3G4S1

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g4s100
1KC81 1Q821 1Q822 1KQSY 1VQ9Z 1YIT1 1M1K2 3I56Z 1VQ7Z 1M901 1M902 3CCLZ 1VQK1 3G71Z 3CD61 3CME1 3CC41 3CCUZ 3CCQZ 3CCSZ 1W2BY 1Q7Y1 1VQNZ 1Q7Y2 3CCJZ 1YJW1 3CPWY 3I55Z 1VQM1 1QVFY 3CC21 3CCR1 3CCEZ 1YJNZ 1YIJZ 3CC71 3CCM1 1VQL1 1YI21 2OTJZ 1KC82 1KD11 1KD12 1JJ2Z 3CXCY 3G4S1 1YITZ 1VQOZ 2OTLZ 1VQ8Z 3CCV1 1QVGY 1VQ61 1K9M1 1K9M2 3CD6Z 1Q861 1Q862 3CMEZ 3CC4Z 2QA41 1YJWZ 1Q811 1Q812 3I561 3G6E1 1VQMZ 1YJ9Z 3CCL1 1VQ4Z 1JJ2Y 3G711 3CC2Z 3CCRZ 2QEXZ 3CCU1 1VQ5Z 1YHQ1 3I551 1VQP1 1K8A1 1S721 1YJN1 1N8R1 1W2BZ 1VQKZ 3CMA1 1NJI1 1VQ91 1QVFZ 1VQ71 2QA4Z 3OW2Z 1M1K1 1VQO1 3G6EZ 2OTL1 1VQ81 1VQN1 3CCQ1 3CCS1 3CCJ1 3CC7Z 3CCMZ 1KQSZ 1VQLZ 1YI2Z 1YHQZ 3CXCZ 1K8A2 3CCE1 1YJ91 1VQPZ 1K731 1N8R2 1K732 3G4SZ 1YIJ1 1VQ41 1QVGZ 1NJI2 3OW2Y 2QEX1 2OTJ1 3CCVZ 3CPWZ 1VQ51 1S72Z 1VQ6Z 3CMAZ
chains in the Genus database with same CATH superfamily
5IT9f 2LFUA 3EERA 1KC81 1Z01A 2JIQA 3GCFA 5T67A 1YIT1 3HOXI 3PO3I 2H85A 2K5RA 3H3VJ 3CCLZ 3D9XA 3BG0B 1NP6A 1VQNZ 1W2BY 3NDIA 2R93I 4E32A 3HOVI 2QRCB 3IX0A 3I55Z 1VQM1 1WCMI 2V8KA 2NAPA 4NBBA 2R92I 5D1OA 3RZOI 4NBAA 3S2DI 3D2LA 2NVYI 1KC82 3J80f 4A3CI 3GTPI 3J81b 1TWHI 1YUAA 4RV9A 3G4S1 1SFOI 3NH5A 1K83I 4A3JI 1QVGY 1RO0A 1K9M2 4NB9A 1Q861 1SIWA 3F3PC 3VMGA 2VPZA 2M48A 2QKDA 1LQLA 4DK1A 3CCL1 2J6AA 3CCRZ 2QEXZ 5FLXb 1RO4A 3NFZA 2PM9A 1YHQ1 5IP9I 3I551 4RS4A 1R9TI 2BJOA 1N8R1 4RVGA 1TWGI 4RVFA 3GTGI 3GTJI 4BY7I 1ZB9A 3NH4A 1TWAI 2RIQA 3G6EZ 3CCQ1 2QR1B 4X6AI 1AA6A 3CC7Z 3CCMZ 1KQSZ 2HF1A 5C4XI 2JUBA 5IP7I 4E2XA 3CCE1 2B63I 1N8R2 2Q51A 2JIMA 4NH1C 2QEX1 1P9NA 1VQ6Z 3KIHA 4MD7A 1KQSY 1VQ9Z 2WAQA 3GTMI 3GTOI 1VQ7Z 2NVTI 1M902 3I4NI 2VUMI 4NBFA 1X3WA 3CD61 5LL6f 1KRLA 2W03A 3CME1 1QYPA 3CCUZ 3CCSZ 2RPRA 2LIYA 2IV2X 1YJW1 3S14I 4E30A 4MXUA 4A3FI 2P28A 1QVFY 3HOWI 2JS4A 2YADA 1JWHC 1YJNZ 2DE6A 1YIJZ 4S1TA 3CC71 3CCM1 3HOYI 3VMIA 3HOUI 2DE5A 1TWCI 4DQYB 3CXCY 2E2II 4A3LI 3MZKB 2OTLZ 4E33A 1VQ61 1K9M1 3GTKI 3CC4Z 1Q812 2R7ZI 3PO3S 2VUGA 4A3II 4A3KI 3M4OI 1YJ9Z 2PK7A 1VLAA 2VF1A 3GKQA 2O53A 2DE7A 3CC2Z 