2H85A

Crystal structure of nsp 15 from sars
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
347
structure length
347
Chain Sequence
b'HQSLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGESVKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCGCSVIDLLLGDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYPKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative orf1ab polyprotein
publication title Crystal structure and mechanistic determinants of SARS coronavirus nonstructural protein 15 define an endoribonuclease family.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 87
structure length 347
sequence length 347
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2h85A01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h85A02
4S1TA 2GTHA 2RHBA 2GTIA 2H85A 4RS4A 2OZKA
chains in the Genus database with same CATH superfamily
2PE5A 1VQN1 3WWEA 1PR9A 4LRSB 4DL9A 2ZW9A 1XDSA 1Z45A 3PPYA 2J6IA 4GIBA 3C3PA 3VPHA 1Y63A 3DZGA 3ICEA 2CDCA 2Q1TA 3FA2A 4LECA 4N76A 3IXLA 4QPZA 3V7YA 2WJYA 4OHPA 1H9AA 1K98A 4PPFA 5DM4A 1T2UA 4JZKA 4TS3A 2J48A 5EMJA 3TRKA 1REQA 5ALQA 3U9TA 3AV3A 5CDGA 5ANRB 1KD11 3BT7A 1VPLA 1T1EA 4MS1A 4MXUA 5T6BA 1YV9A 2Q9UA 2OLKA 2Z04A 1NW3A 1B4DA 2XYVA 2Y6VA 3EOAI 3PHGA 4IWNA 1MZPA 2VT6A 1YF3A 3NHFA 1DAMA 1N1MA 1PD1A 3BORA 3KC2A 4GQBA 2PXCA 2ZEJA 4XSHA 3RAFC 4RO0A 4MW5A 3HXKA 5AHOA 4MTCA 4OBXA 2X76A 3I09A 2A5GA 3JPWA 2B4RO 3AF1A 4X84A 3H7IA 4C88A 2CCKA 4P35A 5A5GA 3L4EA 1WF3A 1MX9A 4YFVA 4YRIA 5IT4A 2PX2A 1ZK1A 3R23A 1I2AA 1J1UA 4EYEA 3IJ5A 4NBVA 2FN9A 4TROA 2BGLA 621PA 2VQEB 1JPJA 2NZXA 3R0JA 2YQ4A 2JFWA 3ZWNA 1ULSA 3V8BA 4BYGA 1EXVA 1J99A 2HREA 4Q7QA 1YL5A 2ZB4A 3VM6A 5KNDD 3ZZTA 1VMDA 1OAKA 3GFSA 2VA9A 1WJGA 2R0QC 2BHLA 2GWHA 4B73A 5BQ3A 1BE1A 1RTTA 2QL6A 3TD6A 3BTSA 4BNGA 3GPCA 4D80A 1OYWA 4JBGA 3T0IA 1JHDA 4LHWA 4ZEXA 3MWFA 3STXA 3TW6A 5JJCA 1USPB 3G6EZ 4G0YA 4K26A 4AXBA 1T8TA 3I39X 3GL9A 5HTOA 2V3CC 1B23P 3L07A 2ODWA 2EFCB 3LWNA 3EXAA 3CNQS 3SQWA 4OHYA 3WLQA 3I3OA 1T8RA 3H13A 1TZCA 3I6YA 5F73A 4DMGA 1Z8FA 1ZUHA 3MD0A 1QYPA 1NYRA 4Z0PA 1RADA 3AUFA 5FFFA 5CDTA 1NVKA 2B2CA 3PUXA 1J8MF 3IQDB 2BDUA 3BRWA 2D1FA 2PGIA 3BE4A 4I9FA 2PYIA 4WY8A 5EYPB 3NETA 3L8EA 3L9WA 1UQTA 1YSCA 5AVRA 1WBDA 1PL0A 2DFNA 2P77A 1LDGA 3K7EA 3LPAA 4JCOA 1RWMA 1XQ1A 1RXSA 3BXZA 3JD2A 3PFWO 1ZN7A 4M9CA 3CLRC 1N8R1 2JKYA 3FVTA 4OH7A 1RWWA 2BTQA 2CVOA 3I76A 4JI1B 4BO0A 5TIIA 1VQ41 3L7JA 1B0AA 4TLLB 2F4MA 4L2IA 1G3QA 4BC0A 1B8UA 3NJ8A 3TQSA 5YASA 2XLBA 2YASA 3NGLA 1WXHA 2DE7A 1TUBA 3X3HA 1TD1A 1EG2A 1BQ3A 1XELA 3GB9A 4Q9AA 3T0FA 1P1CA 1DBSA 3LDAA 1MC8A 5BW4A 1QHSA 3GAFA 1XCJA 1KMCA 3NIGB 3OJFA 1RYNA 5TQ0B 1Y6FA 2DUJA 4P7BA 1MRNA 4GLFA 1DFGA 1DO2A 1H93A 3FPJA 1Q14A 3JVEA 2WD9A 3P94A 3JQDA 3O38A 4B44A 4NCAA 2B4TO 1UZUA 4G5GA 2JFHA 1SURA 2YS6A 2XUDA 3KJZA 1MIOA 2GD0A 5IJ0B 1UMBA 1UJNA 4C3OB 2IODA 1L1QA 1KMMA 3E23A 3JASB 1L1FA 1R8XA 3PE6A 1QE5A 4JLVA 1K732 3WK4A 4EB3A 4J0CA 1VQ7Z 1QV7A 3BKXA 3QMWA 3D4IA 4PC6A 4ZVOA 2JJ2A 2QM8A 4ZDIA 1JXQA 2ZCUA 1G291 3LBYA 2LD4A 3O31A 2WM2A 3D64A 3L4BA 3AM5A 4DQUA 4AMYA 3KSAC 1NBOA 4ESVA 1IUKA 3O8OA 2VLBA 3KOUA 3R5TA 4BKMA 2VQDA 2OCBA 1GL9B 5I9LA 3GAMA 1WQ3A 2W2OA 4D8TA 4NR0A 4PLGA 3BGDA 5BN5A 5C1PA 1ORWA 1Q6ZA 2VOEA 3CRMA 4JBXA 4HV4A 4XD2A 4YAUA 2YVUA 1G1MA 1E89A 2CXOA 4DUPA 3OOWA 4IJVA 3W5AA 4X6XA 4G1VA 4ZALA 2R1ZA 4QPNA 3KJHA 3EEFA 2AJCA 3PI7A 1DEKA 2QMUA 5BMVF 1A95A 2NO5A 3DKIA 4KFTA 4DLVA 2F62A 3VZRA 1RWPA 5ISMA 3VNRA 3UA4A 1W5AA 1E1MA 1RPAA 4K87A 1AUXA 2RARA 5K3CA 4BNTA 1OC4A 2XE8A 4I1RA 2B1JA 4DV6B 4PLZA 1KJWA 1L7MA 1W0JA 2IU4A 1NXQA 3A70A 3NHWA 3IXQA 3NH8A 3O74A 4GO1A 4L4XA 4Z7OB 4BEVA 1IU9A 2IHBA 3EAQA 1XVTA 1WIIA 1DBRA 2QN2A 3BEDA 4CR8A 1IHUA 2PR2A 2AEMA 2MJLA 3BXPA 4M0MA 4UFNA 5FJIA 1Z4PX 1DX4A 2R44A 3NGXA 2NYAA 1E3TA 1KZ9A 3WO1A 4DYVA 4RD3A 4V2UA 3QV1A 5FDFA 1LI5A 3B7WA 4UUOA 4P38A 2ZS9A 4KAXA 3RS0A 3BH7A 1COWA 3W1WA 2DY1A 1GA4A 4JITA 1T9ZA 4HWTA 5J2TF 5DSTA 4Z0NA 1ONSA 4DV7B 2JW5A 5EPOA 1A69A 1DC4A 4Z8XA 3T38A 2OR3A 3G2LA 3AR2A 5J2UF 4O2BF 3FTFA 5F12A 3R8XA 3QF4A 2Q49A 3SCZA 4JL8A 3TE7A 2WQ6A 4KXXA 2G80A 3QVVA 3MUEA 3JQ9C 5AW4A 4CXMA 3B38A 2J87A 4NCHA 5CU7A 4HWOA 2OAEA 3MJVA 4EW3A 3NTVA 2WPDD 3EWSA 1HYQA 4F1KA 3K3PA 5BV2P 1P19A 1O2DA 4RENA 3F5FA 1PT5A 3BVPA 4FR5A 5GONA 5EHGA 1JSCA 1LC3A 4UXHA 5LVAA 2D1RA 1PJSA 1LZLA 2GBPA 3K09A 2Q4EA 2JUBA 1JJVA 2VRBA 5F1KA 3KHUA 1Z5UA 1US8B 4DIKA 3C97A 1IJBA 5K8LA 3C2QA 4ZYXA 4Z4HA 5FI3A 2Q8NA 2Z2ZA 3OQVA 2RE8A 3BREA 5JSUA 3THWB 2M1XA 2GSDA 3A31A 5C37A 1UBEA 2ZJ6A 2WTEA 3IA7A 4G63A 2OZLB 5DN6D 3T06B 3T1VA 2B1QA 1O94C 5JYBA 4J3JA 3BMOA 4EL0A 4DTCA 4TKUB 1GSHA 4RW0A 2ZBFA 3RC8A 3ILXA 1WHTA 4E14A 3ZWXA 2KW5A 5HW0A 1N7IA 5M7EA 4NFHA 1R74A 2H11A 2PMDA 1E0AA 3ABQB 3IMEA 3LUBA 1A5AB 1PZXA 2AD5A 2AOXA 4AUNA 1S4QA 2PIAA 3P20A 5J59A 3VKGA 2XKBA 2O2XA 2ECFA 4IHJB 4ERXA 2CHVA 4HDRA 3A2KA 4J0JA 3DUWA 2OD9A 1JJBA 2EP5A 3K6SA 1FQOA 4IXWA 3W05A 4WESA 3T15A 1RAGA 1W6UA 3QPVA 4PN3A 1K8A2 1BE6A 1DAFA 1GPNA 5C8ZA 3H5WA 1KRWA 2V5AA 4L8WB 4OU4A 3GG9A 3ORHA 1B6RA 4QX6A 2SICE 3FTQA 3F67A 3SE0A 4Y9SA 