2H85A

Crystal structure of nsp 15 from sars
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
347
structure length
347
Chain Sequence
HQSLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGESVKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCGCSVIDLLLGDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and mechanistic determinants of SARS coronavirus nonstructural protein 15 define an endoribonuclease family.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords Putative orf1ab polyprotein
total genus 87
structure length 347
sequence length 347
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2h85A01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h85A02
2H85A 2RHBA 4RS4A 2GTHA 4S1TA 2OZKA 2GTIA
chains in the Genus database with same CATH superfamily
1H5NA 3FX2A 3RPEA 5B3KA 4YRQA 5DM70 1R0YA 5C32A 1NPDA 2FZGA 2H2WA 2PGIA 3DQPA 1TYCA 3WXBA 4MWZA 3TOSA 1BS1A 3GJ0A 2CT8A 3VR2D 3BYZA 5ALDA 4DJFC 3BIFA 2HU8A 2SHKA 4Y3UA 4CN8A 3IBCA 3RODA 3H2JA 4KEAA 4PC3A 2F1IA 1B6RA 3KUUA 4FEYA 5FFFA 4S12A 2FPGB 4KW7A 4L8GA 3UK0A 4D0SA 4IDQA 3B3AA 1QYVA 2HBYA 2X40A 1DCFA 3FVTA 4BMSA 2I62A 3H8SA 5TE9A 2P1ZA 2P7HA 4QUDA 3CX8A 1VQ1A 2GKSA 4AF8A 3G0IA 1WMAA 1ZU5A 3RSOA 4TUYB 3K0KA 3TBFA 3A9CA 3MMNA 3VYUB 4BLRA 3PVZA 3GBSA 4ATNA 3DLPX 5FUQA 2XY4A 4KN5A 3JD2A 4BNDA 4CKCB 3PO2I 3EC2A 3HVIA 5JAZA 4HEJA 2FTKE 1MQSA 1NJI2 2VDKB 3I1FA 2XD9A 3M6VA 1T43A 4XUGB 3VZCA 4LWZA 5HE9A 4CJXA 1EHCA 1X19A 4F4UA 2ZRGA 1XNJA 4F9FA 2PJRA 1JU9A 1Y3CE 1PJCA 3MUOA 1JILA 1ZGJA 2BDTA 4UMEA 3H4MA 1E7MA 1JVSA 1ORVA 5IAGA 2R8XA 1NBMD 4R3UC 3D7SA 3HGQA 4AKSA 2AZTA 3D9XA 4KODA 5HS6A 2IIPA 5CLIA 1H8HA 1VGRA 5A6VA 2G04A 5E4FA 1Z82A 3D6HA 2I6FA 1K2VN 2OBNA 3C6XA 1QDUA 3O31A 4RZ3A 3SPXA 5FDFA 4UEJA 3BK2A 1CY0A 4C1NA 1I9GA 5FLXf 1S9DA 4HVLA 1RP1A 3FW1A 3DQZA 3O2JA 4BQNA 1YQTA 5CB4F 1J0CA 1Y1LA 4GP6A 3ILVA 4WNAA 2XT9A 3VSBA 3OZTA 3J7AC 3KM0A 2ZIFA 1HE3A 2GYWA 3PXEA 2Y76A 4E2WA 3GRVA 1W5FA 3K30A 1YVRA 3KYCA 3NDPA 3STWA 4B3DA 5J1SB 2CE7A 1EVEA 3HKCB 4JH0A 1LBIA 1MCZA 1Z5NA 3LKBA 5KAMA 2VJCA 1UBGA 3C3WA 4LTDA 3WAKA 2KJQA 3AKEA 2H11A 2ISCA 1JJVA 4Z3OA 2Y1WA 2BKEA 2GVDC 3V7UA 3ORHA 1NRXA 4JQZA 4YRCA 2H00A 1ZU4A 5JCPA 1C7FA 2GTPA 2WP8J 4A2CA 3NTLA 4AWAA 4NJEB 4JUIA 4ZVTA 3QFSA 3DHNA 4FWBA 3UJ8A 5NLLA 3VA7A 2VP3A 4HI0E 4OH7A 3WC4A 1PDOA 3ZCSA 3FXAA 1A9SA 2IPMA 4XGIA 2PT6A 4K8OA 4EA7A 3WNDA 4JBNA 1JG4A 3ZBTA 4CMEC 3TJZA 2OILA 4ZQFA 3SS9X 3G89A 4GP7A 4H1UA 1V1RA 3AR9A 4F4FA 1NOKA 1II0A 4YRKA 3W6NA 1VIVA 1DPFA 2O1SA 3CGGA 3W5IA 4I1IA 5AK3A 3ZTTA 3TPFA 1MO4A 1ZM7A 4IDBA 1U3FA 5E6SB 1NYQA 3DCIA 4K0RA 1A9ZA 4MIEA 5JS2A 4M0UA 4E09A 4A15A 2PLFA 3HBJA 1Y8RA 3T5GA 3O47A 1IPFA 4X6AI 1Z4IA 3U3ZA 3GGGA 1PJQA 2NUPB 3K2QA 3O0DA 5KINB 3EQ7A 4L57A 4DNPA 1KD11 3F46A 1CSEE 1S02A 3QYJA 1SZCA 1JXOA 2CFRA 2FQ1A 1M72A 4JQCA 2ET6A 4UDNA 4ZI7B 3CF4A 1GPKA 4A8HA 1KBQA 1QUEA 1X1QA 1NV8A 2HCJB 1QHXA 3IPLA 1O03A 2QN2A 5ILQA 5CJPA 4C5AA 1DHRA 2FE1A 4LSWA 2YFYA 5CHYA 1XZCA 3B53X 4Y9DA 4Y9SA 5HBRA 4NCBA 3DWGA 1XMSA 4QRHA 2J9GA 4BQOA 5BXYA 1H8EA 4XWWA 4D9NA 1QVGY 1DAIA 1XZAA 3DUFA 3GFTA 4N5MA 2B83A 4EQ6B 5KHLB 1KQPA 2F8LA 1WPGA 4IIBA 4OU4A 4AJLA 1IN1A 5A4KA 4XB2A 3OMLA 5EQFA 2IOYA 4LDNA 5I4KA 3Q3CA 3R3HA 1H8HD 4YI5A 3ZIDA 3GXBA 2DE6A 4B44A 2RHMA 1U80A 2EG5A 3LUHA 3QV2A 5H7XA 2ZB4A 2FMUA 1CDEA 3PKJA 4B7XA 4QYMA 3U6KA 2WJIA 2J85A 1XI2A 3DBRB 4GH5A 4O4IF 4I4LA 4OATA 4XIJA 3SX0A 2TMDA 4GC5A 4X3PA 4C4XA 1J20A 1A95A 2Y1LA 3THWA 3LO8A 2HU9A 1N7HA 3EEDA 1QPBA 3TCKA 1ZB9A 5A3SA 8OHMA 1UM9A 2VHTA 1MABA 4MS1B 3ZXXA 1VMAA 3D3QA 3GJSA 1V5EA 3B9BA 3NXSA 4N3GA 2V6IA 3I551 1L5HA 1E3TA 3AP3A 5T4FA 3ENVA 4LV8B 2JBAA 4MCHA 4LWOA 2ZTSA 1Z0KA 2ZRKA 5HMMA 5HFAA 1JBQA 1OPRA 3ZCRA 4DIUA 1TQHA 2OMEA 2YXBA 2FR0A 3PLAE 2HW8A 1DXYA 1FU7A 3UXYA 1V5GA 4PZYA 4CIYA 1RHQA 2HJSA 3I9OA 2TMKA 1RWNA 4K6FA 4MR9A 1CIVA 3LUFA 1CQPA 4MQEB 3IXLA 4S0XA 2HMTA 5LFAA 4QPZA 2AUMA 2UZ1B 2VF8A 4KQ9A 4DJJA 4E5VA 5ICEA 2CN1A 2FZ5A 1T2UA 1EDBA 3E81A 4FFMA 4JKIA 2QAGB 3CRMA 4KQHA 3PE4A 5K0JA 1NI5A 2VEDA 1VLQA 2G1KA 1ZGGA 4BUCA 4Y6OA 3V1UA 4QXRA 3LXXA 1DEOA 3QPUA 2NT3A 5I7UA 1EUYA 1NMZA 1JXAA 4RVGA 1RAEA 1G0NA 2QL9A 3G8DA 4L85A 1SQ6A 4E5DA 4MYCA 3N9IA 3RVSA 3SE7A 4UNPA 3G0GA 5JCJD 3VNUA 1SG0A 1ZRSA 4UEWA 5B3LA 2BSAA 4WVLA 5FA6A 2YMMA 4V0NA 3AFOA 1XTUA 2E2HI 1K92A 3AC0A 3W1VA 1IB0A 4B79A 3IIMA 4XFJA 3PUVA 1VPWA 3ENKA 1R6XA 3KJHA 1T9HA 5U1PA 3RBXA 3PX2A 4DT1A 1O9HA 1RYBA 1BD3A 5F51A 4BRUA 3NRCA 5CEFA 1SCQA 3RIGA 3WQQA 2AFRA 4M9SA 5AVKA 3OECA 3ZHOA 1WHTB 4RULA 3BXHA 3GOHA 3R3UA 2Q4ZA 3I0ZA 1MNAA 1AZSC 4BKPA 2J0QA 2IKSA 3A10A 4QFBA 3VR5H 3NYRA 2H07A 4FR2A 4LHWA 3NBYC 1JFVA 4LE0A 4TL7A 5D1HA 3FQMA 1V45E 4HXGA 1NURA 4KNYA 1TA0A 1P9WA 3HY4A 2X19A 5AW1A 3I9NA 2Y1XA 3F8TA 1VQ81 4MVJM 3NP7A 1ZI9A 1ECJA 5AKLA 1AKYA 4H16A 1T5IA 2OL4A 3GIWA 3ILXA 4HK4A 5BSUA 3WSVA 2JJ8A 5KQMA 3RC1A 2QTRA 4A8JC 1OBCA 1CTQA 3BIJA 3JZDA 4QDTA 1UWVA 4HO1X 3KQKA 4AYWA 4H3KB 2DAPA 3CC2Z 1VG0B 1NNSA 3H83A 4N8SA 1UJMA 4D98A 4FMPA 4XB1A 2YWGA 2HGSA 2I7TA 1SBNE 2VJPA 3A9TA 1YACA 2DQ4A 1LBHA 4HDOB 4NMXB 1MDBA 4QUHA 