2K3RA

Pfu rpp21 structure and assignments
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
KERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCKKCHAFLVPGINARVRLRQKRMPHIVVKCLECGHIMRYPYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Pyrococcus furiosus RPP21, a component of the archaeal RNase P holoenzyme, and interactions with its RPP29 protein partner.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 4
total genus 20
structure length 91
sequence length 91
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2008-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2k3rA01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2k3rA02
1BDCA 5C39A 2KI7B 1EDKA 4GOEA 3RGUA 4GODA 2B89A 4ASWA 1ZXGA 4HJGH 5K5GB 2WMMA 1BDDA 2SPZA 5EFWB 3MZWB 1EDIA 2LR2A 2LXCB 2KZIA 3S1KA 4CPGA 2KZJA 2B88A 3PH0A 2RKLA 1Q2NA 2KIKA 2LXBA 4GOFA 2M5AB 2M5AA 3FXEA 2QVAA 1ZW0A 1EC5A 2ZAEB 4HKZH 4KJMA 4IOIH 5CBOA 2B87B 4NPDA 1DEEG 2KS1B 5DJTB 4NPEA 1NVOA 4K35A 2UWJE 1LP1B 4WWIA 1OVVA 2HR3A 4EYYQ 3QWOC 1X0TA 1JM0A 1S3JA 2Q1KA 4K3AA 4ASVA 1FC2C 4ZMDA 1EDLA 1U7MA 5CBNA 1OVRA 1Y47A 1OVUA 2K3RA 1H0TA 5DJUB 1SS1A 2P58A 3FXDA 3MHVA 3ZDMA 1LT1A 2B87A 2I8DA 1MFTA 2KUBA 4ZNCA 4NPFX 1JMBA 4HB1A 2OTKE 4BXLA 4MN4C 4JBZA 1EDJA 1LP1A 2JWDA 2QRXA 2R44A 1H0TB 1U7JA 2M0BA
chains in the Genus database with same CATH superfamily
1FDOA 4PJ0H 1S7MA 1FZCA 4LC1A 2HODB 3CXHE 3L71J 1XTGB 1X22A 2B63I 1FJKA 1NUIA 3S4RA 2JR6A 1PPJD 3LUSA 3EFGA 3M9BA 3S17I 2P2UA 1T3UA 3AE5C 1NAFA 3HD7A 1USDA 3MGNA 3CCJP 2VPZA 1NKZB 4R4LA 3L74D 1VQ4Z 1SQPJ 2L5GB 3IR7A 1NU1E 3VMGA 2RKLA 3Q3DA 3VMAA 2N1TB 2N1TA 4R4MA 2IDBA 2AEJA 5AVWB 4JYBA 1VQN1 3T97A 2QM7A 3H32A 1AA0A 3H1JE 4U7JA 1VQM1 2O01J 1WW9A 3P32A 4QMAA 2KS1B 1PGOA 1LTGC 3M0AA 3VYIA 3MTUE 4WWIA 2E5TA 2Z4EA 1I6HI 2XNXA 3AE1C 3FKII 2HODA 3GHGC 1KD12 1N2FA 1RY3A 4ASVA 1N8RQ 3SFEC 3IX0A 1OFCX 3RBXA 4GDOA 2WVRA 5AVTB 1VQMP 2W83C 2O01H 1N7SB 2P58A 4O9BA 1DX7A 3H1HG 2K5RA 3G4SP 2FY8A 4D6TE 1LT9B 1JMBA 1H89A 1BGYD 1SQQD 3CD6P 1VQ6Z 2QRCB 5AVRB 2R7ZI 1LP1A 3PTZA 1BE3G 3II6A 3TNUA 3I55Z 3LIDA 3IN6A 5H2FH 2E74D 1BCCJ 3CD6Z 1BCCG 3V2PA 1NTMJ 4I7ZB 1Z01A 1SFCD 1P84H 4BY1I 4OWFA 4H0LC 2NPSA 3VB9A 2AXTE 1JNMA 3CCJZ 3CCRP 2KIKA 1GL2C 5KJ7A 3PO3I 3FXEA 3PLNA 2GTHA 4NBCA 1ZW0A 2XV5A 2JUBA 3RK2D 1N7SA 3AEDC 3AE4C 2BASA 1R5SA 4NPDA 1LNQA 1QX8A 3P8CE 5CCGA 1M8OB 3IR9A 1JB0J 3R2PA 1PPJG 2Z5HA 5B66H 3B4SA 1WZNA 2WPRA 5C44I 5B5EH 2Q1KA 2JR8A 1VQ5Z 2ZT9D 3MZKB 1K73Q 3BVHA 1JY3P 4WY4B 1YJWP 1WJ2A 3D2LA 3AEGC 2KPIA 2P3YA 1KZUB 2C0XA 2JEEA 1KB9D 5KLIC 2RMZA 1J1EC 3B5NC 1TWHI 4HB1A 3MIWA 2Q9IA 1NTKJ 2JWAA 1HBWA 2OYOA 2ZVNB 3M3YI 2ZFCA 5CM2M 3WU2H 2QRXA 1USPA 3CX5I 1K9M2 1UIIA 1N8R2 1EXIA 3I56P 1HJ0A 3GKQA 3ABVC 4PV1D 1S2EA 4NFRA 4MD7A 3S9OA 3L72D 3SWFA 3AE8C 4D6TG 3FX0A 5M1BA 2OYHA 4E2WA 2H89C 3CMEZ 2P1JA 2LXCB 1Q822 3GTMI 1KV4A 3LW5J 1LT9A 1PL5A 2JO1A 2R6MA 2K9YA 1T2KC 3S1MI 2YXRB 3IF8A 4HH4A 5IT9f 2E2HI 4DT0A 1JJ2Z 2WT7A 2JNYA 1KN7A 1NJI2 1VQ9Z 3GTJI 2O53A 3S1QI 1SQVE 1LTJA 4NBDA 2QJKB 3V5BA 3UIAA 2PRRA 1G1IA 1P84I 5IP9I 1NVOA 1ZV8A 2M48A 4RV9A 1S1CX 2KYVA 3HOXI 4BRYB 5APSA 2AEFA 2GUSA 1GD2E 2O1KA 1JM0A 1L0ND 3G4S1 1SQQG 1LTTC 1NKNA 2OTJ1 2YMKA 3B5ND 3PO2I 3I5CA 5TISE 4NBGA 1H0TA 1H8AA 3CQZI 2P28A 3KYQA 4I2LC 1KYOH 1LT1A 3J7A4 2KSJA 2QRDB 5AVXB 4OH8B 1LGHB 1LWUA 3BASA 3GHGA 2V45A 2K37A 3QH9A 5BU8B 3G9RA 4BXLA 4BY7I 1AVOA 1KB9I 2E42A 5KLVJ 2YADA 1IFDA 3CXHH 2JWDA 4IFDK 2I3CA 5A2Qb 4BRYA 3FWLA 4JYCA 3CC71 1K9MQ 3EQ2A 1PV3A 3MUDC 5KLVE 4A3CI 1HGVA 4H44D 3Q5RA 1SVFA 5KAIE 4N78E 5AW6B 3H0GI 2H8PD 1ZXGA 1M902 4HH2A 3S15I 2HYNA 1YJ9Z 2RH0A 5CCHA 1YJNZ 1VQOP 1J1EB 1MUUA 1KRLA 2M3BA 4CL1A 2WSFH 2N9YB 1Q811 1YHQP 1MZ9A 3CC7P 2JIQA 1K732 1S72P 4E31A 1EC5A 2ITAA 4HKZH 1WMKA 4IL6X 3G3ZA 5CBOA 3GW6A 3S14I 2FYUG 4N6JA 1S5LE 1K8A2 3K5BA 3JCUE 1RQVA 1YJW1 1JMMA 3GCFA 1VQ7Z 1IFJA 4K35A 3HOYI 3C8VA 4WVZA 3CMAP 1USPB 1T8ZA 3KHUA 1IO4A 4BXXI 1K8A1 1I3QI 3G6E1 1JEKA 1U7MA 2QR1B 3CX5E 1ZR4A 3GLMA 3C1LA 5D1OA 1Y1VS 2FXOA 2O1JA 1KMIZ 3V2QA 2F4OA 1XTCC 1VDFA 2WPVB 1AQTA 1T6AA 3TK1A 1YTZI 2OOXB 3D71A 4WB4A 1M1JA 1ZOYC 2G2KA 1E79H 3V4QA 1OW6A 4Y28J 3CXHD 1PGQA 5KKZB 3E1RA 3TYYA 1RO2A 1RF1A 5KAFE 2M6NA 1RF1B 2I1KA 3I551 4TNUA 1X79B 1QL2A 3CX5D 3CC41 1SQXG 2WTYA 3Q87A 1GL2A 4RVFA 1KILC 1FDMA 2KNCA 4Z1MH 3CCQZ 4JQ0D 1M1KQ 3HE5A 1NTMK 3L74E 2BCCE 2HF1A 1LWUB 3CCM1 1S72Z 5TISH 2W6AA 4RVDA 3L73G 3VMXA 3RL0g 1Q861 2IBZD 3L74J 1L4AC 3VMIA 4XFJA 1YQ3C 1VQMZ 3A3YB 2JA6I 1DD3A 2W90A 2NPSD 2YIUB 4QTUA 3S1NI 4WY4C 3TGUE 1IFIA 5AW4B 3QWOC 1KILE 3ITKA 2Y9ZA 1BCCD 4RJTA 1WRGA 4DZOA 1Z56A 2WQYC 2GUVA 3EERA 1GK6A 3AEFC 3HUSB 4JPZB 4EDFA 1DH3A 3G71Z 3TSIA 2YKQA 1RE4A 5KKZC 1PP9E 1NWQA 2D2CB 4DJGA 5BU5A 4WBAA 2IYPA 1FOSF 4YTPC 1VQ41 2E75D 3VMZA 2E7ZA 4PV1C 2JA7I 1L0NG 3NXSA 1L0NJ 1Q821 2OTL1 1YHQZ 1N2DC 3FQMA 2R44A 2QJYB 1M1K2 1U7JA 3H1IE 1S5LH 1N73B 2D2CD 