OVR A;  3L35 A;  2Z4E A;  4NB8 A;  1PGP A;  2DE6 A;  3W67 A;  3TGU G;  2E43 A;  5TJH A;  1N8R 1;  1MUU A;  3EED A;  4E32 A;  3H1K J;  4WY4 D;  4PD4 I;  3L75 G;  1I50 I;  3M06 A;  3Q87 A;  2GTI A;  5GTI E;  1NTK D;  2OYO A;  3G71 1;  5AW0 B;  1KMI Z;  1OW7 A;  1NTK E;  1SQB D;  4S1T A;  4IL6 E;  1SQB E;  2NPS C;  3HUS C;  2IV2 X;  1LGH B;  3TDH B;  2RKL A;  3HE4 A;  4ASW A;  3LW5 H;  2V4H A;  2A06 D;  2RHB A;  3D6Y A;  1K9M 1;  4BWN A;  1TWH I;  3GTL I;  4R4L A;  4E31 A;  2A06 E;  2Z5I A;  5LL6 f;  3D6Z A;  1K73 1;  3SFE C;  5EFW B;  4E2X A;  5CHX A;  4I2L C;  3VTN A;  4Y52 I;  1MKM A;  3AE9 C;  3IAO A;  3EWK A;  3KIH A;  1KQS O;  1NJI 1;  4K3A A;  2GA1 A;  1TWG I;  1HGV A;  1YI2 P;  3QH9 A;  4PV1 C;  1K9M 2;  2OGU A;  1SQV G;  1LT9 A;  2JMO A;  1RO2 A;  2O01 J;  1YYC A;  2VPY A;  3K7A I;  1K73 2;  1CSB A;  1FZC B;  2IBZ E;  2IFM A;  3C1L A;  1EC5 A;  1USD A;  2IX7 C;  3S14 I;  4H0L B;  1URQ B;  1VQ8 Z;  4NBA A;  2JKV A;  1DD4 A;  2Q5U A;  3L72 J;  2N1T A;  5CCH C;  1SQX K;  2P3Y A;  1VQO 1;  2KK7 A;  2MJZ A;  3FXD A;  4NBF A;  2B88 A;  2O4H A;  4B86 A;  2HOD A;  2LKM A;  4DT0 A;  2HFE D;  1DX7 A;  2AYD A;  5C4J I;  2P1J A;  2W90 A;  3A5T A;  3HD7 B;  1IZN B;  1W2E A;  1ZR4 A;  5C44 I;  1AFO A;  2MKV A;  1M57 D;  1X79 B;  2Y0D A;  3G6E 1;  2JO1 A;  4BRY A;  3CCR 1;  5BU8 B;  3BCC E;  4EI2 A;  1VF5 D;  1NTK G;  1YIT P;  2FKW B;  3AEG C;  1A02 F;  3CXC Y;  2HU9 A;  1PP9 D;  3T97 B;  4C7R A;  3ZDM A;  2P58 A;  1SQB G;  3FWL A;  2P67 A;  1PP9 E;  3V2Q A;  2RIQ A;  3IFM A;  1TWF I;  1VQM P;  3CD6 Z;  3JCU H;  2BAS A;  1EDK A;  4RS4 A;  1M1K 2;  1T6A A;  1R8E A;  2C0W A;  1DL6 A;  2A06 G;  2O01 N;  4LLH A;  2GUV A;  3I07 A;  3RZO I;  1YIJ P;  1RF1 B;  3GTQ I;  2H89 C;  3BG1 B;  5IT9 b;  1G2C A;  1SFC A;  4NBG A;  3EQ2 A;  1VQ5 P;  3AED C;  2P7J A;  1RQV A;  1GMJ A;  1AVY A;  3CCQ P;  4HGY A;  5AVQ B;  2H88 C;  4EWC A;  3H1H J;  1NTZ K;  2QR1 B;  1GTW A;  3FWN A;  4GOF A;  2IBZ G;  1YQ3 C;  3H0G I;  2WSC H;  2WIT A;  1YJ9 Z;  2IPP A;  2FFD B;  4QTU A;  4ZNC A;  1DIP A;  2K3R A;  2FYN C;  3JCU E;  5CBN A;  4IFF A;  3H1J D;  1BSN A;  3CC2 P;  1IK9 A;  3CCV Z;  1S72 Z;  1RF0 A;  3H1J E;  2Q3I A;  1VQ9 Z;  2KPI A;  1BE3 D;  2E74 D;  2JA8 I;  1WCM I;  4NBD A;  1DEE G;  1BE3 E;  2FBW C;  3CCL Z;  1FZC A;  1N2F A;  1FJK A;  2P10 A;  2VF1 A;  4OVN F;  3OW2 Z;  4R4M A;  3S17 I;  1URQ A;  2WPR A;  4A3L I;  5KJ7 A;  1USP B;  1LTJ A;  3AEF C;  4BXL A;  1VQ7 Z;  1NAY A;  2D2C B;  3BCC G;  2IYP A;  1SQP J;  