1ABFA 1TLLA 3PNQA 1XN4A 2XCRB 3A04A 2B7BA 4RX1A 3QY9A 5JS7A 3OLZA 4QTTA 2EF0A 2QTGA 2F43A 2NW6A 2VTBB 5JO9A 1RLJA 2ORYA 1LLCA 3DDCA 3BWEA 4EUEA 5B2EA 1J7KA 5EOVA 4MPTA 5P8WA 2VDVE 1QIFA 1XE3A 1TEHA 2OZKA 4Z2YA 1XQ9A 4QIHA 2F90A 3OMLA 3UXYA 2H0RA 3I01M 3FCXA 1YZQA 1B43A 2PYZA 5FPPA 1M0SA 3E7PA 3O1HB 2HF2A 1DIBA 2NV6A 3DD5A 4PCVA 3IIJA 2FFBA 5FFNA 1HO3A 5FWYB 5TEVA 2HC9A 3IP5A 5AW7A 2ZRJA 3TNLA 5C5EA 1ZMXA 4OH1A 5FPTA 2VDWB 3LT0A 4GOMD 1HWYA 3CCSZ 2W4IA 4GMHA 4LWOA 5JSKA 4EO7A 4WINA 7REQB 2HEIA 4A5OA 2QZ9A 3AM1A 4GQIA 3TKAA 2EBWA 1ZNXA 2JA8I 4OU5A 2VPWA 3G711 3S55A 1P75A 1NZJA 1T9HA 1XA4A 3C24A 3A10A 1OWPA 3D2CA 4GH5A 2QZZA 4FI3F 5K3FA 4CF6A 1NP3A 4ZK6A 5T3UA 1FNMA 4C6RA 2H1HA 2ZSAA 3DE7X 3ETJA 6NULA 1H4QA 2XH8A 5JZVA 1UIMA 2C2BA 3HKEA 3TZHA 2RJ3A 2DZDA 3GYGA 3K0FB 4DCJA 5IH7A 5DJ5A 4F8EA 1VXOA 1BQ4A 4FWIB 3UY4A 4KQMA 2QZJA 3BD8A 1JFFB 1AMOA 3LQRA 1MJGM 5FOSA 4A10A 3COZA 3EEDA 3DZIA 4OLFA 3LFTA 1THZA 1ID8A 1U0HC 1Z6AA 1M1NB 4EHIA 4GKJB 1RRPA 5K6TA 1DRJA 1YI0A 1XKXA 4HFJA 1APBA 3O8CA 3OEEA 4PNZA 4QNRA 3ZDEA 4ZOBA 1H5QA 4LW8A 2FPIB 4PZDA 1U3VA 1ORVA 1E3WB 3CCLZ 1PZGA 2X14A 4YJ2F 1NUHA 2LNDA 2PSSA 3M6AA 3WI7A 1BU5A 2C5SA 4A15A 2JCVA 3D0OA 1HXHA 3JD3A 4UEWA 2IFTA 1W30A 2V9PA 2F8MA 4G41A 5BNFA 3PXGA 4C0JA 2PUJA 2W2LA 3BF7A 1OWLA 2ACKA 2ODBA 2FPRA 2V7QD 1E9BA 4TWBA 4YMWA 3V4OA 3M4ZA 4JLSA 1WM1A 1ISJA 4AJNA 1ODLA 4MUMA 3J7TA 2HIHA 2Q62A 3ANLA 3EZ2A 2OO3A 3TIVA 4KVAA 1TMYA 1W9HA 2PD4A 2QJWA 2GLTA 3ZV6A 2VJMA 5LLDA 4JS0A 2R8RA 3E3MA 1GLNA 3CNLA 2D7CA 1Y1LA 3FHLA 3GMIA 3HB1A 3N2ZB 3T61A 4D9HA 3NIDB 3U4MA 2L19A 1YH3A 4KJXA 2CJYA 1NW9B 1X7GA 1USGA 2BM9A 1IK4A 2J9XB 2ZJAA 4MARA 3RUPA 3DAYA 4F96A 1DL5A 1OU0A 4V0QA 5G02A 4LXQA 2CWDA 1KZGB 4IVQA 4E13A 3HI4A 4HLDA 2YWGA 1NF3A 4NU8X 1YJ91 4R3UC 4TS4A 1CVIA 4EA6A 1WX1A 3PDHA 4UCFA 2CXPA 2RK4A 5CX4A 5KOJA 1OJLA 3DWGA 3JVUA 4B3HA 2JIZA 4I50F 2H1SA 1Z56C 5EVJA 521PA 3V48A 2O2SA 3CIFA 4X5OA 3CN9A 1E4OA 3VBEA 5AQ1A 5AKEA 1SXQA 4JYAB 5T8KC 1KYTA 3HCCA 3QKRA 1GGFA 1ND5A 2QRJA 2GH1A 4YJHA 1G3IA 1BX0A 1CUFA 2ZAIA 3CR7A 1NUSA 4MCJA 2ZYVX 1QAMA 3RAJA 4B32A 2O8BA 1E3JA 1EGVB 2BR4A 3E1SA 1TAQA 4Y2JA 4D4HA 5K0ZA 5KYKA 3UB3A 3K70C 2Y0CA 1I30A 1NAHA 2FJUA 3FOAA 3V8VA 4HPXB 2PU5A 4M1WA 2FMXA 5JZBA 3AY6A 3KUXA 3MK31 2W43A 4TXJA 1UBLS 4RC9A 5G3ZA 4AX8A 3GMTA 2GAIA 4GKAA 2YDYA 3B20A 4XJSA 4IEIA 2CBXA 1MXHA 2HQOA 2WD7A 2NU9A 4KFRA 4BNZA 1V4BA 3B7PA 4B87A 4NBKA 3C41J 4OAOA 3UJCA 3FOEC 1UBRS 3OFND 4G1BA 4BNFA 4PAWA 2IH2A 1WDTA 3GR6A 3H1GA 3TBKA 1JIUA 1E58A 3QLUC 5J2TB 1O9GA 4YONB 3LYHA 4PBSA 1Q0QA 3JAWB 1T3HA 5IHPA 4NBLA 5J2UB 4D02A 1K1EA 2QA4Z 4KQ6A 1XMXA 4O2BB 5KCMA 2OVBA 3PK0A 3C1AA 1NA5A 2PT5A 1YIJZ 3S1AB 1P2VA 2EJTA 1PG2A 2WJZB 2XCQA 4YDHB 3QUAA 3GD5A 5CXSA 2EWMA 1HMYA 3N2LA 1TZBA 1DBQA 2JGLA 4EY3A 4CLXA 5C80A 4JEMA 3VZSA 3MS4A 2ZTUA 3KKLA 2VF8A 3DFIA 4F4IA 2W04A 1KI6A 5A7GA 3QWFA 3TSOA 2Y2VA 4Q00A 3DTYA 3L1HA 2Q07A 1MHPA 1PFQA 5EE3A 3AHIA 4R9SA 3WADA 3GCDA 2O8FA 1RIFA 2RCNA 3C39A 1YMVA 4ARBA 1SXIA 4B31A 1O8CA 2YWDA 1ILWA 2JIPA 1P29A 2ARKA 2XTZA 1ODCA 3IQXA 4A2CA 4EUNA 1OXBB 2AFIE 3VYSB 1B2LA 1QH1B 1PR2A 3OY2A 4P4SB 4XDZA 1JG2A 2AKEA 2VJQA 3G0CA 1Q84A 1KI3A 3H2SA 3QRWA 1H9BA 1SHZA 3D1JA 3PLRA 1YHQ1 3QU9A 4B45A 4HPWA 3GA5A 4QGGA 4G2TA 5ETJA 1BXGA 1CKEA 2WPNA 4FNOA 2YWJA 4AMUA 2UXDB 1K8RA 1K7YA 1RWKA 3PXCX 4DM7A 3VR0A 3VR2D 1IZ0A 5JNTA 3FKII 1EX6A 4D6PA 5T4HA 4Q5IA 1BROA 2Q3EA 4ZKDA 3KEGA 5FT9A 2JLAA 3PQ6A 1QWSA 3F6EX 4XXHA 1L5ZA 4C6TA 3TUZC 1TJ3A 2AFIB 4PANA 1UPTA 3AONB 5AVKA 4CTOA 2WSIA 4BV3A 4B6OA 2E5WA 4DUZB 4LNHA 3IUJA 5T7BA 5I4BA 2ZKLA 4XDYA 4KAAA 1VA5A 1U7WA 4BQSA 3VAAA 3UOGA 3PUZA 2UZ3A 2X2OA 3E0XA 1O8BA 1Q91A 3BWDD 4NBSA 4X7MA 4XYEA 3CF6R 3CW8X 4N5HX 4QOFA 4RY8A 2ATEA 4LDQA 4R2KA 3DP9A 3V6MA 2LXNA 3U40A 3VZCA 3RR2A 1EM6A 3DEIA 4Z9AA 5TPZA 4LJAA 1QC5B 4MLPA 3ND5A 4PHTA 2XCOA 1Y7IA 5IVPA 4ED9A 4UNRA 2MYNA 3T4NB 3UXMA 1Q11A 1BGWA 1V1MA 4AKTA 3C85A 4DYDA 1E5XA 4CMBA 4ZWNA 1J8DA 3G5TA 3SOPA 1T4MA 2CE7A 5ALHA 3KKZA 4INJA 3ZWAA 4M99A 8ADHA 3N05A 4H18A 3ZXYA 3CLSC 3RVOA 2FPWA 4X8MA 3AUTA 3EQ6A 5K1ZA 1MGOA 2CHEA 4WFJA 4UDXX 4BO6A 4D0SA 3V97A 4GL2A 2CN1A 4C4SA 4PONA 4ZZ0A 1I2MA 1DIHA 4KREA 4NK5A 1M83A 3N76A 4XUCA 5HIIA 5C8YA 1MT0A 1L2TA 3OFVA 1BMFD 4RH0A 4HVAA 1V9SA 1XZMA 1O6ZA 3EW7A 1KRXA 3H84A 1LA2A 4L3VA 2OQVA 3WLRA 1SBYA 1XLWA 1U65A 4KQWA 3TO5A 2IX3A 1TT5A 1PNOA 1XALA 2CYCA 4BIMA 3F5QA 3A1TA 2FCRA 4IXTA 4WACA 5HUJA 4BWYA 2Q4RA 1ZIYA 4NQRA 1E0JA 3VPSA 1F8YA 4W1RA 3WWCA 5CA0F 2YQ5A 2RAPA 3UHJA 5KNCH 2FN4A 4RDCA 2VAWA 1SXJE 1WSBA 3DNMA 3HQ4O 1WG8A 3CX8A 3PNMA 2R4UA 1VHLA 4A3II 2I6QA 1PIWA 4HQRA 3HK2A 2JAPA 3D7KA 4TLDA 3W6OA 3NDJA 2RDMA 4ZA2A 3W8EA 5CJ2A 3EEQA 2DHQA 2ZIGA 3HMQA 4IOJA 4D8YA 4EYKA 2IPOA 4EEXA 2FOXA 1S6YA 1ZGCA 3CR8A 1T3ZA 4KO1S 4YP9A 5AKIA 4KFUA 2PGAA 3JQ7A 3GJZA 3FDIA 4Y1RA 5AVJA 3U7GA 2QE7A 2JD1A 2FNAA 1JAYA 1VP9A 2CLOB 4OI2A 2X7HA 4OJQA 4RLSA 4BWGA 1SXJB 2W6NA 4PAOA 1FRNA 1DRUA 1TRHA 1N0HA 3L1JA 5A4IS 2GHRA 3LCVB 1IWBB 2EHDA 4IOLA 4CLEA 2AUTA 3S81A 4HR7A 4YJ2B 1AUOA 1OX4B 3N07A 4KUEA 3O92A 2NPFA 4AF7A 2R85A 3JD0A 5AM3A 1XVUA 4AJHA 