2K3RA

Pfu rpp21 structure and assignments
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
KERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCKKCHAFLVPGINARVRLRQKRMPHIVVKCLECGHIMRYPYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 4
publication title Solution structure of Pyrococcus furiosus RPP21, a component of the archaeal RNase P holoenzyme, and interactions with its RPP29 protein partner.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 20
structure length 91
sequence length 91
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2008-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2k3rA01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2k3rA02
2KZIA 5CBOA 2RKLA 1SS1A 4ASVA 2QRXA 4NPFX 2KS1B 2KUBA 1S3JA 1ZXGA 2M5AB 5DJTB 2M5AA 1X0TA 4CPGA 3QWOC 2M0BA 4GOEA 4K35A 2KI7B 5C39A 5DJUB 1OVVA 3FXEA 4ZNCA 4KJMA 2SPZA 3S1KA 4GOFA 4JBZA 2K3RA 2HR3A 1LP1B 4K3AA 1LP1A 1LT1A 2B87B 4WWIA 1ZW0A 2Q1KA 2B87A 3MZWB 4BXLA 2KZJA 1JM0A 2QVAA 1DEEG 2R44A 2WMMA 5K5GB 5EFWB 5CBNA 4MN4C 1EC5A 3FXDA 1Q2NA 2B89A 3ZDMA 1EDLA 2UWJE 2LXBA 1BDDA 3RGUA 4HB1A 1OVRA 4HJGH 2I8DA 1EDKA 1BDCA 4ZMDA 1U7MA 1OVUA 4EYYQ 1U7JA 2LR2A 4ASWA 1JMBA 4HKZH 2ZAEB 4NPDA 3PH0A 1NVOA 1MFTA 2KIKA 1EDIA 4NPEA 1FC2C 1Y47A 2JWDA 2B88A 1H0TB 4GODA 2OTKE 4IOIH 1H0TA 3MHVA 2P58A 1EDJA 2LXCB
chains in the Genus database with same CATH superfamily
4A7PA 5C4XI 3HOXI 3H1KG 2XZRA 3M0DA 5GTHH 2R3SA 4H44D 3CC4P 3V2QA 2KK7A 3D6YA 1ZRTD 3NH4A 3CCSZ 1CZQA 4NPFX 2IBZD 2ZYDA 3TNUB 1IFPA 3TDHB 1SQQD 1KQSO 2KS1A 2KNCB 4H44C 1KRLA 1SQXJ 2G2KA 1Q86Q 2NVQI 1L0NG 4JQ0D 1T3JA 1JY2O 1DEBA 4DT0A 1SVFA 3AE8C 5C3EI 5AW2B 2H85A 4BRYB 1SFOI 2JMOA 3TGUG 2LIYA 3RK3B 2KP8A 1JTHB 5AN9F 2WQYC 4MD7A 1WZNA 4C7RA 1AV1A 1P9NA 3CC4Z 2AXCA 1IFIA 1YJWZ 3PP5A 4MD8A 4WY4A 2WMMA 3L75D 5AW4B 3CWBE 3RK3D 3P5JB 1TWAI 1LQLA 2FXPA 3U50C 3CCJP 4RJTA 2JS4A 2B9BA 5KLIC 2CK3H 4HB1A 2AEMA 3IFMA 4OGQB 1M1K1 5AVQB 3V4QA 1L0LK 5AVYB 1S9KE 2QEXP 1AFOA 3PO2I 4GIFA 3Q2YA 2R6MA 3G4S1 4OGQD 2R7ZI 1IK7A 3CCJZ 1L0NK 1VQOZ 4A3LI 4OGQC 1FZFA 2LXCB 1NGMB 4JYBA 1USEA 3B8EB 1R8EA 3QWUA 2V7QH 1HTLC 3RZDI 3K7AI 2WPQA 3S2DI 3LW5H 1K8A1 1VQ6Z 2V4HA 3L36A 3GCFA 4X6AI 2H7HA 1VQ4P 4RVFA 2M5AA 3H1HJ 3A3YB 5CCGD 1CW5A 2QEXZ 2O1KA 4DK1A 2VRSA 4Z1MH 3L71D 1DD3A 4KJMA 1VL2A 3A2AA 5CCGC 3H1JD 3TE5B 2RH0A 3L70D 1RQVA 1BE3D 4DCKA 1QF8A 1ZW0A 5B5EE 5KLVD 4I1LA 3HOZI 3HRNA 3CX5D 2QA41 1SQPE 5M1BA 2GU2A 5CBNA 1SQBE 2K5RA 2QIWA 2LEXA 3IF4A 4N78E 1IFJA 3N7NA 1QGKB 1BCCE 2NVYI 3VMHA 1UIXA 2LXBA 2UWJE 3KDPB 4WBAA 3PLNA 2A06D 4E2XA 1IC2A 3L4FA 3A0HH 2Q9IA 3I561 1J1DB 1M1K2 2Q3IA 5KAIE 3KIFA 3S9OA 5CCHD 1Y8AA 1KV4A 4ZMDA 1FDMA 2YMKA 2I1JA 2V8KA 1VF5C 5CM2M 1SQVG 2GA1A 2FYZA 2KIKA 2YNYA 1S5LE 2DW3A 1J1DC 5C4JI 1LWUB 4A3KI 2RHBA 2OYIB 3M9HA 2V7QJ 2CPSA 3LW5J 5BU8B 2M48A 2R5BA 2OYHA 5AVUB 1DL6A 2W04A 2IPPA 1NTZD 2PM9A 1LWUC 5AVRB 2JWAA 2OYIC 3L73E 2FY8A 2WT7A 1GW4A 2E2JI 2JUBA 1EZVI 3RL0g 1NKNA 4IL6H 4KHXA 1SQQG 3MZWB 3CQZI 1FOSF 1NTKG 2ZT9B 1KYOD 1W2BY 1BSHA 1VLAA 5AW7B 3G4SP 1JMMA 4NBCA 1SQPK 1BGYD 3Q3DA 3FQMA 1VQP1 1SQBK 2K9JB 1SP4A 1SQVK 2W6AA 2ZT9D 3VMXA 2R32A 1AJYA 2M6NA 1Z01A 4W80A 2ZXXA 3H1KJ 3J81f 2ZT9C 2M8RA 2VUGA 1S5LX 3L75G 4UB6E 1GD2E 4LC1A 3VOPA 2IBZI 1KQFB 4NPDA 4NBAA 3G4SZ 2JA5I 2HLOA 3VB9A 2L91A 5CHXA 1Z03A 3IR9A 1HJBA 1ZOYC 2GUSA 4GODA 3EERA 4AQRD 1AVYA 1H0TA 5E79E 4IFMA 2WVRA 2FYNB 2V45A 3P8CE 3BCCJ 1FJPA 1M8OB 1L0LD 4EI2A 2QA4P 3H1ID 4E30A 2WB1A 3CMA1 1SLQA 2PP6A 1SQQK 1PPJD 1UIIA 3G3ZA 3AE5C 2K37A 3CCE1 3QWOC 3CC2P 2A45I 4GOEA 3GTJI 1VQK1 3FXEA 3I56P 2FYNC 1Q82Q 5CMZA 3CL3D 2V8IA 3GLMA 1LTGC 2DE7A 4ZKPA 1X3WA 1IZNB 1YQ4C 3B4SA 4EIJA 4MONA 2Q1KA 2QA4Z 3S1RI 1NOHA 4JF7A 1N8R1 4HGYA 5GTHE 4S1TA 4A3II 1W2BZ 1E5WA 3G6E1 1Q2NA 3B5NB 3L70G 3BG1B 1BE3G 3H1HE 3JCUH 3I551 5KLVG 1ZB8A 1ZB9A 5FLXf 1EDKA 2JA8I 3Q5PA 3GTMS 1OVUA 3B5ND 2HODA 1KILA 2Q6QA 3IR7A 3CWBD 3V2PA 2DE6A 2I1KA 3RBXA 1RQUA 1HWTC 3B5NC 4A3CI 5IT9f 2A06G 3S4RA 3A5TA 3C1LA 3C9IA 4GT1A 1YIJ1 2JR6A 3CPWO 1USDA 2YKPA 3HTKB 4NH1C 2JIOA 1TWHI 3HOYI 1NYHA 1K73Q 1VQPP 2QKDA 1JY3N 3GW6A 2XKMA 2ZVOB 3GHGB 1S9KD 3FWNA 2R93I 1GL2A 3KYQA 3I07A 4UB8H 1ZLLA 3MZKB 1OVVA 4NBBA 3P7KA 2K9YA 4TNUA 2QJPB 4JBZA 2PAJA 3TSIA 1RO4A 4PD4E 2FXOA 1YYCA 4A3MI 1N8R2 3O6QB 1JO5A 2GUVA 2W27A 2XNDH 3E1IA 4OWFA 1HJ0A 3V2RA 5AVTB 1NTZG 1VQPZ 2Y0CA 3PHLA 2QJPC 3W68A 2PGDA 1CI6B 2JA7I 3OW2O 1IFDA 1X8YA 2C0XA 1N7SD 3GTGI 1PL5A 1M1JA 1AQ5A 1N7LA 1HVVA 3CMAP 1OVRA 1YHQZ 4RESB 1G1IA 1N7SC 1ML8A 1N7SA 1SIWA 4PJ0H 1JOCA 1U7JA 2C9NY 3CCEP 4C7NB 1SQPD 1BGYG 2BCCJ 3MUDA 3VMGA 5APTA 1VQ41 5IP9I 1N8RQ 1IO4A 1SQBD 1HF9A 1VQKP 1RY3A 1OX3A 1GU5A 1EZVD 1OW6A 2PRRA 2IZ3A 2HPCB 3SWFA 4N78D 4TT3H 1BCCD 2OYOA 4A93I 2B88A 3V6IA 2OTKE 1A02J 2WSCH 1K04A 2V8JA 2Q7CA 3CMAZ 2R92I 4IFDK 1NTKJ 2XNXA 1SS1A 3AEEC 1FZEA 3U1AA 1NU1E 3RBZA 1EXIA 2KS1B 3CCEZ 4E2ZA 4PD4I 1ZXGA 2RPRA 3G6EP 