2EGTA 3S1NI 3CCU1 1I6HI 1X0TA 2V8JA 3HOZI 1Y1VI 1VQP1 1Z02A 5T6BA 1YJN1 1VQKZ 3IR7A 3RZDI 1NJI1 3P5JB 5A2Qf 4NFRA 3QWUA 3F3FC 2JA5I 3S17I 3I4MI 1N2FA 3T4NB 4BBSI 3S1QI 3S2HI 2OZKA 2RT9A 3ESWA 2QA4Z 2OTL1 1VQN1 1Y1WI 1WJ2A 2OOXB 4QTTA 2JIOA 4MONA 5T64A 4RVDA 3M3YI 4EWCA 1YJ91 1K732 2E2JI 1FDIA 3CQZI 1NJI2 2QRDB 1S72Z 1RO2A 3CMAZ 2AYDA 1Q822 3JAMf 3I56Z 4BXXI 3KIFA 2E7ZA 4Y52I 4HGYA 5AN9F 1M901 2WB1A 4RVHA 1VQK1 3G71Z 3IFUA 5IT9b 1USPB 1Q7Y2 3CCJZ 3VTNA 1RNIA 4A3BI 3CCR1 5CM2M 1X3ZA 3S1MI 5D1OB 3MZLB 4Y7NI 2OTJZ 1ZB8A 1TWFI 2IZ3A 4HGZA 2QREB 1KD12 1ML8A 4A3MI 1JJ2Z 1YITZ 2QLVB 1VQOZ 2JMOA 3FQMA 4MD8A 3J80b 1WIIA 2KI7B 2E2HI 3MONA 1PFTA 1Q811 3GTMS 2K3RA 3U50C 3I561 3G6E1 1VQMZ 2RHBA 2F4OA 2G2KA 4QTUA 1JJ2Y 3G711 1VQ5Z 4BY1I 5A2Qb 1Z03A 3EEDA 2JA8I 2VPYA 3K7AI 1K8A1 5C3EI 4NBDA 1W2BZ 1L1OC 1FDOA 3H0GI 1VQ91 2HU9A 4NBCA 2Y0SA 2JIPA 1VQ71 1M1K1 1VQO1 3TE5B 2ZAEB 2IZ4A 3S1RI 3CCS1 2V45A 2JR6A 3HKZA 4XX2A 4NOZA 3VB9A 4A3DI 1VQLZ 1YI2Z 1USPA 4CL1A 4HH4A 3JAMb 1YHQZ 1K8A2 3GTLI 1K731 3FQQA 1YIJ1 4MH4A 1QVGZ 4MD9A 1TFIA 3CCVZ 3CPWZ 1VQ51 1NUIA 4A3EI 1ZH1A 1Y1VS 3S16I 1DL6A 1Q821 3NH8A 1RLYA 4NBGA 1M1K2 2R6MA 3NDJA 2AKLA 3CC41 3CCQZ 2W04A 1Q7Y1 2O4HA 3CPWY 2YU9I 5C4JI 5D1PA 3D6WA 1I3QI 4E31A 3Q87A 3CC21 2VPXA 2RBLA 3CCEZ 3LUSA 2GTHA 1VQL1 1YI21 4NBHA 1Y8CA 2PMZA 4A93I 1KD11 2E9HA 3TDHB 2JA6I 2VPWA 5FLMI 2JNYA 2V8IA 2LEXA 1VQ8Z 3CCV1 3CD6Z 1Q862 1WW9A 3CMEZ 2GTIA 2QA41 1WZNA 3J81f 1YJWZ 1QXFA 4MRIA 1I50I 3I07A 3PO2I 2JA7I 2NVXI 1VQ4Z 1QF8A 2F4MA 4E2ZA 3BG1B 3FKII 3VMHA 2P3YA 3IF8A 4E2WA 2V3VA 1S721 2NVQI 4BBRI 3J7A4 3CMA1 5FLXf 1YUKA 2I3CA 3GTQI 1QVFZ 4NB8A 3OW2Z 1S7MA 1VQ81 3CCJ1 2M6NA 2KPIA 2GU2A 1Q16A 3CXCZ 4NBEA 4AYBA 5C44I 4A3GI 1VQPZ 3G4SZ 1VQ41 4TNUA 3S15I 3OW2Y 2JIRA 2OOYB 4E2YA 2OTJ1 1RQFA 2Q4ZA 4DGLA
chains in the Genus database with same CATH topology