4TMVA 5JHHB 3JQ9A 4TTAA 1H3EA 4O2LA 1PW5A 4L5IA 3VO2A 3KZNA 4WZAE 4CQMD 4HNRA 4UNNA 4AKIA 2NO1A 1A9PA 3GT4A 1GLGA 2QU8A 4A8HA 2Z8ZA 1J9EA 3IQEA 1P4SA 4OAQA 4B9AA 1P1HA 3FYUC 4QARA 5ECWA 1LQTA 2Q6LA 2BCEA 3EF1A 2PUDA 3GT0A 1M5TA 1DKOA 2IYRA 1BCSB 2P3OA 4LI3X 4O6VA 1NJ2A 4JXZA 2MYUA 5F77A 1KYZA 1RRKA 1TUGA 2ZAGA 4D92A 2J3IA 1FS6A 2ZIXB 4YLGA 4B5KA 1C30A 3WVNA 4FXOA 2E2JI 1A88A 2X42A 2XXBA 2JJ8A 3EY9A 1EP2B 1O94A 5DGHA 1FX0A 1XEWX 1U0TA 1Z2DA 2D5CA 1N9ZA 2HEGA 3IR5A 3LM8A 3WJAA 5JYEA 4L6CA 4EJSB 1CZKA 1N75A 1G8SA 3CWCA 2VO1A 4K28A 4YRQA 4UU7A 1NGSA 4I50B 4Q21A 4M9QA 1X7HA 4MA5A 3FKSD 5IC6A 4QJIA 5KX5F 1F2DA 2WQZA 3CGGA 4G9BA 4HFNA 5HDBB 5TJHA 1Y7TA 3DBRB 3C1OA 4G0VA 5E0OA 2O4CA 4I46A 3CMEZ 2J3MA 4Y6LA 3O8DA 4Z4QA 3MHTA 4WAUA 4IUDS 1L8OA 4TWRA 1XP8A 5L6LB 5LL6P 4URHA 4AZWA 4GYYA 3B3GA 4ZEVA 3LVQE 2QN1A 3EG5A 1YQGA 5FUMA 1FTNA 3SNHA 4EG1A 3PGXA 1VSVA 1AKQA 1XWWA 3TTSA 2H48A 2Q6OA 5EZQA 5G0VA 5BSMA 3FTEA 4MS3A 1KSJA 5DT9A 1XF9A 4TKLA 1N5DA 4PG6A 3SHVA 3WRWA 4A23A 4TTPA 4KQXA 4ZV4A 3OBIA 4KHPB 2YHAA 4XGKA 1VLJA 2CLFB 3JQBC 2C7PA 2O8NA 1JKMA 1Z5WA 3SSOA 4ZIRB 1I2CA 1M2JA 2K6GA 3GDHA 4YP0A 5JQWA 1JYFA 1AKMA 1DJLA 5IJAA 1Z6ZA 1KBQA 1TOAA 3O8QA 3HFRA 2WHXA 4V0SA 2QL5A 3VJLA 4CM8A 1UEIA 1JHMA 2AX3A 3R3XA 1JQJC 3PA6A 2HA3A 4EL5A 3Q3EA 4R6XA 2GEVA 2FG6C 3AEKB 4DSZA 1W0KA 4MJ3A 1Y48E 5TNXA 1SHLA 4YT2A 1TCAA 2YJNA 4R8KA 3EA4A 3L0IB 5HP4A 5ELMA 1JIXA 4TRNA 3EPLA 5B58C 1ID1A 2Q4BA 2HF8A 4B6QA 3FNEA 1OMOA 3GRKA 3ORRA 1DUVG 4HQFA 3PX2A 1WPXA 4X90A 4BC1A 2GPSA 3EXIA 3Q3HA 2X4IA 5IG2A 1CJBA 4GR5A 4CVNA 2Q1YA 3KB6A 1T26A 1DXQA 3EQ8A 3JQEA 4M1QA 4ML3A 3E9RA 1PN3A 5AHXA 2DFVA 4EGCB 3IEKA 1TQ8A 4B6RA 1UJBA 3R3VA 5IW8A 821PA 4IGEA 2PLNA 3WRXC 4MRNA 4EUSA 1NMYA 2OM6A 4GR4A 2ONKA 3NHBA 3WL7A 3CC7Z 1EM8A 2YWXA 5ERXA 1PWHA 2B4QA 1EK2A 4QUDA 1H8HA 1I4TD 1RQXA 1ZLYA 4RPLA 3NR2A 5M3BA 3SZLA 5KWSA 1TVKA 2HRRA 4E46A 2XDYA 5IP9I 3HLYA 4G5YA 3QG5A 3TDNA 1H5NA 1GITA 3VTAA 3WLTA 5JJBA 1I7DA 1E7MA 3EGOA 5AJWA 3J81f 2FCAA 3OZCA 2WTBA 3B82A 2EKBA 1MB3A 3AHJA 3GRYA 3BTOA 3HKDB 2NYVA 4B3BA 5A4MS 3O4IA 3OD5A 5CXUA 2QK4A 3WBKA 1QYIA 1Z4KA 2H3HA 5EHQA 4OQZA 3RUIA 4M86A 3VOBA 2BGKA 1XZGA 2BMEA 3N2KA 4XUGB 4DNXA 2VYNA 3CO0S 1RPNA 2C7OA 2A9FA 3RYHB 1UODA 2B8NA 2G8LA 4R6WA 5EXEA 4ZVMA 4ZVKA 2XIQA 5E6SB 1ZMTA 4I4IA 1I0LA 3DP7A 4QBIA 1HURA 3FWHA 3OX4A 4GLOA 1PSWA 4ZQEA 5FQOA 1F8XA 5L95A 1P4AA 3RFCA 3SN6A 3TGPA 4JX8A 2O8CA 2E2II 4EJMA 4HVLA 2AEJA 2YCBA 1Y3DE 5UKDA 3L7AA 1SIWA 2AI3A 2I4TA 2FWBA 1EJ0A 4WOKA 1GHTA 3RVKA 4JDUA 2HM7A 3BQMB 1G6HA 2WIJA 4KBGA 3FLMA 3A6EA 4JKOA 3BL5A 5TARA 5K0TA 2Z9DA 1ZW1A 1ZUWA 2C2XA 2J7PA 2NTJA 3WLKX 3CMA1 1PVVA 5IARA 3T7SA 3ZVKA 1QTIA 2FXVA 3VSCA 1C1XA 5GQSA 3GVPA 3HCRA 4NJMA 5FO1A 3RFTA 3T3DA 4BUJA 3SQDA 4RELA 4ZC1A 4D57A 4DV0B 3DO6A 3FBTA 3VZDA 4D3FA 4BQRA 2OP1A 3RC7A 4KH1A 2Z3WA 1WZNA 3FOZA 1EGQA 1FDIA 3M5WA 2BD0A 4S1TA 2CJWB 3V8RA 5T8KA 1ISGA 4Q47A 1EFAA 1LKZA 4GGPA 4G4SP 3BS4A 1QV6A 1VQKZ 1EWYA 1U31A 2NOAA 4HEA1 4O25A 3W78A 5CA0B 4GWGA 4X20B 5AVQA 1TFRA 1P1IA 2FX5A 2GS9A 1U63A 4Z1MD 3ACCA 4AKSA 2R8EA 3LHIA 3OKAA 4R69A 5AH0A 4WFKA 5DYIA 2DOKA 3OTHA 3NFRA 4RVOA 3W2TA 1CZOA 5KYXA 3ZWMA 1XT6A 1A8IA 2OZEA 4L8LA 2UVQA 5AM0A 3IQZA 5JCPA 2G40A 2ENWA 3L18A 3PUYA 3OKPA 4RA6A 4JN6B 1NJGA 2OLEA 3UYKA 1IDN1 1XRQA 1UJMA 2CBZA 4ZJZA 4X61A 2O3TA 3PR3A 4GZMA 1K97A 5BYAA 1O5TA 4M22A 2RGDA 2XNSA 1INLA 1MJ5A 2PIDA 3OI7A 4TLCA 2HQBA 4DR6B 3EUWA 2A67A 3QLUA 3QE3A 1KDTA 4PXAA 5BRNA 4M9ZA 4BLUA 3D8TA 2OSVA 1SKMA 2AF4C 1JG7A 1QHHB 4LSMA 1DIAA 4JL6A 1ZESA 4OSPA 3B6JA 2IEAA 3ET5A 3PT5A 3STHA 4D97A 2ZITA 4KK4A 3BJZA 2P9BA 2QR2A 1YS4A 1DHRA 3NHAA 4R8VA 2C84A 1AA9A 1R12A 2P2GA 5C4XI 1HOXA 5GINE 2DT8A 1MFPA 1UK7A 2I4OA 3BHIA 4K1XA 5M2QA 5I3CA 1H65A 1NN5A 4M36A 1N0WA 1ZD1A 4L6AA 3EY4A 5CB4F 4B6GA 3A2MA 1FLNA 1X1BA 2IXDA 3BK7A 1PZFA 4N82A 2NUTA 3VKWA 2JGFA 3OZVA 4B2PA 4GUAA 2X7XA 3ZCTA 5EIXA 1J39A 3E7DA 1VQ6Z 2GQ0A 1K7FB 2PR7A 3F9RA 2X5KO 3DHEA 5AOBA 4HMOA 1Q77A 4LK3A 1Z6TA 4F12A 3Q5EA 3K7AI 1TB4A 5AVXA 2ZBEA 3N2IA 3I53A 2BKAA 1XPJA 4XYMA 5LU8A 2B82A 3KEQA 4ZQIA 3P0JA 3EZ7A 4YAIA 1TEZA 4HYYA 1D03A 2DC1A 2E49A 5EG5A 5L7WA 5K3BA 4Y67A 2BKUA 4QGFA 4QTXA 2MSKA 3TXYA 3AWDA 5BW8A 3MT9A 5D7BA 4LPSA 1WIWA 4E31A 4C78A 4YN3A 3GGJA 3PD7A 4HTFA 4ENSA 3WDKA 1D07A 1TIKA 5IP5A 5C4IA 4NBAA 4QJ5A 2X9VA 4C0HA 1HSOA 3G4SZ 1KQPA 1A97A 2ES4A 3OPMA 3EZLA 5A71A 3RKRA 3RVMA 2DPLA 3NX4A 5HCUA 4ARSA 5LPNA 2HW8A 3QSYA 3ABRB 3MZKB 5LKAA 2M6RA 4FSHA 5FLEX 1E9RA 2VYFA 5FLMI 1SUFA 4PY2A 3RIEA 2JS4A 1LK5A 2ZJBA 3Q7EA 2C2WA 2YXDA 1W49A 3JPYA 1KIAA 3O2JA 4Y2PA 4Y98A 5LNK6 2ZYDA 2HSZA 5GM1A 3KOYA 5T3YA 2WA2A 2ASEA 3NAMA 5HKBA 3UAYA 1CJUC 4KGXA 1GQSA 5BSUA 1WMBA 2VCYA 3S29A 3I92A 1VLAA 2DVMA 5EGNA 2Z2KA 3A4NA 1MX5A 1RKXA 3GJ4A 4WGFA 2FPKA 2ZI4A 4YCJA 5DGCA 1R4MB 3IOCA 2Y2UA 3PFNA 3TF5A 2AH5A 2J0QA 3SZGA 1QCYA 3LLUA 1FBTA 1JLHA 3S15I 4KE6A 4RACA 3VR3A 1RHRA 4WJZA 5KVQA 3RCBA 1QR6A 4RABA 1HOTA 3KHKA 1B8NA 4HC4A 3G79A 2X6TA 5EIWA 3VSBA 1HDOA 4N1AA 3W8DA 1PDVA 3OUUA 2KLHA 3DL4A 2Y05A 3TX2A 3D8BA 3GGPA 2G6BA 5CD1A 4YUAA 4M4SA 4GR9A 5A5VA 5HZKA 2ET6A 