3G4S1

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g4s100
1NJI1 1VQ9Z 3CCU1 1Q811 1YI21 1S721 3CC41 1K731 3CCUZ 1K8A2 1M1K2 1YI2Z 1S72Z 3CC4Z 3CCL1 1JJ2Y 1YIJ1 3CCE1 1VQM1 3CD61 1K732 3CCLZ 1YIJZ 3CCEZ 1VQMZ 1K8A1 1K9M2 1VQP1 1JJ2Z 1M1K1 3CD6Z 1Q7Y2 2OTJ1 1VQ51 1Q862 1M901 1VQPZ 3CCM1 2OTJZ 1YJ91 1VQ5Z 3CPWY 1YHQ1 1QVGY 1K9M1 2QEX1 3CCMZ 3G6E1 3CCQ1 1VQ61 3CCS1 1M902 1Q7Y1 1YJ9Z 1W2BY 1VQL1 1Q861 1VQK1 2QEXZ 3CPWZ 3G6EZ 3CCQZ 3CCSZ 3G4S1 3CC21 1QVGZ 1VQLZ 1KD11 1VQKZ 3CCR1 1N8R2 1W2BZ 2OTL1 3CCV1 3G4SZ 3OW2Y 1KC82 3I561 3G711 3CCRZ 1YIT1 2OTLZ 1VQO1 3CCVZ 1YJW1 1KD12 1VQN1 3I56Z 3G71Z 1QVFY 3OW2Z 1YITZ 1N8R1 3CMA1 1VQOZ 1YJWZ 3CC71 1YHQZ 1VQ71 1VQNZ 3CME1 1KC81 1VQ81 1VQ6Z 3CXCY 3CMAZ 1Q821 1QVFZ 3CC7Z 3I551 1YJN1 1VQ7Z 2QA41 1VQ41 3CMEZ 1VQ8Z 1KQSY 3CC2Z 1NJI2 3CCJ1 3I55Z 1YJNZ 3CXCZ 2QA4Z 1Q822 1VQ4Z 1Q812 3CCJZ 1VQ91 1KQSZ
chains in the Genus database with same CATH superfamily
2G2KA 4MD9A 4A3CI 4MRIA 1Q811 3M3YI 2K3RA 1YI21 1NUIA 1K731 3CCUZ 1K8A2 3CC4Z 4BXXI 3CCL1 1ZB8A 2B63I 5A2Qb 4E32A 5FLXf 1VQM1 1YUAA 4Y52I 1USPB 1Y1WI 4RS4A 3Q87A 1YIJZ 1PFTA 1ZB9A 4BBSI 1K8A1 3TE5B 1RO0A 1K9M2 4A3KI 2NVTI 4MD8A 3BG1B 1VQ51 4E2ZA 3K7AI 1VQPZ 2E2JI 5C44I 3CCM1 4MD7A 2PMZA 4NBEA 3RZOI 2OOXB 3MZKB 3GTQI 2OTJZ 2M6NA 4E2WA 2E2II 1K9M1 2DE6A 3PO3S 1VQ61 2WB1A 3CCS1 4QTUA 4MONA 2QEXZ 3JAMb 3CCQZ 1L1OC 3G4S1 1I3QI 2V45A 2YU9I 2NAPA 3NFZA 4E31A 1VQKZ 2R6MA 1N8R2 2JIOA 5FLXb 3OW2Y 2VPXA 3I561 2WAQA 3HOYI 3VTNA 4QTTA 4S1TA 3CCVZ 1X3WA 4XX2A 3G71Z 1YITZ 1N8R1 1VQOZ 4E2XA 3CC71 3RZDI 4NB9A 3D9XA 3MZLB 3S2DI 3CME1 1VQ6Z 1Y1VS 3PO2I 2E9HA 3HOXI 1KQSY 2LIYA 1Q16A 4RVHA 1WZNA 2J6AA 5D1OA 2H85A 1LQLA 1X0TA 2QA4Z 2VPZA 1Q822 4E33A 1VQ4Z 5T67A 1S7MA 1ML8A 3VMGA 4RV9A 2JIPA 5AN9F 1RO4A 1SIWA 2JR6A 3CCU1 2NVXI 3QWUA 3S14I 5A2Qf 3S15I 3CC41 1TWFI 1WCMI 2RIQA 3HKZA 1NP6A 4HGZA 4TNUA 3NDIA 1S72Z 3J81b 1TWCI 5LL6f 1YIJ1 3FQMA 5T6BA 4A3II 1K732 3KIHA 2JIMA 3S1QI 3VMIA 5C4JI 2DE5A 4NH1C 1JJ2Z 1VQP1 3GTLI 3CD6Z 1QXFA 2OTJ1 3S17I 2QLVB 2V8IA 3H3VJ 2JIRA 3LUSA 4A93I 4X6AI 3JAMf 2O4HA 2P3YA 2GTIA 2QR1B 3F3PC 