3TTSA 3HYSA 4QQ8A 1CJKC 1SUEA 2PQ0A 3MTEA 4IW3B 2PX6A 4A7PA 5IDXA 5LQRA 1U7UA 1ODCA 2EKPA 4PLZA 3N70A 4KBYA 4E5NA 1YOVA 2NW6A 1HR0B 4AMGA 1Q7TA 2PT5A 3HZHA 4Q39A 1U0SY 1XJCA 4FFBB 1BFKA 1HETA 1CEQA 2G5GX 3BBLA 3GMDA 1TTTA 1RJDA 4KR0A 1IN7A 3KJNA 4MS3A 2PZAA 2V9ZA 5D1NA 3E82A 5FLXb 3QPAA 5FRDA 4Z51A 2H1VA 2IPOA 3ELWA 3H87A 3JR3A 4L4XA 4RF2A 4TWIA 3DMGA 4I6GA 2W22A 3ZE6A 4Z9BA 3HM2A 3IE1A 3VZBA 3OU7A 5E3IA 5JRZA 1P19A 5HK9A 2GF9A 2V9CA 4YK7A 1AK2A 3L7LA 4EUFA 1UP4A 1GEGA 1P3JA 1KYWA 4A8JB 4BBRI 3SFTA 3F74A 4XLZA 4C0QC 2J33A 3I37X 1I1QB 3AHIA 2OB1A 5M5BA 3O2NA 4GOLD 1J4AA 1K0UA 3QP9A 2O8VA 3MMXA 4ITUA 4I3GA 4Q03A 2H54A 1XU9A 1PJ2A 1L5GB 3R77A 2B82A 3ZNPA 2X1MA 4HEA6 1SBZA 4W1RA 4D9GA 4BMDA 4G81A 1TIPA 2OG1A 4GPD1 4KTVE 1YE5A 2CNWA 1A4RA 3D7NA 4ZRMA 3HRIA 2B98A 4IG4A 2OEPA 3ANXA 3JQFA 4D74A 2GPYA 1C29B 2IUSA 5CLLA 3B3JA 4PAMA 2M6NA 3ZDCA 4NAVA 1NBHA 4FE3A 2P9HA 3MS2A 1FQJA 5GJCA 3I72A 4G1BA 1KFCB 1TUGA 1ZAKA 3H17A 3CF4G 2X8JB 1YZNA 4HATA 1P1BA 1PDWA 3K1ZA 4ZT4A 3QKTA 1ULUA 3HADA 3ZCPA 1FDUA 1TC1A 5MHTA 3MAAC 4R40A 2G0TA 2ZBRA 3W5DA 2HJVA 2EWVA 4OX9B 4CR6A 1ZUWA 4DRYA 3CPWY 4UULA 5DGXA 1Q821 2H5JA 2JA7I 2OC4A 2PX4A 3O92A 2WAAA 5IARA 4IDPA 5CNKA 5EJ5A 1QIKA 1SQSA 1SKBA 3IJRA 5DN6A 2CUTA 3N2NA 8GPBA 5B2FA 4AYXA 2FEPA 1JJ7A 3R3YA 4FHDA 4MJXA 4ZT6A 2Q5CA 4D96A 3OQNA 2PMFA 4TVOA 3FN4A 4CCAA 1NN0A 1AUQA 1COWD 4H7EA 1T3LA 4DGSA 3BXGA 3E58A 3G7UA 1MZVA 2OG2A 1GQYA 5ICSA 3H2BA 3TB6A 1HC7A 1ZW1A 4RF5A 1UJ2A 3F67A 3REOA 2OD7A 2QZSA 5DGTA 3IL2A 3SXUA 4UCXA 2RARA 2V8BA 3AR2A 3JD0A 1OYVA 3V8BA 1W36B 2V65A 2X2PA 4J2HA 3CIOA 5FHRA 4EARA 3OJWA 5JCOA 4QFMA 4A73A 5CDGA 1CC1S 1KDOA 1O6GA 1ZEJA 2WT9A 4BFXA 3SC6A 2WT4A 4GPBA 1R9MA 1XQVA 3R5KA 1M1YB 2BM9A 1M2OB 5LVAA 4KG7A 2ZPAA 3PICA 5EHNA 1K27A 4HNHA 5HM6A 3M9WA 1OYYA 4C6RA 1KC82 5FWNA 3PB3A 4LIPD 2HHAA 1UC8A 4GXNA 5EP1A 3HU2A 3FVVA 4L3OA 4Q3OA 3URKA 4X63A 1Z7YA 3S2EA 1QP8A 2B9VA 4JUBA 2RC5A 1GKUB 3Q7IA 4MTCA 3WV5A 5LQCA 3KPUA 3A6KA 1SB8A 4TKVB 5IUJC 4CMBA 3QVMA 2Z4RA 4IIGA 2VHYA 4TVBA 4YV2A 4L15A 3CD6Z 1MDFA 4FBGA 3S5UA 2AN4A 3B7PA 5FOQA 3LL4A 1P2FA 1QYCA 1C1DA 3HB7A 4I8IA 1M6WA 2XKAA 5AM0A 5FBHA 1D2EA 1KXJA 3CCE1 3V00A 1DAHA 1QH8A 3DOCA 1M2EA 4FQ5A 3O91A 5JUWA 1PX2A 1WR8A 1FB5A 2XNKA 1SQ0A 2JFZA 2Q6VA 2V6JA 2QRLA 4R2XA 1T8RA 2P5TB 4BMYA 1L4FA 5FLEX 1KXZA 4YDRA 1J49A 1A8IA 2RJ3A 1VHLA 1Z37A 3N5CA 2AOTA 3NFZA 3EDCA 3AVXA 2O8EA 4LKRA 3IAS1 1LPOA 1I51A 1G6KA 1KDVA 1RC8A 1NIJA 721PA 2BUCA 4HL6A 1ZWKA 3FOAA 3RYTC 5P21A 3FPHA 2CLIB 2IH2A 1Y1TA 2I3BA 3CXCY 3LFUA 3BMXA 4F4DA 2YYSA 1X1DA 2EERA 2QTTA 1YRBA 1GN8A 1CV2A 3CKMA 3R0ZA 1G1AA 4TRNA 2OCKA 4U5QA 1RFGE 1IWPB 1ADGA 1USGA 3NVMB 3TRKA 5KNBA 3S8MA 4IEEA 2X7HA 1QJCA 4Q4HA 2QRZA 4OXQA 5DLDA 1E9BA 5BSVA 1TWAI 5CT8A 2CJPA 3RANA 1RPJA 1Z6PA 1HQCA 2QT1A 2QGFA 4K2AA 2Z5LA 1LWNA 4TT3D 1YCFA 3JZAA 1IY8A 3I2IA 1HT0A 1XPUA 1USWA 5ALIA 2JFHA 3RS4A 1PVVA 2IYYA 3SIXA 4RXTA 1CRZA 3DO8A 4L2IB 4UKDA 4BZXA 3F3FC 3U1BA 3LMKA 5AVJA 2A78A 2KSQA 3OE4A 4OI4A 4TLAA 4EVQA 10MHA 3SIPA 3LDFA 1X1EA 3VNRA 3L4SO 1W2WB 5LQAA 1W48A 2WVJA 4H60A 1ZNYA 5DK4A 5K2OA 3OP4A 2OM6A 3W2FA 4XDYA 6REQB 1C9JA 3NWPA 2DUWA 4OCZA 3VMGA 3ROPA 4OHWA 2GCGA 4CL3A 2CDCA 1NU8A 3TVYA 4I55B 3GPLA 3TE7A 3BCUA 1HI9A 1BWPA 1MT0A 3JSXA 3PDWA 4GWLA 4FYJA 1YR8A 5EHQA 1T3TA 3L84A 2XVXA 4DM7A 5B7GA 1M76A 5I7EA 1FS6A 2JBAB 4A6DA 1QFSA 3UN1A 5T4EA 4ZI7A 4NYMQ 1S5PA 2DJ5A 1C3VA 2FR1A 3QXCA 2QMZA 4Q3BA 1W34A 3IMEA 1FP4B 1CUAA 1PS0A 2JLBA 3AFGA 3DBHA 5J5CA 1EJ0A 1LEHA 1FVFA 4JQSA 4O5AA 2ZJ3A 3FSEA 3GJ7A 3WGOA 3U1VA 1GITA 1E2MA 4MITA 1NQOA 2F3SA 1PK8A 1XTKA 1YQUA 2HCBA 2WFMA 2V98A 2WILA 3I09A 4EI9A 3E8SA 1ID8A 1LBTA 4G67A 1G66A 5KCMA 4AZWA 4HVCA 2HRZA 3UENA 1P80A 4NENB 2J5XA 2C2YA 4CG1A 3UHOA 4L7QA 4MR7A 1PBNA 2SKDA 5CLFA 2C5GA 4CCWA 4Q3DA 1JBKA 3TDMA 2JA5I 1UC4B 1D1QA 3RZDI 1Y5IA 3DF7A 1NW4A 3CEMA 4ID9A 1E77A 1MRSA 2C2GA 2CK3A 2HLHA 1PKEA 2W58A 3UJ6A 4GXTA 3G4SZ 2VAVA 1VL6A 3KU4A 4P80A 3PNLA 2C2KA 4F0JA 2Q5OA 3IQDB 4YHBA 4Z4HA 2P9BA 2W0MA 3LV8A 2XHEA 1P4GA 1M34A 3IDFA 4YAKA 5AUPB 5KOJA 4KUEA 3SR3A 4XVHA 1AJEA 1I7NA 1CUYA 4EF5A 3CPSA 2YRXA 2AKAB 4URVR 5JAPA 5G0WA 3H4IA 5HEKA 1PR1A 4K28A 2HSEA 4PZAA 2WV7A 5DHTA 1JU3A 1WA5A 3U3KA 2W6JA 2F1HA 4DQ0A 2QA41 1TUIA 3AWDA 2P2DA 3OUTA 3JQAB 1RW4A 3MQFA 4KVFA 3WJ1A 4UNNA 3UGKA 4YYEA 2HIAA 2HLDD 3DO5A 3BWEA 2C4HA 3OZAA 4TYMA 5DT9A 1COZA 3AINA 1Q812 3HBLA 3GLIB 1THMA 1X7GA 1XZDA 4D5EA 1HDYA 2P5UA 2A9QA 2ORVA 3I9KA 421PA 4F38A 1L3IA 3CV3A 3TZCA 3UT0A 3URMA 1KTVA 1NYLA 4JLVA 1R9GA 4PHTA 3FHJA 4GPZA 3IEMA 5KIAA 1UBRS 4WMLA 1ISFA 3M89A 5DCLA 4NZZA 1AQIA 5KYUA 1F20A 2XA1A 1T3ZA 3CRNA 1YT5A 5BUSA 1J24A 3T0GA 2G72A 3G1WA 1V39A 1BU5A 3ZNOA 1YJ91 4A3MI 5CGZA 4JLMA 3I4NI 2FW7A 3W5SA 3M6FA 5JBQA 3EXIB 2I91A 2QLFA 4BLWA 3U7RA 3NAZA 2C7OA 3OHPA 1U28C 5BXQC 2P6MA 5AW8A 1QCZA 2OHOA 1Q91A 4YJGA 2FX5A 4WESA 4P3OA 1VQO1 1JQAA 2ICAA 1RPAA 1U5CA 4BB0A 3AJEA 4DMGA 5DI3B 3DC7A 1C9NA 1EX9A 1SBHA 2BFFB 3O82A 5SZKB 2PQ2A 3CZRA 2ANCA 2VT3A 1LK0A 1IRXA 1VKHA 1XEAA 3PBKA 3IURA 4J1TA 5E9WA 1M5TA 5EIWA 2PRKA 1ZICA 3ZHXA 3VKGA 3VU0A 1U6KA 