4LJYA 3BGIA 4KI0A 3FVQA 4ND5A 3QYFA 4O33A 4U39A 1EFRA 4QLAA 4B4KA 2XT6A 2QSJA 4Z7JA 2O7VA 3HEAA 1Z03A 2XD4A 3GXOA 2YYAA 3WKCA 1E2QA 2OY0A 3KYCA 3CW9A 1TWCI 4X7BA 1IN5A 5HILA 3H0EA 4CKWB 4EO9A 3RT9A 3OE1A 4IEFB 3ND9A 3P9YA 2QTAA 4G67A 4B47A 1GEEA 1QF7A 4GPBA 5DLYA 3ZLJA 2ILVA 1RZUA 4BLWA 2H4ZA 4FFSA 1X7YA 2PV7A 5B53A 4EI9A 1XL0A 5LYJF 2OYSA 5MFZA 3NXKA 4MROA 1C9MA 4PLWA 4N5DA 5LQSA 4GICA 1P2SA 1WSWA 2FXIA 3PQ4A 3UGQA 1KO4A 2XA1A 1UT5A 3HH8A 3ZDCA 3G2JA 1R0BA 2AEFA 3F6YA 5FOVA 3HPQA 4KQFA 1OGJA 2AI2A 5EHXA 5CM2Z 1N4AA 2I1LA 4Z49A 9ABPA 1D7AA 3L1UA 1M0EA 3GGSA 3GJYA 3MLBA 4NPCA 1NBAA 3HJUA 2HWKA 5K5EA 2VPIA 1IIBA 2Z08A 3BTVA 4YCBA 1Z82A 3EMDA 4EF6A 2BZGA 1VJGA 4CV1A 3D4BA 1CHNA 2ZCJA 2R7KA 1SPXA 3B85A 4IF6A 1QH8A 4TTRA 4QAJA 4RVCA 5AK3A 5B1DA 5C1IA 3Q7PA 4OP3A 3ZKWA 5FPQA 4W5RA 4ARCA 4J8PA 4W6QA 1L8XA 2D0PB 1N5LA 4PPYA 2XE7A 5JE8A 3TECE 1H2WA 2CL0X 1QP7A 2P91A 2FW0A 1V8ZA 3CCQ1 1YE3A 2VZ0A 1NQTA 3DHYA 2BYTA 3IAM1 5TMBA 3T7AA 3DHVA 5BSKA 5I7FA 1C3OB 1N57A 2L82A 1X2EA 2OTJZ 5LMZA 4TYYA 5KNDA 2O52A 3C3CA 4Q12A 2PSHA 4JLWA 2VHYA 1UFOA 3NBAA 3OCYA 3FYUA 1AHPA 5JJIA 3P9CA 5KQPA 4B3SB 5DTIA 2CNOA 1XJ0A 4U8HA 1IM8A 4PO3X 1J9GA 4ZT3A 6GPBA 4F9TA 1ONPA 3VC2A 2I7XA 4JAVC 5GPBA 1R0CA 1W19A 1IY9A 2AMJA 4HI0E 3TSZA 2LIYA 2VH1A 4PX9A 3VO9A 4TVSA 4DBVO 3GNSA 3QENA 2IYFA 4E1VA 4HQLA 5FTMA 3ELDA 3D7SA 3BRSA 5DT2A 2O48X 5A4AA 1XI2A 5CD9A 2GCIA 3R5SA 3P97A 2CMDA 1G18A 3AF6A 3CVUA 3FWKA 1N5OX 3JQQA 2VBFA 4LGMA 4IDFA 3HJTA 4O4LA 1W2BZ 1Y4ZA 2J6CA 4JGIA 4O0MA 4FW8A 1ODFA 2WWTA 5FL3A 1O4VA 2Q0QA 1RM4A 3LBIA 3VNQA 1UXKA 2A4MA 3KTAA 4J6EA 3U0BA 1V8PA 1YAJA 4N5LA 3MXOA 4LRWA 4GS5A 3N2GB 2WV7A 4UBNA 2B9VA 3F98A 4DR5B 4Z6KA 1KC82 2GYUA 4D4JA 5CHYA 1AH2A 4FFVA 3MQFA 1A2OA 3G0OA 3EHDA 4XVRA 4BBJA 1PFWA 2RGNC 4RHUA 4E88A 1GV1A 3FZNA 1C3LA 3VHRA 1VJTA 3VPXA 4DPMA 4FJ2A 2F59A 2QD5A 5TGTA 5KYUA 3GC6A 4DV4B 1MGPA 4KYIB 3U3RA 3QEOA 2YHIA 2IS2A 1VQPZ 2P9HA 1KDOA 1JVNA 1LD3A 3H3JA 1E2EA 1Y6QA 1FP4A 4ZCMA 5JCOC 5KTMA 3I561 4QECA 4RS3A 4EABA 1QF6A 1OV6A 1M6VB 4NMWA 1WS6A 5CT9A 4DPLA 3JV7A 3N87A 5JAMA 5FLXb 1U4NA 2C0PA 2KB0A 4GFDA 1VJ0A 3HXMA 3JQBA 2ZATA 1MAUA 1LJ8A 2NV2B 5IM4F 4NBDA 3FVWA 4ZV7A 1IXZA 2POQX 3M1IA 4I5EA 4K6HA 4F2PA 3S2YA 3ZV5A 3IV9A 1GARA 5L3RA 3TM5A 3N2EA 2R8BA 3WWYA 1OXVA 3M9XA 5A9SB 3MF4A 3U7RA 5LZ4A 2W4MA 1NBEA 4IJ5A 4KLCA 4RHCA 3NYIA 3W1VA 3NVAA 5EJGA 1PNRA 3NYRA 2FEPA 2OTLZ 2PO7A 3CS3A 1R0LA 3VYUB 3QYPA 4BNYA 2A1UA 4XDHA 4N7RA 1A5SB 1JQBA 1SCAA 4JQCA 3QVXA 1DQNA 1WTCA 3LA8A 3QVGB 1BVRA 1NRXA 1XAJA 2ZJ2A 3AF0A 2NWQA 1YOBA 3BMXA 4NFLA 4F3KA 5JZSA 2PRKA 3EFOA 5T4BA 2OORC 1DO0A 3KAPA 1C9EA 2WIFA 4OSOA 1YQXA 4LHXA 4U6NA 4UHKA 4UOEA 5CB4B 2E5LB 1HE8B 3C3WA 1SKBA 1YFKA 3GGDA 3HY4A 3GFVA 1C81A 4S12A 4W7HA 3B9QA 3IBYA 1L7PA 1KMHA 3AETA 3OICA 3T41A 2C9MA 4N0MA 1WBBA 1E9SA 3DKVA 1F0NA 1G3RA 1XDBA 2Y0BA 2IWRA 4LG1A 3LBHA 3WRXA 4DVGA 3TS1A 3IJPA 1KEVA 4B84A 5D1OA 2L2QA 2OO5C 3ACDA 3ISTA 4Q3EA 3PUVA 2D59A 1PGNA 4HDNA 2FAXA 4HDKA 3EMBA 2FN3A 2YOGA 4JJ8A 1FOEB 3A11A 2EAUA 4WN9A 2ZT6A 3VMIA 3U5ZB 3BDVA 4URZR 3UQYS 2EKZA 2HN9A 5JMWA 1KNQA 1M34E 1TNDA 2OFXA 1AK2A 4FQ7A 4TT8A 2FPUA 1AUPA 3H8VA 1QP4A 1GPAA 2FFRA 2PWYA 4LGCA 4L9RA 1BAPA 1DIGA 4YRFA 4E30A 4PTYA 2XZPA 3OLXA 1QG2A 2Q6TA 3INTA 3SAJA 5ALRA 2FPMA 2FVXA 3X0DA 2NQTA 1HZJA 3ET4A 4F7WA 2PSDA 2HU8A 1IAQA 5FTLA 1GTG1 2DE6A 1W5FA 1C8LA 1MO3A 3O03A 4FIDA 5KU7A 1GRRA 3LCJA 3F4BA 4NDZA 1ZVJA 2EFEB 4MWTA 4AO8A 5K99A 2E21A 4MKHA 3HKZA 1QVWA 2WPDA 4ZYUA 1I4DD 1M34B 1IUPA 3KPYA 4NU5A 1OXUA 1FYXA 1N8KA 4MKXA 1PHRA 3BD7A 3MPOA 3RU7A 3WGLA 1NMXA 5IAGA 2X9NA 3QWAA 2Y6UA 2EVWX 1P2BA 3CNHA 1T5TA 2MSWA 3P2IA 4RHEA 4RTKA 1ZJWA 1WCWA 2PZMA 2BE7A 4IR7A 1L5RA 3OKFA 2BBSA 4QWMA 1ENPA 1FDWA 2CDRA 4V3CA 1DCMA 4DT1A 4PX3A 5ALMA 2QRDB 4PLCA 1U4SA 3VYTB 1Q83A 1XDDA 5HF6A 5DN6A 3CR3C 2RKOA 2P9CA 2FOLA 3IQGX 3PVZA 3IOEA 4UE2A 3C4VA 4K6FA 4CKXA 2P68A 1D8TA 1RQGA 1N6IA 2EFYA 2O6LA 5EUQB 1RZRD 4Y2HA 1GVNB 1CUAA 3EZGA 4HUJA 1VIAA 1S9DA 4P31A 4WADA 1Z2CA 4D3XA 3HCOA 1DAHA 1MVNA 1UDCA 1T9AA 1YJ8A 4LYJA 4X95A 5HKLA 3RWBA 1V6AA 3GTQI 3KPVA 3ZE1B 5LD2B 3RIMA 3OLQA 4TMZA 4B7ZA 1VBMA 1EK0A 3H9EO 4C0AC 3EPKA 2YVQA 4XDGA 4N3NA 4RMHA 2V7EA 3PSHA 1T43A 1CJMA 1TXGA 3IURA 3JY6A 2VDOB 3OZRA 3C3XA 1WVGA 4Q9NA 5E8RA 3QEBZ 1YFZA 2DPGA 5EXPA 2BEJA 2IITA 3H9GA 5F1PA 5HZMA 3UIEA 4JLOA 1MQAA 4PSAA 3OAAD 1YR8A 3ZD8A 3H9QA 4ZJYA 4BNUA 5FX2A 5LYJB 4MX8A 4J1NA 3SC4A 4WX2B 4WY5A 5J9FA 1YC5A 3GNQA 4TRJA 4WLFA 4DHEA 2E0IA 2O19A 1O1YA 2J85A 3IT1A 1B1CA 3HCNA 4Q9LA 4GEKA 2DECA 3JQAD 5A7FA 2RSLA 4EYGA 4PLTA 4G09A 3S2HI 4RE6A 2FJ0A 3BGSA 4P58A 2OENG 1YIT1 4Z0TA 1Z6XA 5E1MA 5JCJD 2XBLA 4HRXA 1MD9A 3TOSA 3AF5A 1PT7A 1PZHA 2V3WA 4R2HA 1NFQA 4LSZA 4TLMB 4XEHA 1NF2A 4XVQA 4Z0HO 4HWPA 3EBLA 4UUNA 4YS6A 1ML8A 4JDPA 5JC1A 2P4QA 1NN3A 3ZY4A 1OWMA 4XLZA 3ZCUA 1KJZA 2PQ0A 2KPIA 2WWWA 3O1LA 1MN6A 5JADA 5L4NA 1R88A 5INTA 3I0MA 2AN9A 1VCIA 1OE0A 2CNLA 1Y7LA 1DX9A 3OE5A 4DLKA 1LPMA 3D2AA 2X0NA 1N1EA 3RHSA 3CX7A 1AMNA 3UV6A 4OK3A 1PFVA 2QVLA 4MJXA 4ZN6A 2GU2A 1II8B 2H51A 2ZYGA 3ZY6A 3R4CA 1QONA 2JLBA 2JFOA 3BMQB 4FYHA 