2H85A

Crystal structure of nsp 15 from sars
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
347
structure length
347
Chain Sequence
HQSLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGESVKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCGCSVIDLLLGDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative orf1ab polyprotein
publication title Crystal structure and mechanistic determinants of SARS coronavirus nonstructural protein 15 define an endoribonuclease family.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 87
structure length 347
sequence length 347
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2h85A01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h85A02
2OZKA 2GTIA 4S1TA 2RHBA 2GTHA 2H85A 4RS4A
chains in the Genus database with same CATH superfamily
4FFBA 4MLZA 2HU2A 1PZEA 2PZFA 3FVTA 3IDAA 3TL3A 4A8JC 3HXPA 5FULA 5HDQA 1N4AA 2FPRA 3QBJA 1ZIPA 3QOXA 2GPWA 3L40A 1PUIA 4KN6A 4KQGA 3H9GA 3QU7A 2Q4ZA 2PFGA 4OHKA 2H3HA 1J0AA 3H18A 4Z9FA 3ZDRA 3LQFA 3E15A 1W46A 2JJMA 3MNFA 4B7ZA 1ZSYA 2GEFA 4R1UA 3ZLJA 1ZUIA 2C4UA 2NTNA 1ZG3A 1MOPA 1XD2B 2VQ6A 2WU8A 2NU7A 5IFLA 2JAOA 3FPJA 1YCDA 3DC2A 4XGRA 2GJKA 1Z7BA 4UHJA 1VQK1 2OXTA 2P9YA 3JV7A 4U7PB 5J4LA 3DFMA 4NZPA 4ND8B 1EBBA 1U8CB 4M8IA 1G8SA 2CL0X 2G83A 3N3AC 4MR7B 5BWLA 4QHTA 4P3KA 3BMXA 3ZCUA 4MVXA 5CT4A 5JS7A 3JQAD 3MRXA 4QPZA 4KB5A 1NOIA 4DMFA 1S9DA 3B5IA 2YHBA 3DXFA 3FDIA 1II8A 2V7QD 3N76A 2H1IA 3R5XA 4FKBA 4QYIB 1TZMA 5K6AA 3JQFC 4PN3A 2V55B 3A9WA 4PHGA 4DJ5X 5HTOA 3HV0A 1BGWA 2WA1A 3GCZA 3IH5A 5BT9A 2VT3A 2IPLA 1A4XA 5HZMA 4EB8A 3WFJA 3A28A 5HW0A 1AURA 3C3MA 3I34X 5EHIA 1OHHA 1XMXA 2VH5R 2IU4A 4ZVRA 4J1NA 2VUSA 4RVFA 4BLVA 2G5PA 3RJ9A 4CE6A 4JBLA 2W4QA 3QIAA 3DP9A 3BTSA 2YJ4A 4DDTA 3RADC 2JDIA 1NBME 3N2EA 3DWIA 3H2YA 4BP1A 2R00C 1SXJD 2NZ2A 2G71A 1YITZ 3BL5A 1A1VA 5GOTA 4NB8A 4TGLA 1T5BA 3QHAA 4OOFA 4FFOA 1Y7HA 3VYVA 3C7TA 5C5CA 3W2FA 4Q5IA 4IIYA 4Y2GA 3VR4H 1GRCA 1E20A 3JQ7A 2ZS9A 3ZLVA 2IEZA 3DOHA 4UUPA 2AR7A 3THYB 4QJBA 1REQA 1BYUA 4YRGA 4DQKA 2FZEA 2OGSA 1IOWA 3LM8A 1RZUA 4ZVPA 2VA9A 1V3QE 1KE1A 2CLDX 3PHGA 1UP4A 4RYLA 4WCDA 1T8PA 3VO1A 3R7WA 1YKFA 1JQDA 3BJRA 3KG2A 1B0AA 4M9XA 4TS9A 1L7VC 1KDRA 1JR4A 3HOWI 2W2QA 2ZR8A 1K6EA 1PWYE 2ZRCA 1HQCA 1L4GA 2DC1A 2FWRA 4G9BA 2EGGA 2FSHA 4M37A 1DJOA 4N0MA 1YUKA 1X7HA 3BRSA 3G85A 3MJ4A 4LKRA 4M55A 5A2Qb 4MJ3A 4UC0A 2CNDA 2P41A 1LVUA 3AOEC 3UOGA 2WHPB 3JASA 3BWBA 4RELA 2Q9CA 4YRFA 5K09A 2H6EA 4NESA 5D51S 1WW3A 4P0QB 4CM4B 3LCMA 3UB3A 4CUJA 2FZGA 1BZYA 1TCAA 3FNIA 4E4RA 3B1KA 2QTVB 3IOMA 2FMUA 4OQZA 3THSA 3VU9B 3F4LA 1ZD5A 4DJJA 4EG6A 2PUEA 3C8MA 4EITA 4Q39A 2A9VA 3U1TA 5H83A 1YS9A 3OZCA 3PRJA 3T9DA 1OT3A 4KO4S 2VTDA 2PR2A 4ZHQB 3E18A 4FYMA 2JLZA 3ZJUA 5A3VA 1U7ZA 3N2KA 2F3QA 4NEHB 2WIDA 4P5DA 4A82A 2ECOA 5AKGA 3LY7A 5J5CA 3KTAB 3L8EA 3U3KA 5LU8A 3EEIA 4QDJA 1C30A 1ZCJA 4U3JB 3ZE2B 2YR0A 1ISJA 5F3RA 3B82A 4YDSA 3GROA 3HB4X 4J9VA 3BXHA 3KWJA 4D4JA 1ZXLA 3OCCA 4N39A 2ZIZA 5DDIP 4HDQB 2I1WA 2C4NA 3E9NA 4L4XA 4ETWA 3S2SA 4F72A 3GVPA 1P17A 2CSXA 4HX5A 4LOJA 3L77A 3V4SA 4EG5A 1Z16A 4ER3A 1LV7A 1QPBA 3L0BA 4R16A 1LLCA 2X3UA 3CCS1 4HYEA 4WOKA 1E5TA 4JNCA 5G3ZA 2HH9A 1A1SA 1GRVA 2H1WA 3PR3A 3M3PA 4AK9A 1LD3A 4MQ5A 2VRWA 2PA3A 3B53X 2J08A 2X8LA 3V1UA 3N8KA 3GGSA 3UVEA 2HEIA 3QSYA 4TRMA 4AYXA 1NQXA 2W2MA 1KQSY 2CLFB 3KSDO 4WKOA 3UICA 6PFKA 1GGKA 1K8XB 3L0YA 1IRIA 4TMZA 3S4YA 4EEXA 3SPXA 5GJBA 1OZFA 3GTGI 3PHLA 2O48X 3EXFB 3G17A 2RHJA 4G5HA 3SYTA 4AJ1A 1RRGA 1AQLA 4ZZ1A 1AE1A 5A5FA 1KEKA 5ADVA 5AHOA 2YINC 4C3OB 1P2UA 1UM9A 1VG9B 1BMFA 4LFAB 1NC3A 1ZONA 3EIXA 3EZ7A 4CM3A 4KQJA 5KNDD 2AOXA 4JFRA 5BN3A 3MAJA 4NONA 2QRQA 2H18A 3L92A 3PNYA 2WIBA 1M1ZA 3ITKA 3QVOA 1L3BA 2PRIA 2WKSA 1ZK1A 3IAAA 4ESEA 4KPYA 1FNCA 3H3FA 3DBOB 1GGVA 1TIBA 2AVNA 4LE1A 1X3WA 5LD2C 3WAGA 3R76A 3ZWQA 3HM2A 1EFCA 4ZYZA 3TS1A 1HSZA 2VHJA 1SVLA 3S1MI 1I6WA 3HOYI 3LKVA 4LMRA 3ZDZB 5CDYA 2XGOA 3WLNA 2WYHA 1HFJA 2BUBA 2FEMA 3PNLA 4QUIA 2OCLA 3HABA 4YT4A 2X2FA 3I5YA 4OFXA 4KXXA 3DTYA 4EWLA 4CEIA 4K9NA 2CKMA 4LFCB 2QLJA 5EZ5A 4Z0TA 1RI3A 2DU8A 4BLWA 3WX0A 4URYR 1UPAA 4LY0A 4EKYA 4P3XA 1QGDA 2G1PA 3CD6Z 1R0RE 1RMYA 1L9KA 1WNFA 1MDBA 2AD1A 2II6A 1FS5A 4HAOA 3FWNA 4LF8B 3SR0A 3IPCA 3UMJA 5ECYA 3OVMA 2QRPA 5DKFA 3GG2A 4NHOA 1Z88A 3MHPA 2PS1A 3F2IA 1I1NA 2C5HA 3G2PA 3SXJA 1R9GA 1RHKA 2G1JA 2V97A 3AEKA 8AT1A 1ZOPA 1G6HA 1RLMA 4JC8A 2IPNA 4TKLA 4GP6A 3WB9A 4BGUA 5LDDC 1PTKA 2QN8A 4TKVB 2Z98A 1RABA 1UMDA 5EE1A 4L6AA 3QPWA 5DBEX 4LK3A 4X66B 3U81A 3F9IA 3K05A 4BVHA 2EP5A 4HYQA 1IN1A 4DGLA 5K5EA 3MBOA 2FUKA 3QVGB 4EPWA 2B3DA 1RMQA 2X23A 3GRRA 3L82B 3L6DA 3Q40A 4Q48A 1Z22A 3VHLB 3R4VA 1NVKA 1OPXA 2CSUA 3T95A 4KFCA 4ARSA 4CJXA 2WRZA 4JLBA 1M1NA 5AHXA 4BNHA 5DM1A 1O94C 2JFNA 5ALEA 3U7RA 4EG8A 1CY8A 3W9SA 4OHOA 3SCZA 4YJ2F 5FTMA 4H7EA 3NOQA 2FW8A 1XQWA 2W5UA 5EOVA 3WGZA 1ZN9A 4XIGS 3FDJA 1E3SA 2QW1A 3ANYB 3F2VA 4B47A 2QAGA 3HN6A 2IZ4A 4TLAA 4TTSA 5A1TA 2I29A 4FE4A 2CXNA 1UJBA 4TZTA 2L18A 1E1QA 3DMNA 3F49S 2XQJA 4HX2A 4U7HA 4RADA 3I09A 4XCVA 1Z28A 1Z4QA 2OAGA 2FGKA 3DHEA 1EGMB 2QRKA 3FFWA 