1YHQ1 4MXUA 2QEX1 3CCQ1 4RVFA 3GTMS 1VQK1 3KIFA 2W03A 3VB9A 4AYBA 2ZAEB 2IV2X 1QYPA 3G6EZ 3CPWZ 2JA7I 2F4OA 2E2HI 2RHBA 4CL1A 2R93I 5T64A 3F3FC 1W2BZ 2QRCB 3CCV1 2M48A 1KC82 2EGTA 3G711 1R9TI 1YIT1 2OTLZ 1VQO1 1RO2A 4E30A 1YJWZ 3IR7A 5CM2M 1YHQZ 3M4OI 1KC81 1JWHC 3CMAZ 1QVFZ 1VQ7Z 1YUKA 5FLMI 2DE7A 2QA41 2K5RA 1VQ41 3I55Z 3CXCZ 3J80b 3GTPI 3GTOI 4NOZA 3HOVI 1P9NA 3S1NI 2RBLA 1VQ9Z 3J81f 4HGYA 3S1MI 4A3GI 3PO3I 1USPA 1S721 1TWAI 2R7ZI 1M1K2 2QRDB 4RVGA 1JJ2Y 1Z02A 3ESWA 3CD61 4A3FI 2JA8I 2NVQI 2I3CA 1TWGI 3CCEZ 1AA6A 1M1K1 3U50C 2KI7B 4DK1A 1FDOA 2Q4ZA 1Q7Y2 1Z03A 4NBFA 1Q862 1M901 4MH4A 3P5JB 1ZH1A 3BG0B 2VUMI 2OOYB 3CPWY 4BY7I 4A3EI 4BBRI 1Y1VI 1RQFA 3G6E1 1Q7Y1 1VLAA 3D6WA 1YJ9Z 1W2BY 3HOUI 3MONA 3GTJI 1Q861 1K83I 3GKQA 3IFUA 4A3JI 2KPIA 3CC21 1QVGZ 1VQLZ 1KD11 3J7A4 5IP9I 2OTL1 2JMOA 4DQYB 5IP7I 3S1RI 2IZ3A 3GCFA 3CCRZ 3I4NI 3NH8A 1YJW1 4A3LI 2V8KA 1RLYA 1QVFY 1Y8CA 5IT9b 3CMA1 3NDJA 1WIIA 2QREB 4NB8A 4NBCA 1VQ71 1SFOI 1VQNZ 2JIQA 1QF8A 1TWHI 3J80f 2GU2A 3CXCY 3NH5A 2JA5I 3I551 4A3DI 2GTHA 2V8JA 1VQ8Z 2YADA 3CC2Z 1NJI2 1N2FA 1YJNZ 3TDHB 2NVYI 4A3MI 3CCJZ 2VF1A 1VQ91 2VPYA 1X3ZA 3H0GI 4Y7NI 4NBGA 5D1OB 3CQZI 1NJI1 2JA6I 3IX0A 1KRLA 2JNYA 5D1PA 3D2LA 2RPRA 1WJ2A 2JS4A 3GTMI 3T4NB 1YI2Z 1TFIA 3CCE1 3I4MI 2PK7A 4NBDA 3VMHA 4E2YA 3CCLZ 2O53A 1I50I 4HH4A 1VQMZ 2F4MA 3HOWI 2LEXA 2AYDA 3IF8A 2AKLA 3GTKI 1YJ91 1VQ5Z 5C3EI 3GTGI 1QVGY 3CCMZ 3EEDA 1M902 1RNIA 1VQL1 3NH4A 2R92I 3CCSZ 1I6HI 4DGLA 3FKII 3CCR1 5IT9f 3S2HI 3G4SZ 2JUBA 3S16I 2P28A 2VUGA 4BY1I 1KD12 4NBBA 1VQN1 2PM9A 3I56Z 2LFUA 4NFRA 1FDIA 3OW2Z 2BJOA 1Z01A 3EERA 2QKDA 3I07A 1WW9A 2Q51A 1VQ81 1Q821 2W04A 2HF1A 3CC7Z 1YJN1 2RT9A 2E7ZA 3HOZI 3CMEZ 4RVDA 3CCJ1 2OZKA 5C4XI 4NBHA 4NBAA 2VPWA 1Q812 2HU9A 3FQQA 1DL6A 2V3VA 2Y0SA 1KQSZ 4EWCA 4A3BI 2IZ4A
chains in the Genus database with same CATH topology
