2H85A

Crystal structure of nsp 15 from sars
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
347
structure length
347
Chain Sequence
HQSLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGESVKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCGCSVIDLLLGDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative orf1ab polyprotein
publication title Crystal structure and mechanistic determinants of SARS coronavirus nonstructural protein 15 define an endoribonuclease family.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 87
structure length 347
sequence length 347
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2h85A01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h85A02
2GTIA 2OZKA 4RS4A 4S1TA 2GTHA 2RHBA 2H85A
chains in the Genus database with same CATH superfamily
5JV5A 3ETHA 1Y9AA 3V00A 3W7AA 4HTFA 3PQ6A 4IDCA 3USES 2JASA 1J2JA 5A6SA 1RVV1 3F9CA 5KTPA 4AZ3B 4DB2A 4G4SO 2Y6VA 1JLSA 1Y8QA 3Q3JB 1SKBA 2H1CA 5BR1A 2ZYRA 4XFDA 1TEVA 3TRKA 1TLFA 4OJMX 2ZLBA 1PJTA 4Q4JB 3ZTYA 1QBKC 3IAUA 3L06A 3ZU2A 2PH1A 2X8AA 3VVCA 4CM7A 3B7GA 5FUXA 4EA7A 3AJAA 4AJEA 1F3OA 3S81A 5IAOA 3AUFA 3NIGB 1SPXA 1T8WA 2IPOA 2IXTA 2JHPA 3P9CA 1VQNZ 3QJGA 2GYVA 1ZAKA 4L6CA 4KR0A 3RODA 3MTDA 1XZEA 4F1JA 3P4XA 3FIUA 1R6DA 4QTYA 4N7MA 4B9AA 1WTCA 2C95A 1I1QB 2WYIA 3ANXA 2V03A 4QTTA 1DB3A 1G21E 3GRCA 3L49A 3SI7A 3ZVMA 4DJEC 4G01B 4KW7A 4A5OA 3PGLA 4U7WA 3LY5A 4JLJA 1K27A 2B8TA 3AQIA 2AJLI 2WVJA 4TKZA 4XD7D 5CD1A 1T8SA 1QP7A 1NG1A 1SA0A 2HA5A 1X42A 2VHVA 1AUXA 3M6LA 4H08A 3RUDA 5CU7A 4DG8A 2VPQA 3GRYA 1OBVA 1OWNA 1YK1A 3DO8A 1VHDA 1ZNWA 1VG9B 3COSA 3PQ4A 4QXOA 1WKVA 2HMSA 5BUZA 2WIFA 2QM7A 3PKJA 3J7A4 2B5WA 3WOHA 4A4DA 3PBKA 2FX3A 2H06A 4NZYA 3ZD9A 4C0QC 4UPVA 2WSMA 2JDIA 5ELXA 1Q74A 2QG4A 2QX7A 1WZCA 1XCJA 3GFGA 1E79A 