1M1J A;  1NTM J;  5APT A;  2M3B A;  4HB1 A;  1N73 B;  4RVD A;  1PPJ D;  3U1A A;  1VQ6 Z;  3VB9 A;  4Y7N I;  3H1L D;  1PP9 G;  1PPJ E;  2IBZ I;  1HVV A;  1NHL A;  1YJN Z;  1VQ8 1;  3PO3 S;  3I55 P;  1VPC A;  4ASV A;  3V5B A;  3T4N B;  3PRJ A;  2BCC D;  2M8R A;  1ZR2 A;  4RO0 A;  2E75 C;  1OVV A;  3TNU B;  4CL1 A;  4H44 D;  3L70 D;  3T97 A;  2HF1 A;  3C9I A;  2KZJ A;  4PV1 D;  5KLV D;  2RT9 A;  3BG0 B;  3L73 J;  5KLV E;  2IZ4 A;  2KOG A;  2IZ1 A;  4NFR A;  3I56 Z;  2M5A A;  1JOC A;  1L0N E;  4E2Z A;  3CC4 Z;  3II6 A;  1FZA A;  1JY3 O;  4HGZ A;  2FXM A;  3D2L A;  4GT1 A;  1Q7Y 1;  2NVX I;  3CCJ 1;  2V7Q H;  3HOW I;  1RF1 A;  1N86 A;  5AN9 F;  3P7K A;  1Y8C A;  2VPZ A;  2JIR A;  2R3C A;  1LWU B;  5GTH H;  3CD6 1;  4JF7 A;  4L76 A;  1J1D B;  2UWJ E;  4WY4 C;  2W6A A;  5AW6 B;  4W7Z A;  3TSI A;  2LR2 A;  1N7S B;  2L5G B;  2QA4 P;  2Y0C A;  3ITK A;  2E7Z A;  1S5L H;  1BE3 G;  3E1I A;  5CJ0 A;  1ZME C;  1Q7Y 2;  3IN6 A;  1NU1 D;  1S7M A;  3CXH E;  3M0A A;  2FYU G;  4BY7 I;  3MHV A;  1NU1 E;  1SQB K;  1VQP Z;  3CWB J;  4U7J A;  1CW5 A;  1KQL A;  1RE4 C;  3MUD A;  3CC7 1;  2YU9 I;  3MZW B;  1SQX J;  5KLI C;  3WUT A;  3TDK A;  1WII A;  3M0D A;  1TWA I;  5BU5 A;  3TYY A;  3G71 P;  3A0H H;  1YJ9 1;  1PPJ G;  3VMI A;  5GTH E;  1JTH B;  4DZO A;  5CMZ A;  1HUC A;  3CLQ A;  2E9H A;  3CCV 1;  3Q5P A;  1S72 1;  3NH8 A;  3CI9 A;  4QMA A;  3FXE A;  2QJK B;  2FY8 A;  1VQ9 1;  3U1C A;  4NBB A;  1KD1 Q;  2HPC B;  2JR8 A;  3AE6 C;  3GCF A;  3Q2Y A;  1QVF O;  1N73 A;  3CCL 1;  2NVY I;  2R5B A;  3HTK A;  2G8Y A;  1PL5 A;  3H6P A;  2JIO A;  3IF4 A;  5KLV G;  1NGM B;  3RK2 C;  4YTP C;  1OW6 A;  2V8J A;  3GHG B;  3HOX I;  1L0N G;  3GW6 A;  3BAT A;  3CCE Z;  1JM0 A;  4PJ0 E;  1PIX A;  5B66 E;  2E2I I;  2QKD A;  1GK6 A;  1QVG O;  3TNU A;  1GL2 B;  3MP7 B;  3IX0 A;  5T67 A;  5KAF H;  1K8A 1;  1YJN 1;  2B89 A;  1HWT C;  2QRX A;  4H13 D;  1NVO A;  1R5S A;  1N8R Q;  1VQK Z;  2KLU A;  2YIU C;  1VQO P;  1BCC D;  1KIL A;  4NPD A;  1H88 A;  3CPW Y;  2JEE A;  3SWF A;  1BCC E;  1ZN5 A;  3F89 A;  2YKQ A;  1NTZ J;  1VF5 C;  3V4Q A;  1VQN Z;  1RQU A;  1K8A 2;  5AVX B;  2XU6 A;  2OQQ A;  1H0T B;  2FXO A;  1NU1 G;  1EDI A;  3V2R A;  2XZR A;  1LWU A;  2JUB A;  1IFN A;  1QL1 A;  3I56 1;  5KTB A;  3PO2 I;  3TGU J;  3CC4 1;  1SIW A;  1N7S A;  2I1K A;  3G6E P;  2JWD A;  3KXD A;  2JA6 I;  2W04 A;  2JA7 I;  2QM7 A;  1KQS Y;  2YNY A;  5KAF E;  3L74 D;  3P5J B;  1YUK A;  3J80 b;  4A93 I;  1K73 Q;  3L74 E;  1SQQ K;  3ABV C;  3L71 J;  1UIX