2G2KA 4MD9A 4A3CI 4MRIA 1Q811 3M3YI 2K3RA 1YI21 1NUIA 1K731 3CCUZ 1K8A2 3CC4Z 4BXXI 3CCL1 1ZB8A 2B63I 5A2Qb 4E32A 5FLXf 1VQM1 1YUAA 4Y52I 1USPB 1Y1WI 4RS4A 3Q87A 1YIJZ 1PFTA 1ZB9A 4BBSI 1K8A1 3TE5B 1RO0A 1K9M2 4A3KI 2NVTI 4MD8A 3BG1B 1VQ51 4E2ZA 3K7AI 1VQPZ 2E2JI 5C44I 3CCM1 4MD7A 2PMZA 4NBEA 3RZOI 2OOXB 3MZKB 3GTQI 2OTJZ 2M6NA 4E2WA 2E2II 1K9M1 2DE6A 3PO3S 1VQ61 2WB1A 3CCS1 4QTUA 4MONA 2QEXZ 3JAMb 3CCQZ 1L1OC 3G4S1 1I3QI 2YU9I 3NFZA 4E31A 1VQKZ 2R6MA 1N8R2 5FLXb 3OW2Y 3I561 2WAQA 3HOYI 3VTNA 4QTTA 4S1TA 3CCVZ 1X3WA 4XX2A 3G71Z 1YITZ 1N8R1 1VQOZ 4E2XA 3CC71 3RZDI 4NB9A 3D9XA 3MZLB 3S2DI 3CME1 1VQ6Z 1Y1VS 3PO2I 2E9HA 3HOXI 1KQSY 2LIYA 4RVHA 2J6AA 5D1OA 2H85A 1LQLA 1X0TA 2QA4Z 1Q822 4E33A 1VQ4Z 5T67A 1S7MA 1ML8A 3VMGA 4RV9A 5AN9F 1RO4A 2JR6A 3CCU1 2NVXI 3QWUA 3S14I 5A2Qf 3S15I 3CC41 1TWFI 1WCMI 2RIQA 3HKZA 1NP6A 4HGZA 4TNUA 3NDIA 1S72Z 3J81b 1TWCI 5LL6f 1YIJ1 3FQMA 5T6BA 4A3II 1K732 3KIHA 3S1QI 3VMIA 5C4JI 2DE5A 4NH1C 1JJ2Z 1VQP1 3GTLI 3CD6Z 2OTJ1 3S17I 2QLVB 2V8IA 3H3VJ 3LUSA 4A93I 4X6AI 3JAMf 2O4HA 2P3YA 2GTIA 2QR1B 3F3PC 1YHQ1 4MXUA 2QEX1 3CCQ1 4RVFA 3GTMS 1VQK1 3KIFA 2W03A 3VB9A 4AYBA 2ZAEB 1QYPA 3G6EZ 3CPWZ 2JA7I 2F4OA 2E2HI 2RHBA 4CL1A 2R93I 5T64A 3F3FC 1W2BZ 2QRCB 3CCV1 2M48A 1KC82 2EGTA 3G711 1R9TI 1YIT1 2OTLZ 1VQO1 1RO2A 4E30A 1YJWZ 5CM2M 1YHQZ 3M4OI 1KC81 1JWHC 3CMAZ 1QVFZ 1VQ7Z 1YUKA 5FLMI 2DE7A 2QA41 2K5RA 1VQ41 3I55Z 3CXCZ 3J80b 3GTPI 3GTOI 4NOZA 3HOVI 1P9NA 3S1NI 2RBLA 1VQ9Z 3J81f 4HGYA 3S1MI 4A3GI 3PO3I 1USPA 1S721 1TWAI 2R7ZI 1M1K2 2QRDB 4RVGA 1JJ2Y 1Z02A 3ESWA 3CD61 4A3FI 2JA8I 2NVQI 2I3CA 1TWGI 3CCEZ 1M1K1 3U50C 2KI7B 4DK1A 2Q4ZA 1Q7Y2 1Z03A 4NBFA 1Q862 1M901 4MH4A 3P5JB 1ZH1A 3BG0B 2VUMI 2OOYB 3CPWY 4BY7I 4A3EI 4BBRI 1Y1VI 1RQFA 3G6E1 1Q7Y1 1VLAA 3D6WA 1YJ9Z 1W2BY 3HOUI 3MONA 3GTJI 1Q861 1K83I 3GKQA 3IFUA 4A3JI 2KPIA 3CC21 1QVGZ 1VQLZ 1KD11 3J7A4 5IP9I 2OTL1 2JMOA 4DQYB 5IP7I 3S1RI 2IZ3A 3GCFA 3CCRZ 3I4NI 3NH8A 1YJW1 4A3LI 2V8KA 1RLYA 1QVFY 5IT9b 3CMA1 3NDJA 1WIIA 2QREB 4NB8A 4NBCA 1VQ71 1SFOI 1VQNZ 1QF8A 1TWHI 3J80f 2GU2A 3CXCY 3NH5A 2JA5I 3I551 4A3DI 2GTHA 2V8JA 1VQ8Z 2YADA 3CC2Z 1NJI2 1N2FA 1YJNZ 3TDHB 2NVYI 4A3MI 3CCJZ 2VF1A 1VQ91 1X3ZA 3H0GI 4Y7NI 4NBGA 5D1OB 3CQZI 1NJI1 2JA6I 3IX0A 1KRLA 2JNYA 5D1PA 2RPRA 2JS4A 3GTMI 3T4NB 1YI2Z 1TFIA 3CCE1 3I4MI 2PK7A 4NBDA 3VMHA 4E2YA 3CCLZ 2O53A 1I50I 