3A5TA 4DQYB 4U3FD 4MD8A 3CCRZ 5KLVG 5K5GB 1SP4A 2N9BA 1LTBC 1N8R1 3CCQ1 1URQB 2C9NY 3CMAZ 2HPCA 3BCCE 1EXJA 1NTZE 4H44B 2Q3IA 2A06D 4RVGA 1JWHC 2VUGA 3M0DC 2ZT9C 5CCHD 1MKMA 1FDIA 4RESB 4HGYA 1ZRTD 2H88C 2E76B 2R3SA 1FZCC 4H13B 3HE5B 1CZQA 4PD4H 2WB1A 5GTHH 1VQNZ 2J6AA 1VQP1 2PGDA 1KD11 2JJLA 3S2DI 2RPRA 3H1JJ 1VQOZ 1QGKB 1SQBJ 1BE3J 5KTBA 2QSIA 1OW7A 1KYOE 1VQ51 3CC2Z 3M0DA 2QEXP 4XA4A 5CBNA 2NVQI 1SQQK 1M56D 2AXTH 1SQPE 1X3ZA 1SS1A 1X8YA 4H0LD 1M1K1 3CCEP 1KTMA 2XKMA 3L73J 1JOCA 1GW3A 2QA4Z 4A3MI 4ZNCA 2Q5UA 3OA7A 2LIYA 1YBKA 3CI9A 2E74C 5KJ7D 4NBEA 4S1TA 3TDHB 1R8EA 1BE3D 1M7LA 3A0BH 1OMIA 1VQ5P 3AE2C 3P7KA 1BDCA 2WSFJ 5C39A 2RBLA 2PFXA 2AYDA 1SLQA 2IBZI 3TNUB 1IZNB 3O6QA 4DGLA 3L4FA 2G8YA 4EOTA 1KFNA 4H13D 3CPWZ 3CCVZ 2BCCG 3HUSA 3CD61 3HTKA 3P5JB 4NBAA 1VQ91 1QF8A 1RO0A 2WSCJ 1Z03A 3TDKA 1JCDA 1Q862 4OGQC 3GTOI 2JIRA 3I56Z 1VLAA 2KZIA 2OOYB 1TU3F 2ZYAA 3SWYA 1QVGO 1GU5A 1HJBA 3QWUA 5AW2B 2N1TC 1NTZK 3G711 5CJ4A 2KNCB 1S9KE 1S4XA 2QIWA 1M90Q 4UB6H 1P84D 3H3VJ 1YJ91 4I7ZC 3EFFK 1NU1G 3HKZA 2YMYA 2WSCH 3BG1B 2C9LY 1RO4A 3J81f 1URQC 3U59A 2OQQA 3K7AI 1PPJE 3T4NB 1HF9A 3CCS1 3WUUA 2O01N 4NBBA 3L72J 3H1KE 3KZIE 2PM9A 3GTMS 1NAYA 2HR3A 3CCL1 3CMEP 1ZR2A 3NH8A 2A45G 1S5LX 3G6EZ 1ZN5A 4A3EI 5IT9b 1EDLA 3H1LD 1SQVG 1DD4A 2VRSA 1GL2B 4IL6E 3N7NA 3L70J 2WSEJ 2O3JA 2G3AA 1L2PA 2WITA 1DEBA 2YIUC 1L0LE 2V4HA 1GZLA 1SQXD 1M1JB 1Y1VI 3F89A 3CXHI 3HD7B 3CXCZ 4AYCA 1KB9H 5APXA 2R32A 3VP9A 2WT7B 1FBMA 1NP6A 4E32A 5C4JI 4GOEA 1LQLA 2YO2A 1VQNP 1BE3E 1VQLP 3MZWB 2KB7P 4NB9A 2ZYGA 4H0LB 4Y99B 2GTIA 1K731 1QYPA 2J5UA 3CX5H 1FS0E 1FU1A 1YIJP 3WUTA 1BSNA 3BCCG 1N86A 1SQVK 2PAJA 2DE5A 1SQVJ 5C3EI 3Q2YA 4MXUA 4KJMA 4C46A 3H1KJ 4PD4E 1VQ71 1VF5D 5AVUB 2JA8I 1PFIA 1BCCE 3KXDA 4NBHA 1A02J 4AYBA 4NBFA 5AVVB 1TWGI 3GTPI 2IX7C 1LJ2A 1GU4A 4L73A 3GTLI 4EYYQ 3GHGB 3RK3B 2FYZA 1S3JA 3MP7B 2MJZA 5AW0B 1VF5B 4E2ZA 4ZMDA 2KXPB 1VQ81 4LGDE 1VQ7P 3M4OI 3Q5SA 3LW5H 4PV1B 2Q7CA 3FXDA 2ZVOB 1BGYJ 4E33A 1URQD 1JY2N 3A2AA 2Y0CA 3R4YA 1MFTA 3JAMf 3TF5A 2LKMA 3KIHA 4Y7NI 4BBSI 1VQKP 5AW7B 3RL0C 3P8CD 1HVVA 2V7QH 4MD9A 3MUDA 2N1TD 3M91A 1JTHB 2I1JA 2VPWA 2QEXZ 3HE4B 1VPCA 1H88A 3VMYA 1YITP 4GODA 1TWAI 3S2HI 1GK4A 3J80f 2V8JA 1Q7YQ 5BVZA 3CWBE 3HTKB 1NTKG 1LWUC 4UB8E 3H1IG 3TGUJ 1NYHA 1YJ9P 3OW2Y 1RQUA 2JA5I 1HTLC 4H13C 3JC22 1TWCI 1NOHA 4IL6H 1KC8Q 3IAOA 3CCVP 2K9JA 4MRIA 2IBZE 1RNIA 2QVAA 2FBWC 3WU2E 3L70G 2VPXA 2XNDH 1Z02A 3CWBD 4HYTB 1N7LA 2FXMA 2Z5IA 2FYNC 1KQSY 1DEEG 2L91A 1IK9A 4RS4A 5KAFH 4A3JI 4NOZA 3HOZI 3H1LJ 5IP7I 4DOJA 3CPWY 3TGUD 2NVYI 3OW2Z 1S721 3F3FC 3A0HE 3IFMA 1LP1B 1VQ6P 2HFED 1IC2A 4K3AA 1VL2A 1IK7A 1KFMA 3NFZA 2R5BA 3D6YA 4YXWH 3BG0B 1HH0A 3S16I 2FFDC 1SFCB 1SQBG 4ZKUA 1LT9C 1JY2P 4XE5B 2E74B 1NTZJ 1ZH1A 1M57D 3B5NB 3AE7C 1K05A 2A45I 4D6TD 4YPCA 1JY3O 1FZGA 1EZVG 2KUBA 2E5YA 2OYIA 3RL0D 1SQVD 1FZBA 5T6BA 1EZVD 2OTKE 2OYIC 4C7NB 4MN4C 3J80b 2QE7H 3NDIA 1VQL1 1VQKZ 1VQLZ 3FQQA 2Y0EA 1KQGB 1I50I 2IZ1A 2M8RA 2A06G 5GTIH 2B89A 4IFMA 4GT1A 4W7YA 2YO3A 4HJGH 5TJHA 1NHLA 4DK1A 2QLVB 1NU1D 1BDDA 3GTQI 1NTME 3BRVB 2FYNB 4TT3H 2KOGA 1YYCA 4BBRI 3PH0A 3TE5B 3GTGI 4E30A 1Q81Q 2Y0DA 2E76C 1ZRTE 3WUVA 1A02F 1R5LA 1YJNP 1VF5C 2PMZA 1NGMB 3CL3D 3L73D 2KK7A 3MONA 4KHXA 1VQPZ 4I1LA 5CCGC 2QREB 1IFNA 5AN9F 3PP5A 2E43A 1SFCA 2E2JI 2BEQD 4JF7A 1W2EA 3W67A 1VQ8P 2R3CA 1QVGZ 2KP8A 3H1KG 3GMAA 3H6PA 2OZKA 2NZ2A 5CHXA 1RH5B 5E79H 3AE3C 3G71P 3CWBJ 2JMOA 2AKLA 2E9HA 3VOPA 3O6QB 3HD7D 1FC2C 4KT0J 2RHBA 4B86A 1OVRA 2QJPC 4WY4D 2NPSC 3KIFA 3C9IA 1VQO1 4QTTA 3CCJ1 1RLYA 1PP9G 2W6BA 1ZLLA 2OTJZ 1L4AD 3L70D 3CC21 3PJSK 2Y9YA 3BRTB 3FGAD 2JS4A 1AA6A 1ML8A 1YUKA 3H1JD 1WT6A 3H32B 2PP6A 1NU1J 1J1DB 1ZB8A 1YTZT 4UB6E 2GA1A 3U1AA 1R9TI 2RN0A 3VP8A 2V8KA 1G2CA 3B8EB 3HE4A 1SQPK 2NVXI 3KPEA 2A06E 1IFMA 3PHLA 3I07A 3I561 3NH5A 4W7ZA 3RK3E 4NB8A 2FKWB 3L71E 2QA4P 3ESWA 2M5AB 2M5AA 3H1IJ 2W6JH 5KLVK 3M06A 4EI2A 2ZAEB 5AVZB 3Q1MA 2IFNA 3O8ZA 2QJYC 3T97B 1OIPA 1PIXA 1AJYA 1J2JB 4IOIH 5AW1B 4GIFA 3GTKI 2JIOA 4EIJA 3IFUA 1RE3C 3HOWI 3A0BE 4U3FG 3U1CA 2IZ0A 2P67A 3N4XA 2UWJE 2QJKC 2NPSB 4DCKA 2QA41 5L8RJ 1YI2P 2YU9I 1OVVA 1JO5A 3BATA 4PD4I 1QL1A 4TLFA 1M1JC 1W5CE 5DJUB 2PK7A 3J81b 1YJWZ 1SQXK 1TFIA 2FFDA 2I8DA 4RVHA 3HD7C 4X6AI 1J1DC 1NO4A 1YIJZ 1NTKE 4A3DI 2KSEA 2FYUD 5B66E 1GTWA 1NTZG 4JBZA 1OX3A 3CCUP 3JAMb 5LL6f 1KQLA 1KYOD 3SSUA 1WCMI 4PJ0E 3H1LE 5APVA 2WPSA 2XDJA 4MONA 4LLHA 3I4MI 1VQ8Z 1FZAA 3CC7Z 2K1AA 4L74A 1YJN1 3CWBG 1DIPA 3JSVC 1VQ4P 2VPYA 5EFWB 3OW2O 2B9BA 1EDIA 1LTIC 4U3FJ 1RQFA 3CCSZ 2E76D 2FXPA 3CCU1 1U57A 3CCLZ 3Q5PA 3AEAC 4H44C 1W2BO 2ZT9B 1VQ9P 1PZQA 3EWKA 1LTSC 1L1OC 2R92I 3L71G 2V8IA 2O4HA 4BWNA 5CCHC 2DE6A 2KS1A 4OGQB 2Y0SA 1FAVA 3AEBC 3JCUH 1QVFY 2HG5D 1USEA 3L71D 1Q7Y2 3AE9C 3RBZA 3CCMZ 3RK2B 1Y1WI 3BCCD 3H1LG 4AUWA 1N73A 3I4NI 1EQ7A 2YXQB 3L72E 1L0NK 1FE6A 1VQPP 5AW5B 2CPSA 2J58A 2QG4A 3CC4Z 2AEMA 1LTJB 3WMM0 3MHVA 5KLIB 