3JAMf 1J1EB 3A0HE 3VYIA 2E76B 1KB9H 1RQFA 1VQKZ 1GW3A 3GF3A 4R4LA 1NTMJ 5A2Qf 5AW0B 1ZP0C 3I55P 3TDKA 5CJ4A 5L8RJ 3M0DC 2QR1B 5GTIE 1L0LG 3WU2H 3H1IG 2H8PD 1KC81 2E76D 4QTTA 3NDJA 3J81b 2QG4A 1LT1A 4A3GI 1PPJG 2P7JA 3L75J 2FYUJ 2QRCB 1J1EC 2KZJA 4WY4B 2E76C 4BXXI 5EFWB 2RBLA 3BCCE 3G6EZ 3L35A 3VTNA 1VPCA 3F89A 3HD7A 1FZCA 2Y0SA 1K9M2 2W83C 3L73D 4U3FE 4WVZA 4RV9A 1YIJP 3I55Z 4WY4D 1Y1VI 1KILE 3OA7A 3PO3S 5AVVB 5KLIB 1FZBA 3M3YI 5CJ0A 4NBEA 1LGHB 4WY4C 3WUTA 2OTJ1 3HOWI 3O8ZA 3GMAA 2LR2A 3KPEA 1VQ51 2XDJA 5B66H 4IL6E 1PZQA 2YXRB 2NZ2A 3OAKA 1YIJZ 3CCR1 2WSCJ 1YI21 2P58A 1K9MQ 3VMYA 1KQSY 2HFED 3Q5SA 3AE2C 1Y9BA 4DOJA 3Q1MA 2Y9ZA 3NH5A 1JJ2Y 5APSA 4OVNF 1AVOA 3CWBG 1QVFZ 4NBDA 4Y52I 1NU1K 2M5AB 3AE4C 3HUSA 5DJTB 2NPSA 1R5SA 3NFQA 3CCV1 1ZR4A 3QH9A 4HH2A 2JR8A 1ZMEC 1Q7Y2 1M901 3CXHH 3CME1 2WZ7A 1VQM1 2E5TA 3L70J 1KC82 3FQQA 3CCU1 2G3AA 1DD4A 3D9XA 2Q3EA 3P8CD 2ZYAA 3KQGA 3L72J 5FLXb 1LTSC 1K83I 1LP1A 1PP9J 2PK7A 2C9LY 5D1OA 4BXLA 1HUCA 3AEGC 1FOSE 1BSNA 4LLHA 3S17I 5KKZB 2JIQA 1JY3O 1HGVA 4RKUJ 3H25A 5IT9b 2NVXI 5BVZA 1VQ71 4W7ZA 1Q7YQ 1G2CA 4D6TG 1T8ZA 1W5CE 4MRIA 1KC8Q 4IL6X 3T4NB 4KT0J 4E2WA 2VPWA 3I5CA 1N73A 3L74E 1VQ4Z 5KKZC 1VF5B 3D6ZA 3C8VA 2Q4ZA 2XU6A 5H2FE 4TLFA 3SFEC 1JY2P 3M06A 4RVHA 4A3DI 1GTWA 2KB7P 3CC21 4DQYB 5D1PA 3MONA 2K1AA 2RT9A 2JWDA 1VF5D 2Q51A 3GTKI 4A3BI 2JIRA 3H1HD 2RIQA 1EDJA 3GTQI 1VQL1 3H6PA 1WJ2A 4PV1B 3II6A 3J80f 2OYHB 1SQPG 1MFZA 1FZAA 1SQBG 1Y1WI 1KQSZ 1NTZJ 2MJZA 3CCL1 1EZVG 4M3LA 2EGTA 2IYOA 4Y7NI 1M902 1JJ2Z 1X0TA 3GTLI 1LNQA 1Q821 2E75C 1BCCG 1PGOA 3GG2A 4PV1D 5LL6f 1FE6A 2LFUA 2DE5A 2F4OA 1SFCD 2Q5UA 2M3BA 2WT7B 3D70A 1S1CX 2BCCE 2OTJP 4PV1C 2OYHC 1RO0A 3H1LG 1YJ91 1SFCC 1SFCA 1VQ5P 1BGYJ 2QVAA 3N4XA 3AE3C 4NBGA 3CI9A 2JIMA 1P84E 3CCRP 3FXDA 1LTTC 1YI2P 2OOYB 1NTKE 1M90Q 3H32A 3AEBC 2P2UA 4YXWH 4BY1I 3CCM1 5KAFH 3F3FC 2IBZG 2H43A 1PFIA 2OTJZ 4PD4D 2RN0A 4E31A 1NTME 4I2LC 1VQ5Z 4QTUA 4UB8E 3ESWA 2ZYGA 2N9YB 1WW9A 1HBWA 1LTAC 3CCVP 1GU4A 1JMBA 3JAMb 3CD61 1PIXA 3CMEP 1VQMP 3L73G 3M91A 3EEDA 5A2Qb 1S4XA 3CCUP 3CCRZ 3P32A 1NKZB 1YI2Z 2FYUE 3S14I 3RZOI 3RK3E 1SQXE 4BBSI 3K5BA 1L0LJ 1OWAA 1H0TB 3H1IJ 3GTOI 2QJYB 2A45G 1NH4A 3TF5A 1YQ3C 1K731 2VPXA 2FKWB 1X3ZA 1L0NJ 1KQLA 1Q822 1YTZI 3CCVZ 1LT9A 3NMDA 1N2FA 3CMEZ 1VQMZ 1VQ7P 3F5HA 3TGUJ 2IFMA 3CCUZ 4K35A 4PJ0E 3J7A4 1QXFA 3S1KA 1P84I 2QJYC 3WUVA 4MXUA 1RHZB 1KN7A 1QVGO 4NOZA 2W6BA 2IYPA 3P8MC 2F4MA 2O01H 1NU1D 4A3EI 1VQ81 2WAQA 1NP6A 3U59A 5K5GB 3BRVB 1X22A 1VDFA 4YXDC 2BEZF 1URQD 3WUUA 1VQ7Z 1RF1A 4B86A 1Q16A 1VQLP 2OTL1 1URQC 1URQA 1KB9E 1A02F 1USPA 3CCLP 1T2KD 1LTJA 3AEAC 1FBMA 4GDOA 2QM7A 2MKVA 1NTMK 4EYYQ 2HODB 1KILB 1U57A 3L71G 4BBRI 3CC2Z 1T2KC 3BCCD 3L72E 5KJ7D 3H1JG 2R5DA 2BASA 3I56Z 1PP9E 3D2LA 4NPEA 2ZFCA 2OQQA 1NAFA 2Z5IA 4U3FD 1Y47A 1YJ9P 1KILD 5KJ7C 5KJ7A 1VQLZ 2WSEH 1K732 1SQXK 3IF8A 2P1JA 2KZIA 3JC22 2QE7H 2OOXB 2WTYA 5TISH 1KILC 3CCLZ 2PMZA 4ASVA 5BU5A 2G8YA 3HE5B 3NDIA 4L74A 1QYPA 3CLQA 3CCMP 4NFRA 2VUMI 1GL2B 5C39A 1JCDA 1QEXA 1MZ9A 1YJ9Z 4D6TJ 1TWGI 5B66E 5T67A 1I50I 3HOUI 3AE6C 5AW1B 1GL2D 2O01J 3HE5A 3CD6P 1WCMI 1RNIA 1DH3A 3R2PA 1GL2C 4NBFA 1YTZT 2E5YA 1CSBA 3CCMZ 2Y0EA 2M3EA 2YO2A 3RL0B 1NTZE 4I6MC 4N3YB 2O53A 1M1JB 4I7ZC 2C0WA 1OXZA 1NUIA 1RE4A 2A45H 4HJGH 1BDCA 1SQPJ 3J80b 3CXHE 1FDIA 1N7SB 3ABVC 1SQBJ 3CD6Z 3MP7B 1SQVJ 1U7MA 3T97A 2E7ZA 3RL0D 1RLYA 1L1OC 3PH0A 1DIPA 2P28A 4U7JA 2J5UA 2FFDC 2FFDA 1QVFO 1YUKA 3RL0C 1K9M1 4W7YA 1IFNA 4AUWA 3CPWY 1M1JC 1KD11 2YXQB 3LIDA 4RVDA 2WSEJ 1RH5B 3A7OA 4IOIH 3R4YA 3H1LJ 1VQ8P 4UB6H 4C46A 1YIT1 2KPIA 5APVA 3MUDC 3L74D 3FKII 2YU9I 3AE1C 1XTCC 3S15I 1JUNA 3Q87A 2QJKB 2YIUB 3SSUA 2WWWA 4H13B 1KFNA 2N1TD 2OTLP 2V3VA 1XTGB 4ZNCA 1PV3A 2WSFH 1SQQJ 3HE4A 2K3RA 1MKMA 2N1TC 2N1TA 3BASA 2NVTI 1RF0A 2WPVB 2AEJA 1FJKA 1VQ8Z 4K3AA 1AQTA 2P67A 5AW3B 4H13D 2B87A 3IAOA 1EQ7A 4IFFA 2JEEA 3MD0A 3H1KE 2QJKC 2YIUC 5KTBA 1L4AD 4EDFA 3OW2Y 4H13C 2HG5D 1QLED 3L37A 2KYVA 1TU3F 4HGZA 1EC5A 3HD7B 1PPJE 1FZCB 3A0BH 1Q7Y1 5APXA 1L4AC 1L4AA 2R3CA 2OTLZ 1AA6A 1L0NE 2B89A 5IP7I 2BCCD 3ITKA 2E42A 1ZV8A 1NO4A 3CX5H 1NU1G 2IX7C 2QREB 4O9BA 1R5LA 3TGUE 3HD7D 1IFMA 1NHLA 4HKZH 1YJWP 3HD7C 1FZCC 1P84D 3KZIH 1VQ91 1KD12 1GMJA 1NTKD 4EOTA 1FC2C 3KHUA 1I6HI 2JA6I 1Q812 2P3YA 2JO1A 4CL1A 3U1CA 1KFMA 4L75A 5AW5B 5APYA 3CPWZ 5AVZB 4DJGA 1NTMD 3S1MI 1S721 2RKLA 1TFIA 1G1JA 3BCCG 2O3JA 3FX0A 5KAFE 3TNUA 3H3VJ 3HUSB 2YADA 3NFZA 3CC71 2NPSB 3FGAD 2KNCA 3BRTB 4U3FG 2XV5A 2BJOA 1JCCA 2YO3A 2FYUD 1SQXD 1GK6A 1KD1Q 2WSFJ 1Y8CA 1KTMA 4BRYA 3EQ2A 4DGLA 2NPSD 1VQOP 3I4NI 2HR3A 2IFNA 3MTUE 2VPYA 3V4WA 2AXTH 3RK3C 1LP1B 1Q81Q 1JTHA 1OIPA 5D1OB 3LUSA 1KMIZ 3OJAB 4E32A 3HUSC 2HYNA 2NPSC 1GZLA 1AA0A 3L71J 1VQ6P 3H1JJ 2JP3A 1BE3J 1VQN1 3OW2Z 1WIIA 2L5GB 5KLVJ 3MGNA 3ZDMA 4PD4H 4MH4A 1G2CB 1YITP 3VMIA 1KYOH 3S16I 2Y9YA 2BEQD 3RGUA 2I8DA 3S1NI 1NWQA 1N73B 5T64A 2KXPB 1Q90D 4D6TE 2AKLA 4A3JI 2KLUA 1M7LA 