4HH4A 1VQMZ 2F4MA 3HOWI 3IF8A 2AKLA 3GTKI 1YJ91 1VQ5Z 5C3EI 3GTGI 1QVGY 3CCMZ 3EEDA 1M902 1RNIA 1VQL1 3NH4A 2R92I 3CCSZ 1I6HI 4DGLA 3FKII 3CCR1 5IT9f 3S2HI 3G4SZ 2JUBA 3S16I 2P28A 2VUGA 4BY1I 1KD12 4NBBA 1VQN1 2PM9A 3I56Z 2LFUA 4NFRA 3OW2Z 2BJOA 1Z01A 3EERA 2QKDA 3I07A 1WW9A 2Q51A 1VQ81 1Q821 2W04A 2HF1A 3CC7Z 1YJN1 2RT9A 3HOZI 3CMEZ 4RVDA 3CCJ1 2OZKA 5C4XI 4NBHA 4NBAA 1Q812 2HU9A 3FQQA 1DL6A 2Y0SA 1KQSZ 4EWCA 4A3BI 2IZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI 1;  1VQ9 Z;  3CCU 1;  1Q81 1;  1YI2 1;  1S72 1;  3CC4 1;  1K73 1;  3CCU Z;  1K8A 2;  1M1K 2;  1YI2 Z;  1S72 Z;  3CC4 Z;  3CCL 1;  1JJ2 Y;  1YIJ 1;  3CCE 1;  1VQM 1;  3CD6 1;  1K73 2;  3CCL Z;  1YIJ Z;  3CCE Z;  1VQM Z;  1K8A 1;  1K9M 2;  1VQP 1;  1JJ2 Z;  1M1K 1;  3CD6 Z;  1Q7Y 2;  2OTJ 1;  1VQ5 1;  1Q86 2;  1M90 1;  1VQP Z;  3CCM 1;  2OTJ Z;  1YJ9 1;  1VQ5 Z;  3CPW Y;  1YHQ 1;  1QVG Y;  1K9M 1;  2QEX 1;  3CCM Z;  3G6E 1;  3CCQ 1;  1VQ6 1;  3CCS 1;  1M90 2;  1Q7Y 1;  1YJ9 Z;  1W2B Y;  1VQL 1;  1Q86 1;  1VQK 1;  2QEX Z;  3CPW Z;  3G6E Z;  3CCQ Z;  3CCS Z;  3G4S 1;  3CC2 1;  1QVG Z;  1VQL Z;  1KD1 1;  1VQK Z;  3CCR 1;  1N8R 2;  1W2B Z;  2OTL 1;  3CCV 1;  3G4S Z;  3OW2 Y;  1KC8 2;  3I56 1;  3G71 1;  3CCR Z;  1YIT 1;  2OTL Z;  1VQO 1;  3CCV Z;  1YJW 1;  1KD1 2;  1VQN 1;  3I56 Z;  3G71 Z;  1QVF Y;  3OW2 Z;  1YIT Z;  1N8R 1;  3CMA 1;  1VQO Z;  1YJW Z;  3CC7 1;  1YHQ Z;  1VQ7 1;  1VQN Z;  3CME 1;  1KC8 1;  1VQ8 1;  1VQ6 Z;  3CXC Y;  3CMA Z;  1Q82 1;  1QVF Z;  3CC7 Z;  3I55 1;  1YJN 1;  1VQ7 Z;  2QA4 1;  1VQ4 1;  3CME Z;  1VQ8 Z;  1KQS Y;  3CC2 Z;  1NJI 2;  3CCJ 1;  3I55 Z;  1YJN Z;  3CXC Z;  2QA4 Z;  1Q82 2;  1VQ4 Z;  1Q81 2;  3CCJ Z;  1VQ9 1;  1KQS Z; 
#chains in the Genus database with same CATH topology
 2G2K A;  4MD9 A;  4A3C I;  4MRI A;  1Q81 1;  3M3Y I;  2K3R A;  1YI2 1;  1NUI A;  1K73 1;  3CCU Z;  1K8A 2;  3CC4 Z;  4BXX I;  3CCL 1;  1ZB8 A;  2B63 I;  5A2Q b;  4E32 A;  5FLX f;  1VQM 1;  1YUA A;  4Y52 I;  1USP B;  1Y1W I;  4RS4 A;  3Q87 A;  1YIJ Z;  1PFT A;  1ZB9 A;  4BBS I;  1K8A 1;  3TE5 B;  1RO0 A;  1K9M 2;  