5IT9f 2LFUA 3EERA 1KC81 1Z01A 3GCFA 5T67A 1YIT1 3HOXI 3PO3I 2H85A 2K5RA 3H3VJ 3CCLZ 3D9XA 3BG0B 1NP6A 1VQNZ 1W2BY 3NDIA 2R93I 4E32A 3HOVI 2QRCB 3IX0A 3I55Z 1VQM1 1WCMI 2V8KA 4NBBA 2R92I 5D1OA 3RZOI 4NBAA 3S2DI 2NVYI 1KC82 3J80f 4A3CI 3GTPI 3J81b 1TWHI 1YUAA 4RV9A 3G4S1 1SFOI 3NH5A 1K83I 4A3JI 1QVGY 1RO0A 1K9M2 4NB9A 1Q861 3F3PC 3VMGA 2M48A 2QKDA 1LQLA 4DK1A 3CCL1 2J6AA 3CCRZ 2QEXZ 5FLXb 1RO4A 3NFZA 2PM9A 1YHQ1 5IP9I 3I551 4RS4A 1R9TI 2BJOA 1N8R1 4RVGA 1TWGI 4RVFA 3GTGI 3GTJI 4BY7I 1ZB9A 3NH4A 1TWAI 2RIQA 3G6EZ 3CCQ1 2QR1B 4X6AI 3CC7Z 3CCMZ 1KQSZ 2HF1A 5C4XI 2JUBA 5IP7I 4E2XA 3CCE1 2B63I 1N8R2 2Q51A 4NH1C 2QEX1 1P9NA 1VQ6Z 3KIHA 4MD7A 1KQSY 1VQ9Z 2WAQA 3GTMI 3GTOI 1VQ7Z 2NVTI 1M902 3I4NI 2VUMI 4NBFA 1X3WA 3CD61 5LL6f 1KRLA 2W03A 3CME1 1QYPA 3CCUZ 3CCSZ 2RPRA 2LIYA 1YJW1 3S14I 4E30A 4MXUA 4A3FI 2P28A 1QVFY 3HOWI 2JS4A 2YADA 1JWHC 1YJNZ 2DE6A 1YIJZ 4S1TA 3CC71 3CCM1 3HOYI 3VMIA 3HOUI 2DE5A 1TWCI 4DQYB 3CXCY 2E2II 4A3LI 3MZKB 2OTLZ 4E33A 1VQ61 1K9M1 3GTKI 3CC4Z 1Q812 2R7ZI 3PO3S 2VUGA 4A3II 4A3KI 3M4OI 1YJ9Z 2PK7A 1VLAA 2VF1A 3GKQA 2O53A 2DE7A 3CC2Z 2EGTA 3S1NI 3CCU1 1I6HI 1X0TA 2V8JA 3HOZI 1Y1VI 1VQP1 1Z02A 5T6BA 1YJN1 1VQKZ 3RZDI 1NJI1 3P5JB 5A2Qf 4NFRA 3QWUA 3F3FC 2JA5I 3S17I 3I4MI 1N2FA 3T4NB 4BBSI 3S1QI 3S2HI 2OZKA 2RT9A 3ESWA 2QA4Z 2OTL1 1VQN1 1Y1WI 2OOXB 4QTTA 4MONA 5T64A 4RVDA 3M3YI 4EWCA 1YJ91 1K732 2E2JI 3CQZI 1NJI2 2QRDB 1S72Z 1RO2A 3CMAZ 1Q822 3JAMf 3I56Z 4BXXI 3KIFA 4Y52I 4HGYA 5AN9F 1M901 2WB1A 4RVHA 1VQK1 3G71Z 3IFUA 5IT9b 1USPB 1Q7Y2 3CCJZ 3VTNA 1RNIA 4A3BI 3CCR1 5CM2M 1X3ZA 3S1MI 5D1OB 3MZLB 4Y7NI 2OTJZ 1ZB8A 1TWFI 2IZ3A 4HGZA 2QREB 1KD12 1ML8A 4A3MI 1JJ2Z 1YITZ 2QLVB 1VQOZ 2JMOA 3FQMA 4MD8A 3J80b 1WIIA 2KI7B 2E2HI 3MONA 1PFTA 1Q811 3GTMS 2K3RA 3U50C 3I561 3G6E1 1VQMZ 2RHBA 2F4OA 2G2KA 4QTUA 1JJ2Y 3G711 1VQ5Z 4BY1I 5A2Qb 1Z03A 3EEDA 2JA8I 3K7AI 1K8A1 5C3EI 4NBDA 1W2BZ 1L1OC 3H0GI 1VQ91 2HU9A 4NBCA 2Y0SA 1VQ71 1M1K1 1VQO1 3TE5B 2ZAEB 2IZ4A 3S1RI 3CCS1 2JR6A 3HKZA 4XX2A 4NOZA 3VB9A 4A3DI 1VQLZ 1YI2Z 1USPA 4CL1A 4HH4A 3JAMb 1YHQZ 1K8A2 3GTLI 1K731 3FQQA 1YIJ1 4MH4A 1QVGZ 4MD9A 1TFIA 3CCVZ 3CPWZ 1VQ51 1NUIA 4A3EI 1ZH1A 1Y1VS 3S16I 1DL6A 1Q821 3NH8A 1RLYA 4NBGA 1M1K2 2R6MA 3NDJA 2AKLA 3CC41 3CCQZ 2W04A 1Q7Y1 2O4HA 3CPWY 2YU9I 5C4JI 5D1PA 3D6WA 1I3QI 4E31A 3Q87A 3CC21 2RBLA 3CCEZ 3LUSA 2GTHA 1VQL1 1YI21 