A;  2QSI A;  4A3E I;  2E75 D;  2AXT H;  3EER A;  3CME P;  4W80 A;  1P84 I;  2YKO A;  2VUM I;  5AVU B;  1NJI Q;  2BJO A;  5CM2 M;  3AE2 C;  2PFX A;  2K9Y A;  1AA0 A;  3RL0 D;  1RQF A;  2PP6 A;  1VQ4 Z;  5D1P A;  2V3V A;  3H1K D;  4AQR D;  2IDB A;  3CXH I;  1VQP 1;  3H1K E;  3WUU A;  3A2A A;  2KB7 P;  2N1T C;  2KNC B;  1GU4 A;  2QG4 A;  1U57 A;  3ESW A;  1X22 A;  3U59 A;  2O01 H;  4NPE A;  2E74 C;  3R4Y A;  3PH0 A;  3S1Q I;  2Y9Y A;  2ZXE B;  2E2J I;  2NPS B;  2Y0S A;  2KIK A;  3HUS B;  3VP9 A;  3GF7 A;  3SFD C;  1PFT A;  2JA5 I;  3QWU A;  5TIS H;  2FYU K;  1G1I A;  3AE5 C;  3AE7 C;  2ZVN B;  4RV9 A;  2AXT E;  3GTJ I;  3B5N A;  4E33 A;  1L0L K;  2JP3 A;  2NZ2 A;  2YO2 A;  4YPC A;  3G3Z A;  1BCC G;  1S4X A;  3V2P A;  3CPW O;  2Q3E A;  2K9J B;  4EOT A;  4A3B I;  1GL2 A;  2N9B A;  4KT0 J;  3KQG A;  1EZV I;  2V45 A;  3VMH A;  3HKZ A;  2M48 A;  1DEB A;  5APX A;  1FJP A;  4PV1 B;  3CCE 1;  5AW7 B;  4U3F J;  2O1J A;  4D6T J;  3PP5 A;  3L72 D;  3L74 G;  4H44 C;  1OVU A;  1H0T A;  2ZYG A;  1S2E A;  5TIS E;  3PO3 I;  1SQB J;  3GTG I;  1YJW Z;  1VQK 1;  1UII A;  4GOE A;  2ZAE B;  3AEB C;  1SFC C;  3KYQ A;  2M6N A;  1L4A A;  5AW8 B;  2QM8 A;  3RZD I;  1L0N K;  3I4N I;  3CCU P;  1ML8 A;  2CK3 H;  1ZXG A;  3S1K A;  4A3C I;  3RK2 D;  1VQN 1;  3M9Q A;  2A45 G;  2WT7 B;  1ZB9 A;  1W2B Z;  3H1K G;  4N3Y B;  1X3Z A;  3GMA A;  2R3S A;  2I1J A;  3NMD A;  1ZV8 A;  2HLO A;  2DE7 A;  3CCS P;  2PM9 A;  1YI2 Z;  4E2Y A;  4N78 D;  3NTN A;  1FOS E;  1SS1 A;  3V4W A;  4K35 A;  1FS0 E;  1RF0 C;  4N78 E;  5KKZ B;  1YQ4 C;  2WMM A;  1SLQ A;  2JJL A;  3VMA A;  3J81 f;  1IJD B;  3CXC Z;  1T3J A;  1M1K 1;  3JAM b;  1NWQ A;  1FZC C;  1Q2N A;  2OYI A;  1VQL P;  1JY3 P;  3CD6 P;  1X8Y A;  4H0L C;  3AEC C;  2KZI A;  1URQ C;  3CX5 H;  2B9B A;  5KJ7 C;  1QYP A;  4E30 A;  3CCJ Z;  2ZT9 D;  4EDF A;  1LTJ C;  1AQ5 A;  3J80 f;  4TNU A;  2WAQ A;  1U7M A;  3M9B A;  1LTA C;  4DQY B;  1VQ4 1;  4GKG A;  3J7A 4;  1T3U A;  1M1J C;  3L37 A;  3S1R I;  4M3L A;  1S1C X;  3HUS A;  1Y1V I;  1LTI C;  3S15 I;  2OZK A;  2A45 I;  1JY2 N;  5K5G B;  1K04 A;  1OWA A;  1Q81 Q;  5FLX f;  2QJY C;  3Q3D A;  2QRE B;  1IFJ A;  1JEK A;  3LUS A;  2W83 C;  1BSH A;  1OXZ A;  4DOJ A;  4XX2 A;  1NO4 A;  3BCC J;  3D6W A;  2FYN B;  1Q82 Q;  2OTL Z;  1G1J A;  3CC7 Z;  3OJA B;  1WRG A;  3CX5 D;  3HOY I;  3CX5 E;  3CQZ I;  4O9B A;  3D9X A;  1S72 P;  4NH1 C;  5H2F H;  2JNY A;  1JCD A;  1VQ9 P;  4Y99 C;  3SWY A;  3OA7 A;  1FDO A;  3CCM Z;  1XTC C;  1H89 A;  1RY3 A;  4LC1 