4A3K I;  2NVT I;  4MD8 A;  3BG1 B;  1VQ5 1;  4E2Z A;  3K7A I;  1VQP Z;  2E2J I;  5C44 I;  3CCM 1;  4MD7 A;  2PMZ A;  4NBE A;  3RZO I;  2OOX B;  3MZK B;  3GTQ I;  2OTJ Z;  2M6N A;  4E2W A;  2E2I I;  1K9M 1;  2DE6 A;  3PO3 S;  1VQ6 1;  2WB1 A;  3CCS 1;  4QTU A;  4MON A;  2QEX Z;  3JAM b;  3CCQ Z;  1L1O C;  3G4S 1;  1I3Q I;  2V45 A;  2YU9 I;  2NAP A;  3NFZ A;  4E31 A;  1VQK Z;  2R6M A;  1N8R 2;  2JIO A;  5FLX b;  3OW2 Y;  2VPX A;  3I56 1;  2WAQ A;  3HOY I;  3VTN A;  4QTT A;  4S1T A;  3CCV Z;  1X3W A;  4XX2 A;  3G71 Z;  1YIT Z;  1N8R 1;  1VQO Z;  4E2X A;  3CC7 1;  3RZD I;  4NB9 A;  3D9X A;  3MZL B;  3S2D I;  3CME 1;  1VQ6 Z;  1Y1V S;  3PO2 I;  2E9H A;  3HOX I;  1KQS Y;  2LIY A;  1Q16 A;  4RVH A;  1WZN A;  2J6A A;  5D1O A;  2H85 A;  1LQL A;  1X0T A;  2QA4 Z;  2VPZ A;  1Q82 2;  4E33 A;  1VQ4 Z;  5T67 A;  1S7M A;  1ML8 A;  3VMG A;  4RV9 A;  2JIP A;  5AN9 F;  1RO4 A;  1SIW A;  2JR6 A;  3CCU 1;  2NVX I;  3QWU A;  3S14 I;  5A2Q f;  3S15 I;  3CC4 1;  1TWF I;  1WCM I;  2RIQ A;  3HKZ A;  1NP6 A;  4HGZ A;  4TNU A;  3NDI A;  1S72 Z;  3J81 b;  1TWC I;  5LL6 f;  1YIJ 1;  3FQM A;  5T6B A;  4A3I I;  1K73 2;  3KIH A;  2JIM A;  3S1Q I;  3VMI A;  5C4J I;  2DE5 A;  4NH1 C;  1JJ2 Z;  1VQP 1;  3GTL I;  3CD6 Z;  1QXF A;  2OTJ 1;  3S17 I;  2QLV B;  2V8I A;  3H3V J;  2JIR A;  3LUS A;  4A93 I;  4X6A I;  3JAM f;  2O4H A;  2P3Y A;  2GTI A;  2QR1 B;  3F3P C;  1YHQ 1;  4MXU A;  2QEX 1;  3CCQ 1;  4RVF A;  3GTM S;  1VQK 1;  3KIF A;  2W03 A;  3VB9 A;  4AYB A;  2ZAE B;  2IV2 X;  1QYP A;  3G6E Z;  3CPW Z;  2JA7 I;  2F4O A;  2E2H I;  2RHB A;  4CL1 A;  2R93 I;  5T64 A;  3F3F C;  1W2B Z;  2QRC B;  3CCV 1;  2M48 A;  1KC8 2;  2EGT A;  3G71 1;  1R9T I;  1YIT 1;  2OTL Z;  1VQO 1;  1RO2 A;  4E30 A;  1YJW Z;  3IR7 A;  5CM2 M;  1YHQ Z;  3M4O I;  1KC8 1;  1JWH C;  3CMA Z;  1QVF Z;  1VQ7 Z;  1YUK A;  5FLM I;  2DE7 A;  2QA4 1;  2K5R A;  1VQ4 1;  3I55 Z;  3CXC Z;  3J80 b;  3GTP I;  3GTO I;  4NOZ A;  3HOV I;  1P9N A;  3S1N I;  2RBL A;  1VQ9 Z;  3J81 f;  4HGY A;  3S1M I;  4A3G I;  3PO3 I;  1USP A;  1S72 1;  1TWA I;  2R7Z I;  1M1K 2;  