4NBHA 4A93I 2PMZA 1KD11 2E9HA 3TDHB 2JA6I 5FLMI 2JNYA 2V8IA 1VQ8Z 3CCV1 3CD6Z 1Q862 1WW9A 3CMEZ 2GTIA 2QA41 3J81f 1YJWZ 4MRIA 1I50I 3I07A 3PO2I 2JA7I 2NVXI 1VQ4Z 1QF8A 2F4MA 4E2ZA 3BG1B 3FKII 3VMHA 2P3YA 3IF8A 4E2WA 1S721 2NVQI 4BBRI 3J7A4 3CMA1 5FLXf 1YUKA 2I3CA 3GTQI 1QVFZ 4NB8A 3OW2Z 1S7MA 1VQ81 3CCJ1 2M6NA 2KPIA 2GU2A 3CXCZ 4NBEA 4AYBA 5C44I 4A3GI 1VQPZ 3G4SZ 1VQ41 4TNUA 3S15I 3OW2Y 2OOYB 4E2YA 2OTJ1 1RQFA 2Q4ZA 4DGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 1;  1Q82 1;  1Q82 2;  1KQS Y;  1VQ9 Z;  1YIT 1;  1M1K 2;  3I56 Z;  1VQ7 Z;  1M90 1;  1M90 2;  3CCL Z;  1VQK 1;  3G71 Z;  3CD6 1;  3CME 1;  3CC4 1;  3CCU Z;  3CCQ Z;  3CCS Z;  1W2B Y;  1Q7Y 1;  1VQN Z;  1Q7Y 2;  3CCJ Z;  1YJW 1;  3CPW Y;  3I55 Z;  1VQM 1;  1QVF Y;  3CC2 1;  3CCR 1;  3CCE Z;  1YJN Z;  1YIJ Z;  3CC7 1;  3CCM 1;  1VQL 1;  1YI2 1;  2OTJ Z;  1KC8 2;  1KD1 1;  1KD1 2;  1JJ2 Z;  3CXC Y;  3G4S 1;  1YIT Z;  1VQO Z;  2OTL Z;  1VQ8 Z;  3CCV 1;  1QVG Y;  1VQ6 1;  1K9M 1;  1K9M 2;  3CD6 Z;  1Q86 1;  1Q86 2;  3CME Z;  3CC4 Z;  2QA4 1;  1YJW Z;  1Q81 1;  1Q81 2;  3I56 1;  3G6E 1;  1VQM Z;  1YJ9 Z;  3CCL 1;  1VQ4 Z;  1JJ2 Y;  3G71 1;  3CC2 Z;  3CCR Z;  2QEX Z;  3CCU 1;  1VQ5 Z;  1YHQ 1;  3I55 1;  1VQP 1;  1K8A 1;  1S72 1;  1YJN 1;  1N8R 1;  1W2B Z;  1VQK Z;  3CMA 1;  1NJI 1;  1VQ9 1;  1QVF Z;  1VQ7 1;  2QA4 Z;  3OW2 Z;  1M1K 1;  1VQO 1;  3G6E Z;  2OTL 1;  1VQ8 1;  1VQN 1;  3CCQ 1;  3CCS 1;  3CCJ 1;  3CC7 Z;  3CCM Z;  1KQS Z;  1VQL Z;  1YI2 Z;  1YHQ Z;  3CXC Z;  1K8A 2;  3CCE 1;  1YJ9 1;  1VQP Z;  1K73 1;  1N8R 2;  1K73 2;  3G4S Z;  1YIJ 1;  1VQ4 1;  1QVG Z;  1NJI 2;  3OW2 Y;  2QEX 1;  2OTJ 1;  3CCV Z;  3CPW Z;  1VQ5 1;  1S72 Z;  1VQ6 Z;  3CMA Z; 
#chains in the Genus database with same CATH topology
 5IT9 f;  2LFU A;  3EER A;  1KC8 1;  1Z01 A;  2JIQ A;  3GCF A;  5T67 A;  1YIT 1;  3HOX I;  3PO3 I;  2H85 A;  2K5R A;  3H3V J;  3CCL Z;  3D9X A;  3BG0 B;  1NP6 A;  1VQN Z;  1W2B Y;  3NDI A;  2R93 I;  4E32 A;  3HOV I;  2QRC B;  3IX0 A;  3I55 Z;  1VQM 1;  1WCM I;  2V8K A;  2NAP A;  4NBB A;  2R92 I;  5D1O A;  3RZO I;  