3MCAA 4DR6B 3P71T 3I39X 1CHDA 1NIJA 3RU3A 3UMVA 4TQGA 2I8AA 4FP9A 1JWBB 4OYYA 4QWMA 3UG6A 4RY8A 4AZWA 4CR6A 4MPPA 3TW8B 3KYCA 3ZE6A 5CFQA 2AN3A 1TZ2A 1A3CA 1T3LA 4MMYB 2G5GX 3D54D 1Z7YA 3N8NA 3HU3A 1ISFA 2BMEA 2EKBA 2GHTA 3I5MA 4RD2A 2BMWA 2XWJI 1QRSA 3EJ6A 2J6AA 4F2PA 4OLBA 1E2GA 1RWNA 4ALNA 1R6TA 2C3PA 3C7AA 1Y7TA 2W2XA 4ENQA 5C5IA 3KB2A 4QTZA 1IB6A 2X7JA 4PPNA 3OX4A 1LPOA 5H59A 4TYYA 5CG2A 2VZLA 1G291 3OEEA 4XFKA 3WLIA 4DC9A 3KC2A 2GN1A 3R44A 3IBSA 4UNNA 4EHNA 4C5AA 4JI2B 2AF3C 3AEZA 1M1XB 2ZXEA 4ZOBA 5FUQA 1ZC4A 3BOSA 3W5BA 2ZG6A 3FOCA 5KC9A 2WQ7A 3GFTA 1ODLA 4P93A 4PQGA 3HEBA 5CLQA 1XJ0A 2IRWA 1M0EA 2RKBA 4I55A 4FYYA 4IWYA 4CKBA 5EZ6B 4BQPA 5LLTA 3OG9A 1KH1A 3QF4A 3QVTA 5D3QA 4NX2A 2BJWA 4BS9A 1CEQA 1YB1A 1BMQA 1KAMA 1AHIA 1PSWA 1QV6A 1W5TA 4U9IS 4V03A 4WEQA 5JLJA 1TO2E 3UJAA 1SJ9A 2D2IA 4UM9D 3QUAA 4JJGA 4REMA 4CG0A 1BYIA 4JYCA 1TVCA 2JIOA 1LTKA 3QMVA 4S0XA 3V34A 4G24A 3M0EA 3TEFA 1N2XA 2PBLA 3LC7O 4KV7A 2ASEA 3TIVA 3HVHA 5I9TA 2DKFA 2WSMA 5CXQA 1EFRD 1P4JA 2PZKA 3JR7A 3Q9NA 3BWEA 3QV1A 1OLUB 3Q72A 2VOEA 3Q5GA 4OGLA 3RWMB 1YJW1 2IPOA 2LD4A 4MVJF 5HOEA 3C6YA 5DXAA 1HDGO 1CY2A 1VL5A 1ZJZA 2CUKA 1L7PA 2JAQA 2L17A 4BO2A 2AZDA 2CF5A 2JD2A 2OB1A 1EFPB 1Z4OA 1IJFA 1SXJB 1QMPA 2FF7A 2GBGA 5CLGA 5G0TA 3THWA 2HQOA 4LXQA 3A25A 4MWDA 5L7TA 2WF6A 2OP0A 4DLPA 4MVWA 2Y8EA 4BMVA 4UASA 2OG2A 3SIRA 3O5AA 3Q15C 1I6MA 5IUNC 3ZCRA 1S8NA 4N3GA 2I6UA 3AY7A 3CNOA 5GVRA 5REQA 3NC4A 4U1RA 5JS1A 1TT5A 4L51A 2IGBA 4BU1A 2OHFA 1A8HA 2P2NA 4BBSI 4NNOA 4FFNA 3UJBA 2V65A 4CVNA 1DKMA 1SHUX 3KJIA 4AVYA 1KVRA 3OCWA 1QS0B 1F8GA 2PYZA 2QTGA 2RMKA 1L3CA 2YXLA 3DEYX 3OUTA 4AJNA 1QBGA 3CUSA 1MX1A 3KQOA 1O8CA 5DLDA 4BO6A 5JYBA 4IDGA 2VBIA 5LL6f 1SKMA 5JNUA 3IFSA 1BS9A 4YJ3F 4FM9A 2W71A 4M1OA 1N5LA 1UDXA 4WBSA 5ALYA 3SC4A 4MS1B 3SF8B 4NY1A 2V1XA 2GDZA 2X9GA 4DEVA 1NWCA 3MMSA 2CZGA 4MCJA 3CEAA 3NDRA 3NIBA 2NG1A 3AHGA 1Z0FA 2ZSIA 4FOSA 4UBOA 1TQ2A 1Y80A 2OD2A 2BTQA 3IMCA 1V1RB 4AJHA 1FE8A 4QD3A 4YJ2B 1XRJA 3ANSA 1DJPA 1Q0PA 1ZD9A 5G53C 3ER8A 2E1PA 3EPHA 4X63A 3IRVA 3ROFA 3PJGA 4NFSA 4RVGA 4BFYA 2XVAA 3KUUA 4FOLA 3UAWA 5DHQA 4D3SA 4PVCA 4CIAA 1ARZA 3CC41 4NSNA 2QIPA 3HI4A 1NF2A 5I51A 5LXTA 5DO9A 2VHQA 1WDMA 2MSNA 3MWYW 4AY5A 1C3OA 1W36D 1CIJA 4KIJA 4R9NA 2JD1A 4G8CA 1XROA 2GU2A 1G8MA 1MU0A 3PZRA 3W04A 1EFVA 1AUOA 5IWAB 4FGLA 5LMZA 3WYBA 5CPFA 4P4SA 1H8EA 2COKA 3IYLW 4RU1A 4XYMA 1FFCA 1X87A 1VPWA 2J3MA 4UVGA 3RFVA 3T0GA 4E5MA 1EWVA 4YAIA 2DHDA 2BF4A 1OIWA 1GT91 2H1CA 2FXVA 3OQPA 3QP9A 4WXHA 4Y67A 4ON9A 1SEVA 4IWNA 2Q3JA 4LRXA 4B7CA 3S1SA 4DMRA 2J32A 4PR3A 1GR0A 4A15A 2WHRA 3MGKA 3EDCA 3QLJA 5EHQA 2CJXA 5CIYA 4IX1A 5E0OA 3LUCA 3I83A 4LWPA 1OT5A 3UQYS 3M7IA 3GTJI 1DBVO 1XJCA 3HP1A 3LOQA 3PDIB 3WBKA 4B4VA 4DK1A 2SNIE 2RB4A 2ZRBA 1A9PA 1GQ2A 2I8CA 4KP7A 4B3CA 1N2CA 3JXEA 2Q9AA 1R0BA 3HJRA 2C29D 4H17A 4HH1A 1VQOZ 3KE8A 4J4BA 4B48A 1PL7A 4CETA 2BHNA 2OZPA 3CUEF 2D54A 1ZIXA 1EQ2A 3LCCA 2G7ZA 1JAIA 2F6RA 4RANA 1KMMA 3ACCA 1LY1A 3OIVA 2ZUCA 3DAYA 1P4AA 3HYTA 5D1HA 2NVTI 1VQ7Z 1NL3A 3OPQA 2E9HA 1YIJ1 5KQGA 5FBVB 4O2AA 1BVRA 5JDIC 1GYPA 3RTEA 1ZOOA 4DY6A 3AHJA 4JUAA 2PLWA 5CA1F 4IZOA 2FWPA 3FOFC 3ZBUA 2H63A 3TGWA 1I6LA 3DPUA 3QBDA 1UBGA 3L84A 2A0WA 4PCVA 3ZU2A 4EY4A 4F8JA 2ZANA 3OZIA 4D3ZA 1W4LA 3STYA 3LGXA 1QYWA 2DR3A 2ET6A 2GZ2A 3AINA 1YI0A 4LOKA 5EZYF 5KHAA 3UHJA 2BEVA 3I64A 4X85A 4GFDA 1RPZA 1E9SA 1T4GA 3KKEA 2GCGA 4Q3DA 1E3TA 3EH1A 1INLA 2HN9A 1KVUA 2P9TA 3D2AA 2FU5C 1Y34E 2G76A 3BREA 4ZPJA 1IHXA 2X40A 1I0IA 5LDGA 4CR7A 2HPHA 4P92A 4HEQA 4D1YA 3K71B 4DLNA 2ZUWA 1Y7IA 4MIEA 2IBSA 2L69A 1WXWA 2DVMA 2FPGA 1WPXA 3COSA 3TOXA 5K6RA 4E2YA 1I0ZA 3ROGA 5H4GA 4CCSA 4A3CI 5LWQA 1GNPA 1I3NA 5K51A 4DDVA 1ZUHA 1MNQA 5I7OA 3I1FA 2Q5QA 4QIHA 1N9GB 3GLHB 5KJ6A 2OBNA 2PWAA 3L01A 1VMDA 2H1RA 3N7TA 4JCOA 3Q87A 1H5QA 3EQ7A 1JG7A 1V43A 2DFTA 1THMA 2IUYA 4DR1B 2J7PD 4JYAB 4PZPA 1Y82A 1FP1D 4ZO7A 2W58A 3Q7QA 5D1PA 4WESB 5DTEA 4BX0A 4D6YA 5LB4A 3KLBA 1VLMA 1I7DA 3O4JA 3UB4A 4W6ZA 1QFSA 3X2FA 4HVAA 2GB4A 5DK4A 4ZI2A 3AEYA 2E9SA 3O9ZA 4WXYB 4ER7A 4NZYA 4ZEXA 3O8BA 1YAHA 2D0DA 3CME1 4ZC1A 4F38A 5B1EA 4CMKA 2YN2A 4GZLA 1J49A 4Y1RA 3NDJA 2H7XA 3H4TA 1CR4A 3EH2A 3A4YA 3DL7A 3NYQA 2TMKA 5F5LA 3RYIB 4G0WA 1ADYA 4X6UA 1SRQA 2DTEA 2XSZD 4KUGA 2AT1A 2CVOA 1KVTA 1DMRA 4YJ3B 3OC0A 1E3IA 2C4WA 1VSQA 5HQTA 2E18A 1LBTA 1NVXQ 4AQDA 1PX2A 1A8UA 2XUIA 1PW7A 2GN6A 3LFTA 4C4YA 5A3RA 2R79A 3OTHA 5IK2A 5TB5A 3FE2A 4CPDA 2DSNA 1W8IA 3OQIA 4JWTA 4QPCA 3N2IA 3VR0A 1SWWA 2C83A 2M98A 2NTYC 3A70A 4QQ8A 1P77A 3DH0A 2NVUA 1BW9B 1U11A 2GO1A 3C1OA 3G0OA 5F35A 1BX0A 3CB4A 3VDQA 4B3HA 1G8YA 4EB6A 3AUTA 3UGKA 3DZBA 4UU7A 1S4MA 1Z2OX 2YV5A 2Q62A 3AUYA 4F9TA 2V8OA 5FBQB 1SIUA 1FVXA 1N3LA 3IUYA 1R6DA 1FFWA 5FI0B 3E48A 1JR2A 1WR8A 2LUOA 3ASZA 3PGMA 1SBIA 1MX9A 3WHLA 2R9VA 3COWA 4G4GA 4MKZA 3CLTC 2OVBA 1P3DA 3K0SA 7REQA 1KI2A 3FDFA 5GVSA 4JP1A 1T8TA 2PXXA 2B6NA 3SLRA 1VKZA 2ZBDA 2CXOA 3EAGA 3IP9A 5BSVA 1TT7A 4J3JA 3PQCA 4EHDA 1ZNYA 1J6UA 4CUZA 4EABA 1ZW1A 1Y9AA 4QUAA 4X95A 3Q7IA 2C8JA 5HFNA 3O6VA 3HC7A 4JEIA 3UV7A 3IV9A 1KZ1A 1IJBA 2M32A 4FGSA 1M8JA 2R1UA 