1SQBK 1Q86Q 1GW4A 2DW3A 5CMZA 3D9XA 1SIWA 2IYOA 2HU9A 1VQ61 2ZXXA 1KQFB 4D6TJ 3D70A 4L76A 2E75C 3A0HH 1Q82Q 2IZ3A 4RKUJ 4A3II 3L75D 4GKGA 1EDKA 3EEDA 1JJ2Y 3CCMP 1SFOI 2OTLZ 3CCR1 1FJPA 3USSA 5AVSB 3AECC 3HOVI 2XZRA 1AVYA 1JY2O 3H1KD 3S1KA 5T64A 3S1RI 1MFZA 5APUA 3V2RA 2BCCD 3HOUI 2LXBA 1K83I 3A7OA 2P10A 3H1JG 2VUMI 4UB8H 1JUNA 2OTJP 1AQ5A 3NH4A 3KZIH 1W2BZ 1CI6A 5APWA 2JIPA 1X3WA 1G1JA 2ZJSE 4NPEA 2QJPB 3BCCJ 1ZMEC 1ZP0C 1NJIQ 3L35A 1JTHA 5KLVD 3SWKA 3E1IA 1KILD 4C7NA 1CW5A 4ZKPA 4N78D 5E79E 2E2II 1VQK1 1QVFZ 2FYUJ 5CJ0A 3NMDA 4N3YB 2FYUK 1L0LK 5AW3B 2YKOA 2OYIB 1Y47A 2LEXA 2OARA 1NJI1 4A3GI 3B5NA 2NRGA 1KC81 4MH4A 3L72G 2K88A 3PRJA 3D6ZA 3E7KA 2BEZF 5FLMI 3PO3S 4IFFA 1BGYE 2CK3H 1JCCA 1EDJA 1YHQ1 1H0TB 3CXCY 2LFUA 1EZVI 1URQA 2KI7B 3F5HA 2MKVA 2IPPA 1HWTC 2R93I 1HUCA 1AFOA 2JP3A 2RT9A 1YITZ 1FOSE 3MD0A 2WMMA 2V7QJ 2Q4ZA 1K9M1 1P84E 3L75E 2LR2A 2IV2X 1CSBA 1SFCC 2WZ7A 2FFDB 4CPGA 2KZJA 1OZHA 2WSSH 1FZCB 5C4XI 1QXFA 1PGPA 2W8ZA 2K9JB 4A3LI 2GU2A 3AEEC 5B5EE 2YKPA 2IBZG 2QKDA 1L4AA 3L36A 1OWAA 3V2NA 4RO0A 1Q16A 2A45H 3CLQA 2H7HA 1S9KD 3CCEZ 1LTJC 3H1HD 3B71A 1OW8A 5CCGD 1PP9J 3V4WA 2GM4A 2OYHB 2RIQA 1KORA 4W80A 1Y8AA 3CCE1 1SQBD 2QM8A 1Q90D 2EGTA 3GG2A 3OJAB 1PP9D 1QLED 2H43A 1IFPA 2XU6A 3L73E 1YUAA 1KC82 2OYHC 3KDPB 3RZOI 1Y9BA 1EZVE 3H25A 2P7JA 1SQXJ 2B87A 1KB9E 1YI21 3NFQA 1GDTA 3U50C 1SQBE 1L0LD 3L37A 2HPCB 2VF1A 4L75A 2DE7A 1BGYG 3RGUA 1NH4A 3M9HA 4ASWA 1MV8A 3L74G 2JDIH 1FZFA 1QVFO 2SPZA 2W03A 1TWFI 2CPBA 4AQRD 2Q51A 4A7PA 2HLOA 3FWNA 4Y52I 1QEXA 4GOFA 2WWWA 1PFTA 1ZB9A 1DL6A 4OGQD 1FZEA 3GF7A 4M3LA 1IJDB 1D7MA 1L4AB 5FLXf 2WAQA 1CI6B 1Y8CA 3TGUG 3CCQP 2W04A 4A3BI 1OXZA 2OGUA 5AVQB 3G6EP 1T2KD 3SFDC 4A3KI 2BJOA 1N7SC 4PD4D 2POHA 5AW9B 3CPWO 2NAPA 3P8MC 3RK3D 4EWCA 4U3FE 3IF4A 5KJ7C 2C0WA 5APTA 5AVYB 1N73C 5D1PA 3G4SZ 2Q3EA 1OVUA 1SQPG 1YIT1 3CCSP 3CC2P 1RE4C 1PGJA 1KQSZ 2J59M 3H1HE 3V6IA 3W68A 3CMA1 5T67A 1KILB 1NTZD 1NTKD 3CCLP 3CME1 1KYOI 2V3VA 3D6WA 1RF0A 2FYUE 1W2BY 3CC4P 1YQ4C 1GMJA 4XX2A 1NTKK 2YNYA 3AE6C 2NVTI 1AV1A 1YI2Z 2KLUA 1SQXE 1K04A 1Q7Y1 4E2YA 4WY4A 3CCV1 3M9QA 1SQPD 2QEX1 3HRNA 3GF3A 3VN0A 4I6MC 5AW8B 2H85A 3LIEA 4Y99C 1E5WA 1T3JA 3CCUZ 4NH1C 5FLXb 1L0LJ 4E2XA 3H1HJ 3MZLB 3I55P 1JY3N 5KAIH 3L70E 2B88A 2AXCA 2WPQA 1Q2NA 3HUSC 2Q6QA 2WSEH 4A3FI 3RZDI 2BCCJ 4HGZA 5D1OB 3NDJA 1G2CB 2IFMA 3H1ID 5GTHE 3RK2C 1KILA 5GTIE 1M901 4C7RA 2B87B 5H2FE 1WIIA 2R5DA 1X9VA 3RL0B 2KLVA 5APYA 1UIXA 1GL2D 4OVNF 2D2CC 1YIJ1 3F3PC 5DJTB 1RF1C 1Q812 3NTNA 3L75G 3L75J 1NTMG 5APQA 1SQQE 2IZ4A 1X0TA 1KD1Q 1SQQJ 1NU1K 2JKVA 3VMHA 3OAKA 1K8AQ 4A93I 2K3RA 3KQGA 2OTLP 2F4MA 2M3EA 3RK3C 1BSHA 1RF0C 1L0LG 2W27A 3ZDMA 5A2Qf 1RE3A 1KQSO 1LTAC 1L0NE 1N7SD 2E75B 1QVGY 1RHZB 4NPFX 3VTNA 4YXDC 1P9NA 3VTPC 2ZYDA 1HGZA 2ZXEB 2JIMA 1NTMD 2M0BA
chains in the Genus database with same CATH topology
1S7MA 4A3II 1RO2A 2M6NA 2QEXZ 1EDKA 3EEDA 3I551 1JJ2Y 4TNUA 1SFOI 3CC41 2B63I 2OTLZ 3CCR1 4GODA 1TWAI 1NUIA 3Q87A 3S2HI 3J80f 2V8JA 4RVFA 2JR6A 3CCQZ 3LUSA 3S17I 3HOVI 3S1KA 5T64A 3S1RI 1VQ4Z 3OW2Y 2JA5I 2HF1A 3CCM1 3VMGA 1TWCI 2RKLA 1S72Z 3HOUI 2LXBA 1K83I 4RVDA 4MRIA 1RNIA 2VUMI 2QVAA 1Q861 3VMIA 3NH4A 1Z02A 1VQN1 1W2BZ 1VQMZ 2JA6I 1VQM1 1KQSY 1WW9A 1DEEG 4RS4A 4A3JI 1X3WA 4NOZA 2KS1B 3HOZI 5IP7I 4NPEA 2NVYI 3OW2Z 1S721 3CPWY 4QTUA 3F3FC 3S1NI 1LP1B 4WWIA 1I6HI 3QWOC 3FKII 4K3AA 3NFZA 1KD12 1N2FA 4ASVA 3BG0B 2E2II 1VQK1 3S16I 1QVFZ 3EERA 3G71Z 3IX0A 1Y47A 1NJI1 2P58A 1ZH1A 4A3GI 1KC81 4MH4A 2KUBA 2K5RA 1VQ41 5T6BA 1JMBA 2OTKE 1VQ6Z 5FLMI 2JA7I 4MN4C 2QRCB 3J80b 3PO3S 3NDIA 1Q821 2R7ZI 2OTL1 1YHQZ 1VQL1 1EDJA 1LP1A 1VQKZ 1YHQ1 3FQMA 2R44A 1VQLZ 1M1K2 1H0TB 1U7JA 3CXCY 2LFUA 3FQQA 1I50I 2KI7B 4DQYB 4MD8A 3I55Z 2R93I 2B89A 3CCRZ 3CD6Z 2RT9A 1YITZ 4HJGH 1Z01A 5K5GB 2WMMA 4BY1I 4DK1A 2QLVB 1N8R1 2Q4ZA 1BDDA 3CCQ1 1K9M1 3CMAZ 2LR2A 3GTQI 3VB9A 4CPGA 2KZJA 4BBRI 3PH0A 5C4XI 3CCJZ 3TE5B 3GTGI 2KIKA 4RVGA 4E30A 1JWHC 2VUGA 3PO3I 4A3LI 2GU2A 3FXEA 2GTHA 4NBCA 1ZW0A 2PMZA 4HGYA 2JUBA 2QKDA 2WB1A 3MONA 1VQNZ 1VQPZ 2J6AA 1VQP1 2QREB 5AN9F 4NPDA 2E2JI 3CCEZ 1KD11 3S2DI 2RPRA 1QVGZ 2RIQA 2OZKA 3CCE1 1VQOZ 5C44I 2EGTA 2Q1KA 1VQ5Z 2JMOA 2AKLA 2E9HA 1VQ51 1FC2C 3MZKB 3CC2Z 2RHBA 5CBNA 2NVQI 1OVRA 1YUAA 1KC82 3RZOI 2KPIA 1X3ZA 2P3YA 1SS1A 1M1K1 3KIFA 2B87A 1TWHI 2QA4Z 4A3MI 4ZNCA 1VQO1 2LIYA 4QTTA 1YI21 4HB1A 1RLYA 3CCJ1 3M3YI 5CM2M 3U50C 4NBEA 4S1TA 2OTJZ 3TDHB 3CC21 2VF1A 2QRXA 1USPA 2DE7A 1K9M2 1BDCA 1N8R2 5C39A 2RBLA 2JS4A 1ML8A 1YUKA 3GKQA 4DGLA 3RGUA 4NFRA 1ZB8A 3CPWZ 3CCVZ 4MD7A 4ASWA 3CD61 3P5JB 4NBAA 1VQ91 1R9TI 1QF8A 1RO0A 2V8KA 2SPZA 2W03A 1Z03A 2NVXI 1TWFI 4E2WA 1Q862 3GTOI 3CMEZ 2LXCB 2Q51A 3I56Z 1Q822 1VLAA 3GTMI 2KZIA 3I07A 3I561 3NH5A 2R6MA 4Y52I 4NB8A 2OOYB 3ESWA 4GOFA 1PFTA 1ZB9A 2M5AB 3S1MI 3IF8A 1DL6A 3QWUA 2M5AA 4HH4A 5IT9f 2E2HI 1JJ2Z 2ZAEB 3G711 2JNYA 1NJI2 5FLXf 1VQ9Z 2WAQA 3GTJI 3H3VJ 2O53A 3S1QI 1YJ91 