2K3RA

Pfu rpp21 structure and assignments
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
KERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCKKCHAFLVPGINARVRLRQKRMPHIVVKCLECGHIMRYPYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 4
publication title Solution structure of Pyrococcus furiosus RPP21, a component of the archaeal RNase P holoenzyme, and interactions with its RPP29 protein partner.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 20
structure length 91
sequence length 91
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2008-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2k3rA01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2k3rA02
2UWJE 2B89A 2M5AA 4NPEA 5C39A 4ASWA 1X0TA 1EDIA 3ZDMA 4ZNCA 2Q1KA 2B87B 1LT1A 2JWDA 1EDKA 1SS1A 5DJUB 1EDJA 2KIKA 1H0TB 2SPZA 5CBNA 4JBZA 4BXLA 1S3JA 1OVVA 4NPDA 5K5GB 4GODA 1Y47A 2M5AB 4HB1A 4K3AA 2KI7B 1BDCA 4ASVA 4HJGH 5DJTB 3QWOC 3S1KA 2LR2A 1U7MA 5EFWB 1NVOA 2KUBA 2I8DA 1JMBA 2KZIA 4IOIH 2QVAA 2R44A 1LP1B 1OVRA 4HKZH 5CBOA 2P58A 2QRXA 2B87A 1DEEG 4GOFA 2RKLA 3FXEA 2ZAEB 1OVUA 3RGUA 1MFTA 2KS1B 4MN4C 3PH0A 2KZJA 1ZXGA 2LXBA 2M0BA 4WWIA 4K35A 1ZW0A 2K3RA 4ZMDA 1EDLA 1U7JA 2LXCB 4GOEA 1EC5A 4NPFX 1Q2NA 3MHVA 3MZWB 1FC2C 4EYYQ 2HR3A 3FXDA 4KJMA 1JM0A 1H0TA 2B88A 4CPGA 1BDDA 2OTKE 2WMMA 1LP1A
chains in the Genus database with same CATH superfamily
2IPPA 2Y0EA 3S2HI 3GF3A 4E32A 2Q51A 5KLVJ 2A45G 3EWKA 4YXWH 1HJ0A 1S721 1YTZI 2FYUK 4C46A 1VQNP 2JWDA 2KS1A 3L73G 1Y8CA 3CCM1 4D6TD 1TFIA 1WRGA 2JS4A 3VP8A 2IZ0A 2XV5A 3O6QB 4I6MC 2V8JA 1NJI1 2FBWC 1FOSF 1FZFA 3I56P 3FKII 3I07A 1SQPG 1JY2O 3GTMI 2RT9A 1FZCC 3D6YA 1QVGY 2JA6I 3M3YI 3L73E 1LT9B 2XZRA 1NGMB 4NBHA 3IAOA 4A7PA 1GK4A 1VQKZ 2F4OA 1GDTA 1P9NA 1Q821 4Y28J 3KXDA 1JMBA 1EZVD 2HYNA 3M9HA 1SQPE 1LTGC 1KD11 3K5BA 3CCV1 1K9MQ 3HOYI 1P84D 1W2EA 3CCQ1 2K5RA 1PIXA 5KLVG 3H1JG 3PTZA 2QRXA 2OYIC 3TK1A 1KQGB 2FYUJ 2LKMA 1BSNA 1SQXK 4RKUJ 1NO4A 2OQQA 1NTZD 3A0HE 2FFDC 5E79E 3CMEP 3HUSB 3U59A 3H1JE 3EEDA 2AEJA 1KB9I 4K35A 2B9BA 5AW3B 1RQFA 1VF5D 1Q861 2NPSB 3JAMb 4RVGA 3CX5E 4KT0J 1HF9A 5AW5B 5CCHA 2N9BA 1RLYA 2M8RA 1XTGB 3JCUH 4LGDE 4IL6X 3AE8C 3IFUA 2UWJE 4H0LC 5IT9f 1BCCD 2NVXI 3S15I 3GLMA 1L0LD 1SQXJ 1SIWA 3CXHD 3CCS1 1TWFI 1QVGZ 2HODA 2E42A 3H1IG 3LUSA 2GA1A 1NTKD 2RBLA 2PM9A 2R6MA 3NDIA 5AN9F 1JY2P 3B71A 2M48A 1Y9BA 1VQ51 3S1MI 2IX7C 3T4NB 1PPJG 2I1JA 4NBEA 1OZHA 3V2RA 1KYOE 1LQLA 4EOTA 1URQB 2VPXA 4A3CI 3PRJA 1OIPA 3H1IE 3W67A 3V2PA 1LWUA 3U1AA 1NP6A 2ZVNB 3H1LJ 2JP3A 3CWBD 1RQUA 3L74D 4PV1C 1KILC 4IFDK 2JR8A 1DD3A 1PPJE 1G2CB 1ZP0C 4X6AI 3IN6A 4H13B 1LNQA 2BEZF 3L71G 3GCFA 4S1TA 5C44I 3PHLA 2O01J 1KV4A 1IO4A 2QJYB 5T67A 3CCE1 4RJTA 3D6ZA 2N1TA 4KHXA 4JF7A 1EDLA 3O8ZA 3CCVZ 2NPSD 3L71E 5AW1B 2WAQA 5AW9B 3CCQZ 1TWHI 1Q7Y2 2A06D 5B66E 2Y0DA 1USEA 1KB9D 2E76B 2B88A 3RK2C 3NH4A 4E2YA 3IFMA 4EWCA 5KLIB 3MUDC 2WMMA 1L4AD 3TSIA 5H2FH 2O1JA 1J1EC 1UIIA 3AE2C 1NU1D 1YTZT 5C39A 1VQM1 1PFIA 4U3FE 1L0NK 3RZOI 2FXOA 1Y8AA 2WSCJ 4N78D 2Q1KA 5KAIH 3C8VA 2O01N 3V5BA 1DX7A 3R2PA 1YJN1 2KP8A 5AVUB 5AW8B 3L72J 3L37A 4N6JA 3H25A 3HD7A 1S72P 3HE5B 2DE7A 4L75A 1VQO1 2OYOA 1YIJZ 4TT3H 3F5HA 3CL3D 3S1KA 2BCCD 3I551 2LR2A 3GTQI 3EFFK 4W7YA 3HTKB 1URQD 3AECC 1FZCA 1SQQK 4LC1A 2KZIA 1GU4A 2JKVA 3CC71 2J59M 4A3FI 2E5TA 1YJW1 1SVFA 3C9IA 3CD61 2YADA 2QM7A 1GL2B 3QH9A 1T6AA 1Q81Q 1L0NJ 5LL6f 3SWYA 3CCVP 2IBZD 3HKZA 3TGUD 4B86A 3CCQP 4H44C 2F4MA 4AYBA 2WSFJ 1VQ61 3CMA1 2LXBA 2C9LY 2H7HA 4OGQB 4PJ0H 3B5NB 2FFDA 5TISH 1RF0A 1SQVG 2O01H 4GOEA 1FE6A 3VP9A 5CCGD 2J58A 3D6WA 4MRIA 4HYTB 1SQQJ 2PAJA 2E76D 1EXIA 2KNCB 3GTLI 3BCCD 1S4XA 3BRVB 1SQVE 2QA41 2IFNA 1YUAA 1ZMEC 3IX0A 2PK7A 5APYA 2Q4ZA 1EDKA 2WT7B 1VQ8Z 3OW2Y 1YJ91 1JWHC 3VMYA 3BASA 4A3KI 3H6PA 2C0WA 1M57D 1BGYD 2WSCH 4E2XA 1GTWA 3TDKA 2I3CA 1SFOI 1M90Q 1KB9H 1MUUA 4JYBA 2POHA 3GG2A 5EFWB 3ESWA 1SP4A 1SQQG 1VQ5P 3P8CD 5APQA 1M1JB 3AEGC 1SQBD 2HG5D 2P67A 1YJNZ 5KJ7D 1TWAI 1LTIC 1S5LH 4MD7A 4YXDC 1VQ91 1VQL1 2G8YA 3N4XA 2C9NY 1QVFY 1PP9J 1SFCC 2ZAEB 1IFDA 3H32A 4WBAA 1MZ9A 1E5WA 3FX0A 4WY4B 3I55Z 1SLQA 1X22A 3H1HD 1T2KD 1ZXGA 2ZYAA 2MKVA 2I1KA 2HLOA 1KC82 3H1KG 1YBKA 5L8RJ 4OGQD 3CC7Z 1JCCA 3OW2O 1BE3J 4PD4I 3CCEP 3CD6Z 1CI6A 3CI9A 2R32A 1S5LX 5B5EE 2OTL1 1RE4A 2ZYDA 2E75B 1KQLA 2HPCB 5APXA 2QEXZ 3H1KE 2PFXA 3CCJZ 2WVRA 1KQSY 3GTOI 3RK3B 4NBFA 3OW2Z 3CMAZ 2M5AA 4NPEA 4RO0A 3VMAA 1NUIA 3D71A 3M4OI 3V2NA 2JO1A 1VQMP 1VF5C 1VQ41 3PO3I 2QLVB 1QVFO 2KK7A 1VQP1 4A3LI 2GUSA 4NPDA 1GU5A 1YJNP 2GTHA 1NTMD 3MONA 1VQOP 1CSBA 1YI2Z 3GKQA 5GTHH 2JEEA 1U7MA 3IF8A 3SFEC 2HFED 4AYCA 1QVFZ 1L2PA 3I55P 3KPEA 2WB1A 5AVRB 3L75E 4W80A 1EZVI 1K732 2RN0A 3HOZI 1JY3P 2P1JA 3CC7P 1FOSE 4L74A 1YJWP 1R5LA 4JYCA 1T3UA 3CD6P 1VQNZ 2Q6QA 4E2ZA 2H89C 1P84I 1KQSO 2FY8A 2Q9IA 2DE5A 5A2Qf 2FXMA 1KORA 3II6A 1YIT1 3CCJP 2QIWA 3ITKA 4XA4A 1VQ6P 3CMAP 3D2LA 2R92I 5KTBA 3HOXI 2JMOA 