5IBPA 4EUFA 2NU6A 4JMLA 1SZDA 1LPPA 1C9MA 2E37A 2FJ0A 2ID4A 2J67A 2I22A 3AQ4A 4K6KA 4KPUB 1TJNA 4QASA 1GSAA 3U7FB 4PS0A 5HIIA 2EEZA 5JCPA 1B41A 4G4SO 1FDTA 1CS0A 5F77A 5CDSA 2P90A 3VKUA 1UM8A 2NVQI 3W8EA 3WISA 4TTAA 2W42A 4ERXA 3CY6A 3NGXA 3OJEA 1ADCA 1AK9A 1D2EA 3ETJA 3OX2A 1ZGZA 2J4DA 5KOYA 1T1SA 1BRTA 3PVCA 3K8ZA 3H42B 3WYGA 1ZMBA 4LC1A 1XMSA 1C7QA 2Y0SA 1GG5A 3ERCA 3ANTA 2VOJA 2WKPA 1EM8B 1SQ0A 3I0NA 2HDOA 4AMZA 5DNUA 1JQLB 1WTCA 3A6HA 3DEAA 4MA0A 3X1XA 1KMQA 2QR1B 1AUPA 1RC0A 2HCJB 4N12A 3F71A 3IILA 1C1XB 1U90A 3KYDB 5DT2A 5IDYA 4GKJB 1BJTA 4JKOA 1XKLA 4KQ2A 1Y6JA 3FH0A 3R5FA 4L5BA 4LZNA 4UUOA 4WN9A 5DNEA 5EYPA 1X9IA 4UM9B 1SGWA 1ICEA 2PN1A 1L7EA 1HQDA 1XZAA 3EUEA 4MPJA 1KJQA 3OD1A 2BH9A 3R7NA 5C18A 1U1DA 5CA1B 3PRKE 3LO5A 3GCDA 4YCAA 1ZLYA 4B4KA 4Y2HA 1LJUA 5DWDA 4OH7A 4F60A 5EZYB 4K9OA 1QYDA 2MHCA 3H0KA 1W0JD 4B73A 3VBCA 3S1NI 2QTLA 1U1FA 2PSHA 4ESOA 2NNLD 1JFFA 2PM8A 3IUBA 1N5RA 1KF0A 4KK3A 1FJXA 1L5QA 1XD9A 1N5OX 4P98A 5AI9A 3Q3HA 1H4QA 1N33B 1X0XA 1IVYA 2H8GA 2HM7A 2KBFA 3HB7A 2LXNA 4R2MA 1TEVA 4IO0A 2YZ2A 4KAJA 1OI4A 1X1TA 1CZHA 4G07A 2QX9A 3PGLA 4H18A 2UXDB 1CT9A 1JQEA 4JA0A 2GWHA 1EKXA 5D1NA 4DL9A 3K7EA 5F2NA 4G1UC 3M81A 3DYBA 4AF6A 3MXOA 1E4VA 4DJFC 1E18A 2V8KA 3EF1A 2FZ4A 4GR9A 3SVLA 4OXRA 3AUXA 1QQAA 5IPFA 1Q15A 2FPUA 3O38A 1TCCA 1SHTX 2OE2A 4XPIB 5FI3A 1Q0RA 4NJEA 4DG5A 2KW5A 2O0HA 3S70A 1OWPA 3IO5A 3K1YA 5LMCA 5IT9A 2JLYA 1GUAA 3ZWBA 3H4MA 1CTQA 1FNMA 1WJGA 2AWNA 4F6RA 1JN0A 4Q6WA 2J1LA 4A3LI 4S1WA 2PUGA 3GUHA 1G5TA 3WJ1A 3HUTA 1O03A 4FKMA 2J9GA 1CC1S 2QG4A 1ZR4A 1UT6A 1T2EA 5CHYA 4GE3A 4ZV4A 2O8EB 3PFKA 4OM7A 4Q3KA 1CY6A 1RRPA 2DPHA 3U3RA 5E9WA 1E8DA 1G7SA 3ZU6A 2MINB 4BFXA 5ALZA 3U26A 4QXOA 1O4VA 1XCLA 1EE9A 2BFCA 2JLRA 2ZIFA 2J85A 1KI3A 1LU9A 3GF4A 2C2XA 1KFCB 1KO4A 3QG5A 4GUDA 4X54A 5LP6C 9ATCA 3VQTA 4X6AI 3U9LA 4EJ2A 2O7RA 4PZUA 2F2TA 5EKSA 4RFSB 1W8DA 1CQWA 4DSUA 1W36B 2QUZA 1XA3A 3NYWA 1BXRB 1EUDA 4YQEA 4B84A 5KWVA 2A5YB 4S1VA 2GK3A 3QNUA 4M3NA 5E6UB 2DERA 3R7SA 3VOAA 4M1WA 5GJVC 4N03A 4LF4B 1N2JA 2W90A 2VSXA 1YA4A 2Z3ZA 3B6ZA 1PAUA 1KYYA 1Z8NA 3KKPA 4LJ5A 4LF7B 1U65A 3IIKA 4QPNA 4LVOA 3IE2A 3HMQA 3NBXX 3PE3A 1ZSVA 4OI1A 3UCXA 4URXR 1N2FA 4KW7A 5SZJA 3LQ1A 4RZ2A 4CLRA 3ZW7A 2C57A 4NJMA 2ZIWB 4BFLA 1M34E 1F6WA 4RTPA 2K2WA 4AF7A 3KCQA 1GAJA 1KOFA 2NO0A 3BTUA 4BMPB 4BYGA 2B37A 2AMVA 2OCAA 1IQUA 4H1WA 4X91A 4WT7A 2IWHA 1CRWG 2MSDB 2P6OA 4NWIA 8LDHA 1K88A 3RAGA 1JIJA 4E70A 3WL8A 2HSEA 1FZQA 3CKLA 5BOSB 2B2CA 2OILA 4IH9A 4NATA 2X8JB 3DVQX 3K0BA 3KJFA 3PV0A 5KJEA 4O08A 1JP7A 4M1YA 2Q2OA 4QDKA 1WUHS 4WOCA 4LFBB 4NU0A 3ZHCA 1W581 1YRAA 2WPDA 4CLXA 3ZDBA 2Q3EA 4UBNA 1QNFA 2DPXA 2WINI 3KQYA 5EN4A 1ML4A 3Q9LA 1WDWB 3RKRA 2D0IA 4V0NA 1USIA 3IC5A 1GUZA 1OREA 1Z18A 1XXLA 4RLFA 5BUQA 3CR8A 3P1JA 1GU1A 2CDAA 4MW9A 4PAMA 4LQDA 2RHBA 3WBFA 1YGPA 3PC8C 3B3FA 3MUFA 4UE3S 1VQNZ 1MIOA 4UE6A 3H1PA 3B3QA 1RXCA 3SC6A 1WSAA 5IT4A 1GQRA 4E1AA 1D4ZA 1YL6A 1QCYA 3DR5A 4Q4CA 4OXYA 1MOZA 4EP1A 4F5WA 1KAOA 2BR4A 3WK7A 3RODA 4IDNA 2QTNA 3PQ2A 2TMDA 1WCIB 3RVQA 3GWGA 3L4JA 3H0EA 1Q22A 3ASVA 4RKRA 4D8VA 3SNKA 1AKMA 1RJGA 2GN9A 2R5NA 3DZFA 4RDHA 3MM4A 2FHPA 4W5NA 2J0EA 4WNCA 2YHUA 3MLEA 3OZBA 5CVCA 2IS2A 5I7RA 5FOXA 1Z08A 5K3SA 5TMPA 4LJLA 3C4QA 1NX6A 4NBBA 1FBTA 2JA5I 3DE1X 2EFGA 3R5TA 4RE6A 4UU0A 2FPIA 2QN1A 3UUEA 4IILA 3ZWNA 1MVNA 1QGED 2CFRA 4RK4A 4UREA 4HK4A 1KBQA 1YOVB 5F12A 2XUPA 1MGOA 3JVVA 4L02A 3ZQUA 5JWOA 2VP0A 1VLHA 3AM5A 4JODA 4BZQA 1C9EA 1TCBA 1YJ91 1O54A 2NLOA 1WPRA 5T8KA 1QGOA 2AYYA 3NGMA 1IBSA 1AM4D 3EOZA 4I19A 1JJ2Z 3TQCA 2BP7B 4ZI7A 1EUZA 1UMKA 5JECA 2WMOB 3DOEA 3JAKA 4CV1A 3A6ZA 1TJYA 3OM9A 2WUDA 3STVA 5B1YA 1GYQA 4RWEA 1JBQA 4G1MB 5H68A 5FB3A 2MYTA 2O4HA 2QB5A 4V0QA 1ZCZA 2LV8A 3BRWA 3P4XA 3S8MA 3M6LA 3GD5A 4MS3B 4MINA 3TIGA 3MIIA 4KSCA 1PSZA 1SC4A 2OESA 1BOOA 3AUFA 1TQ6A 2VNAA 1Z6ZA 1WJ2A 1C0LA 1ISSA 4B6JA 2CFIA 3K96A 4R2XA 1X3ZA 2VCYA 1VBMA 3NC1C 4I5IA 1XZMA 1XJWA 1T9BA 2NPOA 2WT4A 4A7PA 1M1YB 1BWRA 4M8NE 4BNFA 4B3RB 1UH5A 3B1XA 5DM60 2SICE 2D2XA 3O93A 4RA6A 4C6RA 3GTLI 2JVKA 4MDHA 4J0DA 3L5OA 4OF4A 2XE7A 1KC81 1YQEA 1I1HA 3MS4A 3QA9A 4GOOD 1R2QA 4FBGA 4HC4A 4XQEA 3WMEA 5C1BA 1GTVA 4B44A 1TC2A 5EQJB 4Q9JA 5DASA 3EB9A 1U0JA 1TL7C 1K9SA 2A4MA 5HM8A 1TKAA 2C5FA 3BZWA 4AWAA 4E5PA 2AN5A 2HNBA 2O3TA 3WYFA 1OF1A 2Q1WA 3JX9A 2P7HA 1RC8A 4PAOA 4V02A 3TQIA 4MD7A 2GRUA 3V6MA 2BISA 3CCE1 1ZEJA 1K8A2 1AO0A 3CR7A 4FI3C 2XUJA 1BX1A 1F0YA 1M6VB 2A0KA 3PQDA 5ETJA 1NVVR 4UM8B 4MRVA 1N6KA 2AB0A 3ZK7A 2Z3WA 5FR2A 5JJIA 2NT3A 2IYFA 3ELDA 4R81A 3A4LA 1OU4A 2NADA 4N3NA 3ESRA 2YASA 1M7GA 1KAHA 2VNIA 3HKBB 4FUQA 3UWDA 3OZSA 1GQFA 4CKEB 1WD7A 2A1UB 1WXFA 1KI4A 3A05A 3T1OA 2IZ5A 3DMTA 2HREA 3OJLA 3QMPA 1CWUA 3EX7C 2QRJA 1FFEA 4YJFA 2F00A 4MUAA 1NBWB 1LV8A 5ADHA 2AA3A 4K1LA 4ACAA 2F4MA 3QU5A 1HE2A 2PL9A 2A7XA 2IE0A 4A0QA 4YJGB 3IDZA 3B13B 2GPYA 4K2AA 4YLGA 1GFZA 1BOFA 3EIUA 1WZCA 4NZMA 5EJ2A 3T9FA 2QRCB 1AUVA 3EWNA 1V5GA 4AZ0B 3O1HB 4ZIRA 1MFZA 1SVNA 2XGGA 1EEXB 2Z2KA 4MB2A 5KVAA 1E8MA 4IF6A 1KO5A 3DE7X 4NBUA 4TWBA 3CPEA 3ZYCA 2RK6A 3TNFA 3WKCA 2EZ9A 4TMVA 5JCOC 4HS4A 