1GTG1 1U3UA 3C4VA 4BASA 1Z2CA 2VWPA 5DXAA 3SXPA 3T95A 1YI2Z 1AB6A 1YQQA 3ETLA 3K9LA 4A6EA 2E89A 3A1WA 2QB5A 3PTZA 1R74A 3FHOA 1NBME 5F2EA 3TAXA 1W44A 1W9MA 3IKLA 3HJHA 3RHZA 4EFDA 4US2R 3GDOA 1OPXA 1OU0A 1LSSA 3VPGA 5F52A 3E5HA 4HX5A 2AKEA 3ICOA 3AM4A 1HPLA 5EZYF 3KTDA 2Y0SA 4FNGA 3CIFA 4K86A 4GWGA 4X1IB 4OU5A 2D59A 3ZV5A 2W48A 4MI9A 1GGHA 4ON9A 1EBUA 3KIHA 3R7WA 5INTA 2C9OA 5JAHA 3R5TA 3WWCA 3KZOA 3SKXA 2WPDA 1WMFA 2B1GA 1NF8A 4MV1A 4XVQA 4A91A 1NR5A 1Q7Y2 1ZMBA 2H1IA 4MYHA 4ZK6A 4CL8A 3TLZA 1VLLA 5IC5A 1JEOA 2FG7C 3V2IA 1U3DA 3TE6A 4C7MA 1CZKA 1YZLA 4DDUA 2F9FA 3DG9A 2BISA 3ZHRA 5IM4F 2BMVA 4JJFA 3R2JA 1QF6A 1RQ7A 3A05A 3KQOA 4JJIA 1A9OA 3R8XA 3O8OA 1WW3A 1KS2A 3VC1A 4B45A 3L0SA 3VR2A 5BNZA 4HGOA 4LHEA 3GN2A 1GVHA 3ZIAD 2QS9A 1ZH8A 2IXEA 1BXRA 1FJ2A 1TQDA 3KWMA 2EWMA 3B1JA 1C50A 2JRCA 3LHFA 3ND6A 2WYUA 1XKQA 2AN5A 1KI8A 3LZCA 4N0EA 4CM1A 3GDGA 1E79A 3PNBA 4R2MA 4F3RA 5BY2A 1EP9A 2O8BA 5I9NA 4ISBA 2NXNA 2IS2A 1C3XA 3B8HA 2JAUA 4A0SA 4C4RA 2M32A 3ZUPA 1M1K2 2IHTA 1T6YA 5AVOA 4OHFA 2WWXA 3B1VA 3EISA 4LC1A 2Q07A 4HXFB 4FQ8A 3R20A 4U9HS 4FKZA 2GXAA 5E6UA 5ALLA 2V7VA 1QU3A 1Z88A 2BHRA 1VA4A 2ZRNA 3NTOA 1KMHB 5F4ZA 5EUMA 1P0IA 4GE3A 5BSTA 3VZRA 3ED5A 1WXXA 2ZIEA 3EZYA 4J94A 4CPDA 3LOUA 1NE2A 1Y33E 4N3AA 3NAGA 1QRRA 5DULA 3E1KA 3WB2A 3NYQA 2HIHA 2IEGA 1Z22A 4OMFG 4DB4A 4MUKA 4YT5A 4ZJYA 1H42A 1WIWA 1KDZA 3GLGB 3E3NA 3MELA 3FWYA 1FU8A 1ECGA 3K92A 2H0AA 3Q87A 2BW0A 1PCXA 4IH1A 5DEIA 4ZCSA 3CF6R 3RVBA 4CW7A 2CVOA 1KSFX 5CVJA 4MS4B 3GZNB 4XYEA 3WLHA 6GPBA 2H16A 2IYPA 2YV2A 1RZRD 4DAEA 2XE6A 2CLSA 3DL0A 4L3WA 4YCLA 2E4VA 3DXZA 4F71A 1FOEB 2I65A 1E5QA 3P9SA 1TVCA 1YOVB 1PD0A 2JGKA 4WX2B 5AJYA 3NM6B 3X1WA 3IAXA 4Q7QA 4NE2A 4P7GA 4IJMA 2YUIA 1NNLA 2EVWX 1QLJA 3O4HA 4RE5A 4JZYA 3RS0A 1U0HC 1X42A 3EIEA 3ROTA 4UFPA 2B5VA 2Q6IA 4EYEA 4NDZA 1RM5A 3PO3S 1OXSC 1ZI6A 1EM6A 3KOOA 3KJQA 1C4WA 1C81A 1V6AA 2QY9A 4C0HA 2BOVA 2O07A 1N0HA 1V7PC 2QYOA 1XHLA 4GZ3A 1JHZA 1HG1A 2PSEA 5D51S 1DP4A 1GWNA 2J0UB 3F3MA 4RL4A 5EWJB 1KKMA 3OOEA 4H6VA 3TECE 3IPRA 4EO4A 4ONEA 3G85A 4UE2A 3GCGA 4OK3A 5I7AA 4EW3A 3LDAA 5FKJA 1F2UA 2YQZA 4HH4A 1Q7CA 4BU1A 4CETA 2B3DA 2X14A 1N2XA 4H6PA 3L6BA 3OU6A 1BMFD 5DP1A 2GTIA 5IS2A 1DWOA 4JJ4A 2XB2A 1BG6A 1J5XA 3A7EA 4DPKA 1TJ3A 2VT7A 3P2IA 3FTEA 2BGNA 4Q9IA 3UMSA 1AIPA 5FLMI 3C14C 4G1UC 1JPJA 1PZGA 4WKNA 2P6PA 4WFKA 5C81A 3AGPA 3VZSA 2J5RA 4RJKA 4MKXA 2ZKLA 3L1UA 5D3QA 3JAMb 5EWMA 5FFNA 4ARBA 5CYGA 5K3DA 1ICEA 1SURA 2IYOA 2WHQA 3UHJA 3CCEZ 5CK5A 4W1PA 3MGBA 4NI5A 4F21A 4A0FA 2WBLC 3KVVA 4D9IA 4REQB 5DLPA 3RG8A 3OLCX 2Q4RA 1QG2A 1NM5A 4UAJA 1K7SN 1WTAA 4Z8YA 3QI7A 3G9UA 1PP4A 3I1YA 4ZZIA 1D1SA 3PNYA 3KALA 2Y9MB 1KKUA 1SQFA 2VYVD 1A9QA 2XMRA 3A6EA 1AE1A 4MQUA 1MA3A 4BCCA 2C4KA 4AJ4A 4I4NA 1T1RA 1CZLA 2C2XA 1ZC4A 3OEWA 5I9SA 3UJ3X 3KKLA 4BV8A 4EYKA 5ALVA 1VQP1 4IIVA 1Z07A 2NTYC 2ZOSA 2AVDA 3O90A 1EIWA 2FPOA 3I8SA 4N7BA 1NJ5A 1T4GA 3GAZA 3E35A 3OO0A 4IIEA 3WGQA 4B3MB 2XI4A 1H2ZA 2I99A 3LSYA 1KK3A 2RE8A 5LXTB 2WD7A 2WIFA 3H7AA 4P08A 1I5OA 1POWA 1GGJA 2WG0A 4CT5A 4Y98A 4AXXA 4G86A 3EUEA 2XB6A 5KNCD 2PL3A 2C54A 1Y6RA 4HPWA 4B0PA 1YB1A 2C0QA 3FZEA 4ZQIA 1Q6ZA 2I9PA 1OXUA 3HKDB 3INNA 1Z29A 4JENA 3JVEA 5TARA 3PSHA 1J33A 1JVBA 1L5HB 1DPGA 3H13A 2WDZA 1JR3A 1TQ2A 3IQIX 3WK4A 4A3SA 2W7TA 1E5LA 1BMFA 5EG5A 2CLCX 4AJ9A 2FRDC 1ZR2A 3DH0A 3GTMS 3RWOA 4L16A 3ONVA 3QVUA 1XZPA 1ZK1A 1EX1A 1DG9A 3M6XA 5DNEA 1H23A 1PL8A 2Q5LA 1BEZA 5AKEA 5DBFA 3V2UA 2BBOA 2QNRA 3PUHA 3VV2A 4EB3A 1YR2A 3CG4A 4RK5A 4OYLA 5IK2D 3USES 3N7AA 2G77B 1E1LA 4B47A 2R8ZA 3RUFA 1VKOA 1P6QA 4YRLA 1P4HA 1KGSA 1Y7LA 4ICIA 1ZR4A 2W2VA 2O23A 2DUMA 2DVMA 2WNSA 4DFDA 3VPAA 3G8AA 4RENA 4Q12A 1DC6A 4GD3Q 4NOMA 5HIMA 1YR7A 3O8BA 2B5WA 4G0OA 3OEHD 3G5MA 1V3QE 5CVTA 1RXSA 2OQ2A 1QVZA 2M9MA 3EXFA 1KSGA 3LVBA 4DCGA 1Z63A 1U8ZA 3TQFA 5K7SA 1SM4A 3UG6A 2GJSA 1NQUA 5D5QA 1KIAA 5FQOA 4FGSA 1W4BA 1E99A 1GFZA 1ZJYA 1RMYA 4EGQA 1SVLA 1TX4B 2GK3A 4ZYVA 2LCIA 2A5LA 2N1BA 5E4YA 1XZLA 4KWTA 3HYNA 2RGRA 3GEIA 4O2AA 2ZRIA 2JIRA 3SJBA 1U04A 2FEKA 1I7PA 3A31A 3R9IA 4PZPA 3MUEA 2XYHA 2NSLA 1AT1A 3NP9A 5AK6A 4BKQA 4A93I 5AVZA 1DC3A 1ODKA 4LDAA 2EFCB 4DQXA 1QRUA 4RPHA 4WN3A 4LHXA 2KS6A 4AO6A 1YNOA 2AJTA 4IDHA 1DXOA 4NMWA 3S40A 2ZT5A 3WIUA 4E22A 1N9KA 5K8LA 5KX5F 2L82A 3U09A 2DBZA 2FR8C 2QUAA 2WIGA 2RHDA 4H7KA 3ZW8A 1L9KA 3AERB 3CMMA 1U9YA 4LK3A 2JFWA 4M89A 4UTOA 4C04A 5HUHA 3OX3A 5TC4A 2CBZA 3T35A 5ITVA 2XNHA 1G8AA 2OORA 3EVCA 3ZLVA 3VYWA 1ARZA 1D7OA 4UATA 3GAFA 1H5UA 4BCBA 2C57A 3B2NA 4ZTUB 3HYRA 4HB2A 5BSHA 3MHPA 3HK2A 2J30A 3OEYA 1E18A 3EHEA 2O0KA 5EKSA 1NT4A 3L7YA 2C9ZA 2GVZC 3QBDA 3QMVA 4HXYA 4MYRA 3EODA 3TZKA 3WYFA 3JWHA 4EATA 4F9TA 5EXEA 1T5TA 2DSTA 3HCCA 3P71T 1Z2AA 3QEMB 4PYLA 3JASB 3GH3A 3H0EA 1SKQA 1Q95A 2HHLA 4X6YA 5KOIA 2C96A 2VEOA 5J4KA 5B1IA 4IKOA 4M1KA 1K06A 1MAAA 1M7HA 1POXA 2I8AA 2PZBA 1KEWA 4ME6A 4H3SA 3J7A4 1E6KA 3P94A 4WT7A 3V4PB 8ATCA 3OX2A 1HNWB 3HU1A 1YIJZ 5FF9A 3ORFA 1DHTA 1Y3FE 2A1UB 3E3LA 2PS1A 4NJMA 4PO9A 1G6Q1 5LQSA 3HDQA 5CA0A 3OLVA 2P9FA 4V02A 2B1IA 2XMBA 3P9KA 3BZWA 3BD8A 4FFVA 4AY6A 1K8A1 4OMCA 2MT9A 3DMTC 