4NBA A;  3S2D I;  3D2L A;  2NVY I;  1KC8 2;  3J80 f;  4A3C I;  3GTP I;  3J81 b;  1TWH I;  1YUA A;  4RV9 A;  3G4S 1;  1SFO I;  3NH5 A;  1K83 I;  4A3J I;  1QVG Y;  1RO0 A;  1K9M 2;  4NB9 A;  1Q86 1;  1SIW A;  3F3P C;  3VMG A;  2VPZ A;  2M48 A;  2QKD A;  1LQL A;  4DK1 A;  3CCL 1;  2J6A A;  3CCR Z;  2QEX Z;  5FLX b;  1RO4 A;  3NFZ A;  2PM9 A;  1YHQ 1;  5IP9 I;  3I55 1;  4RS4 A;  1R9T I;  2BJO A;  1N8R 1;  4RVG A;  1TWG I;  4RVF A;  3GTG I;  3GTJ I;  4BY7 I;  1ZB9 A;  3NH4 A;  1TWA I;  2RIQ A;  3G6E Z;  3CCQ 1;  2QR1 B;  4X6A I;  1AA6 A;  3CC7 Z;  3CCM Z;  1KQS Z;  2HF1 A;  5C4X I;  2JUB A;  5IP7 I;  4E2X A;  3CCE 1;  2B63 I;  1N8R 2;  2Q51 A;  2JIM A;  4NH1 C;  2QEX 1;  1P9N A;  1VQ6 Z;  3KIH A;  4MD7 A;  1KQS Y;  1VQ9 Z;  2WAQ A;  3GTM I;  3GTO I;  1VQ7 Z;  2NVT I;  1M90 2;  3I4N I;  2VUM I;  4NBF A;  1X3W A;  3CD6 1;  5LL6 f;  1KRL A;  2W03 A;  3CME 1;  1QYP A;  3CCU Z;  3CCS Z;  2RPR A;  2LIY A;  2IV2 X;  1YJW 1;  3S14 I;  4E30 A;  4MXU A;  4A3F I;  2P28 A;  1QVF Y;  3HOW I;  2JS4 A;  2YAD A;  1JWH C;  1YJN Z;  2DE6 A;  1YIJ Z;  4S1T A;  3CC7 1;  3CCM 1;  3HOY I;  3VMI A;  3HOU I;  2DE5 A;  1TWC I;  4DQY B;  3CXC Y;  2E2I I;  4A3L I;  3MZK B;  2OTL Z;  4E33 A;  1VQ6 1;  1K9M 1;  3GTK I;  3CC4 Z;  1Q81 2;  2R7Z I;  3PO3 S;  2VUG A;  4A3I I;  4A3K I;  3M4O I;  1YJ9 Z;  2PK7 A;  1VLA A;  2VF1 A;  3GKQ A;  2O53 A;  2DE7 A;  3CC2 Z;  2EGT A;  3S1N I;  3CCU 1;  1I6H I;  1X0T A;  2V8J A;  3HOZ I;  1Y1V I;  1VQP 1;  1Z02 A;  5T6B A;  1YJN 1;  1VQK Z;  3IR7 A;  3RZD I;  1NJI 1;  3P5J B;  5A2Q f;  4NFR A;  3QWU A;  3F3F C;  2JA5 I;  3S17 I;  3I4M I;  1N2F A;  3T4N B;  4BBS I;  3S1Q I;  3S2H I;  2OZK A;  2RT9 A;  3ESW A;  2QA4 Z;  2OTL 1;  1VQN 1;  1Y1W I;  1WJ2 A;  2OOX B;  4QTT A;  2JIO A;  4MON A;  5T64 A;  4RVD A;  3M3Y I;  4EWC A;  1YJ9 1;  1K73 2;  2E2J I;  1FDI A;  3CQZ I;  1NJI 2;  2QRD B;  1S72 Z;  1RO2 A;  3CMA Z;  2AYD A;  1Q82 2;  3JAM f;  3I56 Z;  4BXX I;  3KIF A;  2E7Z A;  4Y52 I;  4HGY A;  5AN9 F;  1M90 1;  2WB1 A;  4RVH A;  1VQK 1;  3G71 Z;  3IFU A;  5IT9 b;  1USP B;  1Q7Y 2;  