4KTTE 1QYCA 2RHRA 4WCFB 4BRWA 4R69A 4XW2A 3ABSB 3WFZA 3HDQA 4EI2A 3D3WA 1GYRA 1OX4A 3A3OA 2VP9A 3BWXA 3GT0A 2FUCA 3UK6A 2GJ8A 3G1WA 3HNOA 1EFHA 4X8OA 2IS6A 2GK7A 1W1UA 1IATA 1RCTE 4M36A 5AT1A 3N39C 4ZT4A 1WAMA 5BSGA 1KK3A 1EJ2A 4GH5A 3QLTA 4K9QA 4QDOA 1OAOC 2ZCUA 5K0JA 3OT1B 4G81A 3HU1A 1J8MF 1B0PA 3B48A 5IAAA 2QMQA 5KQRA 3DBRA 3HKDA 1LGYA 1XZQA 2KPIA 1RSZA 1CB0A 1EVQA 4HWTA 2F3SA 3T5CA 4CLEA 5KYNA 5EWJB 1VE9A 5HFJA 1E2BA 5AW8A 3O8RA 1LBSA 2R751 3PA8A 1NBAA 1IHYA 1T36B 4B7AA 1HL3A 2GJ4A 2IJGX 1N2GA 1Z6YA 3DTTA 4O5AA 3CNNA 3EQ2A 3I1IA 3G1TA 4OKSA 1B8OA 3E8MA 5KSOA 3LH5A 4NMLA 3K30A 3SSMA 3TQOA 5KPJA 1RP1A 4DA0A 3VZCA 3WGIA 4BB9A 4ND7A 1GZUA 1USVA 1UPCA 3IAEA 3X1WA 4E94A 3DT9A 5TIIA 5T7BA 3H87A 3IPRA 5JSHA 2YV1A 1C7FA 2J9YB 3DXYA 1VLAA 2I0FA 1V6SA 4QYXA 2BEWB 2N9UA 2EERA 2GN0A 1X86B 3IP5A 1MH9A 3JSAA 3LT5A 1OMOA 3ONFA 5E38A 2EKDA 3SXUB 1I9GA 4FYJA 4RX1A 2BGTA 2AIRA 3X1JA 1DQNA 4CEHA 1ISIA 1P60A 4PLFA 1G38A 3IBCA 1V48A 2X0FA 4AMVA 4YJHB 5JS2A 1TVKA 3VZRA 4Y9SA 1GPMA 3HJHA 1FRZA 1FP7A 4LVCA 4EO4A 4ILKA 4G0QA 4G0VA 3KB1A 3VKGA 1NUIA 4UHBA 1SUFA 3BE4A 2XIJA 3WZ2A 1JAZA 3PL5A 5JH7A 3ACDA 3IT3A 1PZFA 1ECCA 4NDNE 1KJNA 1MJFA 2N42A 2OCDA 4LDPA 3N0TA 4ZQHA 5EUBA 2JFWA 5F21A 1P1HA 2B83A 3DDNA 4IIJF 1M9NA 4ZAGA 3LLSA 3JD2A 1SM4A 3B2NA 4IL5A 1CX9B 5HF8A 1IIBA 3KEGA 2CLIB 2B63I 2IQ5A 1CF9A 1RHMA 2VSFA 1JDVA 1MV5A 3A6DA 1PWXA 4KFTA 4OAQA 4UBJA 4HAZA 1I3OA 3ESQA 5TQ0A 3WGKA 2A57A 4M86A 1IHUA 1TRKA 3F6YA 2LCIA 2PU5A 4L4RA 4A2QA 5HQJA 3RRZA 1MRZA 2FP4B 4L57A 1EWRA 1XN1A 4RSMA 3ZVLA 3COPA 4L5IA 3H2JA 4K6HA 3OCJA 4UNRA 1T2FA 2XMGA 4X7MA 5TQJA 1SBQA 2TECE 3G6KA 2R6JA 2AJBA 3CINA 4MYDA 2W43A 1C8LA 4XKJA 2JASA 3GLGE 4BRSA 2DFNA 3MVEA 4Q9AA 4RK0A 3MJEA 4F6LA 2MYUA 3LT4A 3M9WA 3MWFA 1QHHA 2FN7A 3FR8A 3GFFA 4PO8A 2P9JA 5ANRB 1I3KA 4LJ9A 4HGNA 3KZCA 4LJ8A 3T1VA 5COQA 3RYFA 3C3YA 4KR3A 2D74A 4Z1MA 3WWEA 2RCYA 1VLQA 2JBAA 2JFBA 3AZOA 3PHIA 1HYBA 2JEZA 4CWAA 3MGAA 4CTNA 5KOHB 3HVRA 3DE0X 5CT9A 5F52A 3M83A 2OBYA 3QTLA 4FR0A 3LBFA 4Q18A 1P2TA 4XR4A 3ANNA 3SZLA 3LFHA 1BEUB 1X19A 2GEUA 3JRWA 3ZIAD 4NOMA 2X0KA 2ZSAA 4H3KB 5BQPA 3WGYA 2YZ7A 3KHUA 4M2LA 4ZVLA 3ICQB 3M2TA 5IW8A 2EX0A 5H8WA 1X1CA 2OV3A 1WZ2A 3LGAA 1Z5PA 1J0EA 4O5OA 1N75A 4IOMA 1X77A 3I01A 4OUKX 3B51X 1JS1X 2DLCX 3AVXA 1EK2A 3N53A 4JBWA 4B76A 4Q7MB 3V7NA 1KFKB 3KL4A 3UKOA 4A8JB 3SFVA 3BIXA 3KJHA 2I03A 4K9LA 4MVJH 3TTSA 4BXOA 1YR3A 4R3WA 3CCM1 2DETA 5DBFA 4B6RA 1WZNA 1QK4A 3M1AA 4ND6A 2IYEA 1HDOA 4JU9A 3IPXA 4RZ3A 5DK6A 4DQXA 3GRKA 1OLSA 3P2EA 4GOMD 4QOSA 3SQDA 4TMKA 1J1ZA 4LJAA 1DCFA 1HXHA 3BH0A 4U8GA 2NN3C 3INYA 2A88A 3ADKA 3ZTWA 3NEAA 4CF3A 5DGCA 2IWRA 3C7DB 4KLRA 3LZ6A 1CU1A 4BDSA 3TFOA 2AVDA 2VJMB 4IHKA 2B4KA 3K9GA 1J25A 3UKDA 2HK9A 2BSXA 3GQBA 3CBGA 1II9A 3M6WA 1KKMA 2Q6LA 3MWDB 4Z6KA 3I4CA 3AEUA 5AM3A 1Y4SA 4H7KA 5K0GA 3NTOA 2BKEA 2FY8A 1DX6A 2JLWA 1SQFA 3O8NA 4EYEA 2WJ6A 2HIMA 3DD5A 1DC3A 2JAWA 2VHTA 2WU3A 1E5LA 1S3IA 3OLYA 3ELWA 4I1YA 4K0RA 1KDTA 3RAJA 3AVQA 5K8JB 2BGNA 4O25A 2I78A 4JMPA 4RJJA 1C81A 1Q7Y2 2H5IA 1KS9A 1DWPA 4XDHA 4RJ2A 2E87A 2YV3A 4J2HA 4HFJA 5IYZA 4BO3A 1N7HA 3THOA 5A7FA 2UYCA 1GIAA 2NPFA 3NANA 2DLNA 4A8TA 4AJ4A 4S1TA 1T2VA 4C22A 1GPJA 5JCXA 4RBNA 3U7GA 4BWVA 2GM9A 1JLLB 1JFTA 3DDOA 5CB4A 1ST3A 1G20B 4QQFA 5FLXA 2X5XA 3HYNA 4TSFD 2EJWA 3EXHA 3T12A 5C2JB 2EEPA 3IAS1 5LQRA 2ANBA 5EFZA 1RAGA 1Y6GA 1PL0A 1P8JA 1DO8A 4Q34A 1WXQA 2HF8A 3ZDQA 2Q6IA 1RKQA 3D8UA 1XI2A 1QVVA 4MYTA 1QANA 3HXOA 3S28A 2B34A 2C0QA 5IDXA 1CNEA 2IEIA 8ADHA 5AW0A 2IW1A 2ZYAA 4OIMA 1UOQA 4F4CA 4C3VA 2WTAA 4DWJA 3L8CA 2P3YA 1L0BA 4PTZA 1NW7A 1LZLA 1LUAA 3NRCA 1TAQA 4DJEC 2H2DA 5HQ3B 3DZ8A 3ZJYA 1PDOA 2V9PA 4WVLA 4BTEA 4IIJB 1TMKA 4HLQB 3RS3A 5HKOA 2OBMA 3B5JA 5LVAA 3CCUZ 3HXQA 4OXKA 4TVOA 1ADGA 4WD3A 4RPCA 3CLVA 4FHCA 5IZCC 1P9RA 4WBNA 4G1VA 1Y0BA 4I50F 4QTTA 3WE7A 5JC1A 3W2IA 1HTTA 2QP4A 1MC8A 1XQ1A 2QUIA 4DE5A 1FYVA 1LW6E 4MZXA 2I54A 1CRQA 2BH2A 2MDTA 3TBKA 2VQ3A 3PXGA 1RPNA 2J0SA 4CF7A 1IQPA 2OFPA 1EVLA 4ZOEA 4LX0A 2GD6A 4K46A 3AVTA 1U2EA 1JT2A 5CLJA 1U2SA 1KKLA 1CJCA 2QLLA 2H9AA 3RS8A 3IIEA 4BGVA 1THTA 4ZYVA 2OXRA 3CC8A 1C7RA 2BWJA 4S2UA 1C1HA 1WABA 5I8PA 5LSAA 2VP2A 3D1VA 3WWZA 2Z57A 3CMAZ 2RI6A 1ZRNA 4D80A 3EG9A 2CMHA 3WNZA 1YR9A 4C4PA 4D4IA 1H4TA 4HNQA 5BRNA 5BSUA 1DWQA 5TY0A 4BAGA 1KNQA 1P44A 3IXQA 1BE1A 3H99A 5IF9A 5A0VA 2ISCA 2Q3BA 2QTMA 1PGNA 5GWXA 3KETA 2O7QA 9ABPA 2MMCA 4B4OA 1ZJ5A 2EJTA 3V97A 3VPXA 3GTPI 1OFIA 1GG8A 3A1UA 1ULUA 3FOAA 2C94A 3EOBI 4H7FA 3ISVA 2WJHA 1THGA 3IVCA 5DBGA 3WIUA 5BQXA 1VG0B 1JSRA 3Q0TA 4RHUA 1E6LA 2PTGA 3CNEA 3KUKA 2O0JA 4GL4A 5IN5A 4NEQA 5CNJA 2IYNA 2PIDA 5B7NA 2Z2JA 1EZ1A 2E7ZA 3ZEIA 4MKGA 2RHHA 1VQPZ 3O4IA 3DDCA 4OB7A 3ZNNA 2BUCA 2DQZA 3HY3A 4G5FA 4GQAA 4H4CA 2FFBA 3LHDA 4PLYA 4RCZA 2OV4A 4DARA 5FWNA 3DAHA 3QOYA 5D85A 5GM1A 4JYMA 1XTBA 2NQTA 3GIDA 5C7LO 1U2GA 1RWOA 5B1IA 2DQ4A 2Y0DA 4FYWA 2G63A 4HLDA 4I3FA 4M0PA 2Z2IA 4MUHA 5E95A 4JI8B 2B7CA 2XYGA 4HH3C 3VDNB 5TPZD 4PY2A 2NUBA 5SYMA 1BGVA 3LPNA 2PYIA 2JNYA 2Z2YA 3VYRB 2H1LA 4GBJA 2W6IA 4J03A 4L7QA 5J2UA 4LXGA 5AI8A 1A69A 1RS0A 2QMHA 3W3AH 