5F2OA 4RJTA 4JI2B 2PYZA 3ETHA 1K68A 1E2FA 3NDBB 2WJJA 1QIDA 4RLQA 1Z16A 4J76A 1M1YE 4G41A 4CM8B 1WU8A 1FPQA 2ACVA 2OO3A 3IBFA 3IYLW 1DAOA 1GXSA 4G97A 4ZOLA 1JEQA 3P2OA 1ZGZA 2O1XA 3RT7A 4E1BA 4DY4A 4RSHA 4GL2A 4BV3A 1LNZA 3CMCO 4G8DA 4NU8X 2IVFA 4HZUB 2AQIA 4XQEA 4CM4A 4YXWD 4IKPA 4UQPA 1DBVO 4B17A 5AW0A 4K7JA 2YVAA 3WWDA 3FH0A 3MFYA 2J07A 2ETVA 3ZCVA 1S4MA 4KL8S 1QCYA 3G9XA 3NBUA 2QOEA 4C08A 1U8TA 3SDSA 2NP6A 3V3KA 3CTPA 2BY4A 5LZ8A 3GRCA 4RSRA 2JB9A 3EFEA 3IP9A 4ARSA 1L7MA 3QHPA 2YWFA 4H4EA 1E0SA 1NNI1 4F6CA 5JISA 3QPDA 2Q0HA 4NBBA 3H9GA 4D3SA 3TTYA 1SBYA 5D7BA 5E1OA 3W2IA 4WXPA 1O0CA 1DJPA 3ZR4B 1VM6A 5FTWA 3SEAA 4ZIRA 2Y0BA 2WOOA 2EJVA 4UBOA 4FEEA 5LMNB 16PKA 3U3RA 1N9ZA 1E7SA 2JHPA 5DNWA 1G17A 4B82A 4Z7OB 1Z74A 1LLDA 3QFCA 1VQ4Z 4WH0A 2FPRA 1XZNA 1LDNA 2OHIA 2VZLA 2ADOA 4FMDF 3A4VA 2X41A 3TZLA 3VHRA 4BMPB 2MU1A 5DYTA 4KAXA 2VZ9A 2NZ8A 1MW8X 4DQYB 4MUJA 3QX3A 1Z4NA 1JHDA 4KDEA 4IICA 2O2XA 3B5EA 5H8WA 4RV5A 1AMUA 2XCIA 4LCBA 5EVJA 3JYOA 1A50B 5CFOA 4GLJA 1BDIA 3ELDA 1N33B 1TZ2A 4DUPA 2ACWA 1LZLA 3IFUA 2IHKA 4JNKA 2NAPA 1FSSA 2WSLA 3NCTA 3OCUA 1Q16A 2IOFA 3PEVA 4XB6B 3CME1 4C01A 4DWVA 1MXFA 1YZVA 1ISGA 2I54A 3GV0A 4PBSA 3MVEA 1ODTC 3RVOA 6Q21A 4L50A 2H51A 4U4AA 2ZM5A 2CLEB 2FW8A 2VAMA 3LDUA 3SIWA 4AKTA 2FWMX 5CH8A 1Z03A 3H5IA 1JL3A 4O8CA 2HT6A 2YS6A 3CR3C 1E63A 4G0PA 4NBCA 2C7PA 3DR5A 4MB6A 4MWSA 3H6KA 1P1KA 3A4TA 4HPXB 2ZAEB 3A7DA 5AW7A 2ZYTX 4DWOA 2GPNA 1KQSZ 4ALMA 3C98A 4ND6A 4QREA 3FCEA 3GHHA 1AV7A 3IAUA 4G09A 5FOSA 4D0LB 2QRVB 4EHLA 3JW8A 3C41J 4HH3C 4UNRA 4P0PB 3K4QA 3KE9A 4FU0A 4IDDA 4TQ9A 3O8RA 3PF8A 4ZOLB 1Z0AA 4CM6A 4QJ4A 5FT9A 1KEVA 1TEXA 3SK0A 4B3GA 3TW0A 2QN9A 4M9XA 2R7LA 4BLSA 3H11B 5HJEA 2DB3A 3HKEA 2CUNA 1EGAA 2RGBA 3ZNNA 3HKBB 5ECGC 1GPJA 1CHNA 1J2EA 5TGTA 3HO1A 3SYKA 5B7QA 1K89A 4OD0A 2CHUA 1IATA 4LNAA 3ZE2B 2WTEA 1Z2PX 3EZ9A 3SKVA 1JYFA 1NJ8A 5DMXA 2FPMA 1RT9A 3F8SA 5JFOA 3PHJA 3R3XA 4G26A 4ZVMA 1EA7A 5FAKA 2PS9A 2V4MA 5JS7A 3IQEA 4R8MA 2QJTA 2NO4A 2QVBA 2ZBDA 3RNOA 3FTQA 3KSBC 3MPUA 1ZJ6A 1QP7A 3BHJA 1XEXA 3MWJA 4JOCA 4IIXA 5AKKA 3KZMA 1JXQA 4L8YA 1G9XA 3IOEA 1YJAA 3DE7X 3EXHA 3ZE7A 1YR6A 2CC2A 3ZKAA 1ZL0A 3FHTA 2AXPA 1EE9A 2M6RA 1VE6A 2V5VA 3JASA 4LSZA 4RD0A 4J8PA 4PLWA 3UY4A 5HTKA 3RSLA 2BMWA 1DAPA 1KMNA 4ZV7A 1ADBA 2XYPA 1ZD2P 3K20A 3H9QA 3O4FA 4GP9A 1XA4A 1GRRA 1T2EA 2B6HA 4KFSA 5T41A 1A2KC 1MU0A 1N7GA 3DT6A 4OH1A 2FEXA 2PX3A 4XASA 3CJTA 4Z3KA 3OZWA 5C8YB 5DBHX 3A3NA 1BD4A 1EVLA 2D1YA 2O2HA 5TF4A 1MB9A 4RHUA 3WKDA 4RKWA 2POCA 1L5WA 3LXRA 3HFSA 4K5QA 1QVRA 3DLBA 1SKYB 1Y5LA 4Y0NA 4OV6B 3GJ6A 3JRXA 1BCRB 3Q8WA 1KERA 1VKJA 1TXGA 3CUTA 1ENYA 3JR7A 4JT4A 2BTQA 1PQYA 3JD1A 2BJHA 4ER6A 1LDGA 4RIGA 5ENDA 3EX7C 3VV3A 3G1UA 5ENVA 1G9TA 2DWUA 1PR5A 4X66B 2LVBA 1VOTA 1EUZA 2P9QA 4KPEC 2GBLC 3QOWA 2ZM6B 2JFXA 4RJ2A 3WLJA 2PUFA 3T5DA 2I78A 1ULZA 1NJ1A 5JDCA 3HL0A 4J2OA 3SG0A 1G4AE 4D9KA 2AJBA 2DRIA 4RK1A 3AESA 4KPYA 1A8SA 4K6OA 5KSOA 5C52B 4W9MC 3KYCB 4HDCA 1AB5A 4PVCA 3R6LA 5FL7A 2HO5A 3SZGA 2OCPA 2X0NA 3TXXA 3ZCXA 3TNYA 2EGUA 3F4BA 3W77A 1XMJA 1JLKA 1FNBA 4I2NA 4U5XA 2OTLZ 3U4IA 5CX1A 3V4ZA 1YCHA 4C29A 2BAGA 4GFDA 4L22A 3ROFA 1G1MA 2VJDA 4XIGS 4LE1A 2A5DA 3H6GA 5D8DA 4E4TA 1DRWA 4WOBA 4CG0A 2WUGA 3NW9A 1EVYA 1AMNA 4H4DA 4CIAA 3G4S1 3NH9A 4ZCLA 2PRZA 4JAVC 3OZGA 1PZEA 2GU2A 2FW1A 2RGXA 2AEJA 3I2HA 1ZNZA 2H18A 3BFKA 4LDJA 5EKXA 3WP1B 5ALMA 4KN8A 1KARA 4HJXA 3Q72A 3VNBA 3VSEA 5EVCA 3TNJA 5CCEA 5F78A 3CCRZ 4DG9A 4IO0A 3OF3A 1KF0A 3E9QA 1I3NA 3G6E1 1WVMA 3OZRA 4EAQA 3WFJA 5ARBA 5HCIA 3WJ7A 3VR6H 1X1BA 1A97A 5IDWA 1TZBA 2J3IA 4H77A 1XYGA 3KZ1E 4AN4A 1OX5A 2HCFA 4M6WA 4W9RA 4LC0A 3CF0A 3D7MA 3HWRA 3OQMA 3A4LA 1EZ4A 2WSYB 2C3YA 1OAAA 4P3NA 2WA1A 1EFLA 2ZWOA 1ZMRA 3DOOA 4II2A 3CSDA 3NJ8A 2QU8A 2OOYB 3S15I 1K08A 2YS7A 2BFOA 4C05A 5KNLA 2YNMD 4PLVA 4ILKA 3GXOA 3K9HA 3K0EA 3PGJA 2VNKA 3CH4B 2BI8A 4FT4A 3FGZA 1YJBA 4H59A 4KQGA 3TMKA 1FDRA 1JWAB 3ZYZA 3INYA 4AJKA 1RRFA 5EHZA 2XUKA 3L5OA 3IQFA 5KWVA 4RM2A 3N8HA 1YZKA 1VI5A 1EQAA 3F3YA 2I1QA 2O0JA 1PHRA 3UXMA 2DERA 3FKII 1B2RA 4IL5A 3DVAB 3OLWA 1I3LA 3JQPA 2EHDA 1T2VA 1U2DC 2XV1A 3KQTA 3NHLA 3FA2A 1J0BA 2FY8A 4GPEA 4DHWA 4CM9D 1J00A 3CW2A 1I80A 4HX9A 1HV8A 3DOIA 2ZS8A 3TLEA 3DFKA 3PQCA 4D80A 5ICFA 4LFAB 3X2EA 2VUIB 4E08A 3MTDA 4ZVUA 1NTRA 5KQRA 4IDNA 1N6HA 3FPSA 4PZEA 1MV8A 1PV2A 1GYQA 1VXOA 3EXIA 1DT3A 3EDOA 4G01B 4TWZA 3DGFC 1UBFA 3ZTWA 2WU4A 1JIVA 3PJEA 3PNKA 2BTEA 1B1CA 3EZ6A 2P9EA 2EFEB 2GZ1A 4UZSA 2H92A 4A8PA 1CFJA 1QH1B 4IO1A 3WLOA 4RGYA 4ERNA 4RPJA 3S44A 3EF1A 1LV7A 3H5WA 3RLIA 5LPNA 2X1LA 2P3OA 2JI7A 1GJRA 4LN1A 3WHPA 3W3AH 3GGOA 5LL6P 4XPIA 3N87A 2IF2A 3H05A 1LVUA 1KR2A 2JZNA 3DAGA 5KNDA 2RH8A 3S17I 4Q6BA 4I5IA 1M66A 1WSBA 3TM4A 1LXCA 3ECAA 4FZ3A 4HVAA 1IU9A 4QOFA 4ZYYA 4CKXA 1IOLA 2VVTA 3JQ6A 3DZIA 3SEZA 3AUXA 1MJFA 5FOWA 2OO5A 4WPGA 4BQSA 3SF8A 1WUIS 3INTA 1QYPA 2AMYA 2Q3BA 2QQFA 2IIQA 5IDVA 5CAEB 2IV3A 5IT0A 1GT91 5A4MS 3U17A 5KTNA 2VA9A 3C1TA 1N36B 3QNWA 4POOA 4G0MA 4LA4A 3LZ6A 1OJ7A 2PFGA 3RLFA 4FMBB 4KVZA 1SULA 3UHFA 4BBSI 1XGKA 3AK4A 2AMFA 1X94A 3IT3A 4A1FA 1CUZA 1MR3F 2DT8A 2JD1A 