1EDIA 2LKMA 3D71A 2KLVA 4AYCA 4EWCA 3Q5RA 1YITZ 1KB9D 3PTZA 1N73C 1FDOA 2AYDA 3D6WA 4A3FI 5CCGA 1PGQA 3G9RA 3NXSA 4R4MA 3EWKA 2IZ4A 2IV2X 3L72D 2E75B 1PP9D 1FU1A 2O1JA 1Z02A 1SQVE 4HH4A 1EZVE 4GOFA 3VMAA 2JKVA 3L74G 2E75D 1SFCB 4XA4A 1R9TI 1RO2A 3JCUE 3CCQ1 1VQ9P 2WITA 3H0GI 2KOGA 3H1LE 4MN4C 3SWKA 5TISE 4RO0A 3VP8A 3WMM0 3TYYA 1WRGA 2W8ZA 2QM8A 5GTIH 3H32B 5CCHC 5CCHA 4E2YA 1W2BO 4E33A 3GTMI 3VTPC 1S72P 1BDDA 4JPZB 4Y99B 1QL2A 4WB4A 3CC7P 1K8A2 2FXMA 4DZOA 1Y1VS 3BG0B 1ZRTE 1ZR2A 1JNMA 2IBZE 1VQ9Z 3I4MI 5AW8B 1SQQE 1QX8A 2KSJA 2O4HA 1M1KQ 1NVOA 1OZHA 1FZGA 1J2JB 2E74B 2BCCG 4N6JA 1FAVA 2JIPA 5AVWB 2YKOA 1LWUA 5C44I 2E2HI 2OYIA 1S72Z 4Y99C 3MZLB 3CXHD 2E74D 1TWCI 2GTHA 3HOVI 3CC7Z 2QRXA 1LT9B 1JY3P 3PRJA 1VQNP 1S3JA 2OGUA 1K8AQ 2E74C 3JSVC 3L75E 4CPGA 1WT6A 2QRDB 1YJN1 1IJDB 2H88C 2ZJSE 2SPZA 2QLVB 3F3PC 4NB9A 2W6JH 1NTMG 1DX7A 3S2HI 1ZH1A 1NU1J 3GKQA 5APWA 5APUA 2E9HA 1TWFI 3TK1A 3HKZA 4WWIA 1LT9C 1D7MA 3G711 1T6AA 1M57D 1OFCX 1JM0A 5FLMI 1DEEG 4YPCA 1VQNZ 2IDBA 2FYUG 1YHQ1 3BVHA 1YUAA 3E1RA 1SQXG 4RVGA 4YTPC 1X9VA 3M4OI 3IN6A 3V5BA 1RF1B 2K9JA 1NJI1 2N9BA 3CXCY 2E2II 1URQB 3M9BA 1USPB 5AVSB 1LTJB 1QL1A 3EFGA 1PGJA 3H1KD 3USSA 3KXDA 3NTNA 4U3FJ 2GTIA 1RF1C 2POHA 4GKGA 4XX2A 1JY2N 1MFTA 3S1QI 1NTKK 2HU9A 3E7KA 5B5EH 1L0ND 3L71E 2J6AA 3GTPI 1LTJC 1Z56A 3IFUA 5TJHA 1IK9A 3H1JE 3CCQP 3CWBJ 4AYBA 5CBOA 3TGUD 3L70E 3A0BE 3AE7C 1BE3E 4JYCA 3WU2E 1OW8A 5H2FH 5KLVE 5AW6B 4OH8B 3CX5E 2YKQA 3CCS1 1GK4A 1H8AA 1GDTA 1OMIA 2OARA 5KAIH 1QVGY 2FYUK 2KI7B 2ZXEB 2RMZA 4L73A 1NAYA 4NB8A 3VMZA 2OZKA 2YMYA 3KZIE 2A06E 3CCQZ 2J59M 2WPSA 2NAPA 1S5LH 3M0AA 3L72G 2Z5HA 3CC41 2NRGA 1PP9G 1OW7A 1YJW1 3PO3I 3H1HG 1NJI2 1N2DC 3AECC 3BATA 1X79B 3NH8A 2Y0DA 1RE3C 3B5NA 1RE3A 1FS0E 4I7ZB 3FWLA 1KB9I 4Y28J 2Z4EA 3CXCZ 3AEFC 4H0LB 3T97B 1KORA 4L76A 1P84H 3MIWA 2JJLA 1YJNP 1JB0J 1M56D 2ZAEB 1H89A 2JNYA 1Q861 3AEDC 2AXTE 1MUUA 2FFDB 5APQA 2VF1A 3CX5I 1W2EA 2KSEA 4QMAA 4H0LD 3IX0A 1RE4C 1NJIQ 3CCJ1 3MHVA 2W90A 3L74J 3G71P 2AEFA 1S7MA 1VQO1 4H0LC 1H88A 2CPBA 2O01N 2VPZA 3HTKA 2D2CB 2IZ0A 1YHQP 3AE9C 1BCCJ 1I3QI 4D6TD 1PFTA 2KUBA 3PJSK 1KYOE 5KLVK 1YJNZ 1VQ61 3GF7A 4NBHA 2WSSH 3GHGC 3GHGA 1BGYE 1KQGB 4RS4A 2M0BA 2HF1A 3SFDC 2D2CD 5DJUB 1MV8A 3VP9A 3LIEA 2K88A 2QEX1 1Q811 2QSIA 4BY7I 1E79H 3HE4B 1QVGZ 1YBKA 2N1TB 2WPRA 4HYTB 1HGZA 1LTBC 3G71Z 2D2CC 3M9QA 2IZ1A 2B87B 1PGPA 1HH0A 3O6QA 2B63I 2I3CA 2R44A 4XFJA 5E79H 2GM4A 1KZUB 3KIHA 2PFXA 3RK2B 1ZN5A 1L4AB 3V2NA 2ZVNB 2H89C 1SQVD 2FBWC 1CI6A 1RF0C 2J58A 1EDLA 1WMKA 1EXJA 3W67A 2ITAA 2E43A 1JWHC 3VN0A 4MD9A 5AVXB 3RK2D 1L0LE 3H1IE 3SWYA 2JDIH 3CCSP 1QVFY 3CXHI 3L73J 1Q862 1L2PA 5T6BA 4ASWA 4ZKUA 4C7NA 1JEKA 3RK2C 5AW9B 3H1LD 1K05A 1T3UA 3B71A 4H44B 1S2EA 2HPCA 1KYOI 1LTIC 4XE5B 1NTZK 1LJ2A 1N86A 3UIAA 3EFFK 2W03A 4LGDE 4BWNA 2P10A
chains in the Genus database with same CATH topology
5C4XI 3D6WA 3HOXI 4A3FI 2JR6A 1K731 4NH1C 1X3ZA 3CCSZ 3NH4A 2IZ4A 1TWHI 4NPFX 3HOYI 3TDHB 1Q822 3CCVZ 2QKDA 1KRLA 1N2FA 2G2KA 3CMEZ 2NVQI 1VQMZ 2R93I 3CCUZ 4K35A 1Z02A 3I07A 3MZKB 3J7A4 1OVVA 4NBBA 5C3EI 2H85A 4HH4A 3S1KA 4TNUA 1SFOI 2JMOA 4GOFA 4MXUA 4JBZA 2LIYA 4NOZA 1R9TI 1RO4A 5AN9F 4MD7A 1RO2A 1P9NA 2F4MA 4A3MI 3CC4Z 1N8R2 3CCQ1 1YJWZ 4A3EI 1VQ81 4MD8A 2WAQA 1NP6A 2WMMA 5K5GB 3H0GI 1VQPZ 4MN4C 3P5JB 1TWAI 1LQLA 1VQ7Z 3U50C 4E2YA 4E33A 2JS4A 3GTMI 2JA7I 3GTGI 2OTL1 1BDDA 1USPA 4HB1A 1OVRA 1YHQZ 1M1K1 1ML8A 1K8A2 1Y1VS 3BG0B 4EYYQ 1U7JA 1VQ9Z 3I4MI 4BBRI 3VMGA 3CC2Z 2O4HA 1VQ41 5IP9I 1NVOA 3I56Z 3PO2I 2IZ3A 4NPEA 2R6MA 3G4S1 2R7ZI 3CCJZ 1Y47A 4A93I 1VQOZ 2B88A 1VQLZ 2OTKE 2V8JA 5C44I 1K732 3IF8A 2E2HI 4A3LI 1S72Z 2LXCB 3MZLB 2KZIA 3QWUA 3CMAZ 2OOXB 3RZDI 3K7AI 2R92I 1TWCI 3S2DI 2GTHA 3CCLZ 1SS1A 3HOVI 2PMZA 1K8A1 4ASVA 1VQ6Z 3CC7Z 2QRXA 3GCFA 4X6AI 2KS1B 3CCEZ 4E2ZA 4RVFA 1S3JA 1ZXGA 2RPRA 3JAMf 3NDIA 2M5AA 1RQFA 4CPGA 1QYPA 2QRDB 1VQKZ 1YJN1 4NFRA 5A2Qf 2QEXZ 2VUMI 4DK1A 5C39A 4KJMA 2SPZA 2QLVB 3F3PC 4NB9A 1YJ9Z 1TWGI 2QR1B 3S2HI 1ZH1A 5T67A 3GKQA 3TE5B 1KC81 4QTTA 1I50I 2E9HA 1TWFI 3NDJA 3J81b 3HOUI 3HKZA 1LT1A 4WWIA 1QF8A 1ZW0A 4A3GI 3G711 1WCMI 2QRCB 2KZJA 1RNIA 3HOZI 1JM0A 5FLMI 1DEEG 4BXXI 2QA41 2GU2A 5EFWB 1VQNZ 4NBFA 5CBNA 2RBLA 3G6EZ 1YHQ1 1YUAA 2K5RA 4RVGA 3VTNA 3M4OI 3CCMZ 2Y0SA 1K9M2 1NJI1 4RV9A 3I55Z 2NVYI 1Y1VI 3VMHA 3CXCY 2E2II 2UWJE 2LXBA 2O53A 3PO3S 1USPB 4E2XA 3M3YI 3I561 1M1K2 1NUIA 4HJGH 4NBEA 1BDCA 3J80b 3KIFA 2OTJ1 3HOWI 4ZMDA 3CD6Z 1U7MA 2V8KA 2LR2A 1RLYA 1VQ51 5CM2M 1L1OC 3PH0A 2GTIA 2P28A 4XX2A 1MFTA 3S1QI 2KIKA 1YUKA 2HU9A 1K9M1 3CPWY 1KD11 2J6AA 1YIJZ 3CCR1 4RVDA 5C4JI 4A3KI 1YI21 3GTPI 2RHBA 4IOIH 2P58A 3IFUA 4AYBA 1KQSY 5CBOA 1YIT1 2KPIA 3NH5A 2M48A 1JJ2Y 3FKII 2YU9I 1QVFZ 1DL6A 4NBDA 2W04A 4Y52I 2M5AB 3S15I 5DJTB 3CCS1 3Q87A 3CCV1 2PM9A 1QVGY 1Q7Y2 1M901 3CME1 2KI7B 1VQM1 4ZNCA 1KC82 3FQQA 3CCU1 2E2JI 4NB8A 3D9XA 2JUBA 2OZKA 2K3RA 3CCQZ 2NVTI 5FLXb 1K83I 1VQ8Z 