1FSSA 1ND6A 2C82A 4AKSA 3P9ZA 3TNDA 1W5BA 3F90A 2IYUA 4RETA 4M0MA 1S5PA 4AROA 4D6XA 2EGHA 4PU0A 1XAHA 5D00A 2PWBA 3ELBA 3RS4A 4P0TA 4TXNA 1WSWA 2FX3A 2AYZA 2I2CA 1XVUA 2IXDA 2Y76A 2Q4BA 3I9LA 2IYLD 3OESA 3PQ5A 3LV8A 4WWHA 1YVDA 1L5GB 3RARA 5AW2A 4ZQBA 4KR0A 2IHTA 4NV1A 1M901 1SUPA 5A4KA 1ITZA 5IP5A 3D02A 1U8AA 1HYHA 3EWAA 3RYHA 1XPJA 1KQGA 1YZ3A 4G97A 4FK8A 1T5LA 1IM5A 2OK8A 5BN5A 3U50C 3WGUA 4IIVA 4L7VA 3HO1A 2DJIA 5CA0A 1P7YA 4DM4A 2ZIGA 3WICA 4R4JA 4FC7A 3PEFA 2GD1O 4RD4A 2DX7A 4GECA 4M98A 5KYWB 4DIBA 2X42A 3V8NA 4KQ1A 3ZVMA 2IEAA 4XFDA 3RLFA 3K6SA 3H9QA 1SKAA 5GM2A 5T4FA 4GZMA 5AOVA 4ZI5A 5C8VA 1Q0HA 2A5JA 2XCOA 3M49A 1W88A 3AERA 1HZZC 3CW8X 1YSCA 3GJ3A 3M2PA 3NATA 4ZP1A 4MUXA 2W6OA 5CIWA 1NUQA 4Q4AA 1T2AA 1KO7A 2JFHA 3PPXA 4KXQA 2QN9A 4NBVA 1CVRA 1SQ6A 1NONA 2QU8A 4PNZA 1AVTA 4D92A 4BKQA 2C2MA 1OLXA 1AB5A 4MV8A 2XODA 1BD4A 3RG8A 1TYCA 4BV9A 3U09A 5AVOA 4OUDB 4RF4A 4BNJA 2X5NA 4MITA 3H2SA 1IXRC 3GIWA 3MAGA 3G7SA 3Q85A 3PFGA 2CLCX 4I50B 1E62A 4FSDA 5DLQC 2ZJ6A 1ABEA 4M9ZA 4CBVA 4F96A 1ZVMA 1CDEA 3D0RA 3GJXC 1FRVA 5AESA 4CM8B 3GDOA 4ZT2A 1OIVA 4NV0A 1GV1A 1QHGA 3IULA 1JF8A 1Z39A 3L6CA 4DR5B 3R3WA 4PE5B 1KP9A 1X1QA 1O8BA 3C85A 2EBHX 4KIUA 3AUSA 1SXIA 2R8BA 3IA2A 3ZG6A 3VR6D 4BJHB 2WB4A 1V9SA 3AY0A 3H3JA 3CX8A 1KJ8A 4EF6A 4MOWA 4XE5A 1T1RA 2PMKA 1N2ZA 1DG9A 3FETA 3HA2A 3PFCA 4NPAA 1CUEA 4HAWA 1KQPA 1RPJA 2CYBA 4C04A 2K7ZA 4YV1A 1QOPB 4OBWA 3T7RA 1GG2A 4I81A 4ZAFA 2F4VB 4NBGA 4PVDA 3HUFA 1S721 2Q50A 1IAQA 3CLTD 4D82A 5ABPA 4BC0A 2PKCA 3DG9A 2H1FA 4A3BI 3GLIA 1WSDA 4BECA 1E94E 3F97A 1VTKA 3MBIA 4FILA 4HLUA 4NI5A 3SQLA 2G08A 1SC3A 4Q9HA 4DBVO 1DLJA 1GQQA 2FSGA 4PS1A 2BI8A 2Q2QA 4LTNA 1S01A 3OIDA 4ZO4A 1XZIA 5E4TA 2G4LA 3AG5A 3DFIA 3JYPA 4IFIA 2QD5A 2W70A 4EFDA 1H9AA 5TJ9A 4DANA 1NKSA 4DM3A 1OA1A 2Z8XA 1PS0A 4Q02A 2PQ0A 2FMHA 2ZT7A 2IP2A 3HB1A 3TIXB 2P35A 2X6QA 3DO6A 3Q10A 2DFKB 4NZ9A 3JQ6A 2IHKA 2Q5FA 1YRBA 1NJGA 3QRWA 3C6ZA 1R0YA 3ZQKA 3H6KA 3NHFA 2WD8A 5B36A 2GEJA 1UJ5A 2ECQA 4RESA 4Z0NA 3VA7A 2R7NA 3U3XA 1MO4A 4LDAA 4FZRA 3PYMA 5F5XA 2YVQA 4N7JA 3WIVA 2ID9A 2CBZA 3MWKA 1DNPA 1YQGA 4URHA 1KVQA 1GL7A 2TS1A 3AU9A 3UV3A 2CLOB 5C8DA 1MO6A 2A30A 1MXHA 1P2GA 3KD3A 3NRBA 3HHEA 3R6DA 4NLLA 5CRIA 1P5JA 5AM5A 3UUGA 4DLLA 2I2FA 4F46A 4AY6A 2WTBA 3P26A 1AGXA 4HJRA 4CKCB 5TLSA 5FBHA 3LKDA 1WCXA 1HTBA 2HLDA 2PSEA 3DLHA 4V39A 3BIJA 2Q5HA 3OW2Y 2HO4A 5A3JA 1NW8A 2D5CA 3I9V1 1ZINA 5DH9A 1IN7A 3E1SA 5K6AC 3WDMA 1VYVA 1Z37A 2WP0A 5G0UA 4QPJC 1D5CA 3ZXUB 2GBCA 3GDFA 2VFAA 4GEKA 2DJ5A 5DI3A 1N2SA 1IPHA 1VSVA 3AVPA 1T9GR 1JQAA 1FCJA 3OM1A 1YB2A 1RTTA 5AKKA 5ILGA 3RANA 3VYWA 2VF5X 4AF8A 4M99A 2VK8A 3RUEA 3EA0A 3DTVA 2W2LD 3W5DA 4RORA 3SWWA 4JVLA 6AT1A 5B6PA 3TDHB 2W2KB 1KSFX 1UQRA 3BKXA 3HY4A 4QJ3A 4EGQA 4B3MB 4G0MA 3T3OA 1JA1A 1RWMA 2A35A 1JWAB 4A6DA 2F3RA 3WBJA 4CCYB 1J2UA 4N49A 1OBFO 1HEIA 3I2YX 4OLJA 1CUXA 3WA6A 4H0CA 1B8NA 2QLBA 2QEX1 3NEPX 4U00A 4WK0B 2NXEA 3LHFA 4MUEA 3VBEA 1LLFA 1B16A 2VK2A 1JNYA 3KLOA 1NXSA 1YZQA 2WV9A 2ZRHA 3PL1A 4RENA 3HLTA 1DRVA 3T4PA 3TN7A 5ELXA 3UJ3X 2NU9B 3RV3A 5CVEA 5AD1A 1NBMA 4HQRA 4WZBB 2W00A 1PQYA 3OZFA 1K4KA 4KQIA 4U2CA 4Q24A 4LXTA 1IL0A 4RH0A 3NHYA 4MUJA 1FEZA 2P4EA 4KUEA 2PJUA 3LECA 2XXJA 2AKLA 1E1KA 3HG7A 1XX6A 1YTLA 4F8EA 4XM0A 4HGZA 1G42A 4JH0A 1DOAA 2REQB 3ZUPA 2R96A 5FJJA 1CUHA 2B7BA 4EKDA 1BS2A 3ZBQA 3BGDA 5CIQA 2O8FB 3LI2A 5LJIA 1SU7A 5D3KA 1GKIA 4DDWA 3AONB 4V0OA 1OZGA 5BN4A 2IXAA 5EINA 3LUHA 2KI5A 4NNJA 3LD9A 3J80A 3F3KA 3PYLA 1DKRA 1QGUB 4R0VA 3VZQA 4Z3DA 3I4FA 4EKNB 3DZDA 1CVLA 2GTPA 1YIT1 1ZA1A 1ZZEA 2BGRA 1Z68A 4D79A 3G8CA 4NYJR 2IYRA 1QHYA 2BM0A 2JGEA 2PKQO 3BEDA 5LIRA 4IDEA 2FFAA 1ZOLA 1KFJB 3U4AA 2J59A 3EMKA 3PDWA 2P69A 4NS1A 3O83A 2UKDA 3OKPA 4CQMA 1KZ6A 1Z56C 3I76A 2XBUA 4FFMA 1JSLA 4WK2B 3P0FA 4R0MA 3Q2OA 3F4BA 2Q6VA 3WRXA 1YZTA 4ZV7A 5JNVA 1QE0A 5EE5B 3WQQA 4LXUA 3SKVA 2B8JA 2PVPA 5IMSA 4D26A 4DCMA 1QRDA 3AI3A 1P0QA 3LL7A 1A9YA 4BEBA 1GZVA 1I4EB 1RKVA 1RLIA 1L7QA 2YXDA 4OAPA 1RWPA 5J43A 1WTAA 1IHOA 3GJTA 5BSWA 3IP6A 4K87A 3C14C 3IAM1 3WMXA 1BHJA 2WE8A 3EPPA 3ETDA 4LDJA 4C7BA 1AMNA 4TXJA 3RQSA 4DOMA 1NYLA 1YUAA 1F8XA 2ZRLA 1IULA 4I9UA 2PRZA 4L73A 5IHPA 1F7VA 4BNTA 2IDKA 3FWHA 4L3WA 4XJVA 4HNRA 3K0FB 4I5DA 2WZBA 1NN3A 3DKIA 3EF0A 3QU2A 4WGFA 1Z6AA 3D9XA 3CZMA 3QX7A 4JI1B 4I1SA 1ZH6A 4BATA 1Q91A 2C20A 3HYRA 4J0GA 2CXRA 3FKSD 1TTQB 4AUEA 4HFRA 3PUIA 3GL9A 1XKXA 2D1QA 3NV7A 3I6MA 4MDEA 1ZUD1 2P5UA 3EFOA 5TT0A 1DIOB 5AXAA 3CRVA 2J31A 2Z5FA 3T5GA 3AHCA 1VJTA 2AC7A 4GGPA 1M0WA 1E9EA 1P1RA 1WCYA 1ZM7A 2X0JA 4HN9A 1SOWA 4KIWA 4JQOA 4LC0A 5DYYA 4B71A 2UYOA 3TTYA 4KXVA 4LHVA 1PJ8A 3CZAA 3HVUA 2X4LA 1C0PA 3E0QA 3ESWA 4HAVA 4DR7B 3EMDA 3MCZA 4KGXA 5DCWA 4A9AA 4ZOQI 1RPAA 3MJTA 5D6OA 5EPEA 4TMWA 1NZJA 1KI9A 4GBMA 4BWGA 1SBZA 3LXRA 1QP0A 1TQ4A 5CGQB 4ZRMA 2JANA 5K01A 3D6WA 4OO3A 2ZT6A 3K8OE 1XZHA 3R3VA 1OAAA 1RRKA 2L42A 4JJZA 3ZS8A 5CUQA 1I4WA 2ZBQA 1C0KA 3S1AB 1GA4A 3LF2A 4OQEA 3B78A 5HMMA 3H65A 4Y3UA 4G84A 4ER0A 3FCSB 3B3GA 5L8VA 1DJNA 5FYQA 1U2TA 2H1SA 3E8XA 4FYHA 2VATA 3D59A 2ZUBA 1JHZA 4EW1A 3CISA 1K6XA 1XEXB 3L7OA 4HDKB 3RV4A 