3NMDA 1W5CE 2ZFCA 2V8KA 1OXZA 3L73D 2M3BA 1JTHA 1JM0A 1H0TA 1CZQA 4DQYB 1A02J 4CPGA 3JAMf 3KHUA 1G1JA 3RL0g 5KAFH 1KC81 1SQPD 3G4SZ 3CQZI 4GDOA 3D9XA 3RL0B 3VMHA 2QJKB 2KSEA 4NBGA 3HUSC 4ZNCA 1M1KQ 3T97A 1AA6A 2QRDB 3Q5SA 1YI2P 3LW5J 2YMYA 2OARA 2NPSC 2OGUA 4A3BI 2W6AA 1OVVA 3CXHI 3WMM0 1K05A 2BASA 3J81b 2YU9I 3H1JD 4MONA 1N7SA 1L4AC 2O4HA 3TE5B 4NBCA 3CX5D 4NBAA 2HF1A 2E5YA 2HODB 3BATA 3NXSA 2P7JA 2XKMA 3VN0A 2M6NA 1SFCD 3AE6C 2P3YA 4E2WA 4HKZH 1WIIA 3K7AI 2KLUA 2E7ZA 2NZ2A 2CPBA 1VQ9P 1VQLP 2AXTE 4E33A 1QF8A 4D6TJ 5GTIH 1NTZK 1LWUB 2V7QJ 3TNUB 3RK3E 4DOJA 2QG4A 1QGKB 1URQC 3JCUE 5T6BA 1IFPA 5A2Qb 4Y7NI 3G4SP 4DGLA 1K731 1AJYA 2JUBA 4BRYA 3FWLA 1Q2NA 2OYHC 3P32A 3CCU1 1RO4A 4IL6H 1I50I 1KYOD 1GW4A 2RHBA 4H13C 3H1ID 1FZGA 2E74B 2GM4A 2VUGA 2W27A 3HOWI 5KLVE 1AVOA 2N1TB 1KZUB 2QJYC 1EQ7A 1PPJD 3S1NI 1FDIA 2QREB 1ML8A 1L0LK 2J6AA 2LEXA 4MD9A 4UB6H 1NTZJ 2QR1B 5CBNA 1HH0A 5M1BA 4JBZA 5CCGC 2QRCB 1VQ4P 2P2UA 4NB8A 1NTKK 1GD2E 3LW5H 2E76C 2LFUA 1ZOYC 1RY3A 5KKZB 4ASVA 1VQPP 5KLIC 1AQ5A 1IFIA 3QWOC 1Y1VI 1LGHB 4BBRI 2FYUG 5CHXA 4ZKUA 1PZQA 1YQ3C 3L71D 1VPCA 1VLAA 2BEQD 4PD4H 2JIMA 2PGDA 4Z1MH 3HD7B 3EERA 3I4MI 5CJ4A 2BJOA 1LP1B 3CC2Z 5AVWB 2WTYA 2FYUE 1BCCJ 1R8EA 1DEEG 1RNIA 1QL2A 1MKMA 3MGNA 3FXEA 1L0LJ 4U3FD 3S1RI 3EQ2A 4A3JI 3AEEC 3A0HH 5CM2M 1NTZG 3RGUA 3WU2E 4MN4C 3PJSK 2GU2A 1S72Z 2IBZI 2Y9YA 4WB4A 2H8PD 3B4SA 1NTKJ 2R3SA 3CCMZ 3MTUE 1RF1A 4XX2A 1NKZB 5H2FE 1ZW0A 3A0BH 4I1LA 1YITP 1S7MA 1SQXG 5KJ7C 2V7QH 3CPWY 5KAIE 3FXDA 4QTUA 4W7ZA 1HTLC 1M7LA 3V2QA 2WPVB 2H43A 3CWBJ 2JDIH 3L74J 1BCCG 3KQGA 1T2KC 2N1TD 3AE4C 1SQXE 1NAYA 2B87B 3GTMS 2JR6A 2ZT9B 1SS1A 3JC22 4OGQC 3B5NC 1XTCC 1P84H 3M0DA 3CCUZ 1HGZA 3H1LG 1NTKG 2Q3EA 2FYNB 2VPWA 3CC2P 2NPSA 3SWFA 3L70D 3GF7A 2O53A 1BDCA 2IZ4A 1KMIZ 4R4LA 2HU9A 4XE5B 1NVOA 3OJAB 3H1LE 3Q87A 1TWGI 1L4AA 3L74G 3E1IA 3EFGA 1I3QI 3CCMP 3CPWO 1KFMA 1IFJA 2YO2A 2M3EA 1SQVD 2KYVA 2P58A 4Y99C 4PJ0E 4GOFA 5TISE 3S17I 1S1CX 2K9YA 2E9HA 3CLQA 5CJ0A 3A2AA 3SWKA 3L74E 2W90A 2G2KA 4IFMA 3CCSZ 3CPWZ 4QTTA 2OTJ1 2YKPA 1QL1A 2P10A 5IP7I 3CCR1 2E2JI 3CXHH 1M1JC 2C0XA 4NPFX 4H13D 2BCCJ 2YKQA 1Q812 4PV1B 3G6E1 3IR7A 1VQ5Z 4KJMA 3CCL1 3L72G 2WWWA 2ZVOB 3CCUP 3V4QA 2OYIA 2OTKE 2OYHA 2O3JA 5AVYB 4NB9A 1N8RQ 4NBBA 3GTJI 1X0TA 1W2BY 1WCMI 3P8MC 1J1DB 3PO2I 3L72E 3TGUJ 4BY7I 3M91A 5DJUB 2RH0A 1T3JA 2QSIA 1JOCA 3H3VJ 2W04A 2QJPB 4BXLA 1X9VA 4NOZA 4U7JA 5K5GB 1FJKA 2E75C 2M5AB 3NH5A 5AVXB 1S5LE 1L0NG 3RK2B 2W8ZA 3CCEZ 3A5TA 2J5UA 3RK3C 1Q7Y1 1VQ71 4YTPC 1J1EB 3IF4A 1LTJC 2IDBA 2L91A 1IC2A 2W6BA 4IOIH 3CCSP 5APTA 1SQBK 2D2CB 1L0NE 2YKOA 3H1KD 1BSHA 4HGZA 2IBZG 5BVZA 2RKLA 1VQMZ 1M902 1N73C 4O9BA 2VPZA 4EIJA 3NDJA 1W2BO 2YXQB 3OAKA 2XDJA 1BGYJ 1K8AQ 2Z5HA 1GL2D 3A7OA 4TNUA 1VQOZ 1EC5A 1SQQE 3FWNA 3HOUI 5APVA 1KILA 4M3LA 2QKDA 1W2BZ 2EGTA 3I561 1R9TI 4UB8H 4A3DI 2A45I 3G9RA 1IFMA 3CXCY 1SQBJ 4H44B 3BRTB 3L75D 1KQFB 2GUVA 1DIPA 2V8IA 3B5ND 3ZDMA 1YJWZ 1QLED 3CCRZ 1Q811 5GTHE 1JCDA 4RVDA 1N86A 1OW6A 1JTHB 1H0TB 5TJHA 3H1HJ 5FLXf 1ZN5A 2IFMA 3AE7C 2WPRA 1VQ6Z 1NTMK 1H88A 4HGYA 2RMZA 4HJGH 1PGOA 1FAVA 1PP9G 3MUDA 2LIYA 4GIFA 1USPA 3GHGC 3LIEA 2W83C 3VTNA 3S1QI 3J81f 2QJKC 4HH4A 2KNCA 3AE3C 2AKLA 1ZRTE 2R44A 4C7RA 3CX5I 4BWNA 2D2CD 5AVTB 1PP9E 1BE3G 3MZKB 1YQ4C 3F3FC 2N9YB 1KILE 3BG0B 2QA4Z 2IV2X 1N7SB 3R4YA 4BY1I 3MD0A 2JIPA 1NJIQ 1HBWA 1ZR4A 2R93I 1K83I 2KS1B 3H1HG 1QYPA 1VQ7Z 1QX8A 1FDMA 1BE3E 1NTMJ 1FBMA 1YJ9Z 2OOXB 1VQK1 5KAFE 4RS4A 3CXCZ 4QMAA 1Q82Q 1JEKA 3CCRP 5APWA 1M901 1IK7A 3UIAA 1KD1Q 5T64A 1M1JA 3P7KA 4WY4D 2O1KA 3M9BA 1AA0A 3G6EP 1LT9C 4Y52I 2FKWB 2V3VA 1KYOI 2R5BA 2QE7H 1SQPK 1LWUC 4AUWA 3P5JB 4BRYB 1KQSZ 3H0GI 1R5SA 1VQ9Z 1OMIA 3AEDC 1VQLZ 1YUKA 2E75D 1J2JB 2V4HA 1Q86Q 4RVHA 3RK3D 1Y47A 3Q1MA 3L36A 3E1RA 3L4FA 5FLXb 2E74C 4E31A 2Y0SA 2QA4P 1ZR2A 5AVSB 2N1TC 2K9JA 3L73J 1M1K2 2AEFA 4I7ZB 1FJPA 1Z03A 5BU8B 5GTIE 1WMKA 1VQ7P 2OTLZ 3QWUA 1FU1A 3N7NA 1LTJA 2Z4EA 1YJ9P 1SQPJ 1PGQA 5KLVD 5CBOA 1KN7A 3AE5C 1LTBC 2RPRA 2DE6A 3TF5A 1N7SD 1E79H 5AW7B 3HE4A 3NTNA 1S9KE 3S14I 5KKZC 4IL6E 1D7MA 1IZNB 1N73A 2M0BA 1VQ4Z 2QM8A 3A3YB 4N3YB 4WVZA 4AQRD 1JJ2Y 2VPYA 3AEAC 1DH3A 2K3RA 1VQPZ 3HD7C 3H1JJ 2NVYI 4MD8A 5CMZA 4HH2A 3WUVA 3Q5RA 4MH4A 4DK1A 3VMZA 3I5CA 2MJZA 3HRNA 4UB6E 4MXUA 1SFCA 1OWAA 3SFDC 1X79B 3PO3S 3D70A 3GTKI 1RF1B 4A93I 1ZB8A 1NOHA 3KYQA 1K9M2 3Q3DA 2FYUD 1UIXA 1Q16A 4C7NA 3KZIH 4GKGA 2KIKA 4PD4E 2SPZA 5D1OA 1RE3C 3G711 2PRRA 2OTLP 3MIWA 2IYOA 4HB1A 1YITZ 1FDOA 2FYZA 3RL0D 1RHZB 1N2DC 5CCHD 1NWQA 4D6TG 3RBZA 3MZLB 1RF0C 2YIUB 4L73A 3H1IJ 2Q5UA 3GHGA 2A45H 2ZT9C 1NHLA 1PV3A 2KOGA 3ABVC 1GZLA 4BBSI 2G3AA 3A0BE 2NVQI 1SQXD 2AXTH 1JJ2Z 2FYNC 4D6TE 1JO5A 1OVUA 2W6JH 1M1K1 1YIJ1 1MFTA 2WQYC 1QVGO 3S2DI 1EZVG 1L4AB 2Q7CA 2AEMA 1DD4A 2OOYB 1I6HI 1KRLA 3W68A 1A02F 2IYPA 4NBDA 2CPSA 2K1AA 2RIQA 1VQKP 3L71J 4EDFA 1EZVE 1FC2C 2HR3A 3GMAA 5C4XI 1L1OC 5E79H 1FZCB 3O6QA 1WW9A 4I2LC 3H1LD 