2QRD B;  4RVG A;  1JJ2 Y;  1Z02 A;  3ESW A;  3CD6 1;  4A3F I;  2JA8 I;  2NVQ I;  2I3C A;  1TWG I;  3CCE Z;  1AA6 A;  1M1K 1;  3U50 C;  2KI7 B;  4DK1 A;  1FDO A;  2Q4Z A;  1Q7Y 2;  1Z03 A;  4NBF A;  1Q86 2;  1M90 1;  4MH4 A;  3P5J B;  1ZH1 A;  3BG0 B;  2VUM I;  2OOY B;  3CPW Y;  4BY7 I;  4A3E I;  4BBR I;  1Y1V I;  1RQF A;  3G6E 1;  1Q7Y 1;  1VLA A;  3D6W A;  1YJ9 Z;  1W2B Y;  3HOU I;  3MON A;  3GTJ I;  1Q86 1;  1K83 I;  3GKQ A;  3IFU A;  4A3J I;  2KPI A;  3CC2 1;  1QVG Z;  1VQL Z;  1KD1 1;  3J7A 4;  5IP9 I;  2OTL 1;  2JMO A;  4DQY B;  5IP7 I;  3S1R I;  2IZ3 A;  3GCF A;  3CCR Z;  3I4N I;  3NH8 A;  1YJW 1;  4A3L I;  2V8K A;  1RLY A;  1QVF Y;  1Y8C A;  5IT9 b;  3CMA 1;  3NDJ A;  1WII A;  2QRE B;  4NB8 A;  4NBC A;  1VQ7 1;  1SFO I;  1VQN Z;  2JIQ A;  1QF8 A;  1TWH I;  3J80 f;  2GU2 A;  3CXC Y;  3NH5 A;  2JA5 I;  3I55 1;  4A3D I;  2GTH A;  2V8J A;  1VQ8 Z;  2YAD A;  3CC2 Z;  1NJI 2;  1N2F A;  1YJN Z;  3TDH B;  2NVY I;  4A3M I;  3CCJ Z;  2VF1 A;  1VQ9 1;  2VPY A;  1X3Z A;  3H0G I;  4Y7N I;  4NBG A;  5D1O B;  3CQZ I;  1NJI 1;  2JA6 I;  3IX0 A;  1KRL A;  2JNY A;  5D1P A;  3D2L A;  2RPR A;  1WJ2 A;  2JS4 A;  3GTM I;  3T4N B;  1YI2 Z;  1TFI A;  3CCE 1;  3I4M I;  2PK7 A;  4NBD A;  3VMH A;  4E2Y A;  3CCL Z;  2O53 A;  1I50 I;  4HH4 A;  1VQM Z;  2F4M A;  3HOW I;  2LEX A;  2AYD A;  3IF8 A;  2AKL A;  3GTK I;  1YJ9 1;  1VQ5 Z;  5C3E I;  3GTG I;  1QVG Y;  3CCM Z;  3EED A;  1M90 2;  1RNI A;  1VQL 1;  3NH4 A;  2R92 I;  3CCS Z;  1I6H I;  4DGL A;  3FKI I;  3CCR 1;  5IT9 f;  3S2H I;  3G4S Z;  2JUB A;  3S16 I;  2P28 A;  2VUG A;  4BY1 I;  1KD1 2;  4NBB A;  1VQN 1;  2PM9 A;  3I56 Z;  2LFU A;  4NFR A;  1FDI A;  3OW2 Z;  2BJO A;  1Z01 A;  3EER A;  2QKD A;  3I07 A;  1WW9 A;  2Q51 A;  1VQ8 1;  1Q82 1;  2W04 A;  2HF1 A;  3CC7 Z;  1YJN 1;  2RT9 A;  2E7Z A;  3HOZ I;  3CME Z;  4RVD A;  3CCJ 1;  2OZK A;  5C4X I;  4NBH A;  4NBA A;  2VPW A;  1Q81 2;  2HU9 A;  3FQQ A;  1DL6 A;  2V3V A;  2Y0S A;  1KQS Z;  4EWC A;  4A3B I;  2IZ4 A; 
#chains in the Genus database with same CATH homology