A;  3FKI I;  1NUI A;  3GG2 A;  3CCL P;  5DJT B;  1NKZ B;  2N1T D;  2Y9Z A;  4MH4 A;  5T6B A;  2KUB A;  5CCH A;  1GU5 A;  1SQQ J;  1VLA A;  4H13 C;  1SQP D;  4C46 A;  1VQ5 Z;  1LTG C;  1NTM D;  3AE8 C;  1SQP E;  1YHQ Z;  2K88 A;  3EFG A;  1VQ7 P;  2R44 A;  4XE5 B;  1RNI A;  4OGQ B;  4EIJ A;  1LP1 B;  5CCG A;  2NAP A;  1JCC A;  1NH4 A;  1FZG A;  1VQ6 P;  4DK1 A;  2WT7 A;  1ZP0 C;  2WPQ A;  3TF5 A;  1BGY D;  5A2Q b;  3L36 A;  2CPS A;  3PLN A;  1YJW 1;  5FLM I;  1BGY E;  3Q5R A;  3GLM A;  4HKZ H;  1ZRT D;  5AVT B;  3R2P A;  5H2F E;  2E75 B;  1M90 Q;  1ZRT E;  2N9Y B;  1L1O C;  3H1L E;  3FX0 A;  3HD7 A;  3M0D C;  2KP8 A;  2H43 A;  2QEX Z;  3L73 D;  2QVA A;  3KIF A;  1HH0 A;  1Z03 A;  2VRS A;  1KB9 H;  3L73 E;  2QRC B;  1NP6 A;  1A02 J;  3VMG A;  1IO4 A;  2O3J A;  2YKP A;  5CJ4 A;  1QVF Y;  2FYU J;  1YI2 1;  1SQV K;  3RK3 C;  3EFF K;  2BCC E;  1R9T I;  4IL6 X;  1L0L J;  1Y1W I;  3KHU A;  2J6A A;  3L70 E;  2XV5 A;  1I3Q I;  2HG5 D;  3RL0 C;  2LIY A;  1SFC D;  2QJP C;  1GDT A;  4WY4 B;  2POH A;  3P8C D;  4NBE A;  2YXR B;  3B8E B;  1HJ0 A;  1QVG Y;  3H1I J;  3P8C E;  3F5H A;  5BVZ A;  1J1E B;  2LFU A;  2F4M A;  1Z56 A;  3CWB D;  3IR9 A;  1AV1 A;  3CWB E;  3H1J G;  1T8Z A;  3I5C A;  4JYB A;  4BXX I;  3G4S P;  1SQX D;  2I8D A;  2WB1 A;  1VQP P;  1SQX E;  3JSV C;  2WPV B;  5KLI B;  1SQP G;  4DJG A;  3KPE A;  1NTK K;  1E5W A;  1Y1V S;  5C3E I;  2ZXX A;  1MV8 A;  1N7L A;  1P9N A;  2FFD A;  1L0N J;  1KIL C;  1HGZ A;  5D1O B;  3NFQ A;  4H0L D;  1URQ D;  2OTL 1;  5KJ7 D;  2WSE J;  1M8O B;  3BVH A;  1BGY G;  4DCK A;  1WW9 A;  3W68 A;  3TK1 A;  5IT9 f;  3CX5 I;  2QA4 Z;  1OIP A;  1Q86 1;  2B87 B;  3HE5 B;  1Z01 A;  3AEA C;  3AE1 C;  2O53 A;  4QTT A;  3H1L G;  3CCM 1;  1WT6 A;  4AUW A;  2G2K A;  1Z02 A;  2OOX B;  1USP A;  3C8V A;  3CMA Z;  3L73 G;  2WWW A;  4MN4 C;  2LEX A;  3OW2 O;  2E76 C;  2RPR A;  3JC2 2;  1IFP A;  2P2U A;  2ZFC A;  1VQ5 1;  1S5L E;  3NDJ A;  3IR7 A;  2BCC G;  4UB8 H;  1YHQ 1;  1S3J A;  2BEQ D;  1GW3 A;  1Q86 2;  1KC8 1;  4JPZ B;  2IZ3 A;  3L70 G;  4A3K I;  5IP7 I;  3IF8 A;  3A7O A;  4A3I I;  3HOU I;  3A0B H;  2AXC A;  4WB4 A;  1FU1 A;  2YIU B;  1L2P A;  1ZW0 A;  1AJY A;  1NTZ D;  3A0H E;  2Q1K A;  2OOY B;  1KC8 2;  3O8Z A;  3IFU A;  1VF5 B;  1NTZ E;  3VP8 A;  3WMM 0;  1BDC A;  1HTL C;  1RE3 A;  2F4O A;  4GIF A;  2R93 I;  3Q1M A;  2QEX 1;  3CWB G;  1VQN P;  4JBZ A;  2J59 M;  2OTJ Z;  3TGU D;  1NAF A;  1SQX G;  4WY4 A;  1IC2 A;  2E5T A;  3TGU E;  3FQQ A;  2HR3 A;  1DD3 A;  3HE4 B;  4UB8 