2AEEA 4RY2A 2VPXA 3HE3A 3FAZA 3MEQA 2B99A 4IAOA 1RKVA 4X85A 1EXWA 1TM7E 2W2TA 2WJPA 4XCVA 2FFHA 2C3PA 3TVTA 3ZIAD 1LNSA 5EHIA 3KJFA 4BMOB 3B3FA 1Q6YA 3OSZA 4XEUA 4CCSA 5E7MA 3GWGA 4DQ0A 1U5BA 3Q5GA 2BH2A 2FPPB 3G23A 1RYBA 2C83A 4UE6A 1HZZC 1B0UA 1A4IA 3ESYA 5KNCD 3I1FA 2BSAA 1VL6A 2VTDA 3JX9A 4Y2GA 2B9EA 5JSHA 2VF2A 1WL8A 1CUVA 1OSNA 3TTXA 1WOYA 1SPBS 3AEQA 4QBTA 3PR2B 5KJ6A 1VMIA 4DXHA 5K7SA 2JGEA 1K9VF 3NBYC 2I2BA 2WAXA 3RWOA 2A9KA 1I9GA 4YROA 4OHUA 3GV0A 1XQYA 3GEPA 2E2WA 1A3CA 1FK8A 3O90A 4KW7A 1O9BA 3L41A 3M82A 1R9JA 1Z68A 4TVKA 4B9EA 2D7JA 4OBEA 2GM4A 1AQ6A 1CPYA 2I8LA 3MINA 3NANA 2UXCB 1AKYA 1W4AA 5KX5B 1G9XA 3BWMA 2X3FA 1MW9X 2J0UB 3L2OB 4ZCTA 1IPFA 4NVRA 2IS6A 1UOOA 3EGEA 4MLZA 2V7QA 3ZY5A 3F8SA 4WSOA 4KXQA 5HBGA 1UPAA 4B33A 5CFPA 1C3EA 3CCR1 3K1AB 2I2FA 4WBSA 1OFIA 1Q5PA 1RT9A 3LOPA 3OECA 1OTYA 5BOSA 2HF1A 1LK0A 2P27A 4CEHB 4IWYA 3H18A 2X40A 2LDXA 2PMZA 1PU2A 5D1HA 3WJ1A 1JHPA 5BURA 2ODPA 3A1DA 3DAPA 1PWEA 1NHWA 3ELUA 4MQFB 4MHSA 5E9JA 3DDWA 5A3SA 3BN3A 3TBFA 4DVJA 5CCXA 2QRPA 2CFIA 4MS4B 3E5RA 4N3GA 1A7JA 4FFBA 2CLDX 3Q7QA 2HYDA 4FHCA 3WLNA 5IKMA 1KQSZ 4E22A 1B74A 1U3FA 2TS1A 3OQIB 3R20A 4BCDA 2ZQ5A 3ADPA 3CKMA 4ZVQA 4Q15A 1C0PA 1U7UA 1L5FA 1RS0A 3IPLA 4GOXA 2P30A 1P9RA 3KZMA 1P2FA 2B3DA 4MXDA 5K6AC 3NMUF 9MHTA 1X1AA 5ALSA 1N2BA 5IX8A 3T3OA 2LBPA 2Z5FA 3NBFA 1F7VA 2RC5A 3FKJA 1QFZA 4YP6A 4GPZA 2F3SA 1VHQA 2I54A 1NUIA 3V8PA 1O6FA 3EDQA 5KPDA 1DUIA 1J70A 4NH0A 4RZUA 1KJIA 1VQNZ 5DHAA 1SBCA 1KJYA 1Y4AE 3M9WA 4J2TA 2BFEB 5BWMA 4DK1A 1QLJA 4PNPA 3KPUA 4FHGA 1DKRA 1HETA 2CT8A 1W47A 2HIAA 4D9IA 3GLFE 2P65A 3ER6A 3EVDA 2NLOA 4RK7A 3JQFC 3TL2A 4KXMA 4K6CA 2QGNA 3RRYA 3QHPA 2I66A 3V00A 2IYEA 5FLXA 3FTCA 1NBHA 1JG3A 5AVUA 1JEYA 3ZLVA 1DS6A 1JXOA 3LK7A 3UK0A 2O7QA 3I28A 1BS9A 1BW9B 1BEEA 2JGIA 3KZVA 4REQA 2CXNA 4ZRDA 3MM4A 1M1UA 1XCGB 2WWVD 1C41A 1PGOA 2YMPA 3OFNA 4BRSA 4F2HA 5KOIA 5ELXA 2NO6A 3LH5A 2R3SA 1QO7A 4LOLA 4KWTA 2GN6A 3G7NA 1R18A 4LIPD 2XDWA 1RYHA 2HBRA 2X7JA 3BD6A 4YI3A 3STTA 4JI8B 2HAEA 1T36B 3V4ZA 4GVPA 1ZITA 4R54A 4W7SA 3ZBQA 2EQBA 3L05A 4JXJA 2CYBA 4QBKA 4F97A 4FB4A 5L53A 1CZLA 1GJRA 3QE0A 1WKVA 4MEAA 4YJ3A 1WUYA 1CU1A 3HUUA 2C94A 2Z30A 3PI6A 1AQNA 4QASA 2OHIA 1HNZB 2QVXX 3ZCQA 4GWKA 4KI7A 4OI0A 1DINA 3AZPA 5H70A 2IE0A 2ILTA 3AHGA 3G88A 3T9EA 4JBWA 2C5EA 721PA 3VR4H 3JAMf 2BBWA 3SC2B 1YBHA 1T2FA 4ZYLA 2OFOA 6PFKA 1Y8ZA 5K05A 2FE1A 3I5MA 1Q1EA 1PI3A 5JAZA 2HD4A 3TQTA 5AVYA 2BJHA 5DMXA 1UM9B 5EIOA 1N77A 4I3FA 4ENPA 1FRVA 3KSZO 5GM2A 2WILA 3MHPA 1OCEA 3MTDA 4YJFB 3OE7D 3PEEA 4WOCA 3GTOI 1DZIA 2PPVA 3ODGA 1GDTA 4UM7A 3AP1A 1YS6A 3WA6A 4R8RA 1NURA 4EQ6B 2AA3A 4IRXA 5I7AA 1SOAA 1X9GA 2J09A 3VR2A 2TMKA 4J1SA 3CE9A 1PX2A 3RC9A 3ZWQA 3TSCA 3OEHD 3OPYA 4FEEA 3AGQA 4YRDA 1WV0A 3HWX1 4GE0A 3X2FA 3A1NA 4MMYB 1O03A 4I2NA 1FJ2A 4ZOCA 1FMCA 4CIXA 2DBZA 3HJRA 4W8GA 4QYIB 1JW9B 2ANBA 4MA4A 4OREX 4V24A 4EF4A 3COSA 1QVFY 3A6JA 2R60A 1K2WA 3TNDA 2QA5A 1T1RA 2G36A 1AZTA 2D00A 1V45E 4UUBA 2RGNA 3DAFA 1G19A 2H8GA 4D74A 3QBDA 3K96A 2O0MA 2ERCA 1EDZA 5B4UA 1G8JA 3LPMA 3U7IA 2V7XA 1TCBA 1GTJ1 2JH8A 3K32A 4G24A 1KKMA 5JCOA 3CPWY 4I19A 2R79A 3AR8A 4HUQB 5K0LA 2HPZA 4O59O 3C8HA 4DMUB 3GVCA 3SKVA 5E38A 1QX4A 3ZS8A 1HDZA 4S3MA 1DKUA 3F3YA 2NT4A 3RJTA 5BV7A 2G9VA 2J6BA 5GJCA 5HM8A 4XIFA 1UOEA 1THMA 4L6IA 5JMTA 2QMHA 2IOYA 2ST1A 4DWVA 4FMBB 1XB2A 1R10A 3TNFA 4BFVA 3HCPA 4RWZA 3VMHA 1SHUX 2AS0A 2NVUA 2PTGA 3NBMA 4FYPA 5CURA 5G0UA 2NU6A 1LSOA 3KT3A 4D0RA 1BHSA 1HYHA 1W9MA 2HA5A 1CIVA 3PWSA 4GE3A 4O0LA 5BWBA 3VU9B 1E61A 4IOMA 1PRYA 2D13A 3I64A 5HJ7A 4FWBA 3RTBA 4AMGA 4IO0A 1BMFA 5LQCA 1YNOA 2TSYB 5H7XA 5AWFC 2ZJOA 1I2DA 1NZDA 2GOYA 1CLEA 2OILA 4JOSA 2OORA 1K63A 4LSWA 5A62A 3REOA 3DMPA 3W6NA 2B7LA 5AJYA 2Z2IA 4NDNE 1X7XB 3D6AA 1TE2A 3KTOA 3G2QA 3D6NB 1ZKDA 3QU2A 1ABEA 1ODSA 1BJKA 3F0TA 1CQJB 1PQ4A 1FS4A 2DBYA 4KLNA 1KRHA 1YB2A 3H5TA 3M1YA 1AURA 2QG9A 3ANNA 4YACA 2F6RA 2DPHA 3ZI0A 3GJRA 3LUSA 1WCYA 2OO5A 2XRMA 4BGIA 1ZD8A 2FI1A 4PVCA 3TLAA 4Q01A 3LTNC 3S8EA 3L4JA 3RLIA 1S5PA 3HB5X 1I3CA 2BKXA 2XVZA 3HKBA 3AFGA 1JKJA 4IMRA 5FWNA 4JLJA 3EDOA 2ZR0A 4F46A 3M5PA 4DA6A 2X0KA 4D25A 4F56A 4J4TA 1T4DA 3CJRA 2QUBA 1QZUA 2ZR8A 2XHEA 3NV9A 1UPFA 2JGNA 2PGNA 4YECA 3A6GA 3KAQA 4MWZA 3CTMA 5DOVA 2JBAA 2WKRA 4QWWA 3LO8A 4D4MA 3AIMA 4FLFA 1H3NA 4FDTA 4TKZA 4NOLA 1X8JA 4YYEA 1ODTC 1IOWA 3AEZA 5BW6B 1Q57A 2NVWA 5A5FA 5FWXB 3OOEA 3L7KA 2OV1A 3RHTA 2DMRA 5L40A 1LPPA 2HPAA 1TWGI 3KFXA 4CQMA 1Z7EA 5TF0A 1XA0A 4CR7A 4OYHA 5LN1A 3H4IA 2BEVA 2VDKB 2X5OA 3KFVA 1TJPB 1PV1A 2ZRDA 3Q1LA 4WZZA 4CZ2A 3U7FB 4FYWA 4HRYA 1GL7A 2FEXA 4BN4A 1JDJA 2H4HA 2WWYA 3EYWA 3T9BA 5COBA 2WDPA 4G84A 3FR8A 3MZ0A 4QRIA 3HJGA 1SCIA 2P9JA 4F38A 2W6OA 2OBFA 3RJ9A 5KNBD 1WZEA 3T9DA 1ZOPA 3B9RA 2G25A 3C3EA 4RIHA 1K08A 3KVNA 1JPNA 2ZQYA 4GP9A 4EFDA 4N3BA 2OMEA 3PQDA 4AYXA 4Y9RA 1B7GO 4C2AA 2K5RA 2D2VA 4BKPA 1DJNA 4PQFA 2Y1CA 5C4MA 2X5XA 5A2Qb 2CZQA 1WHSA 1VFPA 3A27A 3DBLB 3G02A 3IPCA 1IJKA 2DTEA 3Q8MA 4H16A 2QQ5A 2ID8A 2P2CA 4GKKB 4Y2XA 1O87A 4L3WA 1XNJA 1AQUA 1EUDB 4NHEA 5JPCA 3A4MA 2J1LA 1D2GA 1TCUA 1JZTA 5E7QA 1M0WA 4KQ9A 1W36B 3FKSA 