1Q0LA 4C9BA 1FC0A 4PF1A 1Y1RA 1BWSA 2DMRA 3ILSA 3KKNA 4QBGB 4Y6GB 3RDPA 3IDSA 3TCKA 3KQTA 4DUGA 4EG0A 4YRTA 4U6SA 5C1IA 1KTIA 1F2TA 2V5VA 1A5TA 2WZDA 4BWYA 3OOJA 3LRXA 3GNLA 3V5NA 1TLFA 5EMNA 4KE8A 4X62B 2P0EA 1DKOA 4M76B 3OLWA 2PBZA 4M83A 2Z8ZA 1UJ4A 3W79A 1XZJA 2C9ZA 5COAA 4HWRA 1VJCA 4OD0A 2Y1FA 1JU4A 2DHEA 2KX7A 3I73A 8ATCA 5EJ9A 3CCVZ 3WLPA 4UEOA 3F5QA 3K6RA 2LTAA 4CZ2A 4ABYA 2YFYA 2XVYA 1DC8A 5AKYA 1T2NA 2FCAA 1K83I 2J0UB 4YUZA 3OFKA 1EIZA 3H8SA 2I6XA 3BCHA 3WDKA 1TLLA 2XADA 3E1KA 4HVCA 3AR8A 5LP6F 3AHHA 1B6GA 3O3CA 3AX6A 4Z8XA 3DUFB 2HA7A 1UEJA 5CXUA 2V3VA 2VHCA 2ZROA 4NDAA 4X94A 1XVIA 4RM2A 2VJQA 4N0PA 3WIBA 3OEWA 4HEJA 5AKJA 3VH2A 1Z0IA 4QUJA 4GC5A 3H2HA 4G4JA 2QAGC 3CD61 1UKBA 2ZBVA 3H19A 4B2PA 1T13A 4YO8A 4ZMRA 1V5EA 4L5AA 5D5PA 4C7MA 1QU2A 2F1OA 2ZBRA 2D7DA 4WLEA 2BJOA 5CJPA 2R6ZA 3P5BA 1D6MA 1PEYA 3A1SA 3FCEA 2BI4A 2Z30A 2P28A 1WDTA 3HKCB 3MTBA 2IZ7A 4O4LA 4PBSA 4Q4HB 2A9PA 3Q11A 1MX3A 5I9MA 1GNQA 3C1TA 1Y3CE 1QQ5A 2BFEA 3BK7A 3TTXA 2AFIB 1X8KA 5GV7A 2VDKB 1G16A 2EATA 2PL3A 2WLTA 2ZYHA 4BQNA 5ALDA 5B55A 1VRWA 2JLAA 4MP6A 2VKQA 1W1IA 1UFOA 2GPTA 3GFVA 1T2CA 2R68A 4YRMA 1SN7A 2FEAA 4LY6A 2VK1A 1SIWA 1VQ4Z 3C8ZA 4U7WA 3K15A 4R1LA 5EA2A 4FB5A 2Q46A 1WHTA 2C96A 2F43A 2VAXA 2AS0A 3CPSA 4JD5A 4BPBA 4DLBA 4IYJA 3HP4A 2DAPA 1BH6A 2W6NA 3FWPA 3HSSA 1XKQA 1KEEA 4A3FI 2GLTA 3OOWA 4OFWA 4WOJA 2XTZA 5ARBA 5KYYA 3MCUA 3LQYA 4IIEA 4BV8A 2B20A 3C3CA 4IIBA 4Q3AA 5JISA 1ORVA 3IHKA 3CUWA 4JY7A 3M5PA 1Q2XA 2H2GA 2KJQA 4NYMR 7MDHA 1VA4A 3E7FA 1X0VA 2FVXA 1EFTA 1LPAB 4YRPA 3HNRA 3GKQA 4C7XA 3C5HA 2YJTD 3R77A 1AQYA 1ELOA 5ISMA 4ZYYA 3EPRA 4CGZA 2YXEA 5JFGA 1X7GA 1AA9A 1U3TA 2PLNA 4FW9A 3RUCA 1QG4A 4LPSA 3ACBA 1XVVA 5DXFA 3L04A 4DUYB 4FDLA 4OI0A 4JSTA 1XWIA 4G8DA 3ZI0A 2IOFK 2YZMA 3LVRE 3F6SA 2B4RO 5AXCA 1VDZA 2I33A 4BJ6A 2IZ1A 4LRQA 3W6NA 3QE9Y 2WJJA 4S12A 4EY3A 3GCWA 4Y1GA 4UCXA 2MYPA 3BB1A 1M0SA 4LJ4A 5SZIA 5TXGA 1HETA 5CXXA 3GBSA 4KI0A 3UHPA 3IE1A 4AULA 4ECEA 3H1EA 4PSKA 4GR5A 1VI6A 2LFUA 1ZMOA 5DYIA 3USZA 3Q9UA 1E3MA 3KVOA 3HO8A 4TLDA 3EERA 1BDBA 2HDWA 3ROKA 1GAWA 1ZMRA 3DMRA 2C54A 4UXJA 3V8VA 4BEJA 2UZAA 3EA5A 3HJBA 1U0TA 2PE5A 1E1YA 1N36B 2DPLA 4E7PA 1M8GA 1ZUNA 4ENUA 4Z86A 5DULA 2ZT5A 4PYNA 5KB3A 1X9GA 3O8QB 5EC8A 1J5XA 5KBYA 1Z47A 2FEPA 4RTMA 1RXWA 1UJMA 1NJI1 1S0UA 3DE3X 1A88A 3DOCA 4W5WA 3S68A 3SZUA 4AUKA 3VR4A 4CU2A 1NQWA 5F76A 4DHWA 2RGEA 5A06A 3FTDA 2ZB2A 1RZRD 4IQ0A 2NSJA 1F2UB 1PFUA 2CJWB 2V7BA 4F3YA 4TWJA 3OZWA 1YNOA 2H4FA 2WFMA 4MH4A 1J5PA 4C1BA 5A7GA 1GM5A 1ZWKA 3GPIA 3L41A 1L1QA 3IAFA 1H2XA 1V16A 5IC5A 4B9AA 4AO8A 1UEXC 2XIQA 4Q4DA 3IS3A 4DB4A 1LK7A 3IOCA 3ORHA 1GTL1 2Q21A 1RTKA 1MW9X 4O4IA 5ESDA 2EGUA 5FFMA 3MQFA 3TSCA 2WY2D 4QZVA 2HV8A 2WT8A 4QHSA 2ZWOA 1Q84A 1E5DA 1KZ9A 4FQ8A 3N28A 3DF9A 4KQHA 2AI1A 4N7MA 1EFAA 1UK9A 5I7UA 1UKYA 1H4SA 3DBHB 3DZHA 1EX9A 1XDDA 3DDZX 2O0LA 2HWYA 2QV7A 3ES9A 3LE8A 2QN6A 3NKFA 4FZVA 5SYAA 4B8YA 1SR8A 4W9MC 4ZOLF 3RSHA 3P2OA 4V1CA 2CXQA 1XK6A 2O19A 2XQIA 3TH5A 3AVVA 4OP3A 1CUDA 2PUCA 1Y8QB 4EPYA 2OLEA 5LP6B 1QYRA 1WCWA 5GOZA 2PKWA 1GLGA 2XMPA 4CKXA 1PP4A 2YDXA 2ORVA 5CNKA 3V32A 2PT9A 4M1SA 1QVFY 4WAUA 4BX9A 1XRLA 4TQUS 4BFUA 2ECFA 2QL9A 3E81A 1NV9A 2AF4C 2BMFA 2JA8I 4OV6B 4UEWA 3UO8B 4DCPA 4M7RA 2JGMA 1Y63A 2R4TA 2JCGA 5HVNA 3GCXA 3FMPB 1LZKA 1QIMA 4JIGA 1EEHA 1UK6A 3BA6A 4IZ6A 1I4DD 2LVBA 2R62A 3MB5A 1KKUA 4ND2A 5JIBA 4EY8A 3RJTA 3X1MA 4J6FA 4LYAA 4HDNB 4UUNA 1UXGA 1VCMA 3IBGA 4TN1A 4JVSB 5KWSA 4MS4B 3ND7A 1IY0A 2PKXA 2QTRA 1I94B 2BI7A 4F8YA 3S2UA 3PGA1 4JAVC 2JFPA 4GP7A 3CSUA 3HCBA 4GW3A 1UOEA 1SG9A 3O1LA 3PJFA 3QU9A 5IH7A 3OQ1A 4MUNA 1EK5A 1QUFA 1Y5LA 1GCAA 1R5JA 3WYAA 821PA 2QBYB 3CCQZ 3RTCA 5KYUB 5EWMA 1BRMA 3TD2A 2ZI7A 4TQAA 3BMOA 3OM0A 4RLHA 4XWTA 4H3HB 4G9GA 3RS9A 1X9HA 4DSTA 5K8IA 2B9EA 3S16I 5CFLA 2K3RA 3RU7A 3PJDA 1RWWA 3R24A 5HIMA 5KREA 3HA3A 2WNIA 1V1MA 3WQSB 3V4ZA 2YUTA 1IFXA 2QF7A 4GSYA 4EMTA 1C5KA 1LK5A 3H5LA 1G21E 2IV7A 5BUCA 2CVZA 1FFGA 4O2BF 4NYMQ 1XF9A 1WUTA 3UFXB 2FI1A 4FD3A 3WWOA 1LWNA 3O2SB 4ZYTA 4WL0A 2BZ1A 5CLIA 3UWSA 3PCTA 2BR3A 1UBHS 1PJZA 2V7VA 3Q3IA 4LZPA 1OLOA 1KQOA 2UZ3A 5DIZA 1AHHA 2FKAA 4MRPA 4NAHA 5DM2A 2W2OA 3FKQA 2D13A 4HO1X 4QYMA 4V0ME 2J6HA 1J1IA 5KDOA 3V2UA 2BTOA 3CA8A 2ISQA 2R1ZA 3AFGA 2ST1A 3ENVA 3LLMA 1U3DA 3M3DA 3TIFA 1DRKA 3PLNA 2HWKA 3JWJA 1VP9A 4LQLA 4UZFA 3RC9A 4PWZA 1BCSB 3ZD9A 2C07A 3H05A 2IOFA 3DZCA 4OGWA 4RPGA 2AI2A 4U0KA 3JYQA 3K1ZA 4QAQA 1B76A 5DN6D 3D6HA 1WXEA 5JSZB 2ENUA 2R85A 2H5JA 4PCAA 1JZSA 1Y5RA 3GPLA 2GPAA 4EAAA 4AKIA 3KKLA 1OROA 2OHVA 4IYRA 4C0AC 4LJYA 1DT3A 4NEGA 1VQO1 3UA4A 5FPPA 5LKRA 4B83A 3O73A 3HFRA 4FNGA 3M5WA 2DR0A 4DGSA 5KI6A 3HOXI 3W8DA 4H77A 3OLCX 5FRDA 2CHGA 4QLOA 1RQLA 5F3DA 5JG7A 5K4HA 5LQMA 2IHBA 3IVRA 2FW6A 2HXSA 3D0OA 1IUPA 5J47A 4QVIA 2QNIA 3D4IA 5HCIA 1SBTA 2I7VA 4RC9A 3MCTA 3PXBA 2B69A 4A0SA 3PWSA 1VB3A 1IEQA 4QRIA 3CXCY 1KOJA 4MYSA 2C03A 4GM0A 3TAUA 1EVKA 3X2SA 3NXKA 1TA0A 3GPBA 3IPLA 4HWGA 1Z4MA 2HF7A 3QITA 1NR7A 4GLLA 2NVWA 5I5EA 1J8YF 2K5UA 2BRUA 3D8NA 3ER6A 3HOUI 3QMMA 1SCUA 4BAZA 4TWIA 4MW7A 1TKRA 1Y5MA 2O5EA 1SVMA 4R83A 2XCRB 