4K3AA 1LP1A 3MZWB 5D1OA 2B87A 2PK7A 4BXLA 3CQZI 1W2BY 3CC41 1VLAA 3OW2Y 3S17I 1YJW1 3PO3I 4NBCA 1NJI2 4HGZA 1EC5A 1Q7Y1 3FQMA 1VQP1 5IT9b 2OTLZ 2NVXI 1VQ71 2B89A 3NH8A 5IP7I 2M6NA 1Z01A 4MRIA 2QREB 3J81f 3T4NB 4E2WA 3CXCZ 2VUGA 1VQ4Z 4HKZH 2Q4ZA 2ZAEB 4NPDA 2JNYA 4NBAA 3G4SZ 4RVHA 1Q861 2JA5I 4A3DI 1VQ91 1KD12 3VB9A 3CC21 2VF1A 4DQYB 1FC2C 5D1PA 1Z03A 3MONA 3IX0A 2RT9A 2JWDA 2Q51A 1I6HI 2JA6I 1Q812 2P3YA 4GODA 3CCJ1 3GTKI 3EERA 1H0TA 4A3BI 3MHVA 4CL1A 2RIQA 3CPWZ 1EDJA 1S7MA 1VQO1 3GTQI 1VQL1 3J80f 1S721 3S1MI 2RKLA 1TFIA 4E30A 2WB1A 1Y1WI 1KQSZ 3CMA1 1I3QI 1PFTA 3CCL1 3H3VJ 2KUBA 3NFZA 2YADA 1YJNZ 1VQ61 2EGTA 3CC71 4Y7NI 4NBHA 1M902 1X0TA 1JJ2Z 3GTLI 1Q821 3CCE1 3QWOC 2BJOA 4RS4A 2M0BA 4GOEA 5LL6f 2HF1A 2LFUA 2DE5A 3GTJI 5DJUB 2F4OA 1VQK1 3FXEA 2QEX1 1Q811 4BY7I 2V8IA 1QVGZ 4DGLA 3I4NI 2DE7A 2HR3A 1X3WA 1RO0A 3G71Z 1YJ91 1LP1B 4MONA 5D1OB 2B87B 3LUSA 2Q1KA 4E32A 2QA4Z 3S1RI 2B63I 2I3CA 2QVAA 2R44A 4NBGA 1N8R1 4HGYA 4S1TA 4A3II 3KIHA 3FXDA 1W2BZ 2OOYB 1VQN1 3G6E1 3OW2Z 1WIIA 1Q2NA 4BY1I 3ZDMA 3CCM1 1EDLA 3BG1B 4MH4A 3F3FC 3VMIA 3S16I 2OTJZ 3I551 3RGUA 1JWHC 4MD9A 1ZB8A 4E31A 2I8DA 1ZB9A 1EDKA 5FLXf 3S1NI 1VQ5Z 4QTUA 2JA8I 3ESWA 1QVFY 3GTMS 5T64A 1WW9A 1OVUA 1Q862 5T6BA 4ASWA 1JMBA 2AKLA 3JAMb 4A3JI 3CD61 2DE6A 3EEDA 5A2Qb 1EDIA 3CCRZ 1YI2Z 4A3CI 3S14I 3RZOI 5IT9f 4EWCA 4BBSI 1H0TB 1YITZ 3GTOI 2W03A 1YIJ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZI A;  5CBO A;  2RKL A;  1SS1 A;  4ASV A;  2QRX A;  4NPF X;  2KS1 B;  2KUB A;  1S3J A;  1ZXG A;  2M5A B;  5DJT B;  2M5A A;  1X0T A;  4CPG A;  3QWO C;  2M0B A;  4GOE A;  4K35 A;  2KI7 B;  5C39 A;  5DJU B;  1OVV A;  3FXE A;  4ZNC A;  4KJM A;  2SPZ A;  3S1K A;  4GOF A;  4JBZ A;  2K3R A;  2HR3 A;  1LP1 B;  4K3A A;  1LP1 A;  1LT1 A;  2B87 B;  4WWI A;  1ZW0 A;  2Q1K A;  2B87 A;  3MZW B;  4BXL A;  2KZJ A;  1JM0 A;  2QVA A;  1DEE G;  2R44 A;  2WMM A;  5K5G B;  5EFW B;  5CBN A;  4MN4 C;  1EC5 A;  3FXD A;  1Q2N A;  2B89 A;  3ZDM A;  1EDL A;  2UWJ E;  2LXB A;  1BDD A;  3RGU A;  4HB1 A;  1OVR A;  4HJG H;  2I8D A;  1EDK A;  1BDC A;  4ZMD A;  1U7M A;  1OVU A;  4EYY Q;  1U7J A;  2LR2 A;  4ASW A;  1JMB A;  4HKZ H;  2ZAE B;  4NPD A;  3PH0 A;  1NVO A;  1MFT A;  2KIK A;  1EDI A;  4NPE A;  1FC2 C;  1Y47 A;  2JWD A;  2B88 A;  1H0T B;  4GOD A;  2OTK E;  4IOI H;  1H0T A;  3MHV A;  2P58 A;  1EDJ A;  2LXC B; 
#chains in the Genus database with same CATH topology
 4A7P A;  5C4X I;  3HOX I;  3H1K G;  2XZR A;  3M0D A;  5GTH H;  2R3S A;  4H44 D;  3CC4 P;  3V2Q A;  2KK7 A;  3D6Y A;  1ZRT D;  3NH4 A;  3CCS Z;  1CZQ A;  4NPF X;  2IBZ D;  2ZYD A;  3TNU B;  1IFP A;  3TDH B;  1SQQ D;  1KQS O;  2KS1 A;  2KNC B;  4H44 C;  1KRL A;  1SQX J;  2G2K A;  1Q86 Q;  2NVQ I;  1L0N G;  4JQ0 D;  1T3J A;  1JY2 O;  1DEB A;  4DT0 A;  1SVF A;  3AE8 C;  5C3E I;  5AW2 B;  2H85 A;  4BRY B;  1SFO I;  2JMO A;  3TGU G;  2LIY A;  3RK3 B;  2KP8 A;  1JTH B;  5AN9 F;  2WQY C;  4MD7 A;  1WZN A;  4C7R A;  1AV1 A;  1P9N A;  3CC4 Z;  2AXC A;  1IFI A;  1YJW Z;  3PP5 A;  4MD8 A;  4WY4 A;  2WMM A;  3L75 D;  5AW4 B;  3CWB E;  3RK3 D;  3P5J B;  1TWA I;  1LQL A;  2FXP A;  3U50 C;  3CCJ P;  4RJT A;  2JS4 A;  2B9B A;  5KLI C;  2CK3 H;  4HB1 A;  2AEM A;  3IFM A;  4OGQ B;  1M1K 1;  5AVQ B;  3V4Q A;  1L0L K;  5AVY B;  1S9K E;  2QEX P;  1AFO A;  3PO2 I;  4GIF A;  3Q2Y A;  2R6M A;  3G4S 1;  4OGQ D;  2R7Z I;  1IK7 A;  3CCJ Z;  1L0N K;  1VQO Z;  4A3L I;  4OGQ C;  1FZF A;  2LXC B;  1NGM B;  4JYB A;  1USE A;  3B8E B;  1R8E A;  3QWU A;  2V7Q H;  1HTL C;  3RZD I;  3K7A I;  2WPQ A;  3S2D I;  3LW5 H;  1K8A 1;  1VQ6 Z;  2V4H A;  3L36 A;  3GCF A;  4X6A I;  2H7H A;  1VQ4 P;  4RVF A;  2M5A A;  3H1H J;  3A3Y B;  5CCG D;  1CW5 A;  2QEX Z;  2O1K A;  4DK1 A;  2VRS A;  4Z1M H;  3L71 D;  1DD3 A;  4KJM A;  1VL2 A;  3A2A A;  5CCG C;  3H1J D;  3TE5 B;  2RH0 A;  3L70 D;  1RQV A;  1BE3 D;  4DCK A;  1QF8 A;  1ZW0 A;  5B5E E;  5KLV D;  4I1L A;  3HOZ I;  3HRN A;  3CX5 D;  2QA4 1;  1SQP E;  5M1B A;  2GU2 A;  5CBN A;  1SQB E;  2K5R A;  2QIW A;  2LEX A;  3IF4 A;  4N78 E;  1IFJ A;  3N7N A;  1QGK B;  1BCC E;  2NVY I;  3VMH A;  1UIX A;  2LXB A;  2UWJ E;  3KDP B;  4WBA A;  3PLN A;  2A06 D;  4E2X A;  1IC2 A;  3L4F A;  3A0H H;  2Q9I A;  3I56 1;  1J1D B;  1M1K 2;  2Q3I A;  5KAI E;  3KIF A;  3S9O A;  5CCH D;  1Y8A A;  1KV4 A;  4ZMD A;  1FDM A;  2YMK A;  2I1J A;  2V8K A;  1VF5 C;  5CM2 M;  1SQV G;  2GA1 A;  2FYZ A;  2KIK A;  2YNY A;  1S5L E;  2DW3 A;  1J1D C;  5C4J I;  1LWU B;  4A3K I;  2RHB A;  2OYI B;  3M9H A;  2V7Q J;  2CPS A;  3LW5 J;  5BU8 B;  2M48 A;  2R5B A;  2OYH A;  5AVU B;  1DL6 A;  2W04 A;  2IPP A;  1NTZ D;  2PM9 A;  1LWU C;  5AVR B;  2JWA A;  2OYI C;  3L73 E;  2FY8 A;  2WT7 A;  1GW4 A;  2E2J I;  2JUB A;  1EZV I;  3RL0 g;  1NKN A;  4IL6 H;  4KHX A;  1SQQ G;  3MZW B;  3CQZ I;  1FOS F;  1NTK G;  2ZT9 B;  1KYO D;  1W2B Y;  1BSH A;  1VLA