3CCJ Z;  3VTN A;  1RNI A;  4A3B I;  3CCR 1;  5CM2 M;  1X3Z A;  3S1M I;  5D1O B;  3MZL B;  4Y7N I;  2OTJ Z;  1ZB8 A;  1TWF I;  2IZ3 A;  4HGZ A;  2QRE B;  1KD1 2;  1ML8 A;  4A3M I;  1JJ2 Z;  1YIT Z;  2QLV B;  1VQO Z;  2JMO A;  3FQM A;  4MD8 A;  3J80 b;  1WII A;  2KI7 B;  2E2H I;  3MON A;  1PFT A;  1Q81 1;  3GTM S;  2K3R A;  3U50 C;  3I56 1;  3G6E 1;  1VQM Z;  2RHB A;  2F4O A;  2G2K A;  4QTU A;  1JJ2 Y;  3G71 1;  1VQ5 Z;  4BY1 I;  5A2Q b;  1Z03 A;  3EED A;  2JA8 I;  2VPY A;  3K7A I;  1K8A 1;  5C3E I;  4NBD A;  1W2B Z;  1L1O C;  1FDO A;  3H0G I;  1VQ9 1;  2HU9 A;  4NBC A;  2Y0S A;  2JIP A;  1VQ7 1;  1M1K 1;  1VQO 1;  3TE5 B;  2ZAE B;  2IZ4 A;  3S1R I;  3CCS 1;  2V45 A;  2JR6 A;  3HKZ A;  4XX2 A;  4NOZ A;  3VB9 A;  4A3D I;  1VQL Z;  1YI2 Z;  1USP A;  4CL1 A;  4HH4 A;  3JAM b;  1YHQ Z;  1K8A 2;  3GTL I;  1K73 1;  3FQQ A;  1YIJ 1;  4MH4 A;  1QVG Z;  4MD9 A;  1TFI A;  3CCV Z;  3CPW Z;  1VQ5 1;  1NUI A;  4A3E I;  1ZH1 A;  1Y1V S;  3S16 I;  1DL6 A;  1Q82 1;  3NH8 A;  1RLY A;  4NBG A;  1M1K 2;  2R6M A;  3NDJ A;  2AKL A;  3CC4 1;  3CCQ Z;  2W04 A;  1Q7Y 1;  2O4H A;  3CPW Y;  2YU9 I;  5C4J I;  5D1P A;  3D6W A;  1I3Q I;  4E31 A;  3Q87 A;  3CC2 1;  2VPX A;  2RBL A;  3CCE Z;  3LUS A;  2GTH A;  1VQL 1;  1YI2 1;  4NBH A;  1Y8C A;  2PMZ A;  4A93 I;  1KD1 1;  2E9H A;  3TDH B;  2JA6 I;  2VPW A;  5FLM I;  2JNY A;  2V8I A;  2LEX A;  1VQ8 Z;  3CCV 1;  3CD6 Z;  1Q86 2;  1WW9 A;  3CME Z;  2GTI A;  2QA4 1;  1WZN A;  3J81 f;  1YJW Z;  1QXF A;  4MRI A;  1I50 I;  3I07 A;  3PO2 I;  2JA7 I;  2NVX I;  1VQ4 Z;  1QF8 A;  2F4M A;  4E2Z A;  3BG1 B;  3FKI I;  3VMH A;  2P3Y A;  3IF8 A;  4E2W A;  2V3V A;  1S72 1;  2NVQ I;  4BBR I;  3J7A 4;  3CMA 1;  5FLX f;  1YUK A;  2I3C A;  3GTQ I;  1QVF Z;  4NB8 A;  3OW2 Z;  1S7M A;  1VQ8 1;  3CCJ 1;  2M6N A;  2KPI A;  2GU2 A;  1Q16 A;  3CXC Z;  4NBE A;  4AYB A;  5C44 I;  4A3G I;  1VQP Z;  3G4S Z;  1VQ4 1;  4TNU A;  3S15 I;  3OW2 Y;  2JIR A;  2OOY B;  4E2Y A;  2OTJ 1;  1RQF A;  2Q4Z A;  4DGL A; 
#chains in the Genus database with same CATH homology