4AYTA 1SH7A 3QELA 1Q821 4PIPA 4ZU6X 2A9KA 3NT5A 4WKNA 1FTNA 2X3FA 2HJRA 4ZOLB 3T1TA 4DG8A 1QVWA 2J07A 3B7PA 3LYAA 4J1QA 4GQIA 4O0LA 5KOJA 1RBQA 3MTJA 3G88A 5CITA 2JGDA 4IEFB 5DP1A 2C7RA 1SCKA 3IUSA 1VJ1A 4BQFA 4DCGA 1FU7A 2OUKA 1FNBA 3JQCA 3WVNA 1J07A 3ECAA 2XUAA 1JG6A 2O2EA 2PO7A 3CM0A 4LCEA 4N3BA 2CHFA 4FHFA 4ETMA 3VPGA 1RIFA 3D0KA 5IXSA 4QO8A 2WD7A 1QQTA 2BEKA 1GV0A 3IA7A 1AN0A 4MLDA 1NJ6A 3HYLA 4JEUA 2UYHA 2FKNA 3AI7A 5BT8A 3VU8A 3PXEA 1P7CA 2UDPA 1RLOA 3AIOA 1FXWF 1N2IA 5JAZA 4BZZA 5HWSA 4BNNA 1T3GA 2D6FA 2XRYA 1ZGJA 3ENWA 3JQPA 1JDZA 2IODA 3U4CA 1Y1VI 3WB1A 2D5LA 4KO8A 2QGNA 3WYNA 1RLJA 2MU1A 3DCJA 3KAKA 4RMHA 3ESCA 4N6NA 4BLUA 3EAFA 3UCEA 4BMNA 5CYFA 1DEXA 1KRXA 1XALA 2JCSA 3ANMA 3ZN2A 3F98A 4DCTA 1RXVA 3GTKI 1JHUA 3AF5A 2BGUA 3B9PA 4PQYA 3ZQJA 3L6BA 2VAVA 4CM9D 1QQ6A 1DC6A 4EL0A 5L3QB 4EQZA 1VMAA 2I67A 2HCBA 2H00A 2HJVA 2ZIXA 1LQLA 3CEMA 2V1UA 1GD1O 3NPMA 4KG7A 2Z9DA 4YAEA 1RQFA 5BYAA 4M1EA 2V8JA 1J2TA 1QHXA 2QTCA 3BQ9A 1Z17A 4O2BB 4L8VA 2C92A 2HPZA 4UU1A 1T4DA 2OGTA 2XEXA 4PZDA 3KQSA 4GNRA 2F4OA 1PZGA 1J2JA 1XQXA 3KUCA 3MPUA 3TRFA 5G4KB 4EY6A 2LW7A 4R9RA 3CC2Z 3U4QA 4AZSA 5JAHA 4M8LA 5KTYA 3FMFA 2DQKA 2GKGA 3ET5A 2B99A 1ULHA 3NBQA 2NUTA 2E4ZA 3NHAA 1RXUA 2PV7A 2RKWA 4LV6A 3COZA 1PQWA 5KZMB 1DXYA 2EWMA 3VAAA 1T5IA 3FI9A 1XZBA 2CMGA 2HUPA 2Q8QA 1OC4A 1XK7A 4OJTA 4DLYA 2VDPB 2GN2A 1NUSA 4BVLA 4ITRC 2CK3D 2DXIA 2MYNA 4L72A 4EF5A 1LK0A 4OJMX 4QQRA 4HV4A 4DR4B 3FSGD 1DAPA 1AO3A 1FRNA 4HDSA 3ZWVA 1VA5A 3BIWA 4D9EA 4DA9A 1RLUA 4YB8A 2JIZD 4HWOA 1NLYA 2H51A 2HNAA 2GPJA 4GXQA 4NRDA 5T41A 1R18A 4BVJA 5HM6A 4X41A 1HPLA 2P6UA 1O96B 4Z4CA 4QC2A 1Q0TA 4N76A 1IEVA 4G37A 4I3GA 4K81B 4S0ZA 3L7IA 2QT1A 2QPLA 1ULTA 2POQX 3JQFA 5ALIA 3SMQA 2BOVA 3OQOA 1KYQA 1P9LA 2Q7XA 3MOGA 1XRNA 4BNYA 1PKEA 2FQ1A 4YLEA 3OJOA 2A1TR 3E22B 4HFMA 3C70A 3NOXA 2E0IA 3BZBA 3WHPA 5EHZA 4YCNA 3A7DA 3AKZA 3GLFB 1Z5UA 5FLKA 1WV1A 3WKEA 2BBOA 1WXDA 2QKDA 2J41A 1GLNA 2XUHA 4LE2A 4PAQA 4FFPA 2XCTB 1EIWA 2TSYB 4MWGA 1R9MA 2FWIA 1X92A 1PT9A 2P1ZA 2XD9A 3FBWA 3G9ZA 4RIHA 2AN9A 2OR3A 2ZRDA 3MAAC 4JYPA 3RM3A 5FWDA 3KOYA 4LCJA 3H11B 2WR8A 1BU5A 3IEXA 2VBFA 4M1MA 4YHHB 2Y6VA 4WXRA 2NSDA 2X8WA 3IBYA 3YASA 1N2HA 4LQ4A 3R41A 3ORSA 2DGDA 3DXXA 1G2QA 5JE8A 1GKUB 4NHEA 2MSCB 1Z4NA 1ZBQA 4Z8YA 3VX3A 2A9QA 5SZHB 3QJGA 5EIAA 2O7VA 3K32A 2QSJA 2W2NA 3UWPA 2PGNA 1AS2A 2QAJA 2I9PA 1ZPDA 1GNVA 3B1YA 1G19A 2FK7A 3PE4A 4RK1A 2Q4DA 3C3KA 5KYKA 3PFHA 3D7LA 3TLBA 2Y3IA 1CLEA 3BF7A 2FPPB 2O5RA 3DLTA 5FPKA 2HPAA 1DP4A 1E3QA 4TMXA 4Y2YA 2YN0A 2I91A 3Q6MA 4NBDA 3ZJVA 1YI2Z 2X14A 1EK0A 1FX0A 3N8IA 3X3HA 1ZD8A 4R51A 1B93A 3TOVA 2ZKIA 1EWYA 3AOEA 2QU7A 5GJWC 1RAFA 5M3BA 4M6WA 4HTFA 3GLSA 4ENTA 1N6PA 2NP6A 1KQ3A 2DWCA 4AT1A 4DA6A 4PICA 3OLXA 1Z6QA 3PGVA 2MR6A 2CL7X 3PX3A 3VPSA 2NU8A 3S2DI 1OYYA 5K0TA 2R60A 3CW9A 1DIRA 5EHNA 4KO2S 3AKDA 3TNJA 3WLEA 3HVJA 2YVKA 2BDTA 3NBFA 2JEOA 2PZGA 2ZJYA 3OQVA 4CHTA 4B4WA 1B14A 2J9XB 4U6NA 2PZLA 4PAWA 1WIIA 1ZHFA 1JHPA 4E07A 2AH5A 1UOOA 2Z4RA 3AFMA 5DYTA 5I3CA 3FQMA 3ORRA 3PLRA 1O95D 3EVDA 2YQ4A 2AE2A 2A58A 3O9MA 3R7AA 1Z6TA 4JLDA 5G0SA 2R6DA 3KYBA 4UHEA 6ADHA 1ZDMA 4LZZA 3RHSA 5JASA 2A9RA 2G8NA 1B6RA 3FCUB 1EFDN 3K9WA 1SD5A 3HYCA 3ZGVA 4UMEA 1M34A 2CNWD 5CEFA 4BU0A 1JALA 2CLHB 4BMXA 3UCFA 4F3NA 2GF0A 1MA0A 3ND6A 3TTVA 4G4IA 4QDZA 5HKBA 2FSUA 1S2OA 2PIAA 4CUKA 2QJRA 4LK2A 4QVKA 4INOA 3ZH2A 2HHJA 2QVXX 3BWDD 4OU4A 2N75A 4BNUA 1HQYE 2O8CA 1TK2A 2OHGA 1ZJ4A 3QVKA 3VJKA 1E7RA 5B4VA 3FZNA 2GN4A 1H2AS 3TB6A 1MPXA 4FMPA 1NULA 1NBHA 2CD9A 1YBAA 1BDIA 4RY9A 4Y6RA 1SUEA 3OJXA 1UZMA 1WF6A 4ECAA 1A8PA 4QATA 1YHQZ 3CVJA 3PX7A 3KVRA 1R4ZA 1G3UA 3VPBA 1T5TA 4UHHA 1I6KA 4FFLA 3IPYA 4F4DA 1GKKA 3D1LA 4XX0A 4HB2A 4RKEA 4WLVA 3K1JA 1VBFA 1PLLA 1OJLA 2MSKA 3NHRA 4CM7A 2W0MA 3B8HA 1GPYA 1I7QB 5CMLA 3FCCA 3HHPA 4L8FA 3EPJA 1VIDA 5E4JA 4PLVA 1SCJA 1I6HI 1WB6A 1DKNA 3JAMA 1C2YA 1VCHA 4KYVA 1ORHA 2G9RA 3PEEA 4JJ4A 1FOEB 3IUPA 3NVKI 3GPDG 1WY7A 2QRHA 5BVGB 5LOVA 1MABB 4DAEA 4Q1DA 4IFEA 3G6WA 3PWZA 4FYIA 3GP5A 5C4GB 5F7OA 4JITA 1QB8A 3G0DA 1X14A 2YCLA 1VLVA 3L4EA 1IUNA 1D9ZA 2WJYA 2YY7A 5BNWA 1J09A 1QR6A 4MHOA 4JI6B 3ESXA 3SE0A 3T9AA 3DLAA 3ZD6A 1CUZA 5T8KC 3SKXA 4H6PA 10MHA 1VQN1 2C7PA 2AOWA 2G04A 1QG0A 2AXPA 3PUJA 4P7GA 5EVCA 4DNOA 2VTEA 1R0LA 3GVXA 2OM6A 3TQHA 2NUPB 1OIXA 2XHEA 4D9JA 1F4VA 2Y66A 3G2HA 3G7NA 2ZITA 2OYRA 1EDZA 1PNRA 2WYOA 2VK4A 2BMAA 2VDVE 2PKQP 1ZN8A 2Y99A 1F0PA 3CG4A 4M49A 3LZCA 2R6R1 3O0TA 2F59A 3TLMA 1BH2A 2XB9A 2YJ5A 1SG0A 2JMOA 4C6HA 3EXEB 1OHHD 1V7CA 3GZNB 2QJWA 2AX3A 1ZM2A 1V26A 5FOTA 3W2TA 2X77A 4GXRA 4YMIA 2JIQA 1ONOA 3KPYA 1YVPA 3D5EA 4LJRA 1RRCA 1BCRB 2ZYWX 3K4HA 3D8RA 3EHDA 2VF7A 1MORA 1OWLA 1QRRA 3GZ4A 4YIHA 4B3XA 2BGKA 4P4GA 3D5TA 3IX0A 1XAJA 5KX5F 1W2BZ 3VMMA 1EBUA 2VUUA 1IOLA 3TRHA 2C2OA 1UKCA 2YIJA 3SP1A 4B5KA 4YRSA 4Y0VA 1O94A 4BY1I 1V9LA 1F17A 5H80A 1JH8A 2B82A 2NVXI 2ZDGA 1MB2A 1NNI1 3G89A 3HJTA 2ODTX 2XY4A 3G2KA 3HXTA 5I4IA 5IJ9B 4N0DA 2AMJA 1U7HA 2ZR7A 1FX1A 3PNQA 3OF2A 3CE6A 1FU4A 2VLIA 1YH3A 1QH8B 4PX5A 1Z0ZA 1YS1X 3EA4A 1LRJA 2QX7A 3MT7A 5I47A 1GHTA 1QDLB 2GM3A 1EINA 