4IOIH 3HKZA 4NBDA 3GTKI 2W04A 3IFUA 4A3BI 4A3KI 2BJOA 3BG1B 1RO4A 3J81f 3HOWI 3K7AI 5IP9I 1NVOA 2M48A 3T4NB 3CCS1 4RV9A 2UWJE 4NBBA 2QA41 4EWCA 3HOXI 2PM9A 3GTMS 2YU9I 3CCL1 1OVVA 2HR3A 3NH8A 1JM0A 3G4S1 3G6EZ 2OTJ1 5D1PA 3G4SZ 3PO2I 4A3EI 5IT9b 1EDLA 4NBGA 1OVUA 1H0TA 1YIT1 5DJUB 3CQZI 2P28A 1KQSZ 2PK7A 3J81b 1YJWZ 3CMA1 5T67A 1TFIA 3CME1 1LT1A 2I8DA 3J7A4 3D6WA 4RVHA 4X6AI 2QRDB 1W2BY 1YIJZ 4A3DI 4XX2A 4BXLA 2NVTI 1YI2Z 1Y1VI 4BY7I 4JBZA 3CXCZ 3JAMb 5LL6f 1Q7Y1 4E2YA 2YADA 2JWDA 3CCV1 2I3CA 5A2Qb 2QEX1 1WCMI 3CC71 1NP6A 4E32A 2H85A 5C4JI 4GOEA 1LQLA 4A3CI 4MONA 3I4MI 1VQ8Z 3H0GI 1ZXGA 1M902 3CC7Z 3CCUZ 3S15I 4NH1C 5FLXb 1YJN1 1YJ9Z 5EFWB 3MZWB 1YJNZ 1EDIA 4NB9A 4E2XA 1RQFA 3CCSZ 1KRLA 3MZLB 4CL1A 2GTIA 3CCU1 1QYPA 1K731 3CCLZ 2B88A 1Q811 1Q2NA 1K732 4A3FI 2DE5A 3RZDI 4E31A 1EC5A 1L1OC 4HGZA 5D1OB 3NDJA 5C3EI 4HKZH 4MXUA 2R92I 4KJMA 2V8IA 2O4HA 1VQ71 5CBOA 1M901 2B87B 2JA8I 3S14I 1WIIA 1K8A2 4NBHA 2DE6A 1YIJ1 2Y0SA 3F3PC 1QVFY 5DJTB 4AYBA 1YJW1 4NBFA 1Q812 3GCFA 1TWGI 1VQ7Z 3GTPI 4K35A 3HOYI 1Q7Y2 1USPB 3CCMZ 3GTLI 4EYYQ 1Y1WI 2IZ4A 1X0TA 1S3JA 3I4NI 4BXXI 1K8A1 1I3QI 4E2ZA 4ZMDA 3G6E1 1U7MA 3VMHA 4A93I 2QR1B 1VQ81 3M4OI 2K3RA 2F4MA 5D1OA 1Y1VS 3CC4Z 3FXDA 2F4OA 3MHVA 3ZDMA 5A2Qf 4E33A 3D9XA 1MFTA 3JAMf 1QVGY 4Y7NI 3KIHA 4NPFX 2HU9A 4BBSI 2OOXB 1VQ61 3VTNA 1P9NA 2G2KA 4MD9A 2IZ3A 2M0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDC A;  5C39 A;  2KI7 B;  1EDK A;  4GOE A;  3RGU A;  4GOD A;  2B89 A;  4ASW A;  1ZXG A;  4HJG H;  5K5G B;  2WMM A;  1BDD A;  2SPZ A;  5EFW B;  3MZW B;  1EDI A;  2LR2 A;  2LXC B;  2KZI A;  3S1K A;  4CPG A;  2KZJ A;  2B88 A;  3PH0 A;  2RKL A;  1Q2N A;  2KIK A;  2LXB A;  4GOF A;  2M5A B;  2M5A A;  3FXE A;  2QVA A;  1ZW0 A;  1EC5 A;  2ZAE B;  4HKZ H;  4KJM A;  4IOI H;  5CBO A;  2B87 B;  4NPD A;  1DEE G;  2KS1 B;  5DJT B;  4NPE A;  1NVO A;  4K35 A;  2UWJ E;  1LP1 B;  4WWI A;  1OVV A;  2HR3 A;  4EYY Q;  3QWO C;  1X0T A;  1JM0 A;  1S3J A;  2Q1K A;  4K3A A;  4ASV A;  1FC2 C;  4ZMD A;  1EDL A;  1U7M A;  5CBN A;  1OVR A;  1Y47 A;  1OVU A;  2K3R A;  1H0T A;  5DJU B;  1SS1 A;  2P58 A;  3FXD A;  3MHV A;  3ZDM A;  1LT1 A;  2B87 A;  2I8D A;  1MFT A;  2KUB A;  4ZNC A;  4NPF X;  1JMB A;  4HB1 A;  2OTK E;  4BXL A;  4MN4 C;  4JBZ A;  1EDJ A;  1LP1 A;  2JWD A;  2QRX A;  2R44 A;  1H0T B;  1U7J A;  2M0B A; 
#chains in the Genus database with same CATH topology
 1FDO A;  4PJ0 H;  1S7M A;  1FZC A;  4LC1 A;  2HOD B;  3CXH E;  3L71 J;  1XTG B;  1X22 A;  2B63 I;  1FJK A;  1NUI A;  3S4R A;  2JR6 A;  1PPJ D;  3LUS A;  3EFG A;  3M9B A;  3S17 I;  2P2U A;  1T3U A;  3AE5 C;  1NAF A;  3HD7 A;  1USD A;  3MGN A;  3CCJ P;  2VPZ A;  1NKZ B;  4R4L A;  3L74 D;  1VQ4 Z;  1SQP J;  2L5G B;  3IR7 A;  1NU1 E;  3VMG A;  2RKL A;  3Q3D A;  3VMA A;  2N1T B;  2N1T A;  4R4M A;  2IDB A;  2AEJ A;  5AVW B;  4JYB A;  1VQN 1;  3T97 A;  2QM7 A;  3H32 A;  1AA0 A;  3H1J E;  4U7J A;  1VQM 1;  2O01 J;  1WW9 A;  3P32 A;  4QMA A;  2KS1 B;  1PGO A;  1LTG C;  3M0A A;  3VYI A;  3MTU E;  4WWI A;  2E5T A;  2Z4E A;  1I6H I;  2XNX A;  3AE1 C;  3FKI I;  2HOD A;  3GHG C;  1KD1 2;  1N2F A;  1RY3 A;  4ASV A;  1N8R Q;  3SFE C;  3IX0 A;  1OFC X;  3RBX A;  4GDO A;  2WVR A;  5AVT B;  1VQM P;  2W83 C;  2O01 H;  1N7S B;  2P58 A;  4O9B A;  1DX7 A;  3H1H G;  2K5R A;  3G4S P;  2FY8 A;  4D6T E;  1LT9 B;  1JMB A;  1H89 A;  1BGY D;  1SQQ D;  3CD6 P;  1VQ6 Z;  2QRC B;  5AVR B;  2R7Z I;  1LP1 A;  3PTZ A;  1BE3 G;  3II6 A;  3TNU A;  3I55 Z;  3LID A;  3IN6 A;  5H2F H;  2E74 D;  1BCC J;  3CD6 Z;  1BCC G;  3V2P A;  1NTM J;  4I7Z B;  1Z01 A;  1SFC D;  1P84 H;  4BY1 I;  4OWF A;  4H0L C;  2NPS A;  3VB9 A;  2AXT E;  1JNM A;  3CCJ Z;  3CCR P;  2KIK A;  1GL2 C;  5KJ7 A;  3PO3 I;  3FXE A;  3PLN A;  2GTH A;  4NBC A;  1ZW0 A;  2XV5 A;  2JUB A;  3RK2 D;  1N7S A;  3AED C;  3AE4 C;  2BAS A;  1R5S A;  4NPD A;  1LNQ A;  1QX8 A;  3P8C E;  5CCG A;  1M8O B;  3IR9 A;  1JB0 J;  3R2P A;  1PPJ G;  2Z5H A;  5B66 H;  3B4S A;  1WZN A;  2WPR A;  5C44 I;  5B5E H;  2Q1K A;  2JR8 A;  1VQ5 Z;  2ZT9 D;  3MZK B;  1K73 Q;  3BVH A;  1JY3 P;  4WY4 B;  1YJW P;  1WJ2 A;  3D2L A;  3AEG C;  2KPI A;  2P3Y A;  1KZU B;  2C0X A;  2JEE A;  1KB9 D;  5KLI C;  2RMZ A;  1J1E C;  3B5N C;  1TWH I;  4HB1 A;  3MIW A;  2Q9I A;  1NTK J;  2JWA A;  1HBW A;  2OYO A;  2ZVN B;  3M3Y I;  2ZFC A;  5CM2 M;  3WU2 H;  2QRX A;  1USP A;  3CX5 I;  1K9M 2;  1UII A;  1N8R 2;  1EXI A;  3I56 P;  1HJ0 A;  3GKQ A;  3ABV C;  4PV1 D;  1S2E A;  4NFR A;  4MD7 A;  3S9O A;  3L72 D;  3SWF A;  3AE8 C;  4D6T G;  3FX0 A;  5M1B A;  2OYH A;  4E2W A;  2H89 C;  3CME Z;  2P1J A;  2LXC B;  1Q82 2;  3GTM I;  1KV4 A;  3LW5 J;  1LT9 A;  1PL5 A;  2JO1 A;  2R6M A;  2K9Y A;  1T2K C;  3S1M I;  2YXR B;  3IF8 A;  4HH4 A;  5IT9 f;  2E2H I;  4DT0 A;  1JJ2 Z;  2WT7 A;  2JNY A;  1KN7 A;  1NJI 2;  1VQ9 Z;  3GTJ I;  2O53 A;  3S1Q I;  