1P84E 2AXCA 1U57A 1ZV8A 4ASWA 4E30A 3CX5H 1N2FA 2E43A 2KSJA 1LT9A 2JIQA 4JQ0D 3LIDA 1X3ZA 3IR9A 2B63I 1NTZE 2WPQA 4U3FJ 1N7LA 2H88C 3PP5A 3S4RA 2FXPA 1GL2C 1HWTC 5D1PA 3Q5PA 1VDFA 3TNUA 2JJLA 1HJBA 1S3JA 2OYIB 2OYHB 2E74D 1JY2N 2WSEJ 1K04A 3F89A 5BU5A 2E2HI 1NU1K 5DJTB 3FQQA 4IFFA 1HGVA 4DZOA 1K9M1 2FFDB 3NFZA 2JIRA 1L0LG 2JA8I 3RBXA 1X3WA 2IZ3A 2YNYA 3TYYA 4L76A 1J1DC 2Y0CA 1HUCA 5C4JI 3HUSA 1BCCE 1AFOA 4NFRA 1RO2A 1OVRA 1RE4C 3G71Z 1Q7YQ 1WJ2A 1L0LE 2K37A 1VQ81 2QJPC 1KYOH 3CXHE 4ZKPA 1SQVK 4U3FG 3J7A4 3AEBC 3WU2H 1DEBA 1GMJA 4H0LB 3L72D 1NTKE 2ZJSE 3HD7D 1H89A 3CWBG 1IJDB 1AV1A 1NU1J 3L70J 3VTPC 2P28A 3MHVA 1TWCI 3CC41 2D2CC 5IT9b 3M0AA 2PP6A 2WPSA 3CWBE 5AVVB 2ZXEB 4YPCA 2NVTI 1LP1A 4A3MI 3S9OA 1GK6A 1NAFA 2VRSA 2WSSH 1L0ND 4TLFA 1OX3A 1VL2A 2L5GB 1SQVJ 5B66H 4LLHA 1URQA 2A06G 3M06A 1KILB 4A3II 3H32B 1Y1VS 4RVFA 3GTGI 1OW8A 2ZXXA 1KFNA 3OA7A 2VUMI 5APSA 2OZKA 1FZBA 4GODA 1NU1G 3L70G 4WY4C 1G2CA 3G71P 1RE3A 2NRGA 3SSUA 1Z02A 2A06E 2ITAA 1ZLLA 1N8R2 3I4NI 3V6IA 3B8EB 2QEX1 1KB9E 1CI6B 3CCJ1 2K88A 3NFQA 1SQQD 3VMGA 1LTTC 2KB7P 2ZT9D 3VMXA 2WSEH 1MV8A 1NU1E 3L70E 2CK3H 1S2EA 2YXRB 1FS0E 4N78E 4JPZB 2B87A 5CCGA 2BCCG 2JA5I 2KLVA 1USPB 4GT1A 4H0LD 1QEXA 2DW3A 3PH0A 4UB8E 3J80f 4OWFA 3FGAD 1YIJP 1YI21 1M8OB 3BCCJ 2BCCE 1FZAA 3VOPA 2WITA 1U7JA 3KDPB 1YHQ1 3TGUG 1H8AA 1Z56A 3HOVI 4Y99B 3HE5A 1CW5A 1KTMA 1N7SC 2V45A 1USDA 2Z5IA 3WUUA 3H1KJ 4RV9A 1ZRTD 1VQN1 2IBZE 3TGUE 1IK9A 1PFTA 1K8A2 4EI2A 1EDIA 1PP9D 1JMMA 1AQTA 3HTKA 1M56D 4PV1D 1KILD 1IFNA 2PMZA 3CC4Z 3PLNA 5KJ7A 3AE9C 3BCCG 3WUTA 4CL1A 1GL2A 4K3AA 1BE3D 2OTJZ 1JY3O 1DL6A 3MP7B 2VF1A 2GTIA 2ZYGA 4NH1C 2I8DA 3BCCE 2KPIA 1KC8Q 3G4S1 3G6EZ 1RO0A 2QVAA 2JA7I 3CCLZ 1BGYG 1Z01A 3RZDI 3S16I 3C1LA 3B5NA 3VB9A 3L75J 2WSFH 3RK2D 1N8R1 4BXXI 2NAPA 3T97B 3CME1 2Y9ZA 1VQ8P 5AW6B 2K9JB 2YMKA 1BGYE 3RL0C 3KIFA 1RQVA 1SQBG 3Q2YA 4A3GI 5CCHC 2XNDH 4I7ZC 1LTJB 2R5DA 1LTSC 2AYDA 3U50C 1QXFA 3J80b 2E2II 1OW7A 3P8CE 2WT7A 1RH5B 3HE4B 1JUNA 3JSVC 1EXJA 1SQBE 3CC4P 3GTPI 1NJI2 1Y1WI 3AEFC 1BDDA 3U1CA 2KXPB 1N73B 2H85A 1YYCA 2B89A 3L75G 3VMIA 4OVNF 1PL5A 3NH8A 1NYHA 2XU6A 1NH4A 2OTJP 5B5EH 1NKNA 2R3CA 1LT1A 3BVHA 3H1HE 1Q822 1GW3A 2Q3IA 1EDJA 1YHQZ 3BG1B 2JNYA 1S9KD 4DCKA 5AVQB 1KD12 1SFCB 1K73Q 3CCLP 4R4MA 4H44D 4RESB 1G1IA 4A3EI 2KI7B 2WZ7A 1WZNA 5AW4B 1K8A1 1PGJA 1FZEA 3M9QA 4C7NB 1RF1C 2JWAA 5AW0B 4WY4A 1HVVA 3FQMA 2JIOA 2KUBA 1X8YA 5D1OB 3E7KA 2QEXP 1OFCX 1Q90D 3I56Z 1NTMG 1Q862 3AE1C 5AVZB 1JY3N 5KLVK 1WT6A 5FLMI 1PGPA 1MFZA 4DJGA 2W03A 1JB0J 3KIHA 5C3EI 2HPCA 3USSA 1JNMA 2IZ1A 5APUA 1TU3F 1NTME 2KZJA 2XNXA 5IP9I 3TDHB 4PD4D 3GHGB 1LTAC 4WWIA 3GW6A 3VYIA 1VF5B 1AVYA 4ZMDA 3V4WA 2LXCB 3M0DC 2YIUC 5AW2B 4XFJA 3MZWB 1ZH1A 4OH8B 2YO3A 4EYYQ 1LJ2A 3KZIE 1YHQP 3CC21 1ZB9A 3F3PC 3CMEZ 1T8ZA 3G3ZA 3L35A 2R7ZI 4DT0A
chains in the Genus database with same CATH topology
4NBFA 3OW2Z 3CMAZ 2M5AA 4NPEA 4NB9A 3S2HI 4ASWA 4E30A 1NUIA 4E32A 4NBBA 1N2FA 1X0TA 3GTJI 1W2BY 1WCMI 2Q51A 3M4OI 3PO2I 1X3ZA 1S721 2B63I 4BY7I 2JWDA 5DJUB 1VQ41 3CCM1 5D1PA 3PO3I 2QLVB 1TFIA 3H3VJ 2JS4A 2V8JA 2W04A 1NJI1 4BXLA 4NOZA 1S3JA 1VQP1 4A3LI 4NPDA 2GTHA 3MONA 5K5GB 3FKII 3I07A 2M5AB 3NH5A 3GTMI 2RT9A 2E2HI 5DJTB 3FQQA 1QVGY 2JA6I 3M3YI 1K9M1 3CCEZ 1YI2Z 3GKQA 4NBHA 3NFZA 2JA8I 1U7MA 1X3WA 3IF8A 1Q7Y1 1VQKZ 2F4OA 2IZ3A 1VQ71 1P9NA 1Q821 1QVFZ 1JMBA 2WB1A 5C4JI 4IOIH 1KD11 3CCV1 4NFRA 1RO2A 3HOYI 1OVRA 3G71Z 2K5RA 3CCQ1 1K732 3HOZI 1VQ81 2QRXA 4HGZA 3J7A4 2RKLA 1VQMZ 1VQNZ 1M902 4E2ZA 2DE5A 3NDJA 5A2Qf 1YIT1 3EEDA 4K35A 2R92I 1RQFA 1Q861 2P28A 3HOXI 2JMOA 3JAMb 4RVGA 4TNUA 1VQOZ 1EC5A 3MHVA 1TWCI 3CC41 5IT9b 3HOUI 2V8KA 2QKDA 1W2BZ 1JM0A 1H0TA 2EGTA 3I561 1R9TI 1RLYA 4A3DI 4DQYB 4CPGA 3CXCY 3JAMf 2NVTI 1LP1A 3IFUA 4A3MI 2UWJE 1KC81 5IT9f 3G4SZ 3CQZI 3D9XA 2V8IA 3VMHA 2NVXI 3ZDMA 4NBGA 1YJWZ 3S15I 4ZNCA 2QRDB 3CCRZ 3CCS1 1Q811 4A3II 4RVDA 1TWFI 1QVGZ 1Y1VS 1H0TB 4RVFA 3GTGI 4A3BI 5FLXf 2VUMI 3LUSA 1OVVA 2OZKA 2RBLA 2PM9A 2R6MA 3NDIA 5AN9F 1VQ6Z 4GODA 3J81b 2YU9I 2M48A 4HGYA 1Z02A 1VQ51 4HJGH 3S1MI 4MONA 3T4NB 1N8R2 3I4NI 2LIYA 2O4HA 1USPA 3TE5B 4NBEA 1LQLA 2QEX1 4NBCA 4NBAA 3VTNA 3CCJ1 4A3CI 3VMGA 3S1QI 2HF1A 3J81f 4HH4A 1NP6A 2AKLA 2R44A 2M6NA 2P3YA 4E2WA 4HKZH 3MZKB 4X6AI 1WIIA 2B87A 3K7AI 3F3FC 3BG0B 4BY1I 2QA4Z 2JA5I 1USPB 3GCFA 4S1TA 5C44I 4E33A 2R93I 1K83I 2KS1B 1QF8A 1QYPA 3PH0A 1VQ7Z 3J80f 5T67A 3CCE1 5T6BA 1YI21 1YJ9Z 2OOXB 5A2Qb 4Y7NI 1VQK1 4RS4A 3CXCZ 1EDLA 4DGLA 1U7JA 3CCVZ 1K731 2JUBA 2WAQA 1YHQ1 3CCQZ 1TWHI 1Q7Y2 1Q2NA 3CCU1 1RO4A 1M901 1I50I 5T64A 3HOVI 2RHBA 2B88A 3NH4A 4E2YA 4EWCA 2WMMA 2VUGA 4Y52I 3HOWI 4RV9A 5C39A 1VQM1 1VQN1 1PFTA 1K8A2 1EDIA 3RZOI 3P5JB 2Q1KA 3S1NI 1KQSZ 3H0GI 2QREB 1ML8A 1VQ9Z 2J6AA 1VQLZ 1YUKA 1YJN1 4MD9A 2PMZA 3CC4Z 2QR1B 5CBNA 4JBZA 2DE7A 2QRCB 1VQO1 1YIJZ 4NB8A 4RVHA 1Y47A 4CL1A 2LFUA 4K3AA 5FLXb 4ASVA 2OTJZ 3QWOC 1Y1VI 1DL6A 3S1KA 3I551 2LR2A 