3F5DA 3WK5A 3EDRA 1RYNA 1QB8A 1ZLXA 1IHDA 3KAPA 4XA8A 5JXWA 5HF8A 4WFIA 3CNQS 2XXAB 2QW1A 1ML8A 3B38A 4JLPA 1QIHA 5JY1A 1MX9A 3N2ZB 3ZDDA 4ARCA 1E98A 2VTBB 3DEKA 3RZOI 4CM9A 2C7VA 4GYJA 2J3KA 4JB3A 2DTEA 2QTVA 1N0VC 1PT5A 3BREA 4AUMA 2PPVA 3ITKA 1Z4LA 2OE2A 3QEAZ 3E7WA 1N6OA 2G5PA 1ZCFA 3EBPA 3IS3A 4LJ5A 2Q4DA 3SZRA 4X7PA 2ZAMA 2DU8A 1DO8A 4PNHA 1C1XB 4P36A 2Q1SA 3IUEA 3NT2A 3UUEA 4M8KA 3ZWKA 1FDIA 5EZSA 1WUHS 2PL9A 1Q861 5B4TA 2GCOA 5UKDA 1O97D 2MYTA 3OTIA 4YDQA 1I2MA 1UBSB 3SHFA 4L0QA 1I5EA 1F12A 1OAOC 1PW5A 3G7NA 3PIIA 4FQ7A 4IHJA 3IUYA 4HQKA 2VYFA 3RKUA 4B3IA 4CV0A 4L9RA 4V0LA 5EQTA 2A4MA 1FU4A 4LYFA 3ZQJA 3A3KA 1S1CA 4DV1B 4ITRC 3QOFA 4UASA 3RG2A 3ZV3A 3AY7A 4HYTA 4FHGA 5J4YA 1V3VA 3WBFA 1WZ2A 5BQ3A 4DEYA 1C4OA 3RC7A 5KYKA 1DINA 1FDSA 1WLYA 2ZRCA 3KZCA 3EFOB 3PHLA 4KDRA 1ZC3A 3ZBQA 4DV7B 3CUUA 5C8XA 2C61A 2NVQI 2JANA 5DZSA 2HO4A 3KOUA 2WAQA 1JA1A 3N2YA 3ID6C 4BPBA 4YCAA 5K99A 3MTIA 3CN7A 3IB3A 5DKFA 3S2FA 3R6WA 2BPOA 1FFXB 1JAZA 3GJYA 4Y7DA 3KSUA 1ZD8A 4WN9B 5DYYA 1RACA 4RIFA 2C42A 4DWWA 1AUVA 2G9VA 2VDWB 1OI2A 1UXJA 4JBYA 1RPZA 2DHCA 4DRZA 1QP0A 5KQGA 2H0RA 2IUFA 3QKSA 1DUVG 3C3XA 1BA2A 1CS0A 3TQQA 5JR3A 2WSSA 3ADCA 3LWBA 2PX0A 2VDPB 2ZIAA 1E94E 3X2SA 4DR2B 3DXFA 1LPBB 2GUWA 3Q0IA 1QLHA 1TFRA 3L77A 3D6WA 2SICE 3HJBA 1ZW6A 3UOWA 3G8CA 3M33A 5IBPA 1TM4E 5REQA 3ZU2A 2P4UA 5AKGA 1H1TA 1G3UA 1SD2A 2DR2A 2G06A 5AW3A 4EJ2A 4PSVA 1Y3AA 5HKBA 1N7IA 1R4AA 5C9ZA 2QM0A 1JMKC 3ETNA 1F8GA 2ZWAA 3M6UA 3PYMA 5JRJA 1AKWA 2H5IA 4XLLA 3Q3IA 1F0NA 4M88A 4OQMA 2VPXA 1OIXA 1X7XA 1I10A 1JSLA 4N0DA 3BTSA 3CPHA 1H3NA 1CRPA 1OC4A 1AKEA 3QGMA 5DASA 4OHYA 3AM5A 1ZX1A 2XWBF 3X3HA 1I4LD 2Q7DA 3DWEX 4BN5A 4DADA 2XUHA 3KYBA 2UXBB 4DIDA 2QAJA 4O2AB 2F67A 5KSYA 1HEUA 1N3YA 1R8YA 4OTZA 1F3OA 3JCZA 1YH3A 4KLNA 4RK7A 3VH4A 2WTXA 1YUNA 3IGFA 4JYAB 1KI3A 1WXDA 3CR8A 4BECA 2AYXA 5CM8B 4YBZA 1YKSA 3M4XA 2DFVA 3WISA 4EOGA 3KJGA 1CUDA 1CF9A 3L4KA 1QH1A 1RXVA 4QJ5A 2PG3A 2QRDB 2OZLB 4Q1BA 5TNXA 3ENWA 5I9IA 3G49A 2ISSD 4AI6A 1MABB 1WLSA 1AGPA 3UB3A 4C07A 5AJUA 5JD4A 2OXIA 1DO0A 1PGPA 1W94A 5B58T 3BJEA 2FZLA 4P4TA 4ESHA 4EZBA 5BSEA 4N5LA 3ONEA 5K05A 1T8WA 4AZ3A 5T8KC 1Y81A 1GZDA 4XEHA 1JQDA 5TQ0A 5KOJB 5K0TA 1SOUA 4QLAA 4AG5A 4ND2A 2FLKA 3EA0A 5KWEA 2DLCX 3A8TA 3K71B 2JDIA 1QONA 2PVCA 5HIJA 3M2PA 4NCJA 5E9AA 3SQWA 5LDDC 3ZGXA 2UXCB 4K9SA 2NUAB 3WDSA 2VNHA 4JS0A 3E22A 3P52A 2J3DA 1JDNA 2J87A 2ZYHA 4HAUA 4R1NA 3CCJZ 1PGQA 2ZIGA 3KKEA 4O3MA 2ZVQX 1DMRA 2PSFA 1U9IA 5J5AA 4MUIA 1Q862 1FDOA 2RHHA 3B5JA 4I66A 3CISA 4YRSA 3LUCA 5FB3A 4BJ5A 4EEKA 1RQFA 1ZN7A 2OWDA 1YDGA 3KC2A 3WGLA 4AZSA 2BONA 5LZ4A 1USUA 2YMPA 3DC2A 3LY7A 4RHFA 1I6WA 3JVDA 4RFLA 1Z33A 4WADA 2WB1A 3TF5A 1CKEA 9MHTA 1YTLA 2O48X 3SZ3A 1CHDA 5IYZB 3CVWA 2NVBA 2UZIR 1LFAA 3DQQA 4RGVA 4IMIB 5E7JA 3L3BA 1F0PA 1I14A 4LG1A 4B9AA 2W6CX 1NE7A 2YASA 4GWKA 3L46A 5AKZA 2XTJA 1Q7BA 4UM8B 4BNNA 1QPGA 3CTMA 1BGWA 5J2TA 3ZK8A 2EZ9A 2B63I 3MMSA 3QM1A 4FFNA 1UC5B 1NKVA 3AEUB 4ARZA 2MR5A 2X2EA 4JP2A 5A9SB 4HMQA 5HVNA 4RSGA 1GYRA 3W2GA 1E0KA 3DDWA 2RFLA 3LK6A 2K2QB 2DWOA 2XQVA 3NTQA 3CVVA 2I5PO 2Z6AA 2HXGA 3AHJA 3LFTA 1E66A 1QBKC 2Y99A 1V11A 2ZSUA 1LW7A 2EF1A 1ND6A 2UYQA 3KZKA 4GRAA 4FR5A 1K7FB 1RWQA 1JSCA 1Y80A 2FSGA 3PGMA 3C8ZA 4TYPA 1L7QA 5T3YA 4J0JA 2R6R1 2NZJA 4PYMA 1T9BA 1ZD3A 3TSOA 4F86A 4RZ2A 3QUSA 1IUOA 2KBFA 5EJEA 2ZBEA 3UYKA 2VF5X 3QXSA 1QXFA 3AM1A 4XCQA 4LYAA 3BGVA 1TKAA 3HYTA 4JYBA 3WMWA 5AUOB 2AI2A 1OWMA 4OP1A 4XRRA 4BLPA 5I7OA 4UAUA 1DAGA 3PUWA 1FYEA 4YJHB 2DY0A 4DA9A 3HXTA 2W8ZA 5KO2A 2HR1A 1IY1A 2HK7A 4ETWA 4KLAA 5I5GA 3PEWA 1SXPA 2VBGA 2VL7A 4F8YA 2P77A 1XQYA 2JVKA 2ZUTA 6LDHA 4Z54A 4D3ZA 3QVVA 3L01A 4Q05A 1ORTA 3OCXA 1N8R1 4P33A 1D2MA 4RHEA 4V0OA 1EVKA 4RKRA 3LLCA 1CW2B 1Y5MA 2Z2IA 5G4KB 1CIJA 2PPLA 1RPNA 3RE1A 3ZJ4A 4EK9A 3K70D 4WFJA 1PKXA 2HFKA 1PFUA 3H1AA 4CR8A 2HZBA 2WMOB 4HGRA 5EZYA 1NW6A 2EKDA 3E9RA 3LLUA 3WK7A 3RC8A 2BFBA 4MMZB 1AH2A 4JUAA 1WB5A 3RRXA 1IN8A 2GZDA 4OXXA 1L3BA 4IDCA 4S1NA 3KVNA 1Y9DA 2FCAA 1ECFA 2VDRB 1GU0A 3CCBA 3P4YA 1PYOA 3KWLA 4AROA 5JECA 2PRYA 5FOTA 2XLCA 1IQRA 3FMGA 3KAJA 5JEEA 3M83A 3EGXA 3AUKA 4MTLA 3K53A 5FPYA 3UMGA 4RIEA 4JEIA 5JNLA 1OA0A 1CZOA 3U9SA 1MFPA 3CH6A 1EFCA 1VTKA 4AURA 4YACA 3LC7O 2ZJ2A 2OLKA 4NB8A 1M34E 3IP5A 4LRQA 2G80A 4A6XA 2IXBA 1RM0A 3MGKA 4HRAA 4RGQA 3V2HA 4R5MA 3O8DA 1U2EA 4INAA 2C58A 4I1SA 3LOPA 2R68A 3RRZA 1LD3A 2RBGA 3AB3A 3RHSA 4LHZA 5A5DA 5IT5A 3OZ7A 1GTMA 2Q8PA 3RD5A 4C22A 1ZZGA 3SR0A 2J6BA 1VA5A 4CKEB 4B40A 4B5KA 2PEZA 4EDHA 3CRZA 2XF8A 3TJMA 4R1LA 3OPYI 5DBOA 1UPTA 1GTZA 2O2CA 1UWLA 4J7XA 3EOBI 1M1UA 2GBCA 4XUCA 2ID8A 4E15A 3M5DA 1Y9JA 4CEIB 1NFRA 5A0FA 2K7FA 3LLMA 4R2HA 3A0RB 2FGKA 3E4CA 2W2TA 3TL3A 3N8KA 1JUDA 1XXHB 2YTZA 3DP7A 3MCWA 1U94A 1ML4A 2FDRA 4KK4A 4WAUA 5L3QA 1H5QA 2QD4A 4ZO6A 4KX3A 4LY6A 1F2TB 3TUZC 1QZTA 4W8HA 5DTRA 3VR5D 5AM3A 3PT9A 3BK1A 1HYHA 4G5SA 5JNSA 3KEFA 3RGWS 1RNLA 3IBYA 3ZQ6A 2X22A 2ZEJA 3X1MA 2V97A 2WWRA 3I23A 4M0EA 4ZAYA 2YHBA 4A0GA 2P0YA 1ESNA 1NRIA 1U2PA 2GFHA 1C0IA 2JK1A 1YQWA 2OESA 1ZYUA 5CK4A 4ERXA 5KYXA 2AOVA 4TM7A 3EQ9A 3M1LA 3N2GA 2QSYA 