1SQV E;  1LTJ A;  4NBD A;  2QJK B;  3V5B A;  3UIA A;  2PRR A;  1G1I A;  1P84 I;  5IP9 I;  1NVO A;  1ZV8 A;  2M48 A;  4RV9 A;  1S1C X;  2KYV A;  3HOX I;  4BRY B;  5APS A;  2AEF A;  2GUS A;  1GD2 E;  2O1K A;  1JM0 A;  1L0N D;  3G4S 1;  1SQQ G;  1LTT C;  1NKN A;  2OTJ 1;  2YMK A;  3B5N D;  3PO2 I;  3I5C A;  5TIS E;  4NBG A;  1H0T A;  1H8A A;  3CQZ I;  2P28 A;  3KYQ A;  4I2L C;  1KYO H;  1LT1 A;  3J7A 4;  2KSJ A;  2QRD B;  5AVX B;  4OH8 B;  1LGH B;  1LWU A;  3BAS A;  3GHG A;  2V45 A;  2K37 A;  3QH9 A;  5BU8 B;  3G9R A;  4BXL A;  4BY7 I;  1AVO A;  1KB9 I;  2E42 A;  5KLV J;  2YAD A;  1IFD A;  3CXH H;  2JWD A;  4IFD K;  2I3C A;  5A2Q b;  4BRY A;  3FWL A;  4JYC A;  3CC7 1;  1K9M Q;  3EQ2 A;  1PV3 A;  3MUD C;  5KLV E;  4A3C I;  1HGV A;  4H44 D;  3Q5R A;  1SVF A;  5KAI E;  4N78 E;  5AW6 B;  3H0G I;  2H8P D;  1ZXG A;  1M90 2;  4HH2 A;  3S15 I;  2HYN A;  1YJ9 Z;  2RH0 A;  5CCH A;  1YJN Z;  1VQO P;  1J1E B;  1MUU A;  1KRL A;  2M3B A;  4CL1 A;  2WSF H;  2N9Y B;  1Q81 1;  1YHQ P;  1MZ9 A;  3CC7 P;  2JIQ A;  1K73 2;  1S72 P;  4E31 A;  1EC5 A;  2ITA A;  4HKZ H;  1WMK A;  4IL6 X;  3G3Z A;  5CBO A;  3GW6 A;  3S14 I;  2FYU G;  4N6J A;  1S5L E;  1K8A 2;  3K5B A;  3JCU E;  1RQV A;  1YJW 1;  1JMM A;  3GCF A;  1VQ7 Z;  1IFJ A;  4K35 A;  3HOY I;  3C8V A;  4WVZ A;  3CMA P;  1USP B;  1T8Z A;  3KHU A;  1IO4 A;  4BXX I;  1K8A 1;  1I3Q I;  3G6E 1;  1JEK A;  1U7M A;  2QR1 B;  3CX5 E;  1ZR4 A;  3GLM A;  3C1L A;  5D1O A;  1Y1V S;  2FXO A;  2O1J A;  1KMI Z;  3V2Q A;  2F4O A;  1XTC C;  1VDF A;  2WPV B;  1AQT A;  1T6A A;  3TK1 A;  1YTZ I;  2OOX B;  3D71 A;  4WB4 A;  1M1J A;  1ZOY C;  2G2K A;  1E79 H;  3V4Q A;  1OW6 A;  4Y28 J;  3CXH D;  1PGQ A;  5KKZ B;  3E1R A;  3TYY A;  1RO2 A;  1RF1 A;  5KAF E;  2M6N A;  1RF1 B;  2I1K A;  3I55 1;  4TNU A;  1X79 B;  1QL2 A;  3CX5 D;  3CC4 1;  1SQX G;  2WTY A;  3Q87 A;  1GL2 A;  4RVF A;  1KIL C;  1FDM A;  2KNC A;  4Z1M H;  3CCQ Z;  4JQ0 D;  1M1K Q;  3HE5 A;  1NTM K;  3L74 E;  2BCC E;  2HF1 A;  1LWU B;  3CCM 1;  1S72 Z;  5TIS H;  2W6A A;  4RVD A;  3L73 G;  3VMX A;  3RL0 g;  1Q86 1;  2IBZ D;  3L74 J;  1L4A C;  3VMI A;  4XFJ A;  1YQ3 C;  1VQM Z;  3A3Y B;  2JA6 I;  1DD3 A;  2W90 A;  2NPS D;  2YIU B;  4QTU A;  3S1N I;  4WY4 C;  3TGU E;  1IFI A;  5AW4 B;  3QWO C;  1KIL E;  3ITK A;  2Y9Z A;  1BCC D;  4RJT A;  1WRG A;  4DZO A;  1Z56 A;  2WQY C;  2GUV A;  3EER A;  1GK6 A;  3AEF C;  3HUS B;  4JPZ B;  4EDF A;  1DH3 A;  3G71 Z;  3TSI A;  2YKQ A;  1RE4 A;  5KKZ C;  1PP9 E;  1NWQ A;  2D2C B;  4DJG A;  5BU5 A;  4WBA A;  2IYP A;  1FOS F;  4YTP C;  1VQ4 1;  2E75 D;  3VMZ A;  2E7Z A;  4PV1 C;  2JA7 I;  1L0N G;  3NXS A;  1L0N J;  1Q82 1;  2OTL 1;  1YHQ Z;  1N2D C;  3FQM A;  2R44 A;  2QJY B;  1M1K 2;  1U7J A;  3H1I E;  1S5L H;  1N73 B;  2D2C D;  3A5T A;  4DQY B;  4U3F D;  4MD8 A;  3CCR Z;  5KLV G;  5K5G B;  1SP4 A;  2N9B A;  1LTB C;  1N8R 1;  3CCQ 1;  1URQ B;  2C9N Y;  3CMA Z;  2HPC A;  3BCC E;  1EXJ A;  1NTZ E;  4H44 B;  2Q3I A;  2A06 D;  4RVG A;  1JWH C;  2VUG A;  3M0D C;  2ZT9 C;  5CCH D;  1MKM A;  1FDI A;  4RES B;  4HGY A;  1ZRT D;  2H88 C;  2E76 B;  2R3S A;  1FZC C;  4H13 B;  3HE5 B;  1CZQ A;  4PD4 H;  2WB1 A;  5GTH H;  1VQN Z;  2J6A A;  1VQP 1;  2PGD A;  1KD1 1;  2JJL A;  3S2D I;  2RPR A;  3H1J J;  1VQO Z;  1QGK B;  1SQB J;  1BE3 J;  5KTB A;  2QSI A;  1OW7 A;  1KYO E;  1VQ5 1;  3CC2 Z;  3M0D A;  2QEX P;  4XA4 A;  5CBN A;  2NVQ I;  1SQQ K;  1M56 D;  2AXT H;  1SQP E;  1X3Z A;  1SS1 A;  1X8Y A;  4H0L D;  1M1K 1;  3CCE P;  1KTM A;  2XKM A;  3L73 J;  1JOC A;  1GW3 A;  2QA4 Z;  4A3M I;  4ZNC A;  2Q5U A;  3OA7 A;  2LIY A;  1YBK A;  3CI9 A;  2E74 C;  5KJ7 D;  4NBE A;  4S1T A;  3TDH B;  1R8E A;  1BE3 D;  1M7L A;  3A0B H;  1OMI A;  1VQ5 P;  3AE2 C;  3P7K A;  1BDC A;  2WSF J;  5C39 A;  2RBL A;  2PFX A;  2AYD A;  1SLQ A;  2IBZ I;  3TNU B;  1IZN B;  3O6Q A;  4DGL A;  3L4F A;  2G8Y A;  4EOT A;  1KFN A;  4H13 D;  3CPW Z;  3CCV Z;  2BCC G;  3HUS A;  3CD6 1;  3HTK A;  3P5J B;  4NBA A;  1VQ9 1;  1QF8 A;  1RO0 A;  2WSC J;  1Z03 A;  3TDK A;  1JCD A;  1Q86 2;  4OGQ C;  3GTO I;  2JIR A;  3I56 Z;  1VLA A;  2KZI A;  2OOY B;  1TU3 F;  2ZYA A;  3SWY A;  1QVG O;  1GU5 A;  1HJB A;  3QWU A;  5AW2 B;  2N1T C;  1NTZ K;  3G71 1;  5CJ4 A;  2KNC B;  1S9K E;  1S4X A;  2QIW A;  1M90 Q;  4UB6 H;  1P84 D;  3H3V J;  1YJ9 1;  4I7Z C;  3EFF K;  1NU1 G;  3HKZ A;  2YMY A;  2WSC H;  3BG1 B;  2C9L Y;  1RO4 A;  3J81 f;  1URQ C;  3U59 A;  2OQQ A;  3K7A I;  1PPJ E;  3T4N B;  1HF9 A;  3CCS 1;  3WUU A;  2O01 N;  4NBB A;  3L72 J;  3H1K E;  3KZI E;  2PM9 A;  3GTM S;  1NAY A;  2HR3 A;  3CCL 1;  3CME P;  1ZR2 A;  3NH8 A;  2A45 G;  1S5L X;  3G6E Z;  1ZN5 A;  4A3E I;  5IT9 b;  1EDL A;  3H1L D;  1SQV G;  1DD4 A;  2VRS A;  1GL2 B;  4IL6 E;  3N7N A;  3L70 J;  2WSE J;  2O3J A;  2G3A A;  1L2P A;  2WIT A;  1DEB A;  2YIU C;  1L0L E;  2V4H A;  1GZL A;  