3GKQA 1VOTA 4X1IA 3NIWA 4PO8A 3M7IA 1T6YA 1VLHA 3VPCA 4ZYVA 5CT4A 4G5SA 1KK0A 3ZVNA 1P6UA 4G07A 3R0VA 1HA3A 4N5NA 1GZUA 4URUR 5FUBA 1OBOA 1C0LA 3ESBA 4R05A 5CDFE 2YUTA 1KDRA 3P2JA 2O3UA 3H4TA 4R98A 5REQB 3IBTA 1DWQA 1KXJA 4TZ6A 1KU0A 1P33A 1N2CA 1RP1A 4FQ8A 4Q7KA 3T3GA 3PHHA 4K6KA 4GXNA 1LTHR 5TQ2B 1GKLA 2XTAA 2J9FB 3PLNA 4UZFA 5HHTA 1QTRA 3CHYA 5J63A 2OOSA 1JJ2Z 4W8HA 2IV7A 4D6YA 1QGED 4J4HA 2DPYA 1P0FA 1FJXA 3KDAA 1RFLA 1V6SA 1N78A 1MORA 5EVCA 1B3BA 1MO2A 4I99A 1G9TA 4MPDA 3PENA 2DHDA 2P6MA 2TMDA 2YRWA 1JDNA 4JI5B 2C9OA 2I1WA 4CL0A 2ETVA 2FSGA 2HRZA 3KQTA 2C07A 4MR7A 5K0NA 2XUPA 3AUSA 1F1BA 4AY3A 4CFSA 1CYEA 1IZ7A 4FZ3A 3OX2A 3I23A 5G53C 2XNDD 4MAFA 1JR4A 2PBFA 5E3IA 5AIBA 1ZFNA 2YYSA 3HNRA 4H0CA 1A82A 3CINA 4I8DA 3ETGA 2BSXA 2XNHA 3R9IA 5B36A 1O89A 1Y8RA 4G4SO 4YRNA 2G77B 5AW8A 5ALTA 3O8RA 4BXOA 4V0NA 2NU7B 3UB4A 2G0NA 3KOOA 4NFSA 1NF9A 4FQ5A 3W06A 1ZDMA 5JW6A 2R6DA 3PHLA 4BY1I 4MTLA 4WLOA 6Q21A 4IIDA 2O8DA 1P6XA 2UZIR 1E6LA 1G8YA 4PYOA 2XPCA 4M8LA 4ZEOA 3WNBA 1K8ZB 3UJNA 1YJXA 1M902 4A1FA 1U9ZA 3SXPA 2HGZA 1NVFA 1M3SA 2CXXA 1IPHA 3IHWA 1YC2A 1Q17A 1EVIA 2RBGA 5CBPB 1NXPA 3AW8A 3TRDA 1KFEB 4YMUA 4A92A 4B43A 4NBEA 4OMFG 4HLUC 4LE0A 2YMLA 3D7RA 3H2YA 3JATA 3TEJA 3EXEB 4LYFA 4NV0A 4RZXA 4GOJA 1ISIA 1HTTA 2ZLBA 5GONF 2QQFA 1M9NA 1VPVA 2RHDA 2GPYA 4JJEA 1QHEA 4UD6A 5SZJA 3IQFA 2JJ1D 3C6XA 1HZZA 2CLSA 4YQYA 2ODEA 1IOLA 5IFKA 1TW3A 3ZJ4A 3I2HA 3T52A 3ZW9A 2AQKA 4ON9A 1PJRA 3I5UA 3U9LA 4DMFA 2QRVA 3DZCA 4HUTA 1TM5E 1DEAA 1YRLA 3DFUA 4KUHA 2FR0A 2J46A 4C29A 2GTHA 1LLDA 3GHHA 4HJXA 1V7QA 5EQDA 2IX9A 3IDAA 3R74A 3ZK7A 1FQKA 2G9QA 3NH4A 2N1MA 3DCJA 3FROA 4MR9A 4QEDA 3T35A 1YDWA 1S7MA 4E4RA 5E3HA 4EYSA 5EJ7A 2WRZA 3JYHA 3ND6A 4I55A 4LE2A 1CRZA 3G9TA 1U0OC 1R5JA 4Y8VA 5FNVA 1BA2A 2LTAA 1P5ZB 4AIRA 3LI2A 1UJ2A 4KYVA 1NNSA 1SVNA 4KX3A 3UMBA 3NEYA 3NV7A 3FMVA 1OXXK 2WF8A 2OK8A 3L0BA 3PQCA 3PF9A 4N49A 1D2HA 5D85A 5A7HA 4CWAA 4EB6B 3NXSA 4QDUA 4I5GA 2O5CA 2VHTA 1I51A 1UP4A 1MF7A 4M8NE 3KQNA 1OXSC 2WABA 4NS4A 1RO2A 2IU6A 8ABPA 4OQQA 3JZFA 3D7MA 4QU8A 1PQUA 1XR3A 1YJQA 4DDWA 2FGJA 2GK3A 4ZGBA 2VDMB 4CL1A 2ZDGA 1R9GA 3HZHA 1PWYE 1S8NA 1WULS 1ECLA 1REQB 3KJNA 3S40A 4MS1B 3I9V6 1YJ9Z 1UPBA 4HWGA 2ZRQA 4RPHA 3FSJX 4XR4A 4JI3B 1GG9A 4O4IA 3L4SO 2CV2A 121PA 1UZMA 2PU7A 4G26A 1RAIA 2G3YA 4JSTA 5EIFA 2YH2A 3UHAA 1TCCA 2BGJA 2AOVA 4JY7A 5K6AA 3MTBA 3IUQA 4RD2A 5FULA 1TL7C 2J3QA 3HSSA 1E9FA 3RC3A 2ZE5A 2GJAA 2B1IA 4D3ZA 2CSUA 4JP2A 4KOEC 4BXXI 1T2AA 4GLJA 1Z7BA 2A88A 1LC0A 3MJCA 4MZDA 4FMPA 3QQ5A 1XYVA 4D8UA 1XTZA 1CZHA 4B0OA 2QG6A 3M2TA 4HNHA 1VRWA 3UMYA 4Z1MA 2B2NA 5IJZA 2IPXA 1SU8A 2B6HA 5K4HA 3FPFA 4M89A 2HLPA 4LA4A 3KLPX 5EJMA 1J2JA 1RWBA 4A5SA 3HVRA 1RI5A 4ZQFA 4F3RA 3T34A 3JQFA 1PR0A 1F2TB 3ER9A 2J31A 3ST7A 4LOJA 3VMFA 3BF8A 1PS8A 4B46A 2PKQP 1H2BA 3DCNA 2IXGA 3NIBA 3CCVZ 5LLSA 5GIOE 3S99A 3JD4A 4DJTA 3IP6A 4HK4A 2PKWA 3H3XA 1HTWA 1VLZA 4XTCS 5GVSA 1S02A 2G09A 3PFHA 3PUKA 4QU5A 3CEHA 4Q9KA 2RH9B 3JW8A 4OGKA 4XWOA 1I7SB 3A9TA 1Y34E 3COJA 3WMFA 3K8QA 4H15A 2FSFA 1U80A 1YR7A 2HDHA 2QTRA 5ULLA 1SVWA 3G9ZA 2D1YA 2A84A 1L1RA 4ZAGA 3VISA 1P2UA 1E2JA 3WHPA 1JSLA 2OG1A 3QOFA 4FC6A 4OQEA 4R1SA 3ROZA 2BTQB 4DNFA 1VQ51 4EUKA 5IANA 1J00A 3OU2A 1U2EA 2JAXA 4KC0A 2XI4A 4KN6A 4L2IB 1UANA 3EZ9A 1U2GC 1Z17A 1WKBA 2CWWA 2IYPA 4FFDA 5F3RA 4BNXA 1YUNA 1I6WA 4Y0NA 5F21A 1TUBB 5I45A 3RU2A 1EE9A 4EITA 1OWOA 3I62A 2RHCA 3E0QA 1L4FA 1CX9B 4C4XA 2DFPA 5F2EA 3CNNA 4RKWA 1M1ZA 2PRZA 1FU7A 4I9NA 3VUFA 2ZIZA 3EIUA 2ZZMA 2P3LA 1STOA 5D84A 1M2HA 4G36A 4KGDA 4AY6A 2XUFA 1JDSA 5J4LA 3T3NA 1Z75A 4X6AI 4BASA 2W83A 1V2GA 4QU0A 5IKPA 3AR3A 1N6RA 2DM6A 2P9GA 5F2OA 1MIOB 4RQUA 1JKXA 2OFFA 1UMBB 2I6TA 1V5FA 2YZGA 5LA6A 4DB2A 1TD9A 1NJ1A 2QT1A 4WWHA 3LC0A 4K9SA 3CRW1 3ONDA 3SMQA 4C7OA 1JQLB 1RP7A 5JLAA 4TXNA 4MV4A 5ICMA 2C3YA 5H4HA 3EC1A 1SWVA 5BQXA 2ZUSA 4DBLC 3NC1C 3JWIA 1K9SA 3IO3A 4HRVA 1KJQA 4IKEA 3BWVA 4AC9A 1YL6A 3T7TA 3MGCA 4A1OA 3R4VA 4BTEA 2V4MA 1EUCA 2ZBUA 3QJ5A 4BP1A 1HQDA 4RMIA 2HV8A 3O8OB 4K9KA 2JD0A 3ETDA 2XW6A 1TLTA 3ROFA 4DW8A 4YRJA 2E85A 4HVTA 3BYZA 5KKCA 3VNAA 4J1QA 3FD8A 5BN5B 4FZRA 1P45A 3QKTA 4UDOA 5ENZA 3DJYA 2Q2OA 2WJJA 1NU8A 3W5UA 1R8YA 1XDZA 3Q6IA 3VU8A 2YZKA 5HFJA 3HV0A 1OB2A 4Z3OA 3O84A 1FU8A 3RYFA 4WA7A 1E3EA 2H63A 2C29D 4Q7JB 3INRA 5AXAA 1NT2A 3CQ9A 1QPBA 3C7CB 3ZIDA 2NG1A 4TL8A 4EFKA 3CXCY 1Q50A 2WWHA 1TADA 4ZCRA 1Z9BA 4RY9A 2GCGA 4WOJA 3KALA 4MW9A 4XWWA 4NBUA 4LXIA 3DYVA 4M8SA 4NMMA 5E0KB 5BR7A 1UBSB 2JATA 5K8UA 5BSGA 1WJ2A 3B1XA 5J4VA 1A71A 1IHYA 2WI8A 4OHXA 4RSMA 4HQ6A 1DMRA 2OPHA 4YCNA 1VL1A 5A2QA 4TMFA 3TIFA 1ORRA 1Z36A 4A73A 3PZRA 3PL1A 1ZS9A 1WLSA 2XWPA 4N7BA 3QVJA 3GCGA 2RH4A 4AY5A 3W3AD 2H1OA 3KQUA 1E2NA 1HM5A 3EDYA 1LFDB 1GXSA 2RMKA 1EXDA 3F3PC 1UBKS 4RLHA 4DCPA 3AJEA 1W8DA 3JR7A 2C78A 4OKSA 2V58A 3FI0A 4A2QA 1YU9A 1YBFA 1F0PA 4W1QA 3UUGA 5GV8A 2C54A 4V1CA 2BFDB 4KEAA 4WCFC 3SIWA 4KR0A 3WJ7A 1OH5A 2A30A 2GCNA 2P5SA 2ZAYA 3BX1A 3FSGD 3QF4B 4OP1A 1QBGA 4DS3A 4YAFA 5DBFA 3WQQA 3VTFA 1D6SA 3ONVA 3EXG2 1FFWA 4NHOA 1AD2A 3EA5A 1KJ9A 4A3BI 1TYBE 1YJ5A 3KEOA 1E99A 1EVYA 1XZDA 2JHFA 4QFMA 