3EZXA 5SYNA 2LEXA 3RK0A 1O94C 4R1UA 2P5SA 1T25A 1FRVA 3HB5X 2H9YA 5JWOA 1JHAA 1NN1A 5G1NA 4QGSA 5BN1A 3K1TA 1OB2A 1TLTA 3VJRA 1U98A 1J0EA 2JA8I 1GG8A 4IV0A 1LKZA 4MJLA 1XBTA 3H2GA 1JI3A 3B9QA 3PRYA 3FNGA 4M7WA 4NJOA 2CV2A 5C8ZA 3DLHA 3B3GA 3LP6A 5DSTA 3RV3A 4EQZA 4JC0A 1JP7A 1N6NA 2R2GA 3AQ4A 4V3BA 2XD4A 2I2WA 1YJXA 2AR0A 2D3TA 3ZXYA 2ZVDA 5BORA 2HDHA 2C00A 4H3HB 4B84A 3UFXB 3BN3A 1VQMZ 1S8FA 2J4CA 1M6EX 1F2UB 4QX6A 4EHJA 1E7YA 4AM8A 1LU9A 1BKDR 5WRFA 3B6IA 4W99A 2PKQP 4NBFA 3T1NA 4LX8A 1I8TA 1TADA 5KREA 3Q40A 2J6IA 2PLAA 5EPOA 1BVUA 1TWGI 1ZCJA 5KAPA 2EW8A 3AR4A 3A0UA 1JG3A 1U11A 2IPNA 2JGNA 3AM3A 4FJ2A 5IP9I 5E1BA 5FJIA 5KTPA 2C95A 4IVPA 1U9ZA 3OZCA 4ILEA 2O2SA 3GWGA 1YQGA 1WZEA 2VUSA 1RYFA 2ZCUA 2HV9A 4GYWA 3DMFA 3IT1A 1Z6YA 4PAWA 5L53A 2UYYA 5G0SA 5DTMA 3RS3A 5JU6A 3B6ZA 1VRCA 3TRHA 1WEHA 3ICWA 4MVCA 3G68A 4EZIA 1K9SA 2EBHX 3N2IA 3FRHA 3TD2A 3ZV7A 3BHMA 1NXTA 2YJGA 4OLFA 1RAFA 2GBPA 3DD1A 2Y1EA 2A9VA 2EP5A 5JLJA 3C1UA 3EY4A 2GEJA 2GA9A 1JTVA 3QX8A 4N7RA 3V7NA 4WXYB 3L9XA 2AGVA 1J09A 1N1MA 3TOZA 8AT1A 3JQ7A 2PRIA 1X0VA 4YAOA 5LP6A 1M83A 2ZZKA 3W5JA 3WKCA 3GG9A 4NCIA 2ID7A 4D8XA 3CE9A 3RYFA 1JA0A 1E3LA 3ZDFA 1DG3A 3IP6A 1DBRA 4O4JF 2XRZA 2EFDB 3TNFA 1LTKA 2HRQA 2OV8A 1N2CB 2EX4A 3LYLA 1XTRA 3VI4B 1H2HA 4ASUD 4XWAA 4F85A 3MJEA 2ZBVA 2E37A 2CMGA 2IYWA 3JS5A 4UMVA 3TW8A 2LKCA 3VPBA 4IYJA 1MHPA 2KQUA 3EGDA 1Z7EA 2Q8QA 3N75A 1D04A 4OL9A 4RA6A 1NVAA 4WTOA 1FYDA 1NNUA 4JY7A 3ZUGA 2CK3D 4ML3A 3GY0A 3VNSA 1NVBA 3WZMA 3ZW7A 1PNQA 2I67A 3N2KA 3NI2A 1H69A 2H7YA 3EGEA 3QBEA 4Y2TA 3RFCA 3RR2A 2IY9A 5C5CA 1EM8B 1U0BB 3SYNA 4BFCA 1F8UA 5A4IS 2YDXA 3LJKA 3ZV4A 3S55A 3J81A 1QE0A 2WYVA 4R2JA 5H5JA 1KMCA 1C14A 1DTSA 2OZVA 1I7QB 4EKGA 2G9ZA 4PSUA 5HQJA 4AZVA 3CEAA 4TMVA 1P44A 3W7AA 1D4FA 5BWOA 3PL5A 4NU5A 3WWOA 2VJOA 3FZGA 1Y3BE 4LJKA 2G6BA 1UKCA 3BX1A 1QKJA 2YV4A 3KSMA 3A6HA 3RTGA 4D57A 4R98A 3I6MA 3EVFA 4JLAA 1V96A 1RYMA 1MX5A 1CZUA 3D8TA 1LPSA 2D13A 2ZWIA 3DLTA 1NF9A 3FBTA 3IO5A 4D3DA 1T0BA 4GMFA 4ND7A 5KB3A 3I9V6 8ABPA 1TW3A 2CDRA 1TU0A 1QRSA 3JSAA 4QRIA 5AJXA 2QUKA 1D4OA 2R7ZI 2WINI 3AHEA 4BVKA 4Y1RB 5H4HA 3PHIA 3U81A 5M2QA 4L8WB 4XGNA 1KY4A 1ESMA 4NHOA 2P0AA 1E1MA 3RABA 2UYOA 4GOXA 3T5MA 4B3SB 4NPCA 4NICA 1X80B 2IIBA 4NX2A 4UTPA 4AF6A 4XR9A 4ZDWA 1L0BA 1YDEA 2L19A 2PWZA 2FQQA 4J0QA 4KR9A 1PL7A 1XKXA 2NXCA 3WK8A 4Z9AA 4E07A 1KI4A 3LGSA 3IEUA 3UJAA 1XD8A 2B4QA 5EI5A 2JHGA 3PNOA 2FEMA 1EVIA 3AEKB 2R6GA 4CR7A 1CY4A 1W85B 3M81A 2J1LA 4XD2A 1NI3A 1H2WA 5GM2A 5LBTA 4E5SA 2AN9A 2JFUA 2FN3A 3HCAA 2D2EA 1DV1A 1OROA 2OV6A 5BR8B 1E69A 4UAVA 4MRSA 5COQA 5ALHA 3NTRA 2IDJA 4JUCA 1VE5A 2P3QA 5K20A 3PXCX 1K9M2 1HZZC 4PZUA 5H16A 2CL7X 3JQ8A 3NATA 1G21A 2JCGA 1EWQA 3NWOA 4B32A 4YMGA 3BHNA 5C7OO 1L8AA 2FUG6 1UBLS 1EZZA 1XALA 2I3ZA 4UHEA 2ZSHA 3RQIA 4F84A 1NBIA 3TLGB 5HQTA 4F1KA 1I6MA 2PZ8A 3FYCA 4FYIA 4P82A 3T4EA 4GBED 2QIPA 5CT6A 3LIPA 5K09A 4FHZA 3U7FB 4DJTA 1KJWA 2PHZA 1E2HA 3E9YA 4M9UA 4Q9KA 4K6CA 3V8EA 5C1BA 2J9ZB 2NXEA 5AHOA 3QJ5A 1ZOOA 2I71A 3FY4A 2ZUWA 3NVAA 4MEJA 4WINA 4YV1A 4FSXA 4EVSA 1NG9A 4YGXB 3TKAA 4N1AA 4A3FI 4YJKA 5AWFC 4GI1A 1YL7A 3LKZA 2VRCA 2AR7A 2AYYA 2V03A 4AIRA 1NATA 1WW2A 4DXDA 2WTNA 3MZ0A 5MN4A 3DLCA 3AJDA 2YBDA 2JLZA 3CN9A 1VE7A 3ZY2A 4BCDA 3C6MA 3IBGA 1RXWA 4QUEA 2YN4A 3BILA 4BQPA 5DM0A 4BIMA 5H9VA 3RNLA 3CLUD 4RY8A 1EK2A 7MDHA 2PUJA 1UC9A 1YBFA 2E3JA 4OJQA 5J63A 1EWYA 4OHMA 4WGFA 5B1YA 5I01A 1HUQA 2WHPB 4RF3A 4CF6A 2EARA 5LA6A 3QE0A 3G0BA 1N5DA 1WHSA 3SU8A 1II8A 3NZEA 2BYTA 1Z2EA 1XLVA 3C0KA 2BCGY 3FNFA 3PD1A 1IRIA 1ZVVA 1GQSA 2XEDA 3CCUZ 4BB6A 1OF1A 1JDVA 1WJGA 2D1QA 5IVPA 5DCYA 1RTTA 5K3BA 3EULA 3VHXA 1QRTA 4B85A 2WABA 3ZV6A 4BC0A 3PI7A 2VNSA 4LDPA 4B3CA 2Y0DA 3T3HA 2ZSFA 1MEOA 3T4XA 4QJBA 2CNNA 2AXQA 1IM2A 2D7CA 1FX1A 1WXWA 4JP3A 5IM5A 5JMPA 3WYBA 4YEDA 1M2HA 3AH8A 3TN7A 4JWKA 5CJ2A 4BB9A 1S8AA 2GXSA 2B20A 3ZWAA 1TLFA 1IXKA 3AHCA 4ZVSA 5ELMA 4G9EA 4NBEA 1Z34A 3ABZA 3DDZX 1KEPA 1RRPA 2FFJA 3W8EA 5KS2A 1YR9A 3K0FA 3THRA 5B2EA 4EW1A 1K66A 3ZHBA 1W5AA 3CKKA 3KAKA 3DB2A 1GPYA 2ZRLA 3PE6A 4V39A 4QLOA 2Q4EA 2JL1A 4BWFB 1T4MA 4DUGA 5LSAA 1RDFA 1MIOB 2DH6A 4YJHA 2VF2A 1LPMA 4DLYA 3EVAA 2CZGA 3AIOA 3C7CB 1Z0IA 4FHEA 1WB4A 2H5EA 2PUAA 5I7WA 3GLHA 3AOEA 4ND8B 1S96A 3VB9A 2ODNA 1QORA 3P9CA 4PXSA 1WKVA 4G6ZA 4XZ3A 5DB4A 4JEMA 4HNUA 4W5WA 4MA0A 1KEKA 5C18A 3T4NB 2FETA 1VCOA 1VCHA 1R0XA 3SLKA 2JGFA 1YFLA 2X42A 2FK7A 1P1FA 2QMUA 1XJ0A 5F2KA 1Y8ZA 4C7BA 4I3FA 4ZWNA 2X15A 3AI2A 3NH6A 4GZLA 3EXHC 1W4CA 1QR2A 3ND7A 3ONWA 3QK7A 4HRVA 3N8IA 1QE5A 3HWWA 3NHZA 2GF2A 3D0QA 3N53A 3TIVA 3OTOB 3SHVA 1B93A 3ZXUB 2CW5A 4CEHA 2IYLD 2C8LA 5LMCA 3OCJA 1G4HA 1I2BA 3MWYW 1HOTA 3TZEA 3HSKA 1XQXA 3J81k 4IVNA 3UMFA 1Y8QB 4NNJA 4RV4A 4WK6A 4C7OA 4M76B 1M10A 1W4AA 3DV0A 4YJFA 4I3HA 4NZMA 5JYCA 3ABOB 3VH3A 3H16A 1RCUA 4GVLA 5GZ6A 3OQBA 5BURA 1ZHOA 4BS9A 4RY2A 4LF4B 1XRJA 2GI4A 2KBEA 2QYHA 4FIZA 2XNDD 1P4RA 1FX0B 2JNYA 1DKPA 3INGA 3THYB 1TUBB 3R9KA 3ZK9A 4JODA 2C3UA 2XUFA 2R7KA 4AUKA 2P2SA 3N07A 4WBSA 2WZQA 1VJRA 4YRGA 3WIOA 2V8KA 1KRWA 5IULC 1YJWZ 1KJNA 4Q4DA 5BQPA 4LZOA 3EMVA 2YWRA 1SIOA 