 5IT9 f;  2LFU A;  3EER A;  1KC8 1;  1Z01 A;  3GCF A;  5T67 A;  1YIT 1;  3HOX I;  3PO3 I;  2H85 A;  2K5R A;  3H3V J;  3CCL Z;  3D9X A;  3BG0 B;  1NP6 A;  1VQN Z;  1W2B Y;  3NDI A;  2R93 I;  4E32 A;  3HOV I;  2QRC B;  3IX0 A;  3I55 Z;  1VQM 1;  1WCM I;  2V8K A;  4NBB A;  2R92 I;  5D1O A;  3RZO I;  4NBA A;  3S2D I;  2NVY I;  1KC8 2;  3J80 f;  4A3C I;  3GTP I;  3J81 b;  1TWH I;  1YUA A;  4RV9 A;  3G4S 1;  1SFO I;  3NH5 A;  1K83 I;  4A3J I;  1QVG Y;  1RO0 A;  1K9M 2;  4NB9 A;  1Q86 1;  3F3P C;  3VMG A;  2M48 A;  2QKD A;  1LQL A;  4DK1 A;  3CCL 1;  2J6A A;  3CCR Z;  2QEX Z;  5FLX b;  1RO4 A;  3NFZ A;  2PM9 A;  1YHQ 1;  5IP9 I;  3I55 1;  4RS4 A;  1R9T I;  2BJO A;  1N8R 1;  4RVG A;  1TWG I;  4RVF A;  3GTG I;  3GTJ I;  4BY7 I;  1ZB9 A;  3NH4 A;  1TWA I;  2RIQ A;  3G6E Z;  3CCQ 1;  2QR1 B;  4X6A I;  3CC7 Z;  3CCM Z;  1KQS Z;  2HF1 A;  5C4X I;  2JUB A;  5IP7 I;  4E2X A;  3CCE 1;  2B63 I;  1N8R 2;  2Q51 A;  4NH1 C;  2QEX 1;  1P9N A;  1VQ6 Z;  3KIH A;  4MD7 A;  1KQS Y;  1VQ9 Z;  2WAQ A;  3GTM I;  3GTO I;  1VQ7 Z;  2NVT I;  1M90 2;  3I4N I;  2VUM I;  4NBF A;  1X3W A;  3CD6 1;  5LL6 f;  1KRL A;  2W03 A;  3CME 1;  1QYP A;  3CCU Z;  3CCS Z;  2RPR A;  2LIY A;  1YJW 1;  3S14 I;  4E30 A;  4MXU A;  4A3F I;  2P28 A;  1QVF Y;  3HOW I;  2JS4 A;  2YAD A;  1JWH C;  1YJN Z;  2DE6 A;  1YIJ Z;  4S1T A;  3CC7 1;  3CCM 1;  3HOY I;  3VMI A;  3HOU I;  2DE5 A;  1TWC I;  4DQY B;  3CXC Y;  2E2I I;  4A3L I;  3MZK B;  2OTL Z;  4E33 A;  1VQ6 1;  1K9M 1;  3GTK I;  3CC4 Z;  1Q81 2;  2R7Z I;  3PO3 S;  2VUG A;  4A3I I;  4A3K I;  3M4O I;  1YJ9 Z;  2PK7 A;  1VLA A;  2VF1 A;  3GKQ A;  2O53 A;  2DE7 A;  3CC2 Z;  2EGT A;  3S1N I;  3CCU 1;  1I6H I;  1X0T A;  2V8J A;  3HOZ I;  1Y1V I;  1VQP 1;  1Z02 A;  5T6B A;  1YJN 1;  1VQK Z;  3RZD I;  1NJI 1;  3P5J B;  5A2Q f;  4NFR A;  3QWU A;  3F3F C;  2JA5 I;  3S17 I;  3I4M I;  1N2F A;  3T4N B;  4BBS I;  3S1Q I;  3S2H I;  2OZK A;  2RT9 A;  3ESW A;  2QA4 Z;  2OTL 1;  1VQN 1;  1Y1W I;  2OOX B;  4QTT A;  4MON A;  5T64 A;  4RVD A;  3M3Y I;  4EWC A;  1YJ9 1;  1K73 2;  2E2J I;  3CQZ I;  1NJI 2;  2QRD B;  1S72 Z;  1RO2 A;  3CMA