4YHHB 2VP2A 1N2OA 5BN3A 4Y1FA 4C4YA 4TMKA 1OW3B 2MINA 2UYQA 4DY4A 4CN8A 5GONB 3EUFA 1MB2A 1P61B 4GZ6A 3T8YA 2D5IA 1THGA 2J5QA 3E7XA 4GUDA 4JSRA 3FPCA 5KTPA 1PGPA 3LKBA 5FUVA 1BQEA 2Q29A 1AHNA 1KP2A 2VTKA 4I6GA 3F90A 4GC9A 1E1KA 5LQKA 2AZDA 1FW6A 3W2EA 2Q41A 4KUGA 3AUJB 2Z4RA 1BE0A 4D0GA 1YZKA 3TZEA 5TQJA 4RHTA 2YHBA 3IHLA 3IT0A 1A8SA 2WWGA 1SIUA 2BVNA 2Z09A 3IUBA 4EPVA 3IKLA 1WB9A 1XCPA 3CPHA 3RJ5A 3ROXA 3BMOB 2IUFA 3MYRA 3RUEA 2E7ZA 3NTRA 4ALNA 2HWWA 1TGVA 2AKYA 1O58A 2VNAA 1WHTB 3I6BA 2I7DA 2WHYA 5DMHA 3RRJA 1KAHA 1Z33A 3CKLA 2WKPA 1EK1A 4MUIA 3AVWA 4L0CA 3RIHA 3HOYI 2P79A 1CDOA 2QV0A 1YZUA 2PRJA 1N3IA 2NADA 2RGWA 4JUFA 3WK8A 3X2EA 4DG5A 2IT1A 1ZK4A 2OCPA 2IU0A 1IZ8A 2ETXA 1V39A 3C7TA 2VWGA 3P0EA 4HDRB 2AOWA 2O3RA 2A7QA 3C5EA 4LYHA 1E0KA 4TZKA 5DI3A 5MGBA 3WHKA 1FDTA 4WESB 3SICE 4EA9A 3K6SB 4DSTA 3PEWA 2FUNB 4Q16A 3ZWDA 3O73A 1CC1S 1GQOA 2VN8A 2HOQA 3GTJI 3DZFA 4L16A 4GOND 1T0JB 4EI8A 4MLDA 1JSRA 1YULA 2C2OA 1KAQA 1M2VA 3FVVA 2Z6AA 4DDVA 3WGYA 5AKGA 1JQEA 2EWVA 5C44I 1XZFA 2GN9A 1HQYE 1DX6A 4QTTB 5CITA 2F43B 1YIDA 3KR9A 3AR4A 4CU5A 1RYEA 2ZJ5A 4HO1X 2BV3A 5AKJA 3CCCA 3C1TA 5DULA 3UWSA 1CT9A 2AD1A 4DLSA 4QVIA 5EI5A 2AMFA 2Q5LA 4ZMSA 3UWMA 5HRUA 1Q861 1GP2A 1RCFA 2HBZA 4S1OA 1HEUA 4Y2SA 1EWRA 3EASA 2ZJ7A 4YAWA 5DU2A 3S2EA 3T6KA 1V5WA 3EVNA 4Q3NA 1U1EA 1CULC 3G2OA 3U26A 1T4BA 1V3QE 1A7KA 2DWOA 1FXSA 1Y5NA 2BHSA 2F1KA 2JCGA 2QTBA 2VSQA 2VC2B 2AOUB 3DOJA 3R3SA 4MGHA 3SXUA 1VL5A 5C8YF 5KWJA 2GDZA 2YV5A 3THXA 4F3TA 1C9KA 4KV9A 3IR7A 4HN2A 4IOKA 4DGLA 1LVGA 4MB6A 2KMLA 4GD3Q 5HTKA 3EN0A 4JBIA 2GBLC 2W6ID 3PITA 2ZJZA 1ST3A 4K7JA 1WE2A 1OREA 2HIMA 4MICA 5K3FB 3V2GA 5HGXA 2NP6A 2GPJA 2Q5OA 1K9M2 1EG7A 3MMNA 4GYWA 2ZYWX 4GI1A 1V96A 2IPLA 3TIXB 3DULA 5KC9A 2ZRFA 2JFNA 3F7NA 3D7LA 3TB6A 3H0GI 3CNOA 1M2EA 2VF4X 2V9ZA 2I3AA 1XG5A 2PS1A 1YE5A 1L6RA 4J0KA 5BORA 1QH0A 3FN4A 3FWYA 1T5BA 3HKEB 4LN1A 3ZV4A 5B1YA 3GLTA 3DKKA 3OLYA 1YCFA 3LLCA 4US2R 1TPZA 4MAAA 1IY0A 3M34A 1J33A 4JI7B 2DAPA 4L8GA 1KP9A 1LWOA 2WBLC 3D6TB 4L28A 1MJGA 1P5FA 4L73A 4LV8B 4HZUA 1RHUA 5FD8A 4UEOA 3W9YA 2EX4A 4D56A 1IM2A 1USIA 2IQIA 2WG2A 4R8MA 4TUYA 5JC8A 3U7HB 1MAAA 4CM9D 5K0FA 2I1VB 4Q7MB 1P5RA 4DGQA 1D6MA 1JDBC 1JLMA 3O21A 2R9VA 2WTAA 2E1PA 3E35A 2YWEA 3SMVA 3LY7A 5IVHA 2PMFA 4CL8A 1EIZA 4RDHA 4ND2A 1NFRA 2X3UA 1KYXA 4RADA 2IU3A 1NR7A 3KYJB 1E7SA 3GG2A 4FFRA 4CDRA 5B5SA 4ROTA 3E3NA 4OHWA 1X86B 3IPAA 5IT9f 1FVXA 4IDGA 3HXTA 2EZ4A 3NHKA 1NW5A 4HLUA 2ZU0C 4NYMR 2H1VA 1N9KA 1Z4LA 1NDHA 5BNZA 1K89A 4PO1A 3MRTA 4K03A 5MF6A 1UBHS 2QPTA 1WU8A 3QXJA 4HYTA 3IBCA 1U7XA 3P9ZA 4QUHA 1X0TA 1Z0AA 1M0TA 2ONCA 3RV3A 3ZV7A 4S04A 4JUDX 1IRXA 1VPTA 2FPSA 2VJMB 3VDNB 4BVGA 1CUZA 3TRFA 3PBKA 3T12A 1Z2OX 1C7FA 3WYFA 2PRIA 1U1FA 3TQFA 1KE2A 3MWYW 4JCCA 4QYSA 5EWMA 2WIGA 4BZXA 5IU6A 4JLKA 1VLLA 4UARA 1L8AA 5CVJA 3PJEA 1HTBA 1KDVA 2VLIA 4AJJA 1ZJYA 2YVLA 4O2RA 3S28A 3MA0A 3R41A 4YRCA 1U0NA 1DQSA 1MIHA 2GHQA 3HA2A 3KV1A 4ACAA 2JHAA 2CZGA 1WY7A 4GSKA 1DC6A 2HBYA 2IEZA 3K20A 1UXJA 1B0PA 5KOJB 4JYZA 2H2GA 4HX5A 5L3ZA 5KVVA 2Q0SA 4P3PA 3WBBA 5B57C 1DC8A 1GPJA 3ZE6A 4C4OA 2NVXI 3D81A 3MJTA 3QKRB 5E6UA 5BXYA 4PF1A 4QG7A 4YJHB 3CU5A 1L4GA 5J43A 3QLJA 2O8BB 1KZYC 5JRJA 2YVKA 2VNIA 4RS4A 3Q6NA 2AZXA 1AXRA 2ODQA 3KPJA 3NT5A 4CM3A 1RW4A 4F21A 4XIGS 4YDQA 5I7VA 3USCS 1M2NA 1P18A 1MRZA 2FR1A 3P71T 3LZ6A 3VR5H 4DFDA 3BXFA 2CMGA 2IIBA 2PS9A 4KQIA 5CVCA 4KTVE 3UAZA 2GBGA 3VKFA 2HO4A 1JMKC 3MFQA 3ZE8A 3LQQA 4F2WA 3MW8A 2VHXA 2W6ZA 2PUCA 1TA9A 2FSHA 2QNBA 5G40A 3CMAZ 4G89A 3WLAA 5C7IO 3TFOA 3VOSA 2WD7B 4HSGA 1E59A 2NU9B 1RZRA 2XCUA 4M60A 2C59A 4WK0B 1CDZA 2WNHA 2WZBA 2J9RA 3QU4A 4Z2AA 4NE7A 1UINA 1XZAA 4L5YA 3LMKA 4I9HA 1VKNA 3KEFA 4KO8A 3VHQA 3A9WA 3ZJ5A 4B6FA 4YMGA 3M6LA 4R1MA 1V16A 2CFCA 2Y67A 3A8TA 4JJ6A 3OQ6A 1P5HA 1AGPA 3HBNA 3C7DB 1R0WA 4Y2YA 1H2RS 3KVYA 3TLJA 4DSOA 2H5JA 3L06A 1XZIA 3OAAA 4GG1A 3I9MA 2Y4NA 1PQWA 3F3MA 4AD8A 1OI3A 1JXAA 2MSLA 1Z3IX 2FKNA 3L0PA 1YK1A 3AM4A 4M7RA 5FRDA 3U4IA 2UYHA 2ZIWB 4KYTA 3HVUA 3QVOA 2J08A 4FWTA 3Q87A 1SG9A 1KI6B 2GPTA 4YUVA 3JQAA 1YUAA 2ZK7A 4LGYA 2LCQA 1A27A 3GJ8A 4V38A 2O8FB 3PRYA 3I4MI 1U0FA 4ZICA 5G4KA 3WZMA 5JCJA 5A0FA 4WZAA 4IJ6A 1Y6GA 3CUSA 1NOKA 2GLUA 2OTCA 3A2LA 5KYTA 3WIBA 3MD9A 1F60A 4XX2A 4QGHA 3MOSA 1Y6RA 1HORA 4LYDA 4NZZA 4MD7A 2GPNA 1N6LA 4XW2A 4A3GI 1ZAKA 3QLVC 1BXGB 4GRAA 3IVCA 4X00A 4B3JA 3I4FA 3T4UA 2G06A 3WHLA 1BDBA 1RXYA 4FHFA 1L4UA 4JWKA 1QIHA 5DTJA 1PK9A 2HK8A 1HPLA 2WSYB 4R1NA 1FYDA 1R6AA 2HWXA 5AR1A 2FSSA 5B1IA 3MFYA 4C6TB 5JSYA 4IMJB 4ZQBA 3U4QA 2XMPA 4KFSA 2ESRA 1EE1A 2OHHA 3DKRA 1SKYB 1U2GA 4GOOD 5KVAA 3AY3A 2X1VA 2BONA 4FDUA 5H81A 5FBLB 4HGYA 3BULA 1NRIA 1DXOA 3RARA 3K72B 2VBIA 4HYQA 1GO2A 2Y3IA 2BZ0A 3K5PA 1NYLA 4UW9A 5A2GA 4BTLA 5LMUB 2VQSA 3ZIAA 1H69A 1T1GA 2B3TA 2SCUA 3EIQA 2OXEA 1J8FA 1NOJA 3KQSA 4R7GA 2IUUA 1NI4A 4PVDA 4AXXA 4C7JA 2H7XA 3PNPA 3NOXA 1NUPA 4BBZA 2G67A 4CNBA 5KNCA 4C0XA 1XFDA 4N6OA 3T5AA 1GZDA 3AUYA 4GYKA 1DG1G 1F5SA 2B5VA 5H80A 4C43A 1V1MB 1TM4E 2I80A 2O2EA 2QIOA 4I1YA 4NS1A 1E8MA 4DLNA 2FFJA 3D4PA 2WU4A 1GQ2A 3KQPA 5IN4A 1EWTA 3ANMA 2N75A 2ANCA 4MDFA 