1SQX D;  1M1J B;  1Y1V I;  3F89 A;  3CXH I;  3HD7 B;  3CXC Z;  4AYC A;  1KB9 H;  5APX A;  2R32 A;  3VP9 A;  2WT7 B;  1FBM A;  1NP6 A;  4E32 A;  5C4J I;  4GOE A;  1LQL A;  2YO2 A;  1VQN P;  1BE3 E;  1VQL P;  3MZW B;  2KB7 P;  4NB9 A;  2ZYG A;  4H0L B;  4Y99 B;  2GTI A;  1K73 1;  1QYP A;  2J5U A;  3CX5 H;  1FS0 E;  1FU1 A;  1YIJ P;  3WUT A;  1BSN A;  3BCC G;  1N86 A;  1SQV K;  2PAJ A;  2DE5 A;  1SQV J;  5C3E I;  3Q2Y A;  4MXU A;  4KJM A;  4C46 A;  3H1K J;  4PD4 E;  1VQ7 1;  1VF5 D;  5AVU B;  2JA8 I;  1PFI A;  1BCC E;  3KXD A;  4NBH A;  1A02 J;  4AYB A;  4NBF A;  5AVV B;  1TWG I;  3GTP I;  2IX7 C;  1LJ2 A;  1GU4 A;  4L73 A;  3GTL I;  4EYY Q;  3GHG B;  3RK3 B;  2FYZ A;  1S3J A;  3MP7 B;  2MJZ A;  5AW0 B;  1VF5 B;  4E2Z A;  4ZMD A;  2KXP B;  1VQ8 1;  4LGD E;  1VQ7 P;  3M4O I;  3Q5S A;  3LW5 H;  4PV1 B;  2Q7C A;  3FXD A;  2ZVO B;  1BGY J;  4E33 A;  1URQ D;  1JY2 N;  3A2A A;  2Y0C A;  3R4Y A;  1MFT A;  3JAM f;  3TF5 A;  2LKM A;  3KIH A;  4Y7N I;  4BBS I;  1VQK P;  5AW7 B;  3RL0 C;  3P8C D;  1HVV A;  2V7Q H;  4MD9 A;  3MUD A;  2N1T D;  3M91 A;  1JTH B;  2I1J A;  2VPW A;  2QEX Z;  3HE4 B;  1VPC A;  1H88 A;  3VMY A;  1YIT P;  4GOD A;  1TWA I;  3S2H I;  1GK4 A;  3J80 f;  2V8J A;  1Q7Y Q;  5BVZ A;  3CWB E;  3HTK B;  1NTK G;  1LWU C;  4UB8 E;  3H1I G;  3TGU J;  1NYH A;  1YJ9 P;  3OW2 Y;  1RQU A;  2JA5 I;  1HTL C;  4H13 C;  3JC2 2;  1TWC I;  1NOH A;  4IL6 H;  1KC8 Q;  3IAO A;  3CCV P;  2K9J A;  4MRI A;  2IBZ E;  1RNI A;  2QVA A;  2FBW C;  3WU2 E;  3L70 G;  2VPX A;  2XND H;  1Z02 A;  3CWB D;  4HYT B;  1N7L A;  2FXM A;  2Z5I A;  2FYN C;  1KQS Y;  1DEE G;  2L91 A;  1IK9 A;  4RS4 A;  5KAF H;  4A3J I;  4NOZ A;  3HOZ I;  3H1L J;  5IP7 I;  4DOJ A;  3CPW Y;  3TGU D;  2NVY I;  3OW2 Z;  1S72 1;  3F3F C;  3A0H E;  3IFM A;  1LP1 B;  1VQ6 P;  2HFE D;  1IC2 A;  4K3A A;  1VL2 A;  1IK7 A;  1KFM A;  3NFZ A;  2R5B A;  3D6Y A;  4YXW H;  3BG0 B;  1HH0 A;  3S16 I;  2FFD C;  1SFC B;  1SQB G;  4ZKU A;  1LT9 C;  1JY2 P;  4XE5 B;  2E74 B;  1NTZ J;  1ZH1 A;  1M57 D;  3B5N B;  3AE7 C;  1K05 A;  2A45 I;  4D6T D;  4YPC A;  1JY3 O;  1FZG A;  1EZV G;  2KUB A;  2E5Y A;  2OYI A;  3RL0 D;  1SQV D;  1FZB A;  5T6B A;  1EZV D;  2OTK E;  2OYI C;  4C7N B;  4MN4 C;  3J80 b;  2QE7 H;  3NDI A;  1VQL 1;  1VQK Z;  1VQL Z;  3FQQ A;  2Y0E A;  1KQG B;  1I50 I;  2IZ1 A;  2M8R A;  2A06 G;  5GTI H;  2B89 A;  4IFM A;  4GT1 A;  4W7Y A;  2YO3 A;  4HJG H;  5TJH A;  1NHL A;  4DK1 A;  2QLV B;  1NU1 D;  1BDD A;  3GTQ I;  1NTM E;  3BRV B;  2FYN B;  4TT3 H;  2KOG A;  1YYC A;  4BBR I;  3PH0 A;  3TE5 B;  3GTG I;  4E30 A;  1Q81 Q;  2Y0D A;  2E76 C;  1ZRT E;  3WUV A;  1A02 F;  1R5L A;  1YJN P;  1VF5 C;  2PMZ A;  1NGM B;  3CL3 D;  3L73 D;  2KK7 A;  3MON A;  4KHX A;  1VQP Z;  4I1L A;  5CCG C;  2QRE B;  1IFN A;  5AN9 F;  3PP5 A;  2E43 A;  1SFC A;  2E2J I;  2BEQ D;  4JF7 A;  1W2E A;  3W67 A;  1VQ8 P;  2R3C A;  1QVG Z;  2KP8 A;  3H1K G;  3GMA A;  3H6P A;  2OZK A;  2NZ2 A;  5CHX A;  1RH5 B;  5E79 H;  3AE3 C;  3G71 P;  3CWB J;  2JMO A;  2AKL A;  2E9H A;  3VOP A;  3O6Q B;  3HD7 D;  1FC2 C;  4KT0 J;  2RHB A;  4B86 A;  1OVR A;  2QJP C;  4WY4 D;  2NPS C;  3KIF A;  3C9I A;  1VQO 1;  4QTT A;  3CCJ 1;  1RLY A;  1PP9 G;  2W6B A;  1ZLL A;  2OTJ Z;  1L4A D;  3L70 D;  3CC2 1;  3PJS K;  2Y9Y A;  3BRT B;  3FGA D;  2JS4 A;  1AA6 A;  1ML8 A;  1YUK A;  3H1J D;  1WT6 A;  3H32 B;  2PP6 A;  1NU1 J;  1J1D B;  1ZB8 A;  1YTZ T;  4UB6 E;  2GA1 A;  3U1A A;  1R9T I;  2RN0 A;  3VP8 A;  2V8K A;  1G2C A;  3B8E B;  3HE4 A;  1SQP K;  2NVX I;  3KPE A;  2A06 E;  1IFM A;  3PHL A;  3I07 A;  3I56 1;  3NH5 A;  4W7Z A;  3RK3 E;  4NB8 A;  2FKW B;  3L71 E;  2QA4 P;  3ESW A;  2M5A B;  2M5A A;  3H1I J;  2W6J H;  5KLV K;  3M06 A;  4EI2 A;  2ZAE B;  5AVZ B;  3Q1M A;  2IFN A;  3O8Z A;  2QJY C;  3T97 B;  1OIP A;  1PIX A;  1AJY A;  1J2J B;  4IOI H;  5AW1 B;  4GIF A;  3GTK I;  2JIO A;  4EIJ A;  3IFU A;  1RE3 C;  3HOW I;  3A0B E;  4U3F G;  3U1C A;  2IZ0 A;  2P67 A;  3N4X A;  2UWJ E;  2QJK C;  2NPS B;  4DCK A;  2QA4 1;  5L8R J;  1YI2 P;  2YU9 I;  1OVV A;  1JO5 A;  3BAT A;  4PD4 I;  1QL1 A;  4TLF A;  1M1J C;  1W5C E;  5DJU B;  2PK7 A;  3J81 b;  1YJW Z;  1SQX K;  1TFI A;  2FFD A;  2I8D A;  4RVH A;  3HD7 C;  4X6A I;  1J1D C;  1NO4 A;  1YIJ Z;  1NTK E;  4A3D I;  2KSE A;  2FYU D;  5B66 E;  1GTW A;  1NTZ G;  4JBZ A;  1OX3 A;  3CCU P;  3JAM b;  5LL6 f;  1KQL A;  1KYO D;  3SSU A;  1WCM I;  4PJ0 E;  3H1L E;  5APV A;  2WPS A;  2XDJ A;  4MON A;  4LLH A;  3I4M I;  1VQ8 Z;  1FZA A;  3CC7 Z;  2K1A A;  4L74 A;  1YJN 1;  3CWB G;  1DIP A;  3JSV C;  1VQ4 P;  2VPY A;  5EFW B;  3OW2 O;  2B9B A;  1EDI A;  1LTI C;  4U3F J;  1RQF A;  3CCS Z;  2E76 D;  2FXP A;  3CCU 1;  1U57 A;  3CCL Z;  3Q5P A;  3AEA C;  4H44 C;  1W2B O;  2ZT9 B;  1VQ9 P;  1PZQ A;  3EWK A;  1LTS C;  1L1O C;  2R92 I;  3L71 G;  2V8I A;  2O4H A;  4BWN A;  5CCH C;  2DE6 