E;  3SSU A;  3BRT B;  2H7H A;  2ZT9 C;  3B5N C;  1LJ2 A;  1EDL A;  3HOZ I;  1KQS Z;  3L71 D;  3VMX A;  1NKN A;  3L71 E;  1QXF A;  4I1L A;  1QEX A;  5E79 H;  4XFJ A;  1YTZ T;  1AQT A;  3L75 J;  3CCR P;  3M91 A;  1K9M Q;  2PK7 A;  2V8I A;  4TLF A;  1HBW A;  2NRG A;  5L8R J;  1TU3 F;  1GD2 E;  2GUS A;  5D1O A;  3NFZ A;  1LNQ A;  1T2K C;  1VQ4 P;  2OAR A;  2OTK E;  3RK3 D;  4UB6 H;  2OYH B;  3RK3 E;  4KJM A;  2JIQ A;  1NYH A;  2E74 B;  4IFD K;  1LT9 C;  4RKU J;  1QGK B;  5APQ A;  1M7L A;  3M4O I;  3S9O A;  3FGA D;  1L4A C;  1WZN A;  1JTH A;  3OAK A;  3NXS A;  2WSF J;  2HOD B;  1RH5 B;  4Z1M H;  1U7J A;  5AVV B;  1JJ2 Y;  4RVH A;  2HPC A;  2PGD A;  1JY2 P;  4IFM A;  4A3F I;  3CME Z;  1EXI A;  1QF8 A;  1OZH A;  2QA4 1;  1KD1 2;  2LXC B;  1NTZ G;  2L91 A;  2YMK A;  1SQV J;  3LID A;  4BRY B;  5AW4 B;  1SP4 A;  1R5L A;  2RMZ A;  3S4R A;  1LTB C;  3AE4 C;  2QLV B;  1JMB A;  3RL0 g;  3CMA 1;  4I7Z C;  1S9K D;  1FOS F;  3GHG A;  4UB6 E;  1D7M A;  1S9K E;  1M1K Q;  4NOZ A;  1TWC I;  1KIL D;  4U3F D;  2OYI C;  2VPX A;  2FXP A;  2JIM A;  4D6T D;  1PV3 A;  1KIL E;  4U3F E;  3MZL B;  4D6T E;  3MON A;  4L75 A;  1MZ9 A;  1AA6 A;  4H44 B;  3L71 G;  2WPS A;  1PGQ A;  2JS4 A;  3BRV B;  2W03 A;  4I6M C;  1G2C B;  1N8R 2;  1SFC B;  1N7S D;  2K1A A;  1YJW P;  2R7Z I;  4A3M I;  3GTM S;  1PFI A;  1NTK J;  3L72 E;  2E76 D;  2KXP B;  4CPG A;  1IK7 A;  1VQ8 P;  5AVZ B;  2YMY A;  5KLV K;  2OTJ 1;  1M56 D;  3UIA A;  2KS1 B;  4YXD C;  1K05 A;  2XKM A;  3M9H A;  2IYO A;  3PTZ A;  3MD0 A;  2AEM A;  3B4S A;  2IBZ D;  1MFZ A;  2GM4 A;  4ZKP A;  4Y28 J;  5AVY B;  3LIE A;  1DH3 A;  2RH0 A;  4YXW H;  1GW4 A;  4WBA A;  2OYH A;  1EQ7 A;  1KV4 A;  5AVS B;  1WMK A;  2XND H;  4HH2 A;  1S5L X;  2PAJ A;  1NJI 2;  2YXQ B;  3H25 A;  1LTJ B;  4NBC A;  2KI7 B;  2E5Y A;  2R5D A;  2VUG A;  4BBR I;  1FDI A;  3CCU Z;  3CCJ P;  1LQL A;  1M1J B;  1SFO I;  1IFI A;  5CBO A;  3S2H I;  2ZJS E;  1VDF A;  1NU1 K;  5AVR B;  2NVQ I;  4JYC A;  5CCG C;  1W2B Y;  2H85 A;  5AW9 B;  1GZL A;  2KNC A;  2QJY B;  3B5N D;  3LW5 J;  1TFI A;  3CCS Z;  4U3F G;  3MZK B;  2W6B A;  3BCC D;  4L74 A;  1I6H I;  4D6T G;  2NPS A;  1GL2 D;  1X9V A;  2WZ7 A;  5KKZ C;  1FDM A;  4OWF A;  3H1H D;  1RO0 A;  1ZH1 A;  3HD7 C;  3H1H E;  1VQL Z;  2OTL P;  2KSE A;  3CC7 P;  1QL2 A;  3TE5 B;  1JMM A;  2QE7 H;  1JY2 O;  3CME 1;  1YIT Z;  2E42 A;  4ZKU A;  2K9J A;  4Y99 B;  2M5A B;  4HH4 A;  1T2K D;  1Q90 D;  3KDP B;  3WU2 H;  1LTT C;  2JDI H;  3L72 G;  1ZLL A;  1YJ9 P;  3MIW A;  