4BBRI 4E31A 3GTQI 2Y0SA 1VLAA 2VF1A 2GTIA 1M1K2 4NH1C 2I8DA 2KZIA 2KPIA 1Z03A 3G4S1 3G6EZ 3EERA 1RO0A 3CC71 2QVAA 2OTLZ 3QWUA 3I4MI 4A3FI 2JA7I 3CCLZ 2BJOA 1YJW1 1Z01A 1LP1B 3RZDI 3CC2Z 3S16I 3CD61 2YADA 3VB9A 5LL6f 5CBOA 1DEEG 1RNIA 2RPRA 3HKZA 1N8R1 2DE6A 3FXEA 4BXXI 3S1RI 4A3JI 3CME1 2F4MA 5CM2M 3S14I 3RGUA 4AYBA 4MN4C 1VQ61 2GU2A 3KIFA 1S72Z 3CMA1 2LXBA 2M0BA 1VQ4Z 3CCMZ 4A3GI 4XX2A 1JJ2Y 1ZW0A 2K3RA 3U50C 1VQPZ 3J80b 2NVYI 4MD8A 2E2II 4GOEA 1S7MA 3D6WA 4MRIA 3CPWY 4MH4A 4DK1A 3FXDA 4QTUA 3GTPI 1NJI2 1Y1WI 4MXUA 1BDDA 3GTLI 2H85A 3PO3S 2QA41 2B89A 3GTKI 4A93I 3VMIA 1YUAA 1ZB8A 3IX0A 3NH8A 2PK7A 1K9M2 2B87B 1LT1A 2Q4ZA 3GTMS 2JR6A 1EDKA 1Q822 1SS1A 1EDJA 1VQ8Z 1YHQZ 2KIKA 3BG1B 2JNYA 2SPZA 5D1OA 3OW2Y 1YJ91 3CCUZ 1JWHC 3G711 4A3KI 1KD12 4E2XA 2I3CA 4HB1A 4A3EI 2KI7B 1SFOI 2O53A 1BDCA 1YITZ 1K8A1 2IZ4A 2HU9A 5EFWB 3ESWA 1NVOA 3FQMA 3Q87A 2KUBA 1TWGI 5D1OB 3MZLB 1YJNZ 3I56Z 1TWAI 1I3QI 4MD7A 1Q862 1VQ91 1VQL1 4BBSI 2P58A 1QVFY 4GOFA 2NVQI 5FLMI 2ZAEB 1JJ2Z 3S17I 2E9HA 2W03A 1OVUA 5C3EI 3KIHA 3I55Z 1MFTA 1YIJ1 1M1K1 3S2DI 2KZJA 2G2KA 1ZXGA 5IP9I 3TDHB 3CCSZ 3CPWZ 4QTTA 2OTJ1 4WWIA 1KC82 2OOYB 5IP7I 3CCR1 2E2JI 3CC7Z 1I6HI 1KRLA 4ZMDA 2LXCB 4NBDA 4NPFX 3CD6Z 2RIQA 3MZWB 1Q812 1ZH1A 3G6E1 1FC2C 4EYYQ 2HR3A 1VQ5Z 4KJMA 2OTL1 3CCL1 5C4XI 3CC21 1L1OC 1WW9A 1ZB9A 3F3PC 2QEXZ 3CMEZ 2OTKE 3CCJZ 2R7ZI 1KQSY 3GTOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWJ E;  2B89 A;  2M5A A;  4NPE A;  5C39 A;  4ASW A;  1X0T A;  1EDI A;  3ZDM A;  4ZNC A;  2Q1K A;  2B87 B;  1LT1 A;  2JWD A;  1EDK A;  1SS1 A;  5DJU B;  1EDJ A;  2KIK A;  1H0T B;  2SPZ A;  5CBN A;  4JBZ A;  4BXL A;  1S3J A;  1OVV A;  4NPD A;  5K5G B;  4GOD A;  1Y47 A;  2M5A B;  4HB1 A;  4K3A A;  2KI7 B;  1BDC A;  4ASV A;  4HJG H;  5DJT B;  3QWO C;  3S1K A;  2LR2 A;  1U7M A;  5EFW B;  1NVO A;  2KUB A;  2I8D A;  1JMB A;  2KZI A;  4IOI H;  2QVA A;  2R44 A;  1LP1 B;  1OVR A;  4HKZ H;  5CBO A;  2P58 A;  2QRX A;  2B87 A;  1DEE G;  4GOF A;  2RKL A;  3FXE A;  2ZAE B;  1OVU A;  3RGU A;  1MFT A;  2KS1 B;  4MN4 C;  3PH0 A;  2KZJ A;  1ZXG A;  2LXB A;  2M0B A;  4WWI A;  4K35 A;  1ZW0 A;  2K3R A;  4ZMD A;  1EDL A;  1U7J A;  2LXC B;  4GOE A;  1EC5 A;  4NPF X;  1Q2N A;  3MHV A;  3MZW B;  1FC2 C;  4EYY Q;  2HR3 A;  3FXD A;  4KJM A;  1JM0 A;  1H0T A;  2B88 A;  4CPG A;  1BDD A;  2OTK E;  2WMM A;  1LP1 A; 
#chains in the Genus database with same CATH topology
 2IPP A;  2Y0E A;  3S2H I;  3GF3 A;  4E32 A;  2Q51 A;  5KLV J;  2A45 G;  3EWK A;  4YXW H;  1HJ0 A;  1S72 1;  1YTZ I;  2FYU K;  4C46 A;  1VQN P;  2JWD A;  2KS1 A;  3L73 G;  1Y8C A;  3CCM 1;  4D6T D;  1TFI A;  1WRG A;  2JS4 A;  3VP8 A;  2IZ0 A;  2XV5 A;  3O6Q B;  4I6M C;  2V8J A;  1NJI 1;  2FBW C;  1FOS F;  1FZF A;  3I56 P;  3FKI I;  3I07 A;  1SQP G;  1JY2 O;  3GTM I;  2RT9 A;  1FZC C;  3D6Y A;  1QVG Y;  2JA6 I;  3M3Y I;  3L73 E;  1LT9 B;  2XZR A;  1NGM B;  4NBH A;  3IAO A;  4A7P A;  1GK4 A;  1VQK Z;  2F4O A;  1GDT A;  1P9N A;  1Q82 1;  4Y28 J;  3KXD A;  1JMB A;  1EZV D;  2HYN A;  3M9H A;  1SQP E;  1LTG C;  1KD1 1;  3K5B A;  3CCV 1;  1K9M Q;  3HOY I;  1P84 D;  1W2E A;  3CCQ 1;  2K5R A;  1PIX A;  5KLV G;  3H1J G;  3PTZ A;  2QRX A;  2OYI C;  3TK1 A;  1KQG B;  2FYU J;  2LKM A;  1BSN A;  1SQX K;  4RKU J;  1NO4 A;  2OQQ A;  1NTZ D;  3A0H E;  2FFD C;  5E79 E;  3CME P;  3HUS B;  3U59 A;  3H1J E;  3EED A;  2AEJ A;  1KB9 I;  4K35 A;  2B9B A;  5AW3 B;  1RQF A;  1VF5 D;  1Q86 1;  2NPS B;  3JAM b;  4RVG A;  3CX5 E;  4KT0 J;  1HF9 A;  5AW5 B;  5CCH A;  2N9B A;  1RLY A;  2M8R A;  1XTG B;  3JCU H;  4LGD E;  4IL6 X;  3AE8 C;  3IFU A;  2UWJ E;  4H0L C;  5IT9 f;  1BCC D;  2NVX I;  3S15 I;  3GLM A;  1L0L D;  1SQX J;  1SIW A;  3CXH D;  3CCS 1;  1TWF I;  1QVG Z;  2HOD A;  2E42 A;  3H1I G;  3LUS A;  2GA1 A;  1NTK D;  2RBL A;  2PM9 A;  2R6M A;  3NDI A;  5AN9 F;  1JY2 P;  3B71 A;  2M48 A;  1Y9B A;  1VQ5 1;  3S1M I;  2IX7 C;  3T4N B;  1PPJ G;  2I1J A;  4NBE A;  1OZH A;  3V2R A;  1KYO E;  1LQL A;  4EOT A;  1URQ B;  2VPX A;  4A3C I;  3PRJ A;  1OIP A;  3H1I E;  3W67 A;  3V2P A;  1LWU A;  3U1A A;  1NP6 A;  2ZVN B;  3H1L J;  2JP3 A;  3CWB D;  1RQU A;  3L74 D;  4PV1 C;  1KIL C;  4IFD K;  2JR8 A;  1DD3 A;  1PPJ E;  1G2C B;  1ZP0 C;  4X6A I;  3IN6 A;  4H13 B;  1LNQ A;  2BEZ F;  3L71 G;  3GCF A;  4S1T A;  5C44 I;  3PHL A;  2O01 J;  1KV4 A;  1IO4 A;  2QJY B;  5T67 A;  3CCE 1;  4RJT A;  3D6Z A;  2N1T A;  4KHX A;  4JF7 A;  1EDL A;  3O8Z A;  3CCV Z;  2NPS D;  3L71 E;  5AW1 B;  2WAQ A;  5AW9 B;  3CCQ Z;  1TWH I;  1Q7Y 2;  2A06 D;  5B66 E;  2Y0D A;  1USE A;  1KB9 D;  2E76 B;  2B88 A;  3RK2 C;  3NH4 A;  4E2Y A;  3IFM A;  4EWC A;  5KLI B;  3MUD C;  2WMM A;  1L4A D;  3TSI A;  5H2F H;  2O1J A;  1J1E C;  1UII A;  3AE2 C;  1NU1 D;  1YTZ T;  5C39 A;  1VQM 1;  1PFI A;  4U3F E;  1L0N K;  3RZO I;  2FXO A;  1Y8A A;  2WSC J;  4N78 D;  2Q1K A;  5KAI