A;  5AW7 B;  3G4S P;  1JMM A;  4NBC A;  1SQP K;  1BGY D;  3Q3D A;  3FQM A;  1VQP 1;  1SQB K;  2K9J B;  1SP4 A;  1SQV K;  2W6A A;  2ZT9 D;  3VMX A;  2R32 A;  1AJY A;  2M6N A;  1Z01 A;  4W80 A;  2ZXX A;  3H1K J;  3J81 f;  2ZT9 C;  2M8R A;  2VUG A;  1S5L X;  3L75 G;  4UB6 E;  1GD2 E;  4LC1 A;  3VOP A;  2IBZ I;  1KQF B;  4NPD A;  4NBA A;  3G4S Z;  2JA5 I;  2HLO A;  3VB9 A;  2L91 A;  5CHX A;  1Z03 A;  3IR9 A;  1HJB A;  1ZOY C;  2GUS A;  4GOD A;  3EER A;  4AQR D;  1AVY A;  1H0T A;  5E79 E;  4IFM A;  2WVR A;  2FYN B;  2V45 A;  3P8C E;  3BCC J;  1FJP A;  1M8O B;  1L0L D;  4EI2 A;  2QA4 P;  3H1I D;  4E30 A;  2WB1 A;  3CMA 1;  1SLQ A;  2PP6 A;  1SQQ K;  1PPJ D;  1UII A;  3G3Z A;  3AE5 C;  2K37 A;  3CCE 1;  3QWO C;  3CC2 P;  2A45 I;  4GOE A;  3GTJ I;  1VQK 1;  3FXE A;  3I56 P;  2FYN C;  1Q82 Q;  5CMZ A;  3CL3 D;  2V8I A;  3GLM A;  1LTG C;  2DE7 A;  4ZKP A;  1X3W A;  1IZN B;  1YQ4 C;  3B4S A;  4EIJ A;  4MON A;  2Q1K A;  2QA4 Z;  3S1R I;  1NOH A;  4JF7 A;  1N8R 1;  4HGY A;  5GTH E;  4S1T A;  4A3I I;  1W2B Z;  1E5W A;  3G6E 1;  1Q2N A;  3B5N B;  3L70 G;  3BG1 B;  1BE3 G;  3H1H E;  3JCU H;  3I55 1;  5KLV G;  1ZB8 A;  1ZB9 A;  5FLX f;  1EDK A;  2JA8 I;  3Q5P A;  3GTM S;  1OVU A;  3B5N D;  2HOD A;  1KIL A;  2Q6Q A;  3IR7 A;  3CWB D;  3V2P A;  2DE6 A;  2I1K A;  3RBX A;  1RQU A;  1HWT C;  3B5N C;  4A3C I;  5IT9 f;  2A06 G;  3S4R A;  3A5T A;  3C1L A;  3C9I A;  4GT1 A;  1YIJ 1;  2JR6 A;  3CPW O;  1USD A;  2YKP A;  3HTK B;  4NH1 C;  2JIO A;  1TWH I;  3HOY I;  1NYH A;  1K73 Q;  1VQP P;  2QKD A;  1JY3 N;  3GW6 A;  2XKM A;  2ZVO B;  3GHG B;  1S9K D;  3FWN A;  2R93 I;  1GL2 A;  3KYQ A;  3I07 A;  4UB8 H;  1ZLL A;  3MZK B;  1OVV A;  4NBB A;  3P7K A;  2K9Y A;  4TNU A;  2QJP B;  4JBZ A;  2PAJ A;  3TSI A;  1RO4 A;  4PD4 E;  2FXO A;  1YYC A;  4A3M I;  1N8R 2;  3O6Q B;  1JO5 A;  2GUV A;  2W27 A;  2XND H;  3E1I A;  4OWF A;  1HJ0 A;  3V2R A;  5AVT B;  1NTZ G;  1VQP Z;  2Y0C A;  3PHL A;  2QJP C;  3W68 A;  2PGD A;  1CI6 B;  2JA7 I;  3OW2 O;  1IFD A;  1X8Y A;  2C0X A;  1N7S D;  3GTG I;  1PL5 A;  1M1J A;  1AQ5 A;  1N7L A;  1HVV A;  3CMA P;  1OVR A;  1YHQ Z;  4RES B;  1G1I A;  1N7S C;  1ML8 A;  1N7S A;  1SIW A;  4PJ0 H;  1JOC A;  1U7J A;  2C9N Y;  3CCE P;  4C7N B;  1SQP D;  1BGY G;  2BCC J;  3MUD A;  3VMG A;  5APT A;  1VQ4 1;  5IP9 I;  1N8R Q;  1IO4 A;  1SQB D;  1HF9 A;  1VQK P;  1RY3 A;  1OX3 A;  1GU5 A;  1EZV D;  1OW6 A;  2PRR A;  2IZ3 A;  2HPC B;  3SWF A;  4N78 D;  4TT3 H;  1BCC D;  2OYO A;  4A93 I;  2B88 A;  3V6I A;  2OTK E;  1A02 J;  2WSC H;  1K04 A;  2V8J A;  2Q7C A;  3CMA Z;  2R92 I;  4IFD K;  1NTK J;  2XNX A;  1SS1 A;  3AEE C;  1FZE A;  3U1A A;  1NU1 E;  3RBZ A;  1EXI A;  2KS1 B;  3CCE Z;  4E2Z A;  4PD4 I;  1ZXG A;  2RPR A;  3G6E P;  3JAM f;  1J1E B;  3A0H E;  3VYI A;  2E76 B;  1KB9 H;  1RQF A;  1VQK Z;  1GW3 A;  3GF3 A;  4R4L A;  1NTM J;  5A2Q f;  5AW0 B;  1ZP0 C;  3I55 P;  3TDK A;  5CJ4 A;  5L8R J;  3M0D C;  2QR1 B;  5GTI E;  1L0L G;  3WU2 H;  3H1I G;  2H8P D;  1KC8 1;  2E76 D;  4QTT A;  3NDJ A;  3J81 b;  2QG4 A;  1LT1 A;  4A3G I;  1PPJ G;  2P7J A;  3L75 J;  2FYU J;  2QRC B;  1J1E C;  2KZJ A;  4WY4 B;  2E76 C;  4BXX I;  5EFW B;  2RBL A;  3BCC E;  3G6E Z;  3L35 A;  3VTN A;  1VPC A;  3F89 A;  3HD7 A;  1FZC A;  2Y0S A;  1K9M 2;  2W83 C;  3L73 D;  4U3F E;  4WVZ A;  4RV9 A;  1YIJ P;  3I55 Z;  4WY4 D;  1Y1V I;  1KIL E;  3OA7 A;  3PO3 S;  5AVV B;  5KLI B;  1FZB A;  3M3Y I;  5CJ0 A;  4NBE A;  1LGH B;  4WY4 C;  3WUT A;  2OTJ 1;  3HOW I;  3O8Z A;  3GMA A;  2LR2 A;  3KPE A;  1VQ5 1;  2XDJ A;  5B66 H;  4IL6 E;  1PZQ A;  2YXR B;  2NZ2 A;  3OAK A;  1YIJ Z;  3CCR 1;  2WSC J;  1YI2 1;  2P58 A;  1K9M Q;  3VMY A;  1KQS Y;  2HFE D;  3Q5S A;  3AE2 C;  1Y9B A;  4DOJ A;  3Q1M A;  2Y9Z A;  3NH5 A;  1JJ2 Y;  5APS A;  4OVN F;  1AVO A;  3CWB G;  1QVF Z;  4NBD A;  4Y52 I;  1NU1 K;  2M5A B;  3AE4 C;  3HUS A;  5DJT B;  2NPS A;  1R5S A;  3NFQ A;  3CCV 1;  1ZR4 A;  3QH9 A;  4HH2 A;  2JR8 A;  1ZME C;  1Q7Y 2;  1M90 1;  3CXH H;  3CME 1;  2WZ7 A;  1VQM 1;  2E5T A;  3L70 J;  1KC8 2;  3FQQ A;  3CCU 1;  2G3A A;  1DD4 A;  3D9X A;  2Q3E A;  3P8C D;  2ZYA A;  3KQG A;  3L72 J;  5FLX b;  1LTS C;  1K83 I;  1LP1 A;  1PP9 J;  2PK7 A;  2C9L Y;  5D1O A;  4BXL A;  1HUC A;  3AEG C;  1FOS E;  1BSN A;  4LLH A;  3S17 I;  5KKZ B;  2JIQ A;  1JY3 O;  1HGV A;  4RKU J;  3H25 A;  5IT9 b;  2NVX I;  5BVZ A;  1VQ7 1;  4W7Z A;  1Q7Y Q;  1G2C A;  4D6T G;  1T8Z A;  1W5C E;  4MRI A;  1KC8 Q;  4IL6 X;  3T4N B;  4KT0 J;  4E2W A;  2VPW A;  3I5C A;  1N73 A;  3L74 E;  1VQ4 Z;  5KKZ C;  1VF5 B;  3D6Z A;  3C8V A;  2Q4Z A;  2XU6 A;  5H2F E;  4TLF A;  3SFE C;  1JY2 P;  3M06 A;  4RVH A;  4A3D I;  1GTW A;  2KB7 P;  3CC2 1;  4DQY B;  5D1P A;  3MON A;  2K1A A;  2RT9 A;  2JWD A;  1VF5 D;  2Q51 A;  3GTK I;  4A3B I;  2JIR A;  3H1H D;  2RIQ A;  1EDJ A;  3GTQ I;  1VQL 1;  3H6P A;  1WJ2 A;  