1VQM Z;  3PJS K;  3CCM P;  1SQQ D;  1PP9 J;  3RBX A;  1SQQ E;  4H13 B;  2WSS H;  3CCV P;  4MXU A;  3L4F A;  3AE3 C;  2B63 I;  1L4A D;  1KFM A;  3MTU E;  3S1M I;  1YIJ Z;  1YHQ P;  1Q7Y Q;  2R32 A;  2Q6Q A;  1J2J B;  3K5B A;  1KQG B;  1PGJ A;  1RF1 C;  2Q9I A;  3NH4 A;  3VOP A;  1FZB A;  3CCQ Z;  4E2W A;  1NTM E;  2DW3 A;  2KS1 A;  2H8P D;  4LGD E;  2KYV A;  3VN0 A;  5B5E H;  1KOR A;  3I4M I;  5APS A;  3WU2 E;  3SWK A;  1LTS C;  1Y9B A;  5APU A;  4W7Y A;  4TT3 H;  2GTH A;  2M0B A;  1YJN P;  2E2H I;  1ZB8 A;  1KN7 A;  4NB9 A;  2FFD C;  3CC2 Z;  2FYU D;  2QEX P;  2AKL A;  3QWO C;  3VMZ A;  3A3Y B;  1KYO H;  2FYU E;  1W2B O;  3MUD C;  2XDJ A;  3D70 A;  3RK3 B;  4EYY Q;  1L0L D;  3H1J J;  1QVF Z;  4ZMD A;  1L0L E;  2W27 A;  4MON A;  1BE3 J;  3RL0 B;  2Q4Z A;  3OW2 Y;  5KAI H;  1Q86 Q;  2NPS D;  2WSE H;  1RLY A;  4OGQ C;  2QJP B;  3HTK B;  5IP9 I;  3H1H G;  3H1I D;  4MD8 A;  2YO3 A;  4KHX A;  3I56 P;  1Q81 1;  3H1I E;  3VYI A;  1USE A;  2JIP A;  3CC4 P;  3H32 B;  3P32 A;  2VPW A;  1QVG Z;  5APV A;  2D2C C;  1P84 H;  5B5E E;  3CCU 1;  1BGY J;  4RES B;  4JQ0 D;  1N73 C;  1KC8 Q;  2PRR A;  2WSC J;  3I55 Z;  3GKQ A;  2K37 A;  5AW3 B;  1Q82 1;  1GK4 A;  4GDO A;  1SQQ G;  1KYO D;  3H1L J;  3P8M C;  2ZYD A;  3CXH H;  1FZF A;  1KYO E;  2ZYA A;  1JY3 N;  1Q81 2;  3CCS 1;  3FQM A;  1JUN A;  2IFN A;  1L0N D;  4XA4 A;  3JAM f;  4RVG A;  3F3P C;  4C7N B;  1KB9 D;  1KIL B;  1IFD A;  3RBZ A;  2V8K A;  2BCC J;  5KAI E;  1KB9 E;  2R92 I;  2RN0 A;  1K8A Q;  3B71 A;  1RE3 C;  1Q82 2;  4OH8 B;  5APY A;  1MFT A;  2AEF A;  1YBK A;  3L70 J;  5CCH D;  2C9N Y;  4PD4 H;  1JB0 J;  2Q7C A;  1VQL 1;  1NTM G;  5KLV J;  2WTY A;  1P84 D;  1YIT 1;  2CPB A;  1NOH A;  2YAD A;  4A3J I;  3G9R A;  1P84 E;  4GOD A;  2C9L Y;  3O6Q B;  5CCG D;  1X0T A;  3N7N A;  1VQM 1;  1J1E C;  1BDD A;  1HJB A;  1SVF A;  3CXH D;  1LWU C;  1KTM A;  2E76 B;  3WUV A;  4HYT B;  2O1K A;  2Y0E A;  3G4S Z;  1CI6 B;  2M3E A;  3CMA P;  1J1D C;  1EXJ A;  3NH5 A;  2W6J H;  2PMZ A;  1L0L G;  1N7S C;  4AYB A;  1YIJ 1;  1LP1 A;  1M90 1;  3GTO I;  2HYN A;  2Q51 A;  1KFN A;  2EGT A;  3AEE C;  4PJ0 H;  3HD7 D;  5B66 H;  4RVF A;  3U50 C;  3RK2 B;  4A3G I;  2WVR A;  3GTP I;  4PD4 D;  2AEJ A;  2KSJ A;  4WWI A;  1NU1 J;  4PD4 E;  2KLV A;  2LXB A;  3CCQ 1;  3H1I G;  3CCE P;  3PHL A;  3G71 Z;  4HJG H;  1M90 2;  1Y47 A;  2XNX A;  1IFM A;  2GU2 A; 
#chains in the Genus database with same CATH homology