1CY8A 4JAVC 3DYBA 1GY8A 4W5JA 1KDOA 4KDRA 2AW5A 3I8XA 1E32A 4XB2A 3WQQA 1KC1A 1VQ8Z 3FZEA 2NPFA 1UBKS 4B8YA 4XDYA 4NENA 4MK4A 3K0KA 3BZWA 5AOBA 4QGGA 5CFMA 2A7QA 5ES3A 1HNNA 4HADA 4R81A 4Y2YA 3CVJA 1Q84A 4A8PA 5JEDA 3T3DA 1ATIA 1R1DA 2CMGA 2BTEA 1P2BA 1QHIA 1E2BA 1L8LA 1LUAA 3N9IA 4C30A 4BFCA 4IDBA 3VU1A 1FVFA 2D8AA 1BMFD 3M81A 3KWFA 3KKLA 2YU9I 2HRBA 3FKQA 4LY9A 5K4AA 1MC1A 1MDFA 2H00A 2WIAA 4IS2A 5C4JI 5T6MA 3HOZI 2FUKA 3LTEA 5HILA 2C3OA 5L4LA 1CX9B 4C87A 4WXEA 3CNOA 4AJNA 5KPJA 4G97A 3V3TA 1ZSYA 3QOYA 4D6XA 2ZB2A 2QAGC 1CK4A 2IDJA 1TO6A 3PPVA 4IFIA 1MO2A 4UBLA 1SXHA 2JZNA 1QHSA 2C0QA 2PLFA 2CLHB 4OHYA 1V0JA 2J4FA 3WLIA 3TJRA 1SWWA 3VXKA 2FGKA 3EMDA 3HCFA 3N6XA 3IR6A 1JB1A 4Q21A 4RVNA 1VMDA 2BFNA 5JSQA 2JLUA 4KBFA 4RTLA 4HO1X 1LI5A 2IZ7A 4GLJA 1OX6A 4LHEA 4ND1A 4AWAA 5J2UA 2Z8ZA 3E9ZA 3OX2A 5BXYA 5BSHA 1GNSA 3E27A 1QFSA 3FNGA 1OBFO 2AFHA 5DX1A 1KOJA 3KVVA 4FGLA 4YRLA 1UEXC 1YJAA 1YO6A 2XAAA 2XMCA 1LI4A 4BP9A 4HVLA 3CCQZ 5KOIA 1L4LA 1M1YB 3DDUA 1UPCA 3K8OE 5LQAA 2GM4A 2PMBA 1XZQA 1YS1X 1YU9A 2ZSAA 4O59O 1QFJA 3NDIA 4HQKA 1KEEA 1IAVA 1C9NA 4TNUA 3QPVA 4A8JA 1C30A 1Z8NA 3OIFA 4LN1A 2YJ5A 5E8JA 2AOTB 4IWXA 1RAAA 2HOQA 3HOWI 2BKVA 3IAHA 4G8DA 5FV7A 1DTEA 3W04A 2PYZA 4Q39A 1UBJS 3U49A 3EGCA 1GAQA 3LHFA 1ADGA 4ITRC 1ZX1A 3NHMA 4DCVA 4XVCA 1PSZA 1QQ6A 3PVZA 1N2HA 3EHEA 4DIBA 1DIHA 1F5NA 1X7XA 4MS1B 4BQIA 3ZJUA 3DJFA 1E2GA 3AUUA 4Q12A 3AHFA 3Q7TA 3KYCA 1P2TA 1TZMA 2ZAIA 3L8ZA 2UZ0A 4E3ZA 4KN6A 4JOSA 4WFIA 3HRIA 1GKKA 2WA2A 2BV3A 4LCJA 4E5PA 1FTYA 4AS1A 5A06A 3E3NA 2CB9A 4OMDA 4TL8A 1I24A 3L1UA 1GYQA 4GPZA 2Q7OE 1A5ZA 1M54A 1VBKA 3VDQA 1KK3A 2XE7A 2MSNA 2OESA 2WIJA 3A4LA 3A6EA 4YRCA 1QO9A 2VK1A 2JIMA 4BBSI 2PH3A 3PTAA 1JN0A 1RLIA 3ZWAA 3W9BA 4FEGA 1H5QA 1O5TA 2RHLA 3DFFA 1XTSA 2ZBQA 2NZJA 3I1FA 3E15A 2PLNA 4D3DA 4EARA 1K6EA 