H;  3C8V A;  2O01 N;  3V5B A;  1DX7 A;  3R2P A;  1YJN 1;  2KP8 A;  5AVU B;  5AW8 B;  3L72 J;  3L37 A;  4N6J A;  3H25 A;  3HD7 A;  1S72 P;  3HE5 B;  2DE7 A;  4L75 A;  1VQO 1;  2OYO A;  1YIJ Z;  4TT3 H;  3F5H A;  3CL3 D;  3S1K A;  2BCC D;  3I55 1;  2LR2 A;  3GTQ I;  3EFF K;  4W7Y A;  3HTK B;  1URQ D;  3AEC C;  1FZC A;  1SQQ K;  4LC1 A;  2KZI A;  1GU4 A;  2JKV A;  3CC7 1;  2J59 M;  4A3F I;  2E5T A;  1YJW 1;  1SVF A;  3C9I A;  3CD6 1;  2YAD A;  2QM7 A;  1GL2 B;  3QH9 A;  1T6A A;  1Q81 Q;  1L0N J;  5LL6 f;  3SWY A;  3CCV P;  2IBZ D;  3HKZ A;  3TGU D;  4B86 A;  3CCQ P;  4H44 C;  2F4M A;  4AYB A;  2WSF J;  1VQ6 1;  3CMA 1;  2LXB A;  2C9L Y;  2H7H A;  4OGQ B;  4PJ0 H;  3B5N B;  2FFD A;  5TIS H;  1RF0 A;  1SQV G;  2O01 H;  4GOE A;  1FE6 A;  3VP9 A;  5CCG D;  2J58 A;  3D6W A;  4MRI A;  4HYT B;  1SQQ J;  2PAJ A;  2E76 D;  1EXI A;  2KNC B;  3GTL I;  3BCC D;  1S4X A;  3BRV B;  1SQV E;  2QA4 1;  2IFN A;  1YUA A;  1ZME C;  3IX0 A;  2PK7 A;  5APY A;  2Q4Z A;  1EDK A;  2WT7 B;  1VQ8 Z;  3OW2 Y;  1YJ9 1;  1JWH C;  3VMY A;  3BAS A;  4A3K I;  3H6P A;  2C0W A;  1M57 D;  1BGY D;  2WSC H;  4E2X A;  1GTW A;  3TDK A;  2I3C A;  1SFO I;  1M90 Q;  1KB9 H;  1MUU A;  4JYB A;  2POH A;  3GG2 A;  5EFW B;  3ESW A;  1SP4 A;  1SQQ G;  1VQ5 P;  3P8C D;  5APQ A;  1M1J B;  3AEG C;  1SQB D;  2HG5 D;  2P67 A;  1YJN Z;  5KJ7 D;  1TWA I;  1LTI C;  1S5L H;  4MD7 A;  4YXD C;  1VQ9 1;  1VQL 1;  2G8Y A;  3N4X A;  2C9N Y;  1QVF Y;  1PP9 J;  1SFC C;  2ZAE B;  1IFD A;  3H32 A;  4WBA A;  1MZ9 A;  1E5W A;  3FX0 A;  4WY4 B;  3I55 Z;  1SLQ A;  1X22 A;  3H1H D;  1T2K D;  1ZXG A;  2ZYA A;  2MKV A;  2I1K A;  2HLO A;  1KC8 2;  3H1K G;  1YBK A;  5L8R J;  4OGQ D;  3CC7 Z;  1JCC A;  3OW2 O;  1BE3 J;  4PD4 I;  3CCE P;  3CD6 Z;  1CI6 A;  3CI9 A;  2R32 A;  1S5L X;  5B5E E;  2OTL 1;  1RE4 A;  2ZYD A;  2E75 B;  1KQL A;  2HPC B;  5APX A;  2QEX Z;  3H1K E;  2PFX A;  3CCJ Z;  2WVR A;  1KQS Y;  3GTO I;  3RK3 B;  4NBF A;  3OW2 Z;  3CMA Z;  2M5A A;  4NPE A;  4RO0 A;  3VMA A;  1NUI A;  3D71 A;  3M4O I;  3V2N A;  2JO1 A;  1VQM P;  1VF5 C;  1VQ4 1;  3PO3 I;  2QLV B;  1QVF O;  2KK7 A;  1VQP 1;  4A3L I;  2GUS A;  4NPD A;  1GU5 A;  1YJN P;  2GTH A;  1NTM D;  3MON A;  1VQO P;  1CSB A;  1YI2 Z;  3GKQ A;  5GTH H;  2JEE A;  1U7M A;  3IF8 A;  3SFE C;  2HFE D;  4AYC A;  1QVF Z;  1L2P A;  3I55 P;  3KPE A;  2WB1 A;  5AVR B;  3L75 E;  4W80 A;  1EZV I;  1K73 2;  2RN0 A;  3HOZ I;  1JY3 P;  2P1J A;  3CC7 P;  1FOS E;  4L74 A;  1YJW P;  1R5L A;  4JYC A;  1T3U A;  3CD6 P;  1VQN Z;  2Q6Q A;  4E2Z A;  2H89 C;  1P84 I;  1KQS O;  2FY8 A;  2Q9I A;  2DE5 A;  5A2Q f;  2FXM A;  1KOR A;  3II6 A;  1YIT 1;  3CCJ P;  2QIW A;  3ITK A;  4XA4 A;  1VQ6 P;  3CMA P;  3D2L A;  2R92 I;  5KTB A;  3HOX I;  2JMO A;  3NMD A;  1W5C E;  2ZFC A;  2V8K A;  1OXZ A;  3L73 D;  2M3B A;  1JTH A;  1JM0 A;  1H0T A;  1CZQ A;  4DQY B;  1A02 J;  4CPG A;  3JAM f;  3KHU A;  1G1J A;  3RL0 g;  5KAF H;  1KC8 1;  1SQP D;  3G4S Z;  3CQZ I;  4GDO A;  3D9X A;  3RL0 B;  3VMH A;  2QJK B;  2KSE A;  4NBG A;  3HUS C;  4ZNC A;  1M1K Q;  3T97 A;  1AA6 A;  2QRD B;  3Q5S A;  1YI2 P;  3LW5 J;  2YMY A;  2OAR A;  2NPS C;  2OGU A;  4A3B I;  2W6A A;  1OVV A;  3CXH I;  3WMM 0;  1K05 A;  2BAS A;  3J81 b;  2YU9 I;  3H1J D;  4MON A;  1N7S A;  1L4A C;  2O4H A;  3TE5 B;  4NBC A;  3CX5 D;  4NBA A;  2HF1 A;  2E5Y A;  2HOD B;  3BAT A;  3NXS A;  2P7J A;  2XKM A;  3VN0 A;  2M6N A;  1SFC D;  3AE6 C;  2P3Y A;  4E2W A;  4HKZ H;  1WII A;  3K7A I;  2KLU A;  2E7Z A;  2NZ2 A;  2CPB A;  1VQ9 P;  1VQL P;  2AXT E;  4E33 A;  1QF8 A;  4D6T J;  5GTI H;  1NTZ K;  1LWU B;  2V7Q J;  3TNU B;  3RK3 E;  4DOJ A;  2QG4 A;  1QGK B;  1URQ C;  3JCU E;  5T6B A;  1IFP A;  5A2Q b;  4Y7N I;  3G4S P;  4DGL A;  1K73 1;  1AJY A;  2JUB A;  4BRY A;  3FWL A;  1Q2N A;  2OYH C;  3P32 A;  3CCU 1;  1RO4 A;  4IL6 H;  1I50 I;  1KYO D;  1GW4 A;  2RHB A;  4H13 C;  3H1I D;  1FZG A;  2E74 B;  2GM4 A;  2VUG A;  2W27 A;  3HOW I;  5KLV E;  1AVO A;  2N1T B;  1KZU B;  2QJY C;  1EQ7 A;  1PPJ D;  3S1N I;  1FDI A;  2QRE B;  1ML8 A;  1L0L K;  2J6A A;  2LEX A;  4MD9 A;  4UB6 H;  1NTZ J;  2QR1 B;  5CBN A;  1HH0 A;  5M1B A;  4JBZ A;  5CCG C;  2QRC B;  1VQ4 P;  2P2U A;  4NB8 A;  1NTK K;  1GD2 E;  3LW5 H;  2E76 C;  2LFU A;  1ZOY C;  1RY3 A;  5KKZ B;  4ASV A;  1VQP P;  5KLI C;  1AQ5 A;  1IFI A;  3QWO C;  1Y1V I;  1LGH B;  4BBR I;  2FYU G;  5CHX A;  4ZKU A;  1PZQ A;  1YQ3 C;  3L71 D;  1VPC A;  1VLA A;  2BEQ D;  4PD4 H;  2JIM A;  2PGD A;  4Z1M H;  3HD7 B;  3EER A;  3I4M I;  5CJ4 A;  2BJO A;  1LP1 B;  3CC2 Z;  5AVW B;  2WTY A;  2FYU E;  1BCC J;  1R8E A;  1DEE G;  1RNI A;  1QL2 A;  1MKM A;  3MGN A;  3FXE A;  1L0L J;  4U3F D;  3S1R I;  3EQ2 A;  4A3J I;  3AEE C;  3A0H H;  5CM2 M;  1NTZ G;  3RGU A;  3WU2 E;  4MN4 C;  3PJS K;  2GU2 A;  1S72 Z;  2IBZ I;  2Y9Y A;  4WB4 A;  2H8P D;  3B4S A;  1NTK J;  2R3S A;  