A;  2KS1 A;  4OGQ B;  2Y0S A;  1FAV A;  3AEB C;  3JCU H;  1QVF Y;  2HG5 D;  1USE A;  3L71 D;  1Q7Y 2;  3AE9 C;  3RBZ A;  3CCM Z;  3RK2 B;  1Y1W I;  3BCC D;  3H1L G;  4AUW A;  1N73 A;  3I4N I;  1EQ7 A;  2YXQ B;  3L72 E;  1L0N K;  1FE6 A;  1VQP P;  5AW5 B;  2CPS A;  2J58 A;  2QG4 A;  3CC4 Z;  2AEM A;  1LTJ B;  3WMM 0;  3MHV A;  5KLI B;  1SQB K;  1Q86 Q;  1GW4 A;  2DW3 A;  5CMZ A;  3D9X A;  1SIW A;  2IYO A;  2HU9 A;  1VQ6 1;  2ZXX A;  1KQF B;  4D6T J;  3D70 A;  4L76 A;  2E75 C;  3A0H H;  1Q82 Q;  2IZ3 A;  4RKU J;  4A3I I;  3L75 D;  4GKG A;  1EDK A;  3EED A;  1JJ2 Y;  3CCM P;  1SFO I;  2OTL Z;  3CCR 1;  1FJP A;  3USS A;  5AVS B;  3AEC C;  3HOV I;  2XZR A;  1AVY A;  1JY2 O;  3H1K D;  3S1K A;  5T64 A;  3S1R I;  1MFZ A;  5APU A;  3V2R A;  2BCC D;  3HOU I;  2LXB A;  1K83 I;  3A7O A;  2P10 A;  3H1J G;  2VUM I;  4UB8 H;  1JUN A;  2OTJ P;  1AQ5 A;  3NH4 A;  3KZI H;  1W2B Z;  1CI6 A;  5APW A;  2JIP A;  1X3W A;  1G1J A;  2ZJS E;  4NPE A;  2QJP B;  3BCC J;  1ZME C;  1ZP0 C;  1NJI Q;  3L35 A;  1JTH A;  5KLV D;  3SWK A;  3E1I A;  1KIL D;  4C7N A;  1CW5 A;  4ZKP A;  4N78 D;  5E79 E;  2E2I I;  1VQK 1;  1QVF Z;  2FYU J;  5CJ0 A;  3NMD A;  4N3Y B;  2FYU K;  1L0L K;  5AW3 B;  2YKO A;  2OYI B;  1Y47 A;  2LEX A;  2OAR A;  1NJI 1;  4A3G I;  3B5N A;  2NRG A;  1KC8 1;  4MH4 A;  3L72 G;  2K88 A;  3PRJ A;  3D6Z A;  3E7K A;  2BEZ F;  5FLM I;  3PO3 S;  4IFF A;  1BGY E;  2CK3 H;  1JCC A;  1EDJ A;  1YHQ 1;  1H0T B;  3CXC Y;  2LFU A;  1EZV I;  1URQ A;  2KI7 B;  3F5H A;  2MKV A;  2IPP A;  1HWT C;  2R93 I;  1HUC A;  1AFO A;  2JP3 A;  2RT9 A;  1YIT Z;  1FOS E;  3MD0 A;  2WMM A;  2V7Q J;  2Q4Z A;  1K9M 1;  1P84 E;  3L75 E;  2LR2 A;  2IV2 X;  1CSB A;  1SFC C;  2WZ7 A;  2FFD B;  4CPG A;  2KZJ A;  1OZH A;  2WSS H;  1FZC B;  5C4X I;  1QXF A;  1PGP A;  2W8Z A;  2K9J B;  4A3L I;  2GU2 A;  3AEE C;  5B5E E;  2YKP A;  2IBZ G;  2QKD A;  1L4A A;  3L36 A;  1OWA A;  3V2N A;  4RO0 A;  1Q16 A;  2A45 H;  3CLQ A;  2H7H A;  1S9K D;  3CCE Z;  1LTJ C;  3H1H D;  3B71 A;  1OW8 A;  5CCG D;  1PP9 J;  3V4W A;  2GM4 A;  2OYH B;  2RIQ A;  1KOR A;  4W80 A;  1Y8A A;  3CCE 1;  1SQB D;  2QM8 A;  1Q90 D;  2EGT A;  3GG2 A;  3OJA B;  1PP9 D;  1QLE D;  2H43 A;  1IFP A;  2XU6 A;  3L73 E;  1YUA A;  1KC8 2;  2OYH C;  3KDP B;  3RZO I;  1Y9B A;  1EZV E;  3H25 A;  2P7J A;  1SQX J;  2B87 A;  1KB9 E;  1YI2 1;  3NFQ A;  1GDT A;  3U50 C;  1SQB E;  1L0L D;  3L37 A;  2HPC B;  2VF1 A;  4L75 A;  2DE7 A;  1BGY G;  3RGU A;  1NH4 A;  3M9H A;  4ASW A;  1MV8 A;  3L74 G;  2JDI H;  1FZF A;  1QVF O;  2SPZ A;  2W03 A;  1TWF I;  2CPB A;  4AQR D;  2Q51 A;  4A7P A;  2HLO A;  3FWN A;  4Y52 I;  1QEX A;  4GOF A;  2WWW A;  1PFT A;  1ZB9 A;  1DL6 A;  4OGQ D;  1FZE A;  3GF7 A;  4M3L A;  1IJD B;  1D7M A;  1L4A B;  5FLX f;  2WAQ A;  1CI6 B;  1Y8C A;  3TGU G;  3CCQ P;  2W04 A;  4A3B I;  1OXZ A;  2OGU A;  5AVQ B;  3G6E P;  1T2K D;  3SFD C;  4A3K I;  2BJO A;  1N7S C;  4PD4 D;  2POH A;  5AW9 B;  3CPW O;  2NAP A;  3P8M C;  3RK3 D;  4EWC A;  4U3F E;  3IF4 A;  5KJ7 C;  2C0W A;  5APT A;  5AVY B;  1N73 C;  5D1P A;  3G4S Z;  2Q3E A;  1OVU A;  1SQP G;  1YIT 1;  3CCS P;  3CC2 P;  1RE4 C;  1PGJ A;  1KQS Z;  2J59 M;  3H1H E;  3V6I A;  3W68 A;  3CMA 1;  5T67 A;  1KIL B;  1NTZ D;  1NTK D;  3CCL P;  3CME 1;  1KYO I;  2V3V A;  3D6W A;  1RF0 A;  2FYU E;  1W2B Y;  3CC4 P;  1YQ4 C;  1GMJ A;  4XX2 A;  1NTK K;  2YNY A;  3AE6 C;  2NVT I;  1AV1 A;  1YI2 Z;  2KLU A;  1SQX E;  1K04 A;  1Q7Y 1;  4E2Y A;  4WY4 A;  3CCV 1;  3M9Q A;  1SQP D;  2QEX 1;  3HRN A;  3GF3 A;  3VN0 A;  4I6M C;  5AW8 B;  2H85 A;  3LIE A;  4Y99 C;  1E5W A;  1T3J A;  3CCU Z;  4NH1 C;  5FLX b;  1L0L J;  4E2X A;  3H1H J;  3MZL B;  3I55 P;  1JY3 N;  5KAI H;  3L70 E;  2B88 A;  2AXC A;  2WPQ A;  1Q2N A;  3HUS C;  2Q6Q A;  2WSE H;  4A3F I;  3RZD I;  2BCC J;  4HGZ A;  5D1O B;  3NDJ A;  1G2C B;  2IFM A;  3H1I D;  5GTH E;  3RK2 C;  1KIL A;  5GTI E;  1M90 1;  4C7R A;  2B87 B;  5H2F E;  1WII A;  2R5D A;  1X9V A;  3RL0 B;  2KLV A;  5APY A;  1UIX A;  1GL2 D;  4OVN F;  2D2C C;  1YIJ 1;  3F3P C;  5DJT B;  1RF1 C;  1Q81 2;  3NTN A;  3L75 G;  3L75 J;  1NTM G;  5APQ A;  1SQQ E;  2IZ4 A;  1X0T A;  1KD1 Q;  1SQQ J;  1NU1 K;  2JKV A;  3VMH A;  3OAK A;  1K8A Q;  4A93 I;  2K3R A;  3KQG A;  2OTL P;  2F4M A;  2M3E A;  3RK3 C;  1BSH A;  1RF0 C;  1L0L G;  2W27 A;  3ZDM A;  5A2Q f;  1RE3 A;  1KQS O;  1LTA C;  1L0N E;  1N7S D;  2E75 B;  1QVG Y;  1RHZ B;  4NPF X;  3VTN A;  4YXD C;  1P9N A;  3VTP C;  2ZYD A;  1HGZ A;  2ZXE B;  2JIM A;  1NTM D;  2M0B A; 
#chains in the Genus database with same CATH homology