Z;  1Q82 2;  3JAM f;  3I56 Z;  4BXX I;  3KIF A;  4Y52 I;  4HGY A;  5AN9 F;  1M90 1;  2WB1 A;  4RVH A;  1VQK 1;  3G71 Z;  3IFU A;  5IT9 b;  1USP B;  1Q7Y 2;  3CCJ Z;  3VTN A;  1RNI A;  4A3B I;  3CCR 1;  5CM2 M;  1X3Z A;  3S1M I;  5D1O B;  3MZL B;  4Y7N I;  2OTJ Z;  1ZB8 A;  1TWF I;  2IZ3 A;  4HGZ A;  2QRE B;  1KD1 2;  1ML8 A;  4A3M I;  1JJ2 Z;  1YIT Z;  2QLV B;  1VQO Z;  2JMO A;  3FQM A;  4MD8 A;  3J80 b;  1WII A;  2KI7 B;  2E2H I;  3MON A;  1PFT A;  1Q81 1;  3GTM S;  2K3R A;  3U50 C;  3I56 1;  3G6E 1;  1VQM Z;  2RHB A;  2F4O A;  2G2K A;  4QTU A;  1JJ2 Y;  3G71 1;  1VQ5 Z;  4BY1 I;  5A2Q b;  1Z03 A;  3EED A;  2JA8 I;  3K7A I;  1K8A 1;  5C3E I;  4NBD A;  1W2B Z;  1L1O C;  3H0G I;  1VQ9 1;  2HU9 A;  4NBC A;  2Y0S A;  1VQ7 1;  1M1K 1;  1VQO 1;  3TE5 B;  2ZAE B;  2IZ4 A;  3S1R I;  3CCS 1;  2JR6 A;  3HKZ A;  4XX2 A;  4NOZ A;  3VB9 A;  4A3D I;  1VQL Z;  1YI2 Z;  1USP A;  4CL1 A;  4HH4 A;  3JAM b;  1YHQ Z;  1K8A 2;  3GTL I;  1K73 1;  3FQQ A;  1YIJ 1;  4MH4 A;  1QVG Z;  4MD9 A;  1TFI A;  3CCV Z;  3CPW Z;  1VQ5 1;  1NUI A;  4A3E I;  1ZH1 A;  1Y1V S;  3S16 I;  1DL6 A;  1Q82 1;  3NH8 A;  1RLY A;  4NBG A;  1M1K 2;  2R6M A;  3NDJ A;  2AKL A;  3CC4 1;  3CCQ Z;  2W04 A;  1Q7Y 1;  2O4H A;  3CPW Y;  2YU9 I;  5C4J I;  5D1P A;  3D6W A;  1I3Q I;  4E31 A;  3Q87 A;  3CC2 1;  2RBL A;  3CCE Z;  3LUS A;  2GTH A;  1VQL 1;  1YI2 1;  4NBH A;  4A93 I;  2PMZ A;  1KD1 1;  2E9H A;  3TDH B;  2JA6 I;  5FLM I;  2JNY A;  2V8I A;  1VQ8 Z;  3CCV 1;  3CD6 Z;  1Q86 2;  1WW9 A;  3CME Z;  2GTI A;  2QA4 1;  3J81 f;  1YJW Z;  4MRI A;  1I50 I;  3I07 A;  3PO2 I;  2JA7 I;  2NVX I;  1VQ4 Z;  1QF8 A;  2F4M A;  4E2Z A;  3BG1 B;  3FKI I;  3VMH A;  2P3Y A;  3IF8 A;  4E2W A;  1S72 1;  2NVQ I;  4BBR I;  3J7A 4;  3CMA 1;  5FLX f;  1YUK A;  2I3C A;  3GTQ I;  1QVF Z;  4NB8 A;  3OW2 Z;  1S7M A;  1VQ8 1;  3CCJ 1;  2M6N A;  2KPI A;  2GU2 A;  3CXC Z;  4NBE A;  4AYB A;  5C44 I;  4A3G I;  1VQP Z;  3G4S Z;  1VQ4 1;  4TNU A;  3S15 I;  3OW2 Y;  2OOY B;  4E2Y A;  2OTJ 1;  1RQF A;  2Q4Z A;  4DGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...