4PV1 B;  3II6 A;  3J80 f;  2OYH B;  1SQP G;  1MFZ A;  1FZA A;  1SQB G;  1Y1W I;  1KQS Z;  1NTZ J;  2MJZ A;  3CCL 1;  1EZV G;  4M3L A;  2EGT A;  2IYO A;  4Y7N I;  1M90 2;  1JJ2 Z;  1X0T A;  3GTL I;  1LNQ A;  1Q82 1;  2E75 C;  1BCC G;  1PGO A;  3GG2 A;  4PV1 D;  5LL6 f;  1FE6 A;  2LFU A;  2DE5 A;  2F4O A;  1SFC D;  2Q5U A;  2M3B A;  2WT7 B;  3D70 A;  1S1C X;  2BCC E;  2OTJ P;  4PV1 C;  2OYH C;  1RO0 A;  3H1L G;  1YJ9 1;  1SFC C;  1SFC A;  1VQ5 P;  1BGY J;  2QVA A;  3N4X A;  3AE3 C;  4NBG A;  3CI9 A;  2JIM A;  1P84 E;  3CCR P;  3FXD A;  1LTT C;  1YI2 P;  2OOY B;  1NTK E;  1M90 Q;  3H32 A;  3AEB C;  2P2U A;  4YXW H;  4BY1 I;  3CCM 1;  5KAF H;  3F3F C;  2IBZ G;  2H43 A;  1PFI A;  2OTJ Z;  4PD4 D;  2RN0 A;  4E31 A;  1NTM E;  4I2L C;  1VQ5 Z;  4QTU A;  4UB8 E;  3ESW A;  2ZYG A;  2N9Y B;  1WW9 A;  1HBW A;  1LTA C;  3CCV P;  1GU4 A;  1JMB A;  3JAM b;  3CD6 1;  1PIX A;  3CME P;  1VQM P;  3L73 G;  3M91 A;  3EED A;  5A2Q b;  1S4X A;  3CCU P;  3CCR Z;  3P32 A;  1NKZ B;  1YI2 Z;  2FYU E;  3S14 I;  3RZO I;  3RK3 E;  1SQX E;  4BBS I;  3K5B A;  1L0L J;  1OWA A;  1H0T B;  3H1I J;  3GTO I;  2QJY B;  2A45 G;  1NH4 A;  3TF5 A;  1YQ3 C;  1K73 1;  2VPX A;  2FKW B;  1X3Z A;  1L0N J;  1KQL A;  1Q82 2;  1YTZ I;  3CCV Z;  1LT9 A;  3NMD A;  1N2F A;  3CME Z;  1VQM Z;  1VQ7 P;  3F5H A;  3TGU J;  2IFM A;  3CCU Z;  4K35 A;  4PJ0 E;  3J7A 4;  1QXF A;  3S1K A;  1P84 I;  2QJY C;  3WUV A;  4MXU A;  1RHZ B;  1KN7 A;  1QVG O;  4NOZ A;  2W6B A;  2IYP A;  3P8M C;  2F4M A;  2O01 H;  1NU1 D;  4A3E I;  1VQ8 1;  2WAQ A;  1NP6 A;  3U59 A;  5K5G B;  3BRV B;  1X22 A;  1VDF A;  4YXD C;  2BEZ F;  1URQ D;  3WUU A;  1VQ7 Z;  1RF1 A;  4B86 A;  1Q16 A;  1VQL P;  2OTL 1;  1URQ C;  1URQ A;  1KB9 E;  1A02 F;  1USP A;  3CCL P;  1T2K D;  1LTJ A;  3AEA C;  1FBM A;  4GDO A;  2QM7 A;  2MKV A;  1NTM K;  4EYY Q;  2HOD B;  1KIL B;  1U57 A;  3L71 G;  4BBR I;  3CC2 Z;  1T2K C;  3BCC D;  3L72 E;  5KJ7 D;  3H1J G;  2R5D A;  2BAS A;  3I56 Z;  1PP9 E;  3D2L A;  4NPE A;  2ZFC A;  2OQQ A;  1NAF A;  2Z5I A;  4U3F D;  1Y47 A;  1YJ9 P;  1KIL D;  5KJ7 C;  5KJ7 A;  1VQL Z;  2WSE H;  1K73 2;  1SQX K;  3IF8 A;  2P1J A;  2KZI A;  3JC2 2;  2QE7 H;  2OOX B;  2WTY A;  5TIS H;  1KIL C;  3CCL Z;  2PMZ A;  4ASV A;  5BU5 A;  2G8Y A;  3HE5 B;  3NDI A;  4L74 A;  1QYP A;  3CLQ A;  3CCM P;  4NFR A;  2VUM I;  1GL2 B;  5C39 A;  1JCD A;  1QEX A;  1MZ9 A;  1YJ9 Z;  4D6T J;  1TWG I;  5B66 E;  5T67 A;  1I50 I;  3HOU I;  3AE6 C;  5AW1 B;  1GL2 D;  2O01 J;  3HE5 A;  3CD6 P;  1WCM I;  1RNI A;  1DH3 A;  3R2P A;  1GL2 C;  4NBF A;  1YTZ T;  2E5Y A;  1CSB A;  3CCM Z;  2Y0E A;  2M3E A;  2YO2 A;  3RL0 B;  1NTZ E;  4I6M C;  4N3Y B;  2O53 A;  1M1J B;  4I7Z C;  2C0W A;  1OXZ A;  1NUI A;  1RE4 A;  2A45 H;  4HJG H;  1BDC A;  1SQP J;  3J80 b;  3CXH E;  1FDI A;  1N7S B;  3ABV C;  1SQB J;  3CD6 Z;  3MP7 B;  1SQV J;  1U7M A;  3T97 A;  2E7Z A;  3RL0 D;  1RLY A;  1L1O C;  3PH0 A;  1DIP A;  2P28 A;  4U7J A;  2J5U A;  2FFD C;  2FFD A;  1QVF O;  1YUK A;  3RL0 C;  1K9M 1;  4W7Y A;  1IFN A;  4AUW A;  3CPW Y;  1M1J C;  1KD1 1;  2YXQ B;  3LID A;  4RVD A;  2WSE J;  1RH5 B;  3A7O A;  4IOI H;  3R4Y A;  3H1L J;  1VQ8 P;  4UB6 H;  4C46 A;  1YIT 1;  2KPI A;  5APV A;  3MUD C;  3L74 D;  3FKI I;  2YU9 I;  3AE1 C;  1XTC C;  3S15 I;  1JUN A;  3Q87 A;  2QJK B;  2YIU B;  3SSU A;  2WWW A;  4H13 B;  1KFN A;  2N1T D;  2OTL P;  2V3V A;  1XTG B;  4ZNC A;  1PV3 A;  2WSF H;  1SQQ J;  3HE4 A;  2K3R A;  1MKM A;  2N1T C;  2N1T A;  3BAS A;  2NVT I;  1RF0 A;  2WPV B;  2AEJ A;  1FJK A;  1VQ8 Z;  4K3A A;  1AQT A;  2P67 A;  5AW3 B;  4H13 D;  2B87 A;  3IAO A;  1EQ7 A;  4IFF A;  2JEE A;  3MD0 A;  3H1K E;  2QJK C;  2YIU C;  5KTB A;  1L4A D;  4EDF A;  3OW2 Y;  4H13 C;  2HG5 D;  1QLE D;  3L37 A;  2KYV A;  1TU3 F;  4HGZ A;  1EC5 A;  3HD7 B;  1PPJ E;  1FZC B;  3A0B H;  1Q7Y 1;  5APX A;  1L4A C;  1L4A A;  2R3C A;  2OTL Z;  1AA6 A;  1L0N E;  2B89 A;  5IP7 I;  2BCC D;  3ITK A;  2E42 A;  1ZV8 A;  1NO4 A;  3CX5 H;  1NU1 G;  2IX7 C;  2QRE B;  4O9B A;  1R5L A;  3TGU E;  3HD7 D;  1IFM A;  1NHL A;  4HKZ H;  1YJW P;  3HD7 C;  1FZC C;  1P84 D;  3KZI H;  1VQ9 1;  1KD1 2;  1GMJ A;  1NTK D;  4EOT A;  1FC2 C;  3KHU A;  1I6H I;  2JA6 I;  1Q81 2;  2P3Y A;  2JO1 A;  4CL1 A;  3U1C A;  1KFM A;  4L75 A;  5AW5 B;  5APY A;  3CPW Z;  5AVZ B;  4DJG A;  1NTM D;  3S1M I;  1S72 1;  2RKL A;  1TFI A;  1G1J A;  3BCC G;  2O3J A;  3FX0 A;  5KAF E;  3TNU A;  3H3V J;  3HUS B;  2YAD A;  3NFZ A;  3CC7 1;  2NPS B;  3FGA D;  2KNC A;  3BRT B;  4U3F G;  2XV5 A;  2BJO A;  1JCC A;  2YO3 A;  2FYU D;  1SQX D;  1GK6 A;  1KD1 Q;  2WSF J;  1Y8C A;  1KTM A;  4BRY A;  3EQ2 A;  4DGL A;  2NPS D;  1VQO P;  3I4N I;  2HR3 A;  2IFN A;  3MTU E;  2VPY A;  3V4W A;  2AXT H;  3RK3 C;  1LP1 B;  1Q81 Q;  1JTH A;  1OIP A;  5D1O B;  3LUS A;  1KMI Z;  3OJA B;  4E32 A;  3HUS C;  2HYN A;  2NPS C;  1GZL