 2G2K A;  4MD9 A;  4A3C I;  4MRI A;  1Q81 1;  3M3Y I;  2K3R A;  1YI2 1;  1NUI A;  1K73 1;  3CCU Z;  1K8A 2;  3CC4 Z;  4BXX I;  3CCL 1;  1ZB8 A;  2B63 I;  5A2Q b;  4E32 A;  5FLX f;  1VQM 1;  1YUA A;  4Y52 I;  1USP B;  1Y1W I;  4RS4 A;  3Q87 A;  1YIJ Z;  1PFT A;  1ZB9 A;  4BBS I;  1K8A 1;  3TE5 B;  1RO0 A;  1K9M 2;  4A3K I;  2NVT I;  4MD8 A;  3BG1 B;  1VQ5 1;  4E2Z A;  3K7A I;  1VQP Z;  2E2J I;  5C44 I;  3CCM 1;  4MD7 A;  2PMZ A;  4NBE A;  3RZO I;  2OOX B;  3MZK B;  3GTQ I;  2OTJ Z;  2M6N A;  4E2W A;  2E2I I;  1K9M 1;  2DE6 A;  3PO3 S;  1VQ6 1;  2WB1 A;  3CCS 1;  4QTU A;  4MON A;  2QEX Z;  3JAM b;  3CCQ Z;  1L1O C;  3G4S 1;  1I3Q I;  2YU9 I;  3NFZ A;  4E31 A;  1VQK Z;  2R6M A;  1N8R 2;  5FLX b;  3OW2 Y;  3I56 1;  2WAQ A;  3HOY I;  3VTN A;  4QTT A;  4S1T A;  3CCV Z;  1X3W A;  4XX2 A;  3G71 Z;  1YIT Z;  1N8R 1;  1VQO Z;  4E2X A;  3CC7 1;  3RZD I;  4NB9 A;  3D9X A;  3MZL B;  3S2D I;  3CME 1;  1VQ6 Z;  1Y1V S;  3PO2 I;  2E9H A;  3HOX I;  1KQS Y;  2LIY A;  4RVH A;  2J6A A;  5D1O A;  2H85 A;  1LQL A;  1X0T A;  2QA4 Z;  1Q82 2;  4E33 A;  1VQ4 Z;  5T67 A;  1S7M A;  1ML8 A;  3VMG A;  4RV9 A;  5AN9 F;  1RO4 A;  2JR6 A;  3CCU 1;  2NVX I;  3QWU A;  3S14 I;  5A2Q f;  3S15 I;  3CC4 1;  1TWF I;  1WCM I;  2RIQ A;  3HKZ A;  1NP6 A;  4HGZ A;  4TNU A;  3NDI A;  1S72 Z;  3J81 b;  1TWC I;  5LL6 f;  1YIJ 1;  3FQM A;  5T6B A;  4A3I I;  1K73 2;  3KIH A;  3S1Q I;  3VMI A;  5C4J I;  2DE5 A;  4NH1 C;  1JJ2 Z;  1VQP 1;  3GTL I;  3CD6 Z;  2OTJ 1;  3S17 I;  2QLV B;  2V8I A;  3H3V J;  3LUS A;  4A93 I;  4X6A I;  3JAM f;  2O4H A;  2P3Y A;  2GTI A;  2QR1 B;  3F3P C;  1YHQ 1;  4MXU A;  2QEX 1;  3CCQ 1;  4RVF A;  3GTM S;  1VQK 1;  3KIF A;  2W03 A;  3VB9 A;  4AYB A;  2ZAE B;  1QYP A;  3G6E Z;  3CPW Z;  2JA7 I;  2F4O A;  2E2H I;  2RHB A;  4CL1 A;  2R93 I;  5T64 A;  3F3F C;  1W2B Z;  2QRC B;  3CCV 1;  2M48 A;  1KC8 2;  2EGT A;  3G71 1;  1R9T I;  1YIT 1;  2OTL Z;  1VQO 1;  1RO2 A;  4E30 A;  1YJW Z;  5CM2 M;  1YHQ Z;  3M4O I;  1KC8 1;  1JWH C;  3CMA Z;  1QVF Z;  1VQ7 Z;  1YUK A;  5FLM I;  2DE7 A;  2QA4 1;  2K5R A;  1VQ4 1;  3I55 Z;  3CXC Z;  3J80 b;  3GTP