3ORRA 3K1YA 4M0FA 2JH9A 3L1KA 3P97A 4O2BA 3M3HA 4QXOA 4YJ3A 5KVSA 1JIJA 1H1LA 2WIAA 3GDWA 3KKZA 1B6SA 4AO8A 2ZZNA 2GCOB 3PDCA 1EK0A 3P9QA 4DUGD 5H68A 5ADWA 3PGLA 3FCXA 2GUGA 5ARCA 2W2MA 4W5OA 5ALEA 3RH0A 1WKCA 1E1YA 2H8GA 4ZRDA 3OQPA 1KU6A 4EL5A 3BA1A 4DC9A 1B74A 4NY1A 2QR3A 1CULC 2PANA 2ECPA 1HMYA 3KQUA 1AVTA 2X9NA 3RC9A 1EVZA 4GM4A 5IASA 3EG9A 3IOBA 4D9MA 3GUHA 2HA2A 2HM7A 4S2UA 3FDXA 4E1AA 2GBFA 1H8ED 1GTL1 1LQUA 2QLTA 4QHTA 3ZGNA 4WBNA 2BGWA 1UMCA 3SM9A 4CUZA 4UUAA 2PAFA 2GEDA 3TQTA 1PQUA 1A9TA 3V33A 5L7WA 3P32A 1U5AA 1JDBB 5G41A 2J3HA 5FV4A 5MGNA 1CK4A 1ZRHA 1GLGA 2IHYA 3L18A 3QOYA 2DOKA 5A4AA 2GHIA 2XIQA 4OMDA 4BVLA 3T38A 3M4OI 5IC6A 5BOVA 1LY1A 2IE0A 1O1YA 2ES4A 4BVFA 1RPTA 5AHWA 3BXOA 4ZMRA 5TV2A 3PJDA 2O4HA 1XEXB 3L49A 4R1QA 1O95A 4C0JA 3VC2A 2PLWA 3IIKA 4I6JA 4TYYA 2B6NA 4F60A 3HBAA 4MA4A 5ULLA 4PSKA 1FYFA 2ODAA 3UUGA 4CQMB 3WE7A 1N25A 1B8NA 4HH0A 2NPIA 2UVPB 1JJAA 1VPDA 3BGOS 4L5AA 1T5SA 5EAIA 4LCEA 3TSWA 3WO0A 5BNFA 3Q6IA 2YZ2A 4LVNA 4NOJA 4NEGA 4Y1FA 5M3BA 4KN6A 2V7BA 3UKJA 5L9AA 1L8OA 4MWOA 3F6BX 2X9GA 3I2FA 4N0QA 5A5FA 3FPLA 1LFDB 1GA4A 1L6IA 3Q15C 3K1AA 4G23A 3O2QB 4RTLA 1X0XA 5EP2A 2P8JA 4ZEOA 4AJEA 4QUKA 4UD2A 1RR6A 1AGYA 1PSWA 1QH9A 3UB2A 2XUAA 2YZ7A 1A88A 1U7OA 2YDYA 2EU8A 1IOVA 1ORIA 3BSSA 5AM5A 4M7RA 2LE0A 4B4WA 3ASZA 3R3JA 4YMLA 2F8SA 1CCWA 4BX3A 5IG2A 1NVXQ 4FYMA 1DUIA 5LU9A 5JSZA 1PJ4A 2H2GA 1R5BA 4HB0A 4OHRA 1GAQA 2C2ZA 1X7YA 3B2EA 1CJCA 3AMVA 3BMOB 5GAJA 4H2DA 3V5NA 2PH5A 1VP9A 1ISRA 1T8TA 4LHVA 1CUHA 2NQ2C 1DFGA 2I2DA 3T7RA 5TVGA 7YASA 1RZRA 4H7JA 4ZZ0A 4FGWA 2D0IA 3R44A 3FFTA 2JIMA 4ZU3A 4S04A 2N0SA 4R54A 2CNOA 4RLFA 4XYMA 1H2RS 1OZAA 3RYHB 4R8KA 4D3XA 2FZ4A 5JOQA 3VTKA 3D6UA 4QBHA 2PGDA 4IRMA 2GCPA 2Q2OA 3G2HA 1K5DA 3KLBA 4LAFA 4BX8A 1GTRA 1Z7WA 2OP0A 2GXQA 1DAKA 1E1NA 3WGVA 1P3DA 3I9JA 1R66A 1UBUS 2IWHA 2PMDA 4QO7A 3KOMA 1RBMA 1SXQA 3AVVA 5HFNA 2NWQA 4G1EB 4R2IA 2HU2A 1FMCA 2QQGA 4KPUA 3NHUA 4CKWB 3ME5A 4OIFA 3HB9A 4IXDA 4PAOA 2V45A 3RAFC 4Z4GA 2CNDA 2WG1A 2ZU0C 1M9NA 4FZ5A 1GL9B 4DLNA 1KC81 4OUDB 1S3GA 4K03A 4PG7A 3NC0C 3QPVA 5JPIA 1P1HA 4Z7JA 4RHXA 2OPBA 2HPZA 4NBVA 3FLAA 5A7GA 5THQA 2OOXB 1P4JA 3ZKWB 1D6JA 1ZVJA 2NU8B 1WSWA 3BGDA 4EJ6A 2FAXA 4WY8A 1ZOSA 2PAAA 3FFBA 5EGSA 3CLRD 4PPNA 3DWFA 1KDYA 2RCNA 5F3RA 4B43A 2YXLA 1TW2A 3RJMA 1TTQB 3LRXA 2XCSB 1E1QD 2WD8A 5DGIA 1DC4A 4G9GA 5IRCD 2ISQA 3DNMA 3QF4A 1BC5A 1TVKB 2FWJA 1G8PA 3OESA 2GGSA 4PFKA 4BGUA 2NO6A 3S1SA 1VYVA 2VJKA 3HY6A 1RU3A 3V9AA 3SYLA 1N32B 1VQPZ 4IUDS 3UJCA 6PFKA 3DMYA 2R4TA 2FXIA 2HSGA 3DE3X 3KQMA 1DRVA 1UQUA 1DNPA 1SU4A 2ZWVA 3BXPA 4NCXA 2YJ4A 4ARAA 4DB2A 2GPAA 1VQ91 4NH1C 4OLHA 4X1OA 4ARZB 4NENA 3TGPA 4HQFA 3ZYCA 3DMHA 3K15A 1XMOB 3UJBA 2GNOA 5AXDA 4Z49A 4CMIA 1F0KA 3BXZA 4MDHA 4FFSA 3EOAI 3V4SA 3TK1A 1I2ZA 2OY0A 3RAEC 4KXUA 2CDNA 1FK8A 4CDNA 1QB7A 1B00A 2OQIA 3LPAA 4RD6A 5GOZA 5TT0A 1Y6JA 4FS3A 3PCXA 4KHPB 1R0KA 3A1EA 3PUXA 2VP2A 2QTHA 3DAHA 3KD3A 3EZFA 1VQ71 4IQGA 1SA0A 4X24A 2FN9A 4TMXA 4Z1OA 5BR7A 1G7SA 3DCJA 3KFXA 4ZC1A 4Z9XA 1BSVA 1Y8RB 4FCWA 5K5EA 2PQ6A 3VISA 1UPFA 4ABYA 2FSVC 4I8DA 5BWLA 4IJUA 5HKOA 3WGIA 3HE3A 5F98A 3QXHA 3HV2A 1MV5A 1G20B 4MRRA 1VYHA 3DDUA 4O1HA 3KZNA 3VFDA 4CT4B 1DUSA 1L8LA 2Z3WA 4N8DA 4DZTA 3Q4GA 1YUAA 1D8AA 3H3XA 2NU7B 1H2BA 4AX4A 2E4WA 3JWJA 3P96A 1COWA 2VDMB 3FJ1A 1RVV1 3NKLA 4J16C 3TFWA 2OFFA 3EPPA 3UBMA 2BUAA 1L5VA 3T0IA 3EWNA 4C1BA 4LEIA 5DLQC 4LTNA 1JAHA 4RNCA 4R16A 4WJKB 1OX4A 3K0BA 3UW3A 5HR5A 2J7PA 2O3SA 2YYYA 1HRDA 1I4WA 3A2LA 3H2YA 4GBGA 5ALZA 4QD3A 4B8YA 5TVKA 2MSLA 3JAKB 1IXYA 1NUIA 2OBLA 4G1CA 1PL0A 4E12A 5K0EA 4JJAA 1FF9A 1TFUA 1Y1PA 2EBWA 2Y0CA 4MQMA 1X1TA 3E3MA 3RVKA 2QWXA 4NK5A 1NF3A 2VSQA 2IWRA 2PMCA 1T9DA 3OBIA 3AI7A 4U7HA 1ZQ9A 3QMWA 2GZHA 3DZGA 5CLGA 3UM9A 5JCZA 4KXMA 5A4JA 4KCGA 1I94B 2PNFA 2CB9A 2HMVA 4HLCA 2JA6I 1G63A 3RJZA 3AKZA 3U26A 3RJ5A 2VDVE 4TWBA 3IAAA 3OTGA 1USPB 4QTTB 1HDCA 1YVUA 4LBZA 1N2ZA 4YO7A 4AJIA 5LXTF 3V80A 4CMKA 3E1SA 1V3TA 3PC6A 4I9GA 1NQWA 3BQMB 3HCRA 3HEBA 3K9GA 4LX0A 4CWAA 3TOCA 1DKRA 3PE3A 4QDOA 2B3TA 1KWKA 2R5NA 4MP3A 1FEZA 5GJBA 3ZK7A 3BJIC 2IODA 5C8YF 3IE2A 3FVRA 3EEBA 1BROA 3FFWA 3H6HA 3Q6NA 4DIFA 4YMHA 2PUHA 2O0HA 2GS9A 2H4FA 1R4MB 1YULA 3OPVA 4RM3A 3USCS 4WSOA 4TGLA 2WFAA 1UZAA 3GFVA 4GECA 1HT2E 1S01A 3N59A 3U3XA 3WQRA 2JA1A 4V1CB 4N41A 2Z5GA 1VCMA 3P4UA 1GSOA 1J9ZA 5FNVB 4KWEA 3NDIA 4LPKA 1BJRE 3EXG1 3LF1A 2WRZA 3G711 1PLLA 4PFQA 2IF0A 1GA1A 2DQKA 1YHQ1 3KYDA 4H3VA 4MVJE 4MW5A 4LYYA 3I76A 1JDSA 1NSTA 4WHMA 2X5JO 1ISPA 5LIRA 1JFSA 4FZRA 4U63A 2QX7A 1BDHA 1OASA 1E3IA 2QYSA 2FNAA 3F9IA 4WKOA 3AVQA 1KPIA 1SC4A 2EX0A 4GKAA 1H9CA 1BW9A 2VQEB 2BBSA 5FOUA 3JATA 1FY2A 4CI9A 5E1DA 4HLDA 2PGOA 5HILA 1GUFA 2WTBA 4EQ6A 1WUJS 3OX1A 3LY8A 5JJCA 1Z08A 3IESA 1BHJA 3FCAA 5BVGA 3GGDA 3NKVA 3JX9A 5KX5A 1YC2A 4U0KA 3ZDRA 3WBJA 3AL3A 3K94A 2P90A 3RUAA 4GZ5A 4HGNA 4REQA 2IEIA 3L8GA 3P20A 4PSDA 3EF3A 1HZJA 3C24A 1ZI8A 4NONA 4H7PA 4CNBA 1YBAA 3C15C 3B51X 4KFTA 2LNDA 3BG5A 3RBAA 4HPJB 3ZWCA 2W2KA 3HCPA 1XYYA 3LZDA 3E7FA 3R6TA 4IKEA 1FUUA 3LCJA 4ISCA 4I6EA 2QKYA 4EPYA 1ZAYA 3T61A 4QXAA 4AQ7A 2ZQ5A 