 1VQ8 1;  3PO3 S;  2KZI A;  3GTM I;  3GTK I;  4ASV A;  1QYP A;  4E30 A;  5C4X I;  3T4N B;  1FC2 C;  3CC2 1;  3CCJ Z;  3J80 f;  1KRL A;  2WAQ A;  4TNU A;  1U7M A;  2QLV B;  1JMB A;  4DQY B;  2JR6 A;  3CMA 1;  1VQ4 1;  2R6M A;  3J7A 4;  3S1R I;  3CPW Z;  1OVV A;  4CL1 A;  1Y1V I;  3S15 I;  2OZK A;  4NOZ A;  1TWC I;  2HF1 A;  5T64 A;  5A2Q f;  1VQ7 1;  3RGU A;  4DGL A;  5K5G B;  2KZJ A;  2RT9 A;  5FLX f;  3MZL B;  2QRE B;  3BG0 B;  3LUS A;  3MON A;  1VQ6 1;  2IZ4 A;  4NFR A;  3I56 Z;  2M5A A;  4MD9 A;  4E2Z A;  3CC4 Z;  2NVT I;  4HGZ A;  4BBS I;  4NBH A;  4XX2 A;  4IOI H;  4MD7 A;  2JS4 A;  3D6W A;  1Q7Y 1;  2NVX I;  3CCJ 1;  2W03 A;  5DJU B;  2OTL Z;  3HOW I;  3CC7 Z;  1N8R 2;  4X6A I;  4MRI A;  5AN9 F;  2R7Z I;  3HOY I;  3CD6 1;  3I55 1;  3CQZ I;  4A3M I;  3D9X A;  3GTM S;  3S2D I;  4NH1 C;  2UWJ E;  2JNY A;  2LR2 A;  4BY1 I;  4CPG A;  1VQO Z;  3HOV I;  3CCM Z;  3J81 b;  3FKI I;  2OTJ 1;  1NUI A;  1Q7Y 2;  2SPZ A;  5DJT B;  2KS1 B;  4MH4 A;  4A3D I;  2QRD B;  5T6B A;  2KUB A;  1S7M A;  4NPF X;  4BY7 I;  3MHV A;  1VLA A;  3S16 I;  1VQ5 Z;  1VQP Z;  1YHQ Z;  3H3V J;  3CC7 1;  2YU9 I;  3MZW B;  2K5R A;  2R44 A;  2DE5 A;  1RNI A;  1KD1 1;  1LP1 B;  1WII A;  1RO4 A;  1TWA I;  2B87 A;  3G6E Z;  1JJ2 Z;  1LT1 A;  3CCR Z;  4DK1 A;  1YJ9 1;  3NDI A;  1EDJ A;  1K83 I;  3VMI A;  1NJI 2;  5A2Q b;  4NBC A;  3F3F C;  5FLM I;  1YJW 1;  2KI7 B;  2VUG A;  1X3W A;  4BBR I;  5FLX b;  3CCU Z;  4HKZ H;  3M3Y I;  2E9H A;  3CCV 1;  1LQL A;  1S72 1;  3NH8 A;  1SFO I;  5CBO A;  3FXE A;  1JWH C;  3S2H I;  1VQ9 1;  3G4S 1;  1L1O C;  4NBB A;  5C39 A;  2RBL A;  3GCF A;  2NVQ I;  3S1N I;  2I3C A;  2QEX Z;  1W2B Y;  2H85 A;  2QVA A;  3KIF A;  3CCL 1;  1Z03 A;  2NVY I;  2QRC B;  1TFI A;  3CCS Z;  1YUA A;  1NP6 A;  3VMG A;  2P28 A;  1OVR A;  3MZK B;  1QVF Y;  1I6H I;  4NB8 A;  1YI2 1;  2DE6 A;  1R9T I;  2V8J A;  3HOX I;  1N8R 1;  3EED A;  4E32 A;  3CCE Z;  1JM0 A;  1Y1W I;  2J6A A;  1I3Q I;  1I50 I;  2E2I I;  1RO0 A;  2QKD A;  3Q87 A;  2GTI A;  1ZH1 A;  2LIY A;  1VQL Z;  3IX0 A;  5T67 A;  3G71 1;  3TE5 B;  1K8A 1;  3CME 1;  1YIT Z;  1YJN 1;  4S1T A;  4NBE A;  2B89 A;  2M5A B;  4HH4 A;  2QRX A;  1QVG Y;  1NVO A;  2LFU A;  2F4M A;  1VQM Z;  1VQK Z;  3TDH B;  2RKL A;  4NPD A;  4ASW A;  3CPW Y;  2RHB A;  1K9M 1;  1TWH I;  3GTL I;  4E31 A;  4MXU A;  1VQN Z;  4BXX I;  5LL6 f;  1K8A 2;  2B63 I;  1H0T B;  1K73 1;  2I8D A;  1EDI A;  2WB1 A;  3S1M I;  5EFW B;  4E2X A;  1YIJ Z;  3VTN A;  4Y52 I;  2JUB A;  3I56 1;  1Y1V S;  5C3E I;  3PO2 I;  3KIH A;  1P9N A;  3NH4 A;  3CC4 1;  1NJI 1;  4K3A A;  1TWG