3ETLA 5EMHA 5DNCA 2Y77A 2QL5A 4W5TA 3QPAA 3WK6A 4E5SA 1XP5A 3K0AA 1TUIA 3IL2A 4EOGA 4V24A 2OTJZ 1UXHA 4C08A 1SBCA 2IW3A 3KZKA 4LSMA 2G5CA 3NVDA 4JJ6A 4ND8A 4PHHA 2C7QA 5K4AA 1LX7A 3H0CA 4KFUA 3DMTC 5CX4A 1E1NA 2DUUA 1MV8A 1WCMI 3FM9A 3JYHA 4MR7A 5HBGA 1NP3A 4GYJA 3UJ6A 4QBTA 5FT9A 3VI3B 1HUQA 3U44B 3B52X 1Y3DE 1EXMA 1T8RA 2GUWA 1PR2A 1U6JA 4RZIA 5THXA 4DDHA 3JD4A 4AY3A 3NJ8A 5EEHA 4QYIA 3IR7A 2CC2A 3UT5A 2QKYA 3VZPA 5CYOA 3GLRA 2RBLA 3L7CA 4MV1A 3T9CA 3T5PA 1LC0A 3ZHQA 4CKYA 1NT2A 3JTMA 3VZDA 1NI5A 2FDCA 4NC9A 3AM4A 3TQQA 1FMFA 3I2GA 4KR7A 2W2VA 3EIOA 3EGWA 1D0IA 3LT0A 5AOBA 3WYEA 2JFQA 4NECA 2E4XA 1M5UA 1E2MA 3UOWA 4LMPA 3B12A 2F1RA 2A9JA 2AJDA 4D4HA 4E51A 3OTGA 4TX1A 4F4JA 2PUBA 5AVVA 4HADA 1J22A 1UDBA 1WXXA 4R0NA 5LLSA 1YKSA 3GT3A 1KD12 2D0OB 1K0UA 3FTEA 5HCNA 1CV2A 1D2NA 3UENA 3LUFA 2JGLA 3H75A 3JQGB 4UHKA 3QKSB 3TLGB 2AJTA 3T1NA 1HLGA 1Z2CA 4ZRNA 2BD0A 4QECA 3T34A 2Q6TA 3MCVA 5BP7A 2VPYA 4IUDS 4K6MA 2JARA 3KJZA 3CRNA 1PYGA 1ZK3A 4TVKA 4IDAA 2PGLA 5LQAA 3THYA 1PJBA 3L2OB 2ZS8A 1KGDA 2E48A 1P1IA 3CZ4A 3PPIA 2ZWIA 4G5RA 4KXUA 4S05A 5TPWA 1SCQA 4FSXA 1EJ6A 3RF6A 2DFLA 1NLMA 1I2BA 1R74A 4ZWNA 5THQA 1CBUA 5ALKA 2RGXA 3VSEA 2C1XA 4JLJA 3ER9A 4J8PA 4EH1A 1V7PC 3AY3A 4CODB 2W6CX 4HP8A 3V8RA 1IOVA 2V8BA 2VSNA 3GEBA 3GVCA 3W4IA 2Q2NA 5KWJA 1BMFD 1U8EA 2BMVA 4QDUA 1HEUA 2VP6A 5J5VA 1ZD1A 3Q2KA 4RNCA 4DR3B 1YE3A 1G8KA 4DQ0A 2EWWA 4PCLA 4OX9B 5DV9A 4P38A 3O1IC 3F1LA 2BEJA 1JGTA 4AJEA 3KTFA 2UYYA 5F3WB 3VU9A 3R5HA 2JAXA 1QHSA 1N1DA 5IFKA 5IXJA 4TL9A 3SHTA 1GXSA 1L5OA 4GPEA 3BQMB 4M0KA 5TMDA 3T4UA 3G82C 3K9FC 3KZXA 5AOAA 1OPRA 1JB9A 3L6OO 3EAQA 1PJLA 3N0RA 3FYTA 1RNLA 1UWVA 2OCKA 3KZOA 4GU5A 4EI9A 2QP9X 1L5VA 1E9CA 1R4AA 2GEDA 1DI0A 2AYDA 1IB0A 2ZUTA 2ID8A 3UH1A 5ICCA 4EBFA 1U0LA 3A0UA 4GKAA 4MULA 4AKEA 4S24A 4YO7A 1P31A 1VZ2A 2E85A 4FGZA 3ZIUA 1XQYA 2AG0A 5TS3A 3LC2O 4AZVA 5BMVA 5I7VA 1DWUA 3U61B 3H8JA 4J0EA 3E7DA 1QIFA 4UFNA 2YX1A 2M9MA 2AEJA 2CNBA 2JAUA 2BFDB 2OMEA 2XGJA 3CZ9A 3VTZA 2X2EA 1HI9A 1MLDA 3Q4GA 2C5EA 1MT0A 1BNCA 2CJPA 3AEXA 2VHWA 5FO1A 2Z8YA 4ALLA 1K6IA 2C7VA 1A04A 1HGXA 2VT6A 3PRHA 4KBFA 4N7BA 3O92A 3I53A 1JFRA 2Y9PB 1A9XB 1YV9A 2EXXA 2Q07A 2YZGA 4UAJA 4PQEA 3VHRA 3NAGA 3EK2A 5FORA 2NUAB 5KX5B 3IEUA 3VM6A 5CW2A 1NX9A 4U2EA 1P39A 1Y1SA 2OQ2A 3F9CA 2QM7A 2CXPA 3L46A 1Z35A 3OU6A 2NYRA 3O82A 4DMLA 1N1MA 2H31A 4MK4A 4RA9A 4NCBA 2YW9A 1TJPB 2Y6UA 4B3BA 3BBPA 4XQ9A 5IKEA 3RS2A 3V8BA 4TT3A 1JHMA 1P0IA 1E59A 3KOXA 3EXFA 1KR5A 1KHTA 5AFSA 5IULC 1U0NA 4LZAA 1TM2A 4UPVA 2EL7A 3FRIA 4OOEA 2UZ1A 1JI3A 2JHCA 1V6AA 3DOFA 3LBIA 4FYVA 4OQYA 3ZQ6A 1HORA 4G1CA 2ZYSA 3KXDA 2QPTA 1V71A 1M6WA 5AJYA 4N3AA 1AMOA 1P19A 1YUMA 2Q3LA 3LIIA 2H2IA 1PEAA 2MTBA 3CE9A 4I0WB 3RIXA 1AH2A 2JIPA 5KUTA 3G9QA 4RSHA 1ZIDA 1U0GA 4Z2AA 1D07A 1QVGY 1JU3A 3REQA 4YR9A 4AN0A 1ADJA 4S1OA 2I34A 1N2CE 2JFXA 1E1QD 2IDZA 3FNBA 1N32B 2IYXA 1J0DA 2C2GA 1POXA 3CIOA 4QGFA 1I1OA 4JB3A 4MW5A 4R05A 5BMOA 5HKKA 3HB5X 1YIAA 1XEAA 3HZHA 5E1MA 4DT1A 2IXBA 1JLMA 2FFHA 1UFVA 4JOQA 2DKOA 4YDRA 4H1UA 4PFSA 5CCDA 3ZDYB 4EJSA 3TG8A 1A76A 4QPPA 1ISRA 1FP2A 3SY8A 1Z12A 2GS9A 1RLTA 3TOSA 1MQ9A 5BORA 1GRQA 2DBVO 3OIYA 1UZAA 2JGNA 4V3CA 1DU4A 4PRYA 4AJKA 5BNTA 1XVLA 5FLXf 2V6JA 5KC8A 4BEVA 4C2TA 1KDPA 2B30A 2QRUA 4FFBB 2C1EA 4LOAA 1BU8A 2X76A 5EIFA 5FD8A 4BMZA 5KAPA 4W8HA 3ZXIA 1EFUA 4RGYA 2QNRA 1JIXA 3TNYA 1YQUA 2HY7A 4TSRA 1T43A 3UTCA 4B2YA 2BKLA 3TECE 2ZDQA 3VC1A 2W48A 2GAOA 3L4BA 2GYWA 4G5YA 4YCDA 1PLJA 3PGKA 4Y2QA 4G26A 5JDIA 5IEJA 1XPRA 1N8SA 1ZCFA 5JJCA 1A2OA 2AOUB 5HG0A 1FSFA 3LDHA 2ODAA 1O5OA 2WWVD 4EEZA 3KK0A 4B6PA 5AKLA 4HN2A 3BS4A 4C2UA 2NU7B 1L7NA 3PG5A 3DVSX 3VHQA 3B89A 4BP3A 1G1MA 4A0HA 4LJSA 1PBTA 1V39A 3A4VA 3I0ZA 4FCWA 1HX7A 2OUIA 4TXHA 2ZIVB 3R7FA 2ODPA 5LBIA 4FIZA 4B0OA 2VUTA 4YCCA 2C9DA 3GY0A 2WICA 5LP1A 2G6TA 4MRIA 2C61A 3QKRB 5TGTA 3PUHA 5JATA 4AO6A 4HKTA 4BN4A 1IYZA 2N0SA 2XAAA 3AKEA 1CR6A 3HBFA 1QO7A 1Y1VS 3LUKA 1II8B 4HXGA 5DGXA 1LB1B 2EDCA 1XDUA 3SX4A 3VB9A 1FLNA 1OASA 4TL7A 1T25A 2JBHA 3CLSD 4ZZ0A 3WDLA 5LIPA 1J9ZA 1PR9A 1U0BB 2DP4E 5K4GA 3KE9A 1JKJA 2ZSUA 3AY6A 3GRFA 3FMOB 4JQZA 4L9AA 2VRCD 2WVHA 1E1CA 3KJNA 1ISMA 3L49A 5DM70 1NVUQ 5JRDS 4C7OB 3EXHC 1E3LA 3D2CA 2OECA 5IP7I 1MUUA 1QJ4A 3VMHA 1JECA 1SG6A 2BDEA 4FLMA 3RC2A 4B7UA 3LQKA 4DV4B 4E33A 2Q5JA 3ABRB 4B6EA 4D43A 4X00A 3R9XA 2GA9A 2GFIA 1H69A 3GJSA 4BCBA 5MN5A 3CN9A 2O52A 1HKHA 3DV2A 2V7GA 4NTZA 5CAEB 5I7WA 1BD3A 2XKAA 3AHDA 4QICA 3JQ7B 2NZUG 4OXQA 2YMMA 3FHOA 3GO4A 3RBZA 4D0LB 3NHLA 1K4YA 3EY4A 1REQB 3KOZA 3KSUA 2EX1A 1G5IA 1LNSA 1VYTA 2A0XA 5FA5A 2ABWA 4P86A 2IYQA 2VUIB 3WMWA 1VKHA 5CYGA 4X7PA 3R7WB 1EGAA 1U7UA 3QWHA 5L9AA 4GO1A 5FLEX 2G80A 5JFTA 3AXSA 3WS7A 5DRYA 3QPVA 2QRVA 1DC4A 2MWMA 2BCGY 4HBGA 4XSHA 5B1HA 4AG5A 1PV1A 2C84A 3JASB 2RI0A 4KGDA 1XPUA 2ID7A 1YS4A 3GEHA 3C5CA 3DDSA 3HCEA 2K87A 1JVSA 1ORTA 1XHFA 2GYYA 2C5SA 1AX9A 1STOA 4EG4A 1VKOA 4KXYA 2I62A 5JZ9A 3MGGA 4E1BA 3SBOA 2EU8A 1ZESA 1GNLA 3VNQA 2HA5A 3BTOA 2QS9A 2OORA 3NHSA 4QTYA 3HCWA 5FIUA 4DV2B 3L5KA 3ZV3A 1E77A 4I8XA 4RD1A 3V42A 1MEJA 4BVFA 1B1AA 2ATXA 4K40A 4R9SA 4UFOA<