5CTAA 3IJPA 1A77A 5DISB 2BN4A 5LUBA 2NUTA 1JT9A 4OHPA 3UV3A 3ZE0B 3ZHZA 4CI0B 3H9UA 2HSJA 2IYXA 4LVCA 2PFSA 4R0NA 5L3RA 1MC1A 1ORHA 4B09A 1CQWA 4WL0A 2K5UA 4AO7A 3C3MA 1CYEA 4UARA 1X1RA 5CX4A 3NHFA 2H08A 5CR9A 4ZGGA 2BFCB 3SS8A 5LP6F 2DQYA 3IQXA 4DIMA 2X4LA 1RZ3A 3RQSA 3ADBA 2GK6A 4WOPA 1IBRA 4NC9A 3DWIA 3LX6A 5EA2A 4W63A 1H94A 1L4UA 3S6JA 1LBQA 4MR8B 1YHNA 3O8QA 4QBIA 2WIKA 3N0RA 4DMCA 4KO1S 1X39A 1JA9A 3TDHB 2XVZA 1FP1D 2FPUA 1HYQA 3O1IC 3MA0A 5H3CA 3VC7A 4OFXA 2HA4A 2IUEA 5ALXA 4BE7B 4AG3A 1R6TA 3NHPA 1I0LA 3IVMA 4BNTA 3MZKB 3HCWA 3L1JA 3N39C 3VH1A 1AKQA 3BMNA 4WUTA 1E1CA 4MVJG 2Y1CA 2ZUEA 3G71Z 1NVVR 3HUDA 3QSGA 3TD9A 5BPFA 1EB9A 3OIDA 1OLSB 3QZUA 5BVHB 5TJHA 1T3SA 1WMDA 4A16A 4BEWA 2IZ6A 3CS3A 4CU5A 4F2HA 2I6XA 2NGRA 3GEHA 4LI3X 3AR8A 4P53A 5LWQA 4IDFA 4QEKA 4EPWA 3QVTA 2DKNA 1FNNA 2QRMA 2CXPA 2FP4A 3VTZA 1SK8A 2DY1A 2ZT6A 1H6BA 3U4GA 3K0AA 3NAQA 1L7XA 2OHVA 3N2EA 1MX3A 3TD6A 1K3TA 1J1ZA 4QYIB 5BO5A 2D5BA 3D7RA 4K9QA 2I4RA 4Q02A 2I3GA 4HDRB 3SQLA 4DS3A 5JO0A 2BCJQ 3KQLA 3IKVA 4QDKA 1ZY2A 1X80A 4L07A 5AW5A 1SQGA 2VHUA 3UAWA 4NKRA 1OZHA 4ES6A 2AI3A 3DEIA 4R31A 5FBRB 4YP1A 1A2BA 1LLCA 1P3Y1 1TU3A 2I29A 4CV1A 1T9CA 5KX5B 2LIYA 2A5GA 1TM5E 1Y1QA 2HLNA 4UHHA 4W8OA 3UH0A 4C2UA 1YMUA 5A9RA 2FFAA 2HEIA 3O7MA 4OSPA 5LD2B 2W43A 1TO2E 1VL5A 4RKFA 1Q2XA 3ZS8A 1CB7A 5KTRA 4QUGA 2MSNA 4GSYA 2Q4TA 3NHRA 4Q16A 3TRIA 2ZJ7A 3KUCA 2FF7A 2IP2A 3I45A 3KB6A 3KEOA 4MVJH 5CYFA 2J09A 3EPLA 5CM9C 1CUFA 4PQFA 5CPBA 5A2GA 1UZMA 4ASUA 2I3CA 3OSZA 4CE6A 1P2BA 3ZHQA 1U0OC 1VIDA 3FBGA 3HXOA 1WQ1R 5A04A 4LQDA 1SCIA 2KLHA 1EEXB 3W5AA 3KB8A 2FQWA 3MUFA 3RV4A 2FWRA 1Q1AA 5AVXA 3S68A 3M4NA 1GNRA 1NXXA 2C8VA 2X13A 1L3CA 2QRCB 1UBNA 1NMYA 4DNQA 4BYGA 2Y66A 1JV2B 1O54A 3KE8A 1Q2UA 1UDBA 2G88A 5EIOA 1R0SA 1KQNA 1BE6A 1LDBA 2ACEA 3MT8A 3QWHA 1TOAA 4G0YA 3JPYA 2WIBA 4A1OA 2AOTB 3ASYA 4KN9S 5KPDA 5ITSA 5F5XA 4KYVA 1EKXA 2M98A 3WTBA 1GGMA 3EMBA 4I19A 3T4PA 2AOWA 4JFAA 5CB6A 5DNYB 5IANA 4H35A 3U80A 4GT1A 3LPDA 1PLKA 3FLMA 1LDYA 4OM7A 1N1EA 5DK6A 4LF8B 1NLFA 1KMMA 1A1SA 1GM5A 1UKAA 2O5EA 1B8PA 2QUBA 1SU8A 1WL8A 4FNMA 4YRZA 1NX6A 1L7EA 2ZSKA 3VOSA 4M8NE 1Q5PA 4K6GA 3ST7A 4GXQA 4PC1A 2PKWA 2HHCA 2OBBA 3DZBA 1VQLZ 4FWIB 2C07A 3WYCA 1KOJA 1Z18A 3ICVA 3ACCA 4MW9A 4DN6A 4H1WA 1OAKA 2CHEA 2O52A 2REXB 2QNBA 3H18A 4L5CA 1NX9A 4TKUB 4EGJA 1E3WA 3G5UA 3OPMA 4C0KA 3I56Z 2N47A 3RIEA 4JU8A 5ER6A 4XFDA 3BJRA 3BD9A 1E4EA 3T7DA 1T4BA 5F77A 4IAOA 5FO1A 5I9LA 4LJSA 4WK0B 3JQGA 4MXUA 3O4VA 3GN1A 3CH5A 3DZJA 3LUPA 5LA6F 2A0UA 4HZUA 4RJJA 1P33A 1TJPB 5CBPB 1EMDA 4J0IA 1M2OA 4QGFA 1DAMA 1KFJB 3OFVA 4HFNA 4B2YA 3IIJA 4IZIA 3HCBA 5CA0F 3AYXB 3P9NA 3OFND 2ZYRA 3DHEA 5D86A 5SY4A 1Q0UA 4OQYA 4UDYX 3AUFA 2IYSA 4EX6A 3KQQA 4CMEA 2ZUBA 3H19A 4YP9A 4B35A 1OQAA 2HNKA 2BM8A 4LXYA 4O4LA 4UW9A 4P38A 1C7ZA 5KKCA 3JQ9C 4CF3A 4I50B 1KVTA 1V4BA 2WE8A 4TMYA 2P1RA 2ZJAA 3AKYA 4L08A 4ZHSA 1FE8A 1K7CA 3I0MA 4D3FA 4LYGA 1R18A 1DXQA 4LRXA 2BSXA 3C45A 4MPJA 5JAQA 2IPAB 2FMXA 4MGKR 3DAYA 2XVYA 1RO2A 1A7UA 3BULA 1F8XA 3QF7A 5CIYA 2HWWA 1SXIA 2REQB 3B1ZA 3B1XA 3QKRA 5EQJB 3IKJA 3LX4A 5K0SA 1M5UA 2H2IA 4J1NA 4L4RA 4UZFA 2XUQA 3M7IA 4N03A 4FOSA 3V1KA 4HWKA 1UPUA 2R4QA 1V8ZA 4F11A 2GLTA 1I13A 2YINC 1H0HA 1PRYA 2VSYA 2GCIA 5D3MB 2BGLA 2Y92A 4WN9A 4UTRA 4G5FA 4JOSA 3CQZI 2PWPA 3G2MA 4HWSA 4DLSA 3WGYA 4EG4A 2GSDA 3AHHA 2O50A 3LC2O 4LMBA 5KWIA 5JNTA 1GDTA 4Z53A 1TGYA 3HFJA 4GZ6A 2PCJA 2XGMA 4LVUA 2JA2A 2XGGA 3WL8A 3DZFA 1JX6A 1RE0A 5DX0A 4XR4A 1JQKA 2Z1NA 3M6AA 3MWEA 5DN9A 5IZCC 4BWYA 3RTDA 1UBCA 1YS2X 4NBWA 1OCEA 4MQFB 4R7TA 5J4VA 3I6BA 4MRMB 5H59A 4ZCIA 4W5NA 5FPHA 1QK5A 1CU1A 1VL1A 3UV6A 1J8QA 3I39X 3AIIA 4FDTA 1XAGA 4WWHA 2V8IA 1N8TA 1P8AA 1GGKA 3HCNA 3P0FA 1NBWB 1TWCI 1QANA 1YUBA 2K4MA 3FIJA 4R3WA 4FINA 3ESRA 5H3HA 1JEYB 1XDZA 5AJWA 5AI4A 4UC0A 3LQ2A 1SC1A 3MJDA 1S3SA 3ONNA 4IVQA 5E2IA 3ZDEA 2OA0A 4M7PA 4BY1I 3LX5A 4TRRA 4AS1A 4TPKA 3PXBA 2BKUA 1CNMA 2PRJA 4PCVA 4R6XA 5I9BA 4BFLA 3LP8A 1KY3A 4AC9A 5ICMA 1AA9A 3OO1A 4I1YA 2OV3A 1SUSA 3LH5A 4RVFA 1FZTA 1FP4A 3KOZA 3MGGA 2XODA 1U0TA 5KYTA 1XV5A 4INJA 4WCVA 3CJRA 2OQRA 3NC4A 4FI3F 4QHSA 1DIGA 1VGQA 1VBFA 4ENWA 2NVXI 4I1OA 3OZVA 4KGZA 4XVUA 1AQJA 1ESDA 3QLUA 3KK0A 1W1WA 5JMTA 1KQSY 3GZNA 3RROA 2R2AA 4UBIA 1OYWA 2HQOA 2IEZA 4CMIB 2DFPA 2QEXZ 2ORIA 2IOFK 1EFPA 3S2GA 2WUDA 1J2YA 1BAPA 1YS9A 1BXRB 5P8WA 4WCDA 3PFKA 3CB2A 4HUQA 3TGWA 3ROZA 4YX9A 2PKXA 4YCNA 4JXJA 1WB9A 5JBNA 1TCCA 3HGMA 4M46A 2ONYA 3SQMA 5AK5A 3W8FA 1FTWA 2PH1A 1E8DA 4YRIA 5AI0A 4UQLA 3AR5A 3QKRB 3WGZA 2DUJA 1IJBA 1EH5A 3NETA 4JC8A 3VUEA 2JCSA 1E9SA 1G8JA 2HF2A 1EEHA 1ZJJA 2ONZA 3DSRA 3WRXA 1LS1A 3N5KA 2DJIA 1M0EA 1E0AA 4D6PA 4FD2A 1M6VB 2J08A 1V71A 1G64A 1YONA 5AICA 4YDHB 3UPTA 1ZIYA 1S2MA 1SVOA 3I53A 2PGXA 2QHXA 1TKRA 2JGEA 4OHXA 1KMHA 5ALTA 3FNEA 1B76A 1DRUA 1LK7A 2ZYWX 3MWFA 3QU4A 2BLLA 3S4YA 2R79A 5KNCH 2ZBUA 3A4NA 2L18A 3KKKA 3TW8B 2OXFA 4RTRA 2FDXA 4MRIA 3KQSA 5HZGA 2PKEA 2EZ4A 2BGMA 1Y8AA 2ZYSA 4BO1A 1T1GA 4ZVLA 4ZTZB 2MHCA 1ZOLA 4I9FA 1WULS 2IIVA 4PAGA 3EIXA 4NQRA 5LBUA 2EQ5A 4HJRA 4EF4A 1Y1VS 2E55A 4FYPA 2D1RA 4MPRA 5M7EA