I;  3GTO I;  4NOZ A;  3HOV I;  1P9N A;  3S1N I;  2RBL A;  1VQ9 Z;  3J81 f;  4HGY A;  3S1M I;  4A3G I;  3PO3 I;  1USP A;  1S72 1;  1TWA I;  2R7Z I;  1M1K 2;  2QRD B;  4RVG A;  1JJ2 Y;  1Z02 A;  3ESW A;  3CD6 1;  4A3F I;  2JA8 I;  2NVQ I;  2I3C A;  1TWG I;  3CCE Z;  1M1K 1;  3U50 C;  2KI7 B;  4DK1 A;  2Q4Z A;  1Q7Y 2;  1Z03 A;  4NBF A;  1Q86 2;  1M90 1;  4MH4 A;  3P5J B;  1ZH1 A;  3BG0 B;  2VUM I;  2OOY B;  3CPW Y;  4BY7 I;  4A3E I;  4BBR I;  1Y1V I;  1RQF A;  3G6E 1;  1Q7Y 1;  1VLA A;  3D6W A;  1YJ9 Z;  1W2B Y;  3HOU I;  3MON A;  3GTJ I;  1Q86 1;  1K83 I;  3GKQ A;  3IFU A;  4A3J I;  2KPI A;  3CC2 1;  1QVG Z;  1VQL Z;  1KD1 1;  3J7A 4;  5IP9 I;  2OTL 1;  2JMO A;  4DQY B;  5IP7 I;  3S1R I;  2IZ3 A;  3GCF A;  3CCR Z;  3I4N I;  3NH8 A;  1YJW 1;  4A3L I;  2V8K A;  1RLY A;  1QVF Y;  5IT9 b;  3CMA 1;  3NDJ A;  1WII A;  2QRE B;  4NB8 A;  4NBC A;  1VQ7 1;  1SFO I;  1VQN Z;  1QF8 A;  1TWH I;  3J80 f;  2GU2 A;  3CXC Y;  3NH5 A;  2JA5 I;  3I55 1;  4A3D I;  2GTH A;  2V8J A;  1VQ8 Z;  2YAD A;  3CC2 Z;  1NJI 2;  1N2F A;  1YJN Z;  3TDH B;  2NVY I;  4A3M I;  3CCJ Z;  2VF1 A;  1VQ9 1;  1X3Z A;  3H0G I;  4Y7N I;  4NBG A;  5D1O B;  3CQZ I;  1NJI 1;  2JA6 I;  3IX0 A;  1KRL A;  2JNY A;  5D1P A;  2RPR A;  2JS4 A;  3GTM I;  3T4N B;  1YI2 Z;  1TFI A;  3CCE 1;  3I4M I;  2PK7 A;  4NBD A;  3VMH A;  4E2Y A;  3CCL Z;  2O53 A;  1I50 I;  4HH4 A;  1VQM Z;  2F4M A;  3HOW I;  3IF8 A;  2AKL A;  3GTK I;  1YJ9 1;  1VQ5 Z;  5C3E I;  3GTG I;  1QVG Y;  3CCM Z;  3EED A;  1M90 2;  1RNI A;  1VQL 1;  3NH4 A;  2R92 I;  3CCS Z;  1I6H I;  4DGL A;  3FKI I;  3CCR 1;  5IT9 f;  3S2H I;  3G4S Z;  2JUB A;  3S16 I;  2P28 A;  2VUG A;  4BY1 I;  1KD1 2;  4NBB A;  1VQN 1;  2PM9 A;  3I56 Z;  2LFU A;  4NFR A;  3OW2 Z;  2BJO A;  1Z01 A;  3EER A;  2QKD A;  3I07 A;  1WW9 A;  2Q51 A;  1VQ8 1;  1Q82 1;  2W04 A;  2HF1 A;  3CC7 Z;  1YJN 1;  2RT9 A;  3HOZ I;  3CME Z;  4RVD A;  3CCJ 1;  2OZK A;  5C4X I;  4NBH A;  4NBA A;  1Q81 2;  2HU9 A;  3FQQ A;  1DL6 A;  2Y0S A;  1KQS Z;  4EWC A;  4A3B I;  2IZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...