A;  1AA0 A;  3L71 J;  1VQ6 P;  3H1J J;  2JP3 A;  1BE3 J;  1VQN 1;  3OW2 Z;  1WII A;  2L5G B;  5KLV J;  3MGN A;  3ZDM A;  4PD4 H;  4MH4 A;  1G2C B;  1YIT P;  3VMI A;  1KYO H;  3S16 I;  2Y9Y A;  2BEQ D;  3RGU A;  2I8D A;  3S1N I;  1NWQ A;  1N73 B;  5T64 A;  2KXP B;  1Q90 D;  4D6T E;  2AKL A;  4A3J I;  2KLU A;  1M7L A;  1EDI A;  2LKM A;  3D71 A;  2KLV A;  4AYC A;  4EWC A;  3Q5R A;  1YIT Z;  1KB9 D;  3PTZ A;  1N73 C;  1FDO A;  2AYD A;  3D6W A;  4A3F I;  5CCG A;  1PGQ A;  3G9R A;  3NXS A;  4R4M A;  3EWK A;  2IZ4 A;  2IV2 X;  3L72 D;  2E75 B;  1PP9 D;  1FU1 A;  2O1J A;  1Z02 A;  1SQV E;  4HH4 A;  1EZV E;  4GOF A;  3VMA A;  2JKV A;  3L74 G;  2E75 D;  1SFC B;  4XA4 A;  1R9T I;  1RO2 A;  3JCU E;  3CCQ 1;  1VQ9 P;  2WIT A;  3H0G I;  2KOG A;  3H1L E;  4MN4 C;  3SWK A;  5TIS E;  4RO0 A;  3VP8 A;  3WMM 0;  3TYY A;  1WRG A;  2W8Z A;  2QM8 A;  5GTI H;  3H32 B;  5CCH C;  5CCH A;  4E2Y A;  1W2B O;  4E33 A;  3GTM I;  3VTP C;  1S72 P;  1BDD A;  4JPZ B;  4Y99 B;  1QL2 A;  4WB4 A;  3CC7 P;  1K8A 2;  2FXM A;  4DZO A;  1Y1V S;  3BG0 B;  1ZRT E;  1ZR2 A;  1JNM A;  2IBZ E;  1VQ9 Z;  3I4M I;  5AW8 B;  1SQQ E;  1QX8 A;  2KSJ A;  2O4H A;  1M1K Q;  1NVO A;  1OZH A;  1FZG A;  1J2J B;  2E74 B;  2BCC G;  4N6J A;  1FAV A;  2JIP A;  5AVW B;  2YKO A;  1LWU A;  5C44 I;  2E2H I;  2OYI A;  1S72 Z;  4Y99 C;  3MZL B;  3CXH D;  2E74 D;  1TWC I;  2GTH A;  3HOV I;  3CC7 Z;  2QRX A;  1LT9 B;  1JY3 P;  3PRJ A;  1VQN P;  1S3J A;  2OGU A;  1K8A Q;  2E74 C;  3JSV C;  3L75 E;  4CPG A;  1WT6 A;  2QRD B;  1YJN 1;  1IJD B;  2H88 C;  2ZJS E;  2SPZ A;  2QLV B;  3F3P C;  4NB9 A;  2W6J H;  1NTM G;  1DX7 A;  3S2H I;  1ZH1 A;  1NU1 J;  3GKQ A;  5APW A;  5APU A;  2E9H A;  1TWF I;  3TK1 A;  3HKZ A;  4WWI A;  1LT9 C;  1D7M A;  3G71 1;  1T6A A;  1M57 D;  1OFC X;  1JM0 A;  5FLM I;  1DEE G;  4YPC A;  1VQN Z;  2IDB A;  2FYU G;  1YHQ 1;  3BVH A;  1YUA A;  3E1R A;  1SQX G;  4RVG A;  4YTP C;  1X9V A;  3M4O I;  3IN6 A;  3V5B A;  1RF1 B;  2K9J A;  1NJI 1;  2N9B A;  3CXC Y;  2E2I I;  1URQ B;  3M9B A;  1USP B;  5AVS B;  1LTJ B;  1QL1 A;  3EFG A;  1PGJ A;  3H1K D;  3USS A;  3KXD A;  3NTN A;  4U3F J;  2GTI A;  1RF1 C;  2POH A;  4GKG A;  4XX2 A;  1JY2 N;  1MFT A;  3S1Q I;  1NTK K;  2HU9 A;  3E7K A;  5B5E H;  1L0N D;  3L71 E;  2J6A A;  3GTP I;  1LTJ C;  1Z56 A;  3IFU A;  5TJH A;  1IK9 A;  3H1J E;  3CCQ P;  3CWB J;  4AYB A;  5CBO A;  3TGU D;  3L70 E;  3A0B E;  3AE7 C;  1BE3 E;  4JYC A;  3WU2 E;  1OW8 A;  5H2F H;  5KLV E;  5AW6 B;  4OH8 B;  3CX5 E;  2YKQ A;  3CCS 1;  1GK4 A;  1H8A A;  1GDT A;  1OMI A;  2OAR A;  5KAI H;  1QVG Y;  2FYU K;  2KI7 B;  2ZXE B;  2RMZ A;  4L73 A;  1NAY A;  4NB8 A;  3VMZ A;  2OZK A;  2YMY A;  3KZI E;  2A06 E;  3CCQ Z;  2J59 M;  2WPS A;  2NAP A;  1S5L H;  3M0A A;  3L72 G;  2Z5H A;  3CC4 1;  2NRG A;  1PP9 G;  1OW7 A;  1YJW 1;  3PO3 I;  3H1H G;  1NJI 2;  1N2D C;  3AEC C;  3BAT A;  1X79 B;  3NH8 A;  2Y0D A;  1RE3 C;  3B5N A;  1RE3 A;  1FS0 E;  4I7Z B;  3FWL A;  1KB9 I;  4Y28 J;  2Z4E A;  3CXC Z;  3AEF C;  4H0L B;  3T97 B;  1KOR A;  4L76 A;  1P84 H;  3MIW A;  2JJL A;  1YJN P;  1JB0 J;  1M56 D;  2ZAE B;  1H89 A;  2JNY A;  1Q86 1;  3AED C;  2AXT E;  1MUU A;  2FFD B;  5APQ A;  2VF1 A;  3CX5 I;  1W2E A;  2KSE A;  4QMA A;  4H0L D;  3IX0 A;  1RE4 C;  1NJI Q;  3CCJ 1;  3MHV A;  2W90 A;  3L74 J;  3G71 P;  2AEF A;  1S7M A;  1VQO 1;  4H0L C;  1H88 A;  2CPB A;  2O01 N;  2VPZ A;  3HTK A;  2D2C B;  2IZ0 A;  1YHQ P;  3AE9 C;  1BCC J;  1I3Q I;  4D6T D;  1PFT A;  2KUB A;  3PJS K;  1KYO E;  5KLV K;  1YJN Z;  1VQ6 1;  3GF7 A;  4NBH A;  2WSS H;  3GHG C;  3GHG A;  1BGY E;  1KQG B;  4RS4 A;  2M0B A;  2HF1 A;  3SFD C;  2D2C D;  5DJU B;  1MV8 A;  3VP9 A;  3LIE A;  2K88 A;  2QEX 1;  1Q81 1;  2QSI A;  4BY7 I;  1E79 H;  3HE4 B;  1QVG Z;  1YBK A;  2N1T B;  2WPR A;  4HYT B;  1HGZ A;  1LTB C;  3G71 Z;  2D2C C;  3M9Q A;  2IZ1 A;  2B87 B;  1PGP A;  1HH0 A;  3O6Q A;  2B63 I;  2I3C A;  2R44 A;  4XFJ A;  5E79 H;  2GM4 A;  1KZU B;  3KIH A;  2PFX A;  3RK2 B;  1ZN5 A;  1L4A B;  3V2N A;  2ZVN B;  2H89 C;  1SQV D;  2FBW C;  1CI6 A;  1RF0 C;  2J58 A;  1EDL A;  1WMK A;  1EXJ A;  3W67 A;  2ITA A;  2E43 A;  1JWH C;  3VN0 A;  4MD9 A;  5AVX B;  3RK2 D;  1L0L E;  3H1I E;  3SWY A;  2JDI H;  3CCS P;  1QVF Y;  3CXH I;  3L73 J;  1Q86 2;  1L2P A;  5T6B A;  4ASW A;  4ZKU A;  4C7N A;  1JEK A;  3RK2 C;  5AW9 B;  3H1L D;  1K05 A;  1T3U A;  3B71 A;  4H44 B;  1S2E A;  2HPC A;  1KYO I;  1LTI C;  4XE5 B;  1NTZ K;  1LJ2 A;  1N86 A;  3UIA A;  3EFF K;  2W03 A;  4LGD E;  4BWN A;  2P10 A; 
#chains in the Genus database with same CATH homology