3CCM Z;  3MTU E;  1RF1 A;  4XX2 A;  1NKZ B;  5H2F E;  1ZW0 A;  3A0B H;  4I1L A;  1YIT P;  1S7M A;  1SQX G;  5KJ7 C;  2V7Q H;  3CPW Y;  5KAI E;  3FXD A;  4QTU A;  4W7Z A;  1HTL C;  1M7L A;  3V2Q A;  2WPV B;  2H43 A;  3CWB J;  2JDI H;  3L74 J;  1BCC G;  3KQG A;  1T2K C;  2N1T D;  3AE4 C;  1SQX E;  1NAY A;  2B87 B;  3GTM S;  2JR6 A;  2ZT9 B;  1SS1 A;  3JC2 2;  4OGQ C;  3B5N C;  1XTC C;  1P84 H;  3M0D A;  3CCU Z;  1HGZ A;  3H1L G;  1NTK G;  2Q3E A;  2FYN B;  2VPW A;  3CC2 P;  2NPS A;  3SWF A;  3L70 D;  3GF7 A;  2O53 A;  1BDC A;  2IZ4 A;  1KMI Z;  4R4L A;  2HU9 A;  4XE5 B;  1NVO A;  3OJA B;  3H1L E;  3Q87 A;  1TWG I;  1L4A A;  3L74 G;  3E1I A;  3EFG A;  1I3Q I;  3CCM P;  3CPW O;  1KFM A;  1IFJ A;  2YO2 A;  2M3E A;  1SQV D;  2KYV A;  2P58 A;  4Y99 C;  4PJ0 E;  4GOF A;  5TIS E;  3S17 I;  1S1C X;  2K9Y A;  2E9H A;  3CLQ A;  5CJ0 A;  3A2A A;  3SWK A;  3L74 E;  2W90 A;  2G2K A;  4IFM A;  3CCS Z;  3CPW Z;  4QTT A;  2OTJ 1;  2YKP A;  1QL1 A;  2P10 A;  5IP7 I;  3CCR 1;  2E2J I;  3CXH H;  1M1J C;  2C0X A;  4NPF X;  4H13 D;  2BCC J;  2YKQ A;  1Q81 2;  4PV1 B;  3G6E 1;  3IR7 A;  1VQ5 Z;  4KJM A;  3CCL 1;  3L72 G;  2WWW A;  2ZVO B;  3CCU P;  3V4Q A;  2OYI A;  2OTK E;  2OYH A;  2O3J A;  5AVY B;  4NB9 A;  1N8R Q;  4NBB A;  3GTJ I;  1X0T A;  1W2B Y;  1WCM I;  3P8M C;  1J1D B;  3PO2 I;  3L72 E;  3TGU J;  4BY7 I;  3M91 A;  5DJU B;  2RH0 A;  1T3J A;  2QSI A;  1JOC A;  3H3V J;  2W04 A;  2QJP B;  4BXL A;  1X9V A;  4NOZ A;  4U7J A;  5K5G B;  1FJK A;  2E75 C;  2M5A B;  3NH5 A;  5AVX B;  1S5L E;  1L0N G;  3RK2 B;  2W8Z A;  3CCE Z;  3A5T A;  2J5U A;  3RK3 C;  1Q7Y 1;  1VQ7 1;  4YTP C;  1J1E B;  3IF4 A;  1LTJ C;  2IDB A;  2L91 A;  1IC2 A;  2W6B A;  4IOI H;  3CCS P;  5APT A;  1SQB K;  2D2C B;  1L0N E;  2YKO A;  3H1K D;  1BSH A;  4HGZ A;  2IBZ G;  5BVZ A;  2RKL A;  1VQM Z;  1M90 2;  1N73 C;  4O9B A;  2VPZ A;  4EIJ A;  3NDJ A;  1W2B O;  2YXQ B;  3OAK A;  2XDJ A;  1BGY J;  1K8A Q;  2Z5H A;  1GL2 D;  3A7O A;  4TNU A;  1VQO Z;  1EC5 A;  1SQQ E;  3FWN A;  3HOU I;  5APV A;  1KIL A;  4M3L A;  2QKD A;  1W2B Z;  2EGT A;  3I56 1;  1R9T I;  4UB8 H;  4A3D I;  2A45 I;  3G9R A;  1IFM A;  3CXC Y;  1SQB J;  4H44 B;  3BRT B;  3L75 D;  1KQF B;  2GUV A;  1DIP A;  2V8I A;  3B5N D;  3ZDM A;  1YJW Z;  1QLE D;  3CCR Z;  1Q81 1;  5GTH E;  1JCD A;  4RVD A;  1N86 A;  1OW6 A;  1JTH B;  1H0T B;  5TJH A;  3H1H J;  5FLX f;  1ZN5 A;  2IFM A;  3AE7 C;  2WPR A;  1VQ6 Z;  1NTM K;  1H88 A;  4HGY A;  2RMZ A;  4HJG H;  1PGO A;  1FAV A;  1PP9 G;  3MUD A;  2LIY A;  4GIF A;  1USP A;  3GHG C;  3LIE A;  2W83 C;  3VTN A;  3S1Q I;  3J81 f;  2QJK C;  4HH4 A;  2KNC A;  3AE3 C;  2AKL A;  1ZRT E;  2R44 A;  4C7R A;  3CX5 I;  4BWN A;  2D2C D;  5AVT B;  1PP9 E;  1BE3 G;  3MZK B;  1YQ4 C;  3F3F C;  2N9Y B;  1KIL E;  3BG0 B;  2QA4 Z;  2IV2 X;  1N7S B;  3R4Y A;  4BY1 I;  3MD0 A;  2JIP A;  1NJI Q;  1HBW A;  1ZR4 A;  2R93 I;  1K83 I;  2KS1 B;  3H1H G;  1QYP A;  1VQ7 Z;  1QX8 A;  1FDM A;  1BE3 E;  1NTM J;  1FBM A;  1YJ9 Z;  2OOX B;  1VQK 1;  5KAF E;  4RS4 A;  3CXC Z;  4QMA A;  1Q82 Q;  1JEK A;  3CCR P;  5APW A;  1M90 1;  1IK7 A;  3UIA A;  1KD1 Q;  5T64 A;  1M1J A;  3P7K A;  4WY4 D;  2O1K A;  3M9B A;  1AA0 A;  3G6E P;  1LT9 C;  4Y52 I;  2FKW B;  2V3V A;  1KYO I;  2R5B A;  2QE7 H;  1SQP K;  1LWU C;  4AUW A;  3P5J B;  4BRY B;  1KQS Z;  3H0G I;  1R5S A;  1VQ9 Z;  1OMI A;  3AED C;  1VQL Z;  1YUK A;  2E75 D;  1J2J B;  2V4H A;  1Q86 Q;  4RVH A;  3RK3 D;  1Y47 A;  3Q1M A;  3L36 A;  3E1R A;  3L4F A;  5FLX b;  2E74 C;  4E31 A;  2Y0S A;  2QA4 P;  1ZR2 A;  5AVS B;  2N1T C;  2K9J A;  3L73 J;  1M1K 2;  2AEF A;  4I7Z B;  1FJP A;  1Z03 A;  5BU8 B;  5GTI E;  1WMK A;  1VQ7 P;  2OTL Z;  3QWU A;  1FU1 A;  3N7N A;  1LTJ A;  2Z4E A;  1YJ9 P;  1SQP J;  1PGQ A;  5KLV D;  5CBO A;  1KN7 A;  3AE5 C;  1LTB C;  2RPR A;  2DE6 A;  3TF5 A;  1N7S D;  1E79 H;  5AW7 B;  3HE4 A;  3NTN A;  1S9K E;  3S14 I;  5KKZ C;  4IL6 E;  1D7M A;  1IZN B;  1N73 A;  2M0B A;  1VQ4 Z;  2QM8 A;  3A3Y B;  4N3Y B;  4WVZ A;  4AQR D;  1JJ2 Y;  2VPY A;  3AEA C;  1DH3 A;  2K3R A;  1VQP Z;  3HD7 C;  3H1J J;  2NVY I;  4MD8 A;  5CMZ A;  4HH2 A;  3WUV A;  3Q5R A;  4MH4 A;  4DK1 A;  3VMZ A;  3I5C A;  2MJZ A;  3HRN A;  4UB6 E;  4MXU A;  1SFC A;  1OWA A;  3SFD C;  1X79 B;  3PO3 S;  3D70 A;  3GTK I;  1RF1 B;  4A93 I;  1ZB8 A;  1NOH A;  3KYQ A;  1K9M 2;  3Q3D A;  2FYU D;  1UIX A;  1Q16 A;  4C7N A;  3KZI H;  4GKG A;  2KIK A;  4PD4 E;  2SPZ A;  5D1O A;  1RE3 C;  3G71 1;  2PRR A;  2OTL P;  3MIW A;  2IYO A;  4HB1 A;  1YIT Z;  1FDO A;  2FYZ A;  3RL0 D;  1RHZ B;  1N2D C;  5CCH D;  1NWQ A;  4D6T G;  3RBZ A;  3MZL B;  1RF0 C;  2YIU B;  4L73 A;  3H1I J;  2Q5U A;  3GHG A;  2A45 H;  2ZT9 C;  1NHL A;  1PV3 A;  2KOG A;  3ABV C;  1GZL A;  4BBS I;  2G3A A;  3A0B E;  2NVQ I;  1SQX D;  2AXT H;  1JJ2 Z;  2FYN C;  4D6T E;  1JO5 A;  1OVU A;  2W6J H;  1M1K 