3E8SA 1WB6A 1L9XA 4TS9A 3E3AA 1DU4A 1Y9AA 1PSZA 3ZBTA 1VQM1 5MN4A 3BSSA 5CBKA 1KE1A 1OBHA 3AUXA 3FNRA 4PIMA 2Q51A 1HYGA 3ZK9A 5C8YB 1N1DA 2YWCA 4XVHA 5F33A 1P7CA 4WZBE 2BCGY 5DGXA 1XF1A 2YTZA 4I9UA 4HAZA 4RVDA 2VUTA 4L85A 1FW8A 1TT5B 3WGKA 2WTUA 4W99A 4MWBA 1LCIA 4DCSA 5B1EA 3U16A 1F12A 3RTDA 5BO5A 1NPTO 4OFZA 1ZCBA 2J3DA 2V4UA 4FOOA 5DX1A 1P3Y1 2UVDA 5ALPA 4NH1C 3ZDZB 1SRRA 4FYKA 4X44A 3WKBA 4BFTA 1WW3A 3KZ1E 3PHJA 2HSJA 1B42A 3FWNA 3Q3CA 3IQIX 1Y98A 3WMEA 3YASA 1RSZA 3GLVA 3PGMA 4L5BA 1CEYA 4NB9A 2IHUA 3QHQA 2JH9A 2WYUA 1VKHA 4NBHA 3CH6A 3EYAA 2IBMA 3FOCA 1DL6A 2D2FA 2DUMA 3V7NA 4YMSA 3VPDA 2FDRA 1EZ4A 3IB6A 1HLFA 1TJ4A 3JQ7B 4Y1RB 5BSHA 2WK1A 4Q9IA 1VQ9Z 1E9CA 3H9BA 3UMMA 3IFUA 1EVLA 2P4UA 2IZOA 1XZCA 4P3YA 2JIDA 4YPFA 4CGZA 3HYRA 5TMEA 1Z4MA 3ZGZA 4WCFA 1E20A 3WGTA 2AG1A 3ZOZA 3ZQ4A 3ABZA 1RQLA 2NAFA 4GGOA 4DJEC 3MMSA 3WGJA 4F1WA 1XPUA 3ZHOA 2MWMA 2DPXA 1LI4A 3DE0X 2EKPA 2W22A 4LJ5A 4QFBA 3UC9A 5F51A 3UWOA 4DCGA 3IUNA 1E64A 5I4KA 4W9MC 4HAWA 3C5CA 2V97A 3IFSA 4R3WA 3F6BX 1JWBB 3MS7A 5AI8A 2MT9A 4BE4A 5HJ5A 3ZNOA 1R27A 3VJRA 4E33A 1T6NA 4I5DA 5KQRA 5HQTA 4GDMA 4AK9A 2QN7A 5TS2A 3VKUA 2DSNA 4MV9A 2GPBA 3H2IA 4RCYA 4HXGA 4XX0A 3WYDA 3GJ3A 1QKKA 3CEAA 1IIRA 3F4KA 3GJ5A 4EMSA 3HYTA 2B61A 5C34B 1ELOA 1WMAA 1DC5A 3FUCA 1I9CA 1Q3HA 4Z86A 2I91A 1S3SA 3ONNA 1F20A 1GG2A 1SUPA 3LF1A 4KXVA 2X9GA 3MYYA 2VP5A 4C7BA 4DA0A 3RSFA 1C30B 4HP8A 3EIEA 4IIUA 2GPWA 4Z9BA 1FX0B 4GHWA 3TMYA 2GBFA 1A9OA 1QIMA 1S1MA 3P26A 4DIDA 1EBFA 1E2HA 1FFEA 1MA3A 2EG9A 3LC7O 2ADOA 2AK2A 4FZVA 2V0GA 1DG3A 1GPKA 1NBMD 1K5HA 3F47A 3CCQZ 1OTHA 2NZVG 3FGOA 4IGFA 4K6OA 1GYPA 2ZB8A 3CCE1 2CXRA 3Q41A 3HKCA 4G25A 4XWYA 3WV5A 3HY6A 4HDCA 1E9DA 5I7RA 3VNUA 2C77A 3VSAA 3C1UA 4OEHA 4F2GA 1QHIA 1Y1QA 1ULZA 1TIBA 1QZTA 3I04A 3IV6A 1Q44A 2IF0A 3L7LA 2HF7A 4I4TB 3E2MA 1SUWA 4QHSA 4IV5A 2E5FA 1NYTA 2A57A 2J9YB 4I36A 5BSWA 1QS0A 4JGGA 2GZDA 1ZA2A 5KDLA 4UMEA 1YHNA 2E4WA 5A0VA 1TYZA 1BCRA 1VE5A 4HX2A 4MS3B 1IBCA 3KVRA 3MJ4A 2DFTA 4RV4A 3OE7A 2NXCA 3WB2A 2AJ8A 1F48A 4M0DA 4MMZB 2Q2QA 2I71A 1QYVA 2G08A 1KVQA 5KNLA 1NX6A 4E6PA 4CF7A 3PWKA 1EGHA 2XUJA 3A9RA 2ATXA 3N70A 3FPAA 2HK9A 4FN4A 4IQGA 3OETA 4NZNA 2IDJA 4PBTA 2E4XA 4X6YA 2HA4A 4P33A 1IRIA 4D9NA 3QU5A 4LMAA 4TS1A 4OFXA 1DOHA 1ML4A 1YIAA 2VUHB 3OEHA 4CKBA 4PQRA 5G3YA 2I29A 1NT4A 5K01A 2EEPA 1AHIA 1Q12A 4M0UA 2HA0A 3LVFO 1K68A 3OZTA 3G9XA 4WI1A 4V0RA 2VHJA 1NVDA 4KR9A 2OBLA 1AO0A 3K6KA 1CUXA 3ODPA 4W6ZA 3S1SA 4PWZA 4ODIA 8AT1A 2A94A 4FR0A 4MUBA 1XTRA 4FHEA 1BD4A 3I1IA 4RF5A 2INGX 4WD3A 1ZI6A 4WLNA 5ES3A 1L5SA 1XZQA 3ICVA 2D1QA 2X9QA 2P8SA 1TK9A 2MHCA 2QD2A 1ANKA 2OXTA 3EXIB 3I56Z 2B8WA 3D6HA 1VYUA 5D2CA 4YUYA 5DNUA 1IHPA 4U9IS 4YI5A 4D8XA 4PLYA 3L01A 4Z4EA 1D2NA 2HRBA 2EATA 4NMLA 2I7TA 1Y1WI 3RSSA 1ZIPA 1ECBA 1EFPA 2C0QA 2ZYRA 3FSEA 3MRSA 4Q3BA 1KY3A 4KXUA 1I33A 3TXXA 1JA1A 2VL7A 3CJTA 1FDSA 3P9QA 1AG9A 1S721 1EM8B 2QD4A 1QO9A 3FB4A 3PNLA 4PFQA 1ZJJA 2Z6UA 4DMLA 1FMFA 4GC5A 2GI4A 4FJ0A 1I4WA 1X6VA 5JWHA 3E9MA 3EUAA 1E2FA 1TVKB 5DHUA 3IJRA 4R9UC 3OTWA 1K8XB 3L1KA 2EOAA 5HUHA 5JATA 1BDMA 1H94A 1YQTA 5BYKA 2G6TA 1CQXA 1VKZA 2AN5A 2C8VA 1I1OA 1S2IA 2ROQA 1X1QA 2W58A 4YBRA 2Y1FA 5AKLA 1LUAA 1M2GA 3CC8A 3MWKA 3R0ZA 1RYMA 1QU2A 4D5GA 3RPEA 1CWUA 4KPEC 1V43A 4UBJA 1O4WA 1LTKA 1Z74A 4BRZA 2NZ2A 1UZLA 3LDHA 3E9ZA 2PUFA 2OFWA 1TO2E 2Y92A 3L46A 3MJSA 2WG0A 3N2KB 4IV0A 2F2TA 1J0DA 5I9IA 3DQQA 4KVGA 5A4KA 1EP1B 1NQAO 5KHLB 1QIKA 3ESWA 1EHYA 1USWA 2A8YA 2VWHA 4H6XA 3H97A 5K3DA 1YDMA 4S2UA 3TR5A 1JEAA 2G0TA 4KLRA 1G7RA 4TN5A 3LC2O 3P5SA 3ZDXB 2O8CB 2GVZC 1YMQA 2GCEA 1C29B 4BBPA 1W0JD 4BMZA 3A2NA 4ZI3A 2QTZA 1VBKA 5KYNA 4UTRA 2EV9A 3SZMA 3UVEA 1POXA 4LRQA 1FNBA 3IP8A 3KJGA 1S9HA 2VJPA 3OC0A 2WT4A 5TGZA 1Q7Y1 3I8SA 4WBNA 3TCKA 1PL7A 3R7FA 2VWPA 1JJFA 4RKRA 1FUEA 1RWVA 1DI0A 3PVSA 4GNRA 3RKUA 4JH0A 5LOVA 4WY2A 4MV8A 2R6GA 4Q7EA 4RVNA 2WY2D 1C1XB 3CPEA 3PJGA 4NJMB 3PDCA 4O4LF 3EPJA 1QG6A 3WOVA 1P44A 5LZ5A 3BGVA 1H8ED 1P7VA 2XUIA 3X1KA 4LTMA 2XAAA 5JANA 2BFCA 1QYWA 1TRKA 2IGTA 3I9NA 3KB1A 4M8KA 4NI5A 1A77A 2A2ZA 1IMJA 2GRJA 3DVSX 3EVGA 1Y3HA 1JTVA 3OFKA 2QSZA 2C8KA 2JKVA 1N5JA 3KWLA 3OIUA 1M6WA 2V03A 1F6DA 3CLHA 1HE3A 2N46A 1NNI1 5J4YA 2Q5JA 2R8ZA 4LK2A 4GI3A 1GT6A 2NUPA 1LBIA 3T3EA 4ABTA 1VQL1 2YN0A 5BV8A 3K70B 3IUPA 2XOXA 3ZPXA 5FUYA 4L9WA 1XZLA 1OX6A 1ZOOA 1ZSVA 4L4ZA 1W87A 1V95A 4P7GA 5GAJA 2NVOA 5KYXB 1LLFA 3HFJA 3LQFA 3R7WA 5HM6A 4J29A 1M2WA 2Q5IA 3PG5A 3C98A 4PZZA 3IMKA 4DCOA 1JUDA 4RA6B 3L7CA 3FFAA 5FF9A 1Y1PA 4QFDA 2ACVA 7GPBA 3PQ7A 1T8WA 5D3KA 3QVKA 2WSBA 2L42A 5HQ3A 4U2DA 1Z5GA 4XFKA 3IV7A 5JMPA 3SC3A 1K27A 1OKKD 3EEYA 3D3KA 2W8ZA 3I83A 1GUDA 5TXGA 4ER0A 4H17A 1T5IA 4B4UA 3H8SA 3H86A 5JI2E 1JDZA 4UBMA 1SCKA 1J07A 5GIPE 2XQJA 4LXHA 4XR9A 4PEVA 5JALA 2O2CA 1E7WA 4GPEA 5F1OA 1RM0A 2EYQA 3KFLA 4GM1A 3ZHZA 4BNDA 5KTNA 3DGEC 1C7JA 4UEQA 4MZXA 5DI9A 5EJ2A 1QGAA 1UMDA 3B1VA 3V7WA 2K87A 5D6OA 1YT5A 4BNVA 2ZRGA 1KZ4A 1J25A 4REMA 5HX7A 2DHCA 5CDUA 2DQKA 2P9ZA 3A58B 2JGKA 3EZYA 1Q3TA 2VSOA 4L4YA 5C9ZA 4XA8A 2VYCA 2ISCA 3R24A 2WVHA 2PUWA 1J6UA 2X4GA 4ESOA 4UTPA 1NKTA 4Q3AA 3TNYA 3N6V