 1S7M A;  4A3I I;  1RO2 A;  2M6N A;  2QEX Z;  1EDK A;  3EED A;  3I55 1;  1JJ2 Y;  4TNU A;  1SFO I;  3CC4 1;  2B63 I;  2OTL Z;  3CCR 1;  4GOD A;  1TWA I;  1NUI A;  3Q87 A;  3S2H I;  3J80 f;  2V8J A;  4RVF A;  2JR6 A;  3CCQ Z;  3LUS A;  3S17 I;  3HOV I;  3S1K A;  5T64 A;  3S1R I;  1VQ4 Z;  3OW2 Y;  2JA5 I;  2HF1 A;  3CCM 1;  3VMG A;  1TWC I;  2RKL A;  1S72 Z;  3HOU I;  2LXB A;  1K83 I;  4RVD A;  4MRI A;  1RNI A;  2VUM I;  2QVA A;  1Q86 1;  3VMI A;  3NH4 A;  1Z02 A;  1VQN 1;  1W2B Z;  1VQM Z;  2JA6 I;  1VQM 1;  1KQS Y;  1WW9 A;  1DEE G;  4RS4 A;  4A3J I;  1X3W A;  4NOZ A;  2KS1 B;  3HOZ I;  5IP7 I;  4NPE A;  2NVY I;  3OW2 Z;  1S72 1;  3CPW Y;  4QTU A;  3F3F C;  3S1N I;  1LP1 B;  4WWI A;  1I6H I;  3QWO C;  3FKI I;  4K3A A;  3NFZ A;  1KD1 2;  1N2F A;  4ASV A;  3BG0 B;  2E2I I;  1VQK 1;  3S16 I;  1QVF Z;  3EER A;  3G71 Z;  3IX0 A;  1Y47 A;  1NJI 1;  2P58 A;  1ZH1 A;  4A3G I;  1KC8 1;  4MH4 A;  2KUB A;  2K5R A;  1VQ4 1;  5T6B A;  1JMB A;  2OTK E;  1VQ6 Z;  5FLM I;  2JA7 I;  4MN4 C;  2QRC B;  3J80 b;  3PO3 S;  3NDI A;  1Q82 1;  2R7Z I;  2OTL 1;  1YHQ Z;  1VQL 1;  1EDJ A;  1LP1 A;  1VQK Z;  1YHQ 1;  3FQM A;  2R44 A;  1VQL Z;  1M1K 2;  1H0T B;  1U7J A;  3CXC Y;  2LFU A;  3FQQ A;  1I50 I;  2KI7 B;  4DQY B;  4MD8 A;  3I55 Z;  2R93 I;  2B89 A;  3CCR Z;  3CD6 Z;  2RT9 A;  1YIT Z;  4HJG H;  1Z01 A;  5K5G B;  2WMM A;  4BY1 I;  4DK1 A;  2QLV B;  1N8R 1;  2Q4Z A;  1BDD A;  3CCQ 1;  1K9M 1;  3CMA Z;  2LR2 A;  3GTQ I;  3VB9 A;  4CPG A;  2KZJ A;  4BBR I;  3PH0 A;  5C4X I;  3CCJ Z;  3TE5 B;  3GTG I;  2KIK A;  4RVG A;  4E30 A;  1JWH C;  2VUG A;  3PO3 I;  4A3L I;  2GU2 A;  3FXE A;  2GTH A;  4NBC A;  1ZW0 A;  2PMZ A;  4HGY A;  2JUB A;  2QKD A;  2WB1 A;  3MON A;  1VQN Z;  1VQP Z;  2J6A A;  1VQP 1;  2QRE B;  5AN9 F;  4NPD A;  2E2J I;  3CCE Z;  1KD1 1;  3S2D I;  2RPR A;  1QVG Z;  2RIQ A;  2OZK A;  3CCE 1;  1VQO Z;  5C44 I;  2EGT A;  2Q1K A;  1VQ5 Z;  2JMO A;  2AKL A;  2E9H A;  1VQ5 1;  1FC2 C;  3MZK B;  3CC2 Z;  2RHB A;  5CBN A;  2NVQ I;  1OVR A;  1YUA A;  1KC8 2;  3RZO I;  2KPI A;  1X3Z A;  2P3Y A;  1SS1 A;  1M1K 1;  3KIF A;  2B87 A;  1TWH I;  2QA4 Z;  4A3M I;  4ZNC A;  1VQO 1;  2LIY A;  4QTT A;  1YI2 1;  4HB1 A;  1RLY A;  3CCJ 1;  3M3Y I;  5CM2 M;  3U50 C;  4NBE A;  4S1T A;  2OTJ Z;  3TDH B;  3CC2 1;  2VF1 A;  2QRX A;  1USP A;  2DE7 A;  1K9M 2;  1BDC A;  1N8R 2;  5C39 A;  2RBL A;  2JS4 A;  1ML8 A;  1YUK A;  3GKQ A;  4DGL A;  3RGU A;  4NFR A;  1ZB8 A;  3CPW Z;  3CCV Z;  4MD7 A;  4ASW A;  3CD6 1;  3P5J B;  4NBA A;  1VQ9 1;  1R9T I;  1QF8 A;  1RO0 A;  2V8K A;  2SPZ A;  2W03 A;  1Z03 A;  2NVX I;  1TWF I;  4E2W A;  1Q86 2;  3GTO I;  3CME Z;  2LXC B;  2Q51 A;  3I56 Z;  1Q82 2;  1VLA A;  3GTM I;  2KZI A;  3I07 A;  3I56 1;  3NH5 A;  2R6M A;  4Y52 I;  4NB8 A;  2OOY B;  3ESW A;  4GOF A;  1PFT A;  1ZB9 A;  2M5A B;  3S1M I;  3IF8 A;  1DL6 A;  3QWU A;  2M5A A;  4HH4 A;  5IT9 f;  2E2H I;  1JJ2 Z;  2ZAE B;  3G71 1;  2JNY A;  1NJI 2;  5FLX f;  1VQ9 Z;  2WAQ A;  3GTJ I;  3H3V J;  2O53 A;  3S1Q I;  1YJ9 1;  4IOI H;  3HKZ A;  4NBD A;  3GTK I;  2W04 A;  3IFU A;  4A3B I;  4A3K I;  2BJO A;  3BG1 B;  1RO4 A;  3J81 f;  3HOW I;  3K7A I;  5IP9 I;  1NVO A;  2M48 A;  3T4N B;  3CCS 1;  4RV9 A;  2UWJ E;  4NBB A;  2QA4 1;  4EWC A;  3HOX I;  2PM9 A;  3GTM S;  2YU9 I;  3CCL 1;  1OVV A;  2HR3 A;  3NH8 A;  1JM0 A;  3G4S 1;  3G6E Z;  2OTJ 1;  5D1P A;  3G4S Z;  3PO2 I;  4A3E I;  5IT9 b;  1EDL A;  4NBG A;  1OVU A;  1H0T A;  1YIT 1;  5DJU B;  3CQZ I;  2P28 A;  1KQS Z;  2PK7 A;  3J81 b;  1YJW Z;  3CMA 1;  5T67 A;  1TFI A;  3CME 1;  1LT1 A;  2I8D A;  3J7A 4;  3D6W A;  4RVH A;  4X6A I;  2QRD B;  1W2B Y;  1YIJ Z;  4A3D I;  4XX2 A;  4BXL A;  2NVT I;  1YI2 Z;  1Y1V I;  4BY7 I;  4JBZ A;  3CXC Z;  3JAM b;  5LL6 f;  1Q7Y 1;  4E2Y A;  2YAD A;  2JWD A;  3CCV 1;  2I3C A;  5A2Q b;  2QEX 1;  1WCM I;  3CC7 1;  1NP6 A;  4E32 A;  2H85 A;  5C4J I;  4GOE A;  1LQL A;  4A3C I;  4MON A;  3I4M I;  1VQ8 Z;  3H0G I;  1ZXG A;  1M90 2;  3CC7 Z;  3CCU Z;  3S15 I;  4NH1 C;  5FLX b;  1YJN 1;  1YJ9 Z;  5EFW B;  3MZW B;  1YJN Z;  1EDI A;  4NB9 A;  4E2X A;  1RQF A;  3CCS Z;  1KRL A;  3MZL B;  4CL1 A;  2GTI A;  3CCU 1;  1QYP A;  1K73 1;  3CCL Z;  2B88 A;  1Q81 1;  1Q2N A;  1K73 2;  4A3F I;  2DE5 A;  3RZD I;  4E31 A;  1EC5 A;  1L1O C;  4HGZ A;  5D1O B;  3NDJ A;  5C3E I;  4HKZ H;  4MXU A;  2R92 I;  4KJM A;  2V8I A;  2O4H A;  1VQ7 1;  5CBO A;  1M90 1;  2B87 B;  2JA8 I;  3S14 I;  1WII A;  1K8A 2;  4NBH A;  2DE6 A;  1YIJ 1;  2Y0S A;  3F3P C;  1QVF Y;  5DJT B;  4AYB A;  1YJW 1;  4NBF A;  1Q81 2;  3GCF A;  1TWG I;  1VQ7 Z;  3GTP I;  4K35 A;  3HOY I;  1Q7Y 2;  1USP B;  3CCM Z;  3GTL I;  4EYY Q;  1Y1W I;  2IZ4 A;  1X0T A;  1S3J A;  3I4N I;  4BXX I;  1K8A 1;  1I3Q I;  4E2Z A;  4ZMD A;  3G6E 1;  1U7M A;  3VMH A;  4A93 I;  2QR1 B;  1VQ8 1;  3M4O I;  2K3R A;  2F4M A;  5D1O A;  1Y1V S;  3CC4 Z;  3FXD A;  2F4O A;  3MHV A;  3ZDM A;  5A2Q f;  4E33 A;  3D9X A;  1MFT A;  3JAM f;  1QVG Y;  4Y7N I;  3KIH A;  4NPF X;  2HU9 A;  4BBS I;  2OOX B;  1VQ6 1;  3VTN A;  1P9N A;  2G2K A;  4MD9 A;  2IZ3 A;  2M0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...