I;  2JA6 I;  2JWD A;  2W04 A;  2JA7 I;  1K9M 2;  5D1O B;  3CCQ Z;  1KQS Y;  4E2W A;  2OTL 1;  2JMO A;  3P5J B;  1YUK A;  3J80 b;  1RO2 A;  3K7A I;  1K73 2;  4A93 I;  1EC5 A;  1WW9 A;  3I4M I;  3S14 I;  5IT9 f;  2QA4 Z;  1VQ8 Z;  4NBA A;  4A3E I;  1Q86 1;  2B87 B;  1Z01 A;  3EER A;  2GTH A;  2O53 A;  2M0B A;  4QTT A;  2E2H I;  2VUM I;  1ZB8 A;  2BJO A;  2P3Y A;  1VQO 1;  3CCM 1;  4NB9 A;  3CC2 Z;  3FXD A;  4NBF A;  5CM2 M;  2G2K A;  1Z02 A;  2AKL A;  3QWO C;  2OOX B;  1USP A;  1RQF A;  2B88 A;  3CMA Z;  1VQ4 Z;  2O4H A;  4EYY Q;  5D1P A;  4MN4 C;  1QVF Z;  2RPR A;  4ZMD A;  1VQ5 1;  1VQP 1;  3NDJ A;  5C4J I;  1YHQ 1;  1S3J A;  4MON A;  2Q4Z A;  3OW2 Y;  1Q86 2;  1KC8 1;  2IZ3 A;  5C44 I;  4A3K I;  1RLY A;  3ESW A;  5IP7 I;  3G6E 1;  5IP9 I;  4NPE A;  3IF8 A;  4A3I I;  3HOU I;  4MD8 A;  3CCR 1;  3PH0 A;  3S1Q I;  1Q81 1;  2E2J I;  2Y0S A;  2KIK A;  1QVG Z;  3CXC Y;  2HU9 A;  1PFT A;  1ZW0 A;  2P58 A;  3ZDM A;  2JA5 I;  3CCU 1;  3QWU A;  2RIQ A;  2Q1K A;  1TWF I;  2OOY B;  1KC8 2;  3CD6 Z;  3IFU A;  4RV9 A;  3I55 Z;  1BDC A;  3GKQ A;  3GTJ I;  1EDK A;  4RS4 A;  4E33 A;  1Q82 1;  2F4O A;  1M1K 2;  2R93 I;  2QEX 1;  1DL6 A;  4A3B I;  1Q81 2;  4JBZ A;  3CCS 1;  2OTJ Z;  3I07 A;  3VMH A;  3FQM A;  3RZO I;  3JAM f;  4RVG A;  3GTQ I;  3HKZ A;  2M48 A;  3F3P C;  3FQQ A;  3BG1 B;  2HR3 A;  2V8K A;  5IT9 b;  2R92 I;  3CCE 1;  4NBG A;  1Q82 2;  1EDL A;  1MFT A;  3HOZ I;  1KQS Z;  4HGY A;  1VQL 1;  4EWC A;  2QR1 B;  4GOF A;  1YIT 1;  1OVU A;  1H0T A;  2YAD A;  4A3J I;  3H0G I;  1YJ9 Z;  4GOD A;  3PO3 I;  2PK7 A;  4QTU A;  4ZNC A;  2K3R A;  2V8I A;  1YJW Z;  3GTG I;  1X0T A;  1VQM 1;  1VQK 1;  5CBN A;  4GOE A;  2ZAE B;  1BDD A;  2M6N A;  3CCV Z;  1S72 Z;  3I4N I;  3RZD I;  1VQ9 Z;  2KPI A;  1ML8 A;  3G4S Z;  5D1O A;  1ZXG A;  3S1K A;  3NFZ A;  4A3C I;  2OTK E;  1VQN 1;  2JA8 I;  1WCM I;  3NH5 A;  4NBD A;  1DEE G;  2PMZ A;  3CCL Z;  4AYB A;  1ZB9 A;  1YIJ 1;  1W2B Z;  1LP1 A;  1N2F A;  1M90 1;  1X3Z A;  2VF1 A;  4KJM A;  3GTO I;  3OW2 Z;  2Q51 A;  2EGT A;  3S17 I;  4RVF A;  3U50 C;  2DE7 A;  4A3G I;  4A3L I;  2PM9 A;  3GTP I;  1YI2 Z;  1USP B;  4E2Y A;  3M4O I;  1SS1 A;  4WWI A;  4K35 A;  2WMM A;  4BXL A;  1VQ7 Z;  2LXB A;  3CCQ 1;  3J81 f;  1U7J A;  3CXC Z;  4HB1 A;  4RVD A;  1JJ2 Y;  1VQ6 Z;  1M1K 1;  4RVH A;  3G71 Z;  3JAM b;  4HJG H;  3VB9 A;  4A3F I;  4Y7N I;  1M90 2;  1Q2N A;  1Y47 A;  3CME Z;  1QF8 A;  1YJN Z;  2QA4 1;  1KD1 2;  2LXC B;  2GU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...