1;  1YIJ 1;  1MFT A;  2WQY C;  1QVG O;  3S2D I;  1EZV G;  1L4A B;  2Q7C A;  2AEM A;  1DD4 A;  2OOY B;  1I6H I;  1KRL A;  3W68 A;  1A02 F;  2IYP A;  4NBD A;  2CPS A;  2K1A A;  2RIQ A;  1VQK P;  3L71 J;  4EDF A;  1EZV E;  1FC2 C;  2HR3 A;  3GMA A;  5C4X I;  1L1O C;  5E79 H;  1FZC B;  3O6Q A;  1WW9 A;  4I2L C;  3H1L D;  1P84 E;  2AXC A;  1U57 A;  1ZV8 A;  4ASW A;  4E30 A;  3CX5 H;  1N2F A;  2E43 A;  2KSJ A;  1LT9 A;  2JIQ A;  4JQ0 D;  3LID A;  1X3Z A;  3IR9 A;  2B63 I;  1NTZ E;  2WPQ A;  4U3F J;  1N7L A;  2H88 C;  3PP5 A;  3S4R A;  2FXP A;  1GL2 C;  1HWT C;  5D1P A;  3Q5P A;  1VDF A;  3TNU A;  2JJL A;  1HJB A;  1S3J A;  2OYI B;  2OYH B;  2E74 D;  1JY2 N;  2WSE J;  1K04 A;  3F89 A;  5BU5 A;  2E2H I;  1NU1 K;  5DJT B;  3FQQ A;  4IFF A;  1HGV A;  4DZO A;  1K9M 1;  2FFD B;  3NFZ A;  2JIR A;  1L0L G;  2JA8 I;  3RBX A;  1X3W A;  2IZ3 A;  2YNY A;  3TYY A;  4L76 A;  1J1D C;  2Y0C A;  1HUC A;  5C4J I;  3HUS A;  1BCC E;  1AFO A;  4NFR A;  1RO2 A;  1OVR A;  1RE4 C;  3G71 Z;  1Q7Y Q;  1WJ2 A;  1L0L E;  2K37 A;  1VQ8 1;  2QJP C;  1KYO H;  3CXH E;  4ZKP A;  1SQV K;  4U3F G;  3J7A 4;  3AEB C;  3WU2 H;  1DEB A;  1GMJ A;  4H0L B;  3L72 D;  1NTK E;  2ZJS E;  3HD7 D;  1H89 A;  3CWB G;  1IJD B;  1AV1 A;  1NU1 J;  3L70 J;  3VTP C;  2P28 A;  3MHV A;  1TWC I;  3CC4 1;  2D2C C;  5IT9 b;  3M0A A;  2PP6 A;  2WPS A;  3CWB E;  5AVV B;  2ZXE B;  4YPC A;  2NVT I;  1LP1 A;  4A3M I;  3S9O A;  1GK6 A;  1NAF A;  2VRS A;  2WSS H;  1L0N D;  4TLF A;  1OX3 A;  1VL2 A;  2L5G B;  1SQV J;  5B66 H;  4LLH A;  1URQ A;  2A06 G;  3M06 A;  1KIL B;  4A3I I;  3H32 B;  1Y1V S;  4RVF A;  3GTG I;  1OW8 A;  2ZXX A;  1KFN A;  3OA7 A;  2VUM I;  5APS A;  2OZK A;  1FZB A;  4GOD A;  1NU1 G;  3L70 G;  4WY4 C;  1G2C A;  3G71 P;  1RE3 A;  2NRG A;  3SSU A;  1Z02 A;  2A06 E;  2ITA A;  1ZLL A;  1N8R 2;  3I4N I;  3V6I A;  3B8E B;  2QEX 1;  1KB9 E;  1CI6 B;  3CCJ 1;  2K88 A;  3NFQ A;  1SQQ D;  3VMG A;  1LTT C;  2KB7 P;  2ZT9 D;  3VMX A;  2WSE H;  1MV8 A;  1NU1 E;  3L70 E;  2CK3 H;  1S2E A;  2YXR B;  1FS0 E;  4N78 E;  4JPZ B;  2B87 A;  5CCG A;  2BCC G;  2JA5 I;  2KLV A;  1USP B;  4GT1 A;  4H0L D;  1QEX A;  2DW3 A;  3PH0 A;  4UB8 E;  3J80 f;  4OWF A;  3FGA D;  1YIJ P;  1YI2 1;  1M8O B;  3BCC J;  2BCC E;  1FZA A;  3VOP A;  2WIT A;  1U7J A;  3KDP B;  1YHQ 1;  3TGU G;  1H8A A;  1Z56 A;  3HOV I;  4Y99 B;  3HE5 A;  1CW5 A;  1KTM A;  1N7S C;  2V45 A;  1USD A;  2Z5I A;  3WUU A;  3H1K J;  4RV9 A;  1ZRT D;  1VQN 1;  2IBZ E;  3TGU E;  1IK9 A;  1PFT A;  1K8A 2;  4EI2 A;  1EDI A;  1PP9 D;  1JMM A;  1AQT A;  3HTK A;  1M56 D;  4PV1 D;  1KIL D;  1IFN A;  2PMZ A;  3CC4 Z;  3PLN A;  5KJ7 A;  3AE9 C;  3BCC G;  3WUT A;  4CL1 A;  1GL2 A;  4K3A A;  1BE3 D;  2OTJ Z;  1JY3 O;  1DL6 A;  3MP7 B;  2VF1 A;  2GTI A;  2ZYG A;  4NH1 C;  2I8D A;  3BCC E;  2KPI A;  1KC8 Q;  3G4S 1;  3G6E Z;  1RO0 A;  2QVA A;  2JA7 I;  3CCL Z;  1BGY G;  1Z01 A;  3RZD I;  3S16 I;  3C1L A;  3B5N A;  3VB9 A;  3L75 J;  2WSF H;  3RK2 D;  1N8R 1;  4BXX I;  2NAP A;  3T97 B;  3CME 1;  2Y9Z A;  1VQ8 P;  5AW6 B;  2K9J B;  2YMK A;  1BGY E;  3RL0 C;  3KIF A;  1RQV A;  1SQB G;  3Q2Y A;  4A3G I;  5CCH C;  2XND H;  4I7Z C;  1LTJ B;  2R5D A;  1LTS C;  2AYD A;  3U50 C;  1QXF A;  3J80 b;  2E2I I;  1OW7 A;  3P8C E;  2WT7 A;  1RH5 B;  3HE4 B;  1JUN A;  3JSV C;  1EXJ A;  1SQB E;  3CC4 P;  3GTP I;  1NJI 2;  1Y1W I;  3AEF C;  1BDD A;  3U1C A;  2KXP B;  1N73 B;  2H85 A;  1YYC A;  2B89 A;  3L75 G;  3VMI A;  4OVN F;  1PL5 A;  3NH8 A;  1NYH A;  2XU6 A;  1NH4 A;  2OTJ P;  5B5E H;  1NKN A;  2R3C A;  1LT1 A;  3BVH A;  3H1H E;  1Q82 2;  1GW3 A;  2Q3I A;  1EDJ A;  1YHQ Z;  3BG1 B;  2JNY A;  1S9K D;  4DCK A;  5AVQ B;  1KD1 2;  1SFC B;  1K73 Q;  3CCL P;  4R4M A;  4H44 D;  4RES B;  1G1I A;  4A3E I;  2KI7 B;  2WZ7 A;  1WZN A;  5AW4 B;  1K8A 1;  1PGJ A;  1FZE A;  3M9Q A;  4C7N B;  1RF1 C;  2JWA A;  5AW0 B;  4WY4 A;  1HVV A;  3FQM A;  2JIO A;  2KUB A;  1X8Y A;  5D1O B;  3E7K A;  2QEX P;  1OFC X;  1Q90 D;  3I56 Z;  1NTM G;  1Q86 2;  3AE1 C;  5AVZ B;  1JY3 N;  5KLV K;  1WT6 A;  5FLM I;  1PGP A;  1MFZ A;  4DJG A;  2W03 A;  1JB0 J;  3KIH A;  5C3E I;  2HPC A;  3USS A;  1JNM A;  2IZ1 A;  5APU A;  1TU3 F;  1NTM E;  2KZJ A;  2XNX A;  5IP9 I;  3TDH B;  4PD4 D;  3GHG B;  1LTA C;  4WWI A;  3GW6 A;  3VYI A;  1VF5 B;  1AVY A;  4ZMD A;  3V4W A;  2LXC B;  3M0D C;  2YIU C;  5AW2 B;  4XFJ A;  3MZW B;  1ZH1 A;  4OH8 B;  2YO3 A;  4EYY Q;  1LJ2 A;  3KZI E;  1YHQ P;  3CC2 1;  1ZB9 A;  3F3P C;  3CME Z;  1T8Z A;  3G3Z A;  3L35 A;  2R7Z I;  4DT0 A; 
#chains in the Genus database with same CATH homology