 5C4X I;  3D6W A;  3HOX I;  4A3F I;  2JR6 A;  1K73 1;  4NH1 C;  1X3Z A;  3CCS Z;  3NH4 A;  2IZ4 A;  1TWH I;  4NPF X;  3HOY I;  3TDH B;  1Q82 2;  3CCV Z;  2QKD A;  1KRL A;  1N2F A;  2G2K A;  3CME Z;  2NVQ I;  1VQM Z;  2R93 I;  3CCU Z;  4K35 A;  1Z02 A;  3I07 A;  3MZK B;  3J7A 4;  1OVV A;  4NBB A;  5C3E I;  2H85 A;  4HH4 A;  3S1K A;  4TNU A;  1SFO I;  2JMO A;  4GOF A;  4MXU A;  4JBZ A;  2LIY A;  4NOZ A;  1R9T I;  1RO4 A;  5AN9 F;  4MD7 A;  1RO2 A;  1P9N A;  2F4M A;  4A3M I;  3CC4 Z;  1N8R 2;  3CCQ 1;  1YJW Z;  4A3E I;  1VQ8 1;  4MD8 A;  2WAQ A;  1NP6 A;  2WMM A;  5K5G B;  3H0G I;  1VQP Z;  4MN4 C;  3P5J B;  1TWA I;  1LQL A;  1VQ7 Z;  3U50 C;  4E2Y A;  4E33 A;  2JS4 A;  3GTM I;  2JA7 I;  3GTG I;  2OTL 1;  1BDD A;  1USP A;  4HB1 A;  1OVR A;  1YHQ Z;  1M1K 1;  1ML8 A;  1K8A 2;  1Y1V S;  3BG0 B;  4EYY Q;  1U7J A;  1VQ9 Z;  3I4M I;  4BBR I;  3VMG A;  3CC2 Z;  2O4H A;  1VQ4 1;  5IP9 I;  1NVO A;  3I56 Z;  3PO2 I;  2IZ3 A;  4NPE A;  2R6M A;  3G4S 1;  2R7Z I;  3CCJ Z;  1Y47 A;  4A93 I;  1VQO Z;  2B88 A;  1VQL Z;  2OTK E;  2V8J A;  5C44 I;  1K73 2;  3IF8 A;  2E2H I;  4A3L I;  1S72 Z;  2LXC B;  3MZL B;  2KZI A;  3QWU A;  3CMA Z;  2OOX B;  3RZD I;  3K7A I;  2R92 I;  1TWC I;  3S2D I;  2GTH A;  3CCL Z;  1SS1 A;  3HOV I;  2PMZ A;  1K8A 1;  4ASV A;  1VQ6 Z;  3CC7 Z;  2QRX A;  3GCF A;  4X6A I;  2KS1 B;  3CCE Z;  4E2Z A;  4RVF A;  1S3J A;  1ZXG A;  2RPR A;  3JAM f;  3NDI A;  2M5A A;  1RQF A;  4CPG A;  1QYP A;  2QRD B;  1VQK Z;  1YJN 1;  4NFR A;  5A2Q f;  2QEX Z;  2VUM I;  4DK1 A;  5C39 A;  4KJM A;  2SPZ A;  2QLV B;  3F3P C;  4NB9 A;  1YJ9 Z;  1TWG I;  2QR1 B;  3S2H I;  1ZH1 A;  5T67 A;  3GKQ A;  3TE5 B;  1KC8 1;  4QTT A;  1I50 I;  2E9H A;  1TWF I;  3NDJ A;  3J81 b;  3HOU I;  3HKZ A;  1LT1 A;  4WWI A;  1QF8 A;  1ZW0 A;  4A3G I;  3G71 1;  1WCM I;  2QRC B;  2KZJ A;  1RNI A;  3HOZ I;  1JM0 A;  5FLM I;  1DEE G;  4BXX I;  2QA4 1;  2GU2 A;  5EFW B;  1VQN Z;  4NBF A;  5CBN A;  2RBL A;  3G6E Z;  1YHQ 1;  1YUA A;  2K5R A;  4RVG A;  3VTN A;  3M4O I;  3CCM Z;  2Y0S A;  1K9M 2;  1NJI 1;  4RV9 A;  3I55 Z;  2NVY I;  1Y1V I;  3VMH A;  3CXC Y;  2E2I I;  2UWJ E;  2LXB A;  2O53 A;  3PO3 S;  1USP B;  4E2X A;  3M3Y I;  3I56 1;  1M1K 2;  1NUI A;  4HJG H;  4NBE A;  1BDC A;  3J80 b;  3KIF A;  2OTJ 1;  3HOW I;  4ZMD A;  3CD6 Z;  1U7M A;  2V8K A;  2LR2 A;  1RLY A;  1VQ5 1;  5CM2 M;  1L1O C;  3PH0 A;  2GTI A;  2P28 A;  4XX2 A;  1MFT A;  3S1Q I;  2KIK A;  1YUK A;  2HU9 A;  1K9M 1;  3CPW Y;  1KD1 1;  2J6A A;  1YIJ Z;  3CCR 1;  4RVD A;  5C4J I;  4A3K I;  1YI2 1;  3GTP I;  2RHB A;  4IOI H;  2P58 A;  3IFU A;  4AYB A;  1KQS Y;  5CBO A;  1YIT 1;  2KPI A;  3NH5 A;  2M48 A;  1JJ2 Y;  3FKI I;  2YU9 I;  1QVF Z;  1DL6 A;  4NBD A;  2W04 A;  4Y52 I;  2M5A B;  3S15 I;  5DJT B;  3CCS 1;  3Q87 A;  3CCV 1;  2PM9 A;  1QVG Y;  1Q7Y 2;  1M90 1;  3CME 1;  2KI7 B;  1VQM 1;  4ZNC A;  1KC8 2;  3FQQ A;  3CCU 1;  2E2J I;  4NB8 A;  3D9X A;  2JUB A;  2OZK A;  2K3R A;  3CCQ Z;  2NVT I;  5FLX b;  1K83 I;  1VQ8 Z;  4K3A A;  1LP1 A;  3MZW B;  5D1O A;  2B87 A;  2PK7 A;  4BXL A;  3CQZ I;  1W2B Y;  3CC4 1;  1VLA A;  3OW2 Y;  3S17 I;  1YJW 1;  3PO3 I;  4NBC A;  1NJI 2;  4HGZ A;  1EC5 A;  1Q7Y 1;  3FQM A;  1VQP 1;  5IT9 b;  2OTL Z;  2NVX I;  1VQ7 1;  2B89 A;  3NH8 A;  5IP7 I;  2M6N A;  1Z01 A;  4MRI A;  2QRE B;  3J81 f;  3T4N B;  4E2W A;  3CXC Z;  2VUG A;  1VQ4 Z;  4HKZ H;  2Q4Z A;  2ZAE B;  4NPD A;  2JNY A;  4NBA A;  3G4S Z;  4RVH A;  1Q86 1;  2JA5 I;  4A3D I;  1VQ9 1;  1KD1 2;  3VB9 A;  3CC2 1;  2VF1 A;  4DQY B;  1FC2 C;  5D1P A;  1Z03 A;  3MON A;  3IX0 A;  2RT9 A;  2JWD A;  2Q51 A;  1I6H I;  2JA6 I;  1Q81 2;  2P3Y A;  4GOD A;  3CCJ 1;  3GTK I;  3EER A;  1H0T A;  4A3B I;  3MHV A;  4CL1 A;  2RIQ A;  3CPW Z;  1EDJ A;  1S7M A;  1VQO 1;  3GTQ I;  1VQL 1;  3J80 f;  1S72 1;  3S1M I;  2RKL A;  1TFI A;  4E30 A;  2WB1 A;  1Y1W I;  1KQS Z;  3CMA 1;  1I3Q I;  1PFT A;  3CCL 1;  3H3V J;  2KUB A;  3NFZ A;  2YAD A;  1YJN Z;  1VQ6 1;  2EGT A;  3CC7 1;  4Y7N I;  4NBH A;  1M90 2;  1X0T A;  1JJ2 Z;  3GTL I;  1Q82 1;  3CCE 1;  3QWO C;  2BJO A;  4RS4 A;  2M0B A;  4GOE A;  5LL6 f;  2HF1 A;  2LFU A;  2DE5 A;  3GTJ I;  5DJU B;  2F4O A;  1VQK 1;  3FXE A;  2QEX 1;  1Q81 1;  4BY7 I;  2V8I A;  1QVG Z;  4DGL A;  3I4N I;  2DE7 A;  2HR3 A;  1X3W A;  1RO0 A;  3G71 Z;  1YJ9 1;  1LP1 B;  4MON A;  5D1O B;  2B87 B;  3LUS A;  2Q1K A;  4E32 A;  2QA4 Z;  3S1R I;  2B63 I;  2I3C A;  2QVA A;  2R44 A;  4NBG A;  1N8R 1;  4HGY A;  4S1T A;  4A3I I;  3KIH A;  3FXD A;  1W2B Z;  2OOY B;  1VQN 1;  3G6E 1;  3OW2 Z;  1WII A;  1Q2N A;  4BY1 I;  3ZDM A;  3CCM 1;  1EDL A;  3BG1 B;  4MH4 A;  3F3F C;  3VMI A;  3S16 I;  2OTJ Z;  3I55 1;  3RGU A;  1JWH C;  4MD9 A;  1ZB8 A;  4E31 A;  2I8D A;  1ZB9 A;  1EDK A;  5FLX f;  3S1N I;  1VQ5 Z;  4QTU A;  2JA8 I;  3ESW A;  1QVF Y;  3GTM S;  5T64 A;  1WW9 A;  1OVU A;  1Q86 2;  5T6B A;  4ASW A;  1JMB A;  2AKL A;  3JAM b;  4A3J I;  3CD6 1;  2DE6 A;  3EED A;  5A2Q b;  1EDI A;  3CCR Z;  1YI2 Z;  4A3C I;  3S14 I;  3RZO I;  5IT9 f;  4EWC A;  4BBS I;  1H0T B;  1YIT Z;  3GTO I;  2W03 A;  1YIJ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...