 4NBF A;  3OW2 Z;  3CMA Z;  2M5A A;  4NPE A;  4NB9 A;  3S2H I;  4ASW A;  4E30 A;  1NUI A;  4E32 A;  4NBB A;  1N2F A;  1X0T A;  3GTJ I;  1W2B Y;  1WCM I;  2Q51 A;  3M4O I;  3PO2 I;  1X3Z A;  1S72 1;  2B63 I;  4BY7 I;  2JWD A;  5DJU B;  1VQ4 1;  3CCM 1;  5D1P A;  3PO3 I;  2QLV B;  1TFI A;  3H3V J;  2JS4 A;  2V8J A;  2W04 A;  1NJI 1;  4BXL A;  4NOZ A;  1S3J A;  1VQP 1;  4A3L I;  4NPD A;  2GTH A;  3MON A;  5K5G B;  3FKI I;  3I07 A;  2M5A B;  3NH5 A;  3GTM I;  2RT9 A;  2E2H I;  5DJT B;  3FQQ A;  1QVG Y;  2JA6 I;  3M3Y I;  1K9M 1;  3CCE Z;  1YI2 Z;  3GKQ A;  4NBH A;  3NFZ A;  2JA8 I;  1U7M A;  1X3W A;  3IF8 A;  1Q7Y 1;  1VQK Z;  2F4O A;  2IZ3 A;  1VQ7 1;  1P9N A;  1Q82 1;  1QVF Z;  1JMB A;  2WB1 A;  5C4J I;  4IOI H;  1KD1 1;  3CCV 1;  4NFR A;  1RO2 A;  3HOY I;  1OVR A;  3G71 Z;  2K5R A;  3CCQ 1;  1K73 2;  3HOZ I;  1VQ8 1;  2QRX A;  4HGZ A;  3J7A 4;  2RKL A;  1VQM Z;  1VQN Z;  1M90 2;  4E2Z A;  2DE5 A;  3NDJ A;  5A2Q f;  1YIT 1;  3EED A;  4K35 A;  2R92 I;  1RQF A;  1Q86 1;  2P28 A;  3HOX I;  2JMO A;  3JAM b;  4RVG A;  4TNU A;  1VQO Z;  1EC5 A;  3MHV A;  1TWC I;  3CC4 1;  5IT9 b;  3HOU I;  2V8K A;  2QKD A;  1W2B Z;  1JM0 A;  1H0T A;  2EGT A;  3I56 1;  1R9T I;  1RLY A;  4A3D I;  4DQY B;  4CPG A;  3CXC Y;  3JAM f;  2NVT I;  1LP1 A;  3IFU A;  4A3M I;  2UWJ E;  1KC8 1;  5IT9 f;  3G4S Z;  3CQZ I;  3D9X A;  2V8I A;  3VMH A;  2NVX I;  3ZDM A;  4NBG A;  1YJW Z;  3S15 I;  4ZNC A;  2QRD B;  3CCR Z;  3CCS 1;  1Q81 1;  4A3I I;  4RVD A;  1TWF I;  1QVG Z;  1Y1V S;  1H0T B;  4RVF A;  3GTG I;  4A3B I;  5FLX f;  2VUM I;  3LUS A;  1OVV A;  2OZK A;  2RBL A;  2PM9 A;  2R6M A;  3NDI A;  5AN9 F;  1VQ6 Z;  4GOD A;  3J81 b;  2YU9 I;  2M48 A;  4HGY A;  1Z02 A;  1VQ5 1;  4HJG H;  3S1M I;  4MON A;  3T4N B;  1N8R 2;  3I4N I;  2LIY A;  2O4H A;  1USP A;  3TE5 B;  4NBE A;  1LQL A;  2QEX 1;  4NBC A;  4NBA A;  3VTN A;  3CCJ 1;  4A3C I;  3VMG A;  3S1Q I;  2HF1 A;  3J81 f;  4HH4 A;  1NP6 A;  2AKL A;  2R44 A;  2M6N A;  2P3Y A;  4E2W A;  4HKZ H;  3MZK B;  4X6A I;  1WII A;  2B87 A;  3K7A I;  3F3F C;  3BG0 B;  4BY1 I;  2QA4 Z;  2JA5 I;  1USP B;  3GCF A;  4S1T A;  5C44 I;  4E33 A;  2R93 I;  1K83 I;  2KS1 B;  1QF8 A;  1QYP A;  3PH0 A;  1VQ7 Z;  3J80 f;  5T67 A;  3CCE 1;  5T6B A;  1YI2 1;  1YJ9 Z;  2OOX B;  5A2Q b;  4Y7N I;  1VQK 1;  4RS4 A;  3CXC Z;  1EDL A;  4DGL A;  1U7J A;  3CCV Z;  1K73 1;  2JUB A;  2WAQ A;  1YHQ 1;  3CCQ Z;  1TWH I;  1Q7Y 2;  1Q2N A;  3CCU 1;  1RO4 A;  1M90 1;  1I50 I;  5T64 A;  3HOV I;  2RHB A;  2B88 A;  3NH4 A;  4E2Y A;  4EWC A;  2WMM A;  2VUG A;  4Y52 I;  3HOW I;  4RV9 A;  5C39 A;  1VQM 1;  1VQN 1;  1PFT A;  1K8A 2;  1EDI A;  3RZO I;  3P5J B;  2Q1K A;  3S1N I;  1KQS Z;  3H0G I;  2QRE B;  1ML8 A;  1VQ9 Z;  2J6A A;  1VQL Z;  1YUK A;  1YJN 1;  4MD9 A;  2PMZ A;  3CC4 Z;  2QR1 B;  5CBN A;  4JBZ A;  2DE7 A;  2QRC B;  1VQO 1;  1YIJ Z;  4NB8 A;  4RVH A;  1Y47 A;  4CL1 A;  2LFU A;  4K3A A;  5FLX b;  4ASV A;  2OTJ Z;  3QWO C;  1Y1V I;  1DL6 A;  3S1K A;  3I55 1;  2LR2 A;  4BBR I;  4E31 A;  3GTQ I;  2Y0S A;  1VLA A;  2VF1 A;  2GTI A;  1M1K 2;  4NH1 C;  2I8D A;  2KZI A;  2KPI A;  1Z03 A;  3G4S 1;  3G6E Z;  3EER A;  1RO0 A;  3CC7 1;  2QVA A;  2OTL Z;  3QWU A;  3I4M I;  4A3F I;  2JA7 I;  3CCL Z;  2BJO A;  1YJW 1;  1Z01 A;  1LP1 B;  3RZD I;  3CC2 Z;  3S16 I;  3CD6 1;  2YAD A;  3VB9 A;  5LL6 f;  5CBO A;  1DEE G;  1RNI A;  2RPR A;  3HKZ A;  1N8R 1;  2DE6 A;  3FXE A;  4BXX I;  3S1R I;  4A3J I;  3CME 1;  2F4M A;  5CM2 M;  3S14 I;  3RGU A;  4AYB A;  4MN4 C;  1VQ6 1;  2GU2 A;  3KIF A;  1S72 Z;  3CMA 1;  2LXB A;  2M0B A;  1VQ4 Z;  3CCM Z;  4A3G I;  4XX2 A;  1JJ2 Y;  1ZW0 A;  2K3R A;  3U50 C;  1VQP Z;  3J80 b;  2NVY I;  4MD8 A;  2E2I I;  4GOE A;  1S7M A;  3D6W A;  4MRI A;  3CPW Y;  4MH4 A;  4DK1 A;  3FXD A;  4QTU A;  3GTP I;  1NJI 2;  1Y1W I;  4MXU A;  1BDD A;  3GTL I;  2H85 A;  3PO3 S;  2QA4 1;  2B89 A;  3GTK I;  4A93 I;  3VMI A;  1YUA A;  1ZB8 A;  3IX0 A;  3NH8 A;  2PK7 A;  1K9M 2;  2B87 B;  1LT1 A;  2Q4Z A;  3GTM S;  2JR6 A;  1EDK A;  1Q82 2;  1SS1 A;  1EDJ A;  1VQ8 Z;  1YHQ Z;  2KIK A;  3BG1 B;  2JNY A;  2SPZ A;  5D1O A;  3OW2 Y;  1YJ9 1;  3CCU Z;  1JWH C;  3G71 1;  4A3K I;  1KD1 2;  4E2X A;  2I3C A;  4HB1 A;  4A3E I;  2KI7 B;  1SFO I;  2O53 A;  1BDC A;  1YIT Z;  1K8A 1;  2IZ4 A;  2HU9 A;  5EFW B;  3ESW A;  1NVO A;  3FQM A;  3Q87 A;  2KUB A;  1TWG I;  5D1O B;  3MZL B;  1YJN Z;  3I56 Z;  1TWA I;  1I3Q I;  4MD7 A;  1Q86 2;  1VQ9 1;  1VQL 1;  4BBS I;  2P58 A;  1QVF Y;  4GOF A;  2NVQ I;  5FLM I;  2ZAE B;  1JJ2 Z;  3S17 I;  2E9H A;  2W03 A;  1OVU A;  5C3E I;  3KIH A;  3I55 Z;  1MFT A;  1YIJ 1;  1M1K 1;  3S2D I;  2KZJ A;  2G2K A;  1ZXG A;  5IP9 I;  3TDH B;  3CCS Z;  3CPW Z;  4QTT A;  2OTJ 1;  4WWI A;  1KC8 2;  2OOY B;  5IP7 I;  3CCR 1;  2E2J I;  3CC7 Z;  1I6H I;  1KRL A;  4ZMD A;  2LXC B;  4NBD A;  4NPF X;  3CD6 Z;  2RIQ A;  3MZW B;  1Q81 2;  1ZH1 A;  3G6E 1;  1FC2 C;  4EYY Q;  2HR3 A;  1VQ5 Z;  4KJM A;  2OTL 1;  3CCL 1;  5C4X I;  3CC2 1;  1L1O C;  1WW9 A;  1ZB9 A;  3F3P C;  2QEX Z;  3CME Z;  2OTK E;  3CCJ Z;  2R7Z I;  1KQS Y;  3GTO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...