2GA8A 5IN5A 4DMGA 1BS1A 4XRRA 3O1IC 1XLTC 4E03A 3HFGA 2JI6A 5FO0A 3PFGA 5MN5A 1AKVA 4EB0A 1QIEA 2ZATA 5DLEA 1MX9A 4MA4A 4BFLA 1BQ4A 5LYJB 2OCGA 3MWEA 3R3YA 2X0FA 4E5NA 5KNBA 3L7KA 5KX5F 2ZUDA 4KFRA 1XPRA 3NI2A 4ZYWA 2RH8A 4I1OA 3G6EZ 2QMUA 2RH5A 1QFYA 1TA9A 1WF6A 2VUHB 1QTQA 1ZD8A 1GQSA 3H0GI 5D87A 3L8FA 4IQ4A 1A9PA 4XB6B 1JRLA 2QKDA 2DR3A 3R9WA 1U02A 2MSDB 3A06A 2G1JA 4FD2A 4WASA 3A25A 2NZXA 1HX7A 1FSSA 1GQQA 3GA5A 1SB9A 3R0VA 3E8SA 2KJQA 4D3ZA 4XZ3A 3OT4A 3ZHOA 4FINA 1U2PA 1WKCA 2BMFA 2P2LA 7MDHA 3EPJA 4UXJA 3G59A 3TTYA 5B3AA 3LFHA 2CWDA 2HJSA 3OKAA 4HJRA 1EJ0A 1HSOA 2I6TA 1VQ41 1JZTA 4JLKA 4QFBA 1GRRA 4BCBA 3G5UA 5IJAA 2Q1WA 1YNSA 2EBUA 3SLRA 4TWAA 1LPMA 5C5EA 3EUEA 3UWMA 5K2MA 2ZCVA 3MINB 3QXXA 1Y6QA 2R6ZA 2GZ1A 3WLAA 1OU0A 4LTMA 4AMUA 4XWGA 1JTFA 4GC9A 3VR3D 4ER6A 4ARIA 3E82A 3L7YA 4URFA 2YN0A 3I53A 2J3MA 1SCNE 2X7HA 4HLUC 4Y6QA 1Z2NX 2QPAA 4AM8A 1GPMA 1A5BB 1PSWA 3AILA 4QPJC 2O14A 2KPIA 3IP8A 4E51A 3QLTA 4PAQA 1W96A 4C2UA 4HNHA 4PO9A 2LKDA 2R8ZA 4I50B 3BHJA 4XYBA 4B3IA 3MT9A 4Z49A 2X0JA 1EESA 2DOKA 3WKBA 2IYOA 4LDRA 3AF1A 3I12A 3H1GA 3FRIA 4LRQA 4MAFA 5IVPA 1C81A 3FTCA 4ZV7A 1JHOA 1JLHA 2W2XA 4LZWA 3WG9A 1ZUNB 3P2JA 3UN1A 2WEKA 1BWPA 4Z2AA 3GFOA 3LT5A 1X92A 1I4LD 4L74A 4DM4A 2Z4SA 1S3IA 1PWYE 2AS0A 3JQAA 4TXHA 4UAUA 5K6AA 1K2VN 3U6BA 1SUSA 2JHAA 4PLVA 1BZYA 3KKOA 2P90A 3WDSA 2JG3A 4JJGA 2QY9A 3BRQA 4HDNB 1JPNA 4JKIA 1NV9A 4UQLA 1FPMA 4AS2A 2GI4A 3K7EA 2Z6QA 4UQOA 4OQFA 2ZVQX 3TRIA 1KGSA 1T1IA 4BLOA 2ZZMA 5M29A 4O08A 4MGKR 4KVZA 4M98A 2MSCB 3GLVA 2NV6A 1YJBA 1CUYA 1L1OC 3FFWA 4K6FA 4C14A 3O4FA 4OQPA 3OFND 1OA1A 3DVSX 2RK6A 2VQDA 1AUPA 2HA0A 2WJPA 2X7JA 3E9RA 3KZNA 3MVEA 1YIT1 3BEOA 4FYXA 3PLAE 1PT7A 1Q50A 1JJVA 1QB7A 2W6QA 4RVCA 2Q45A 4MRRA 4Q82A 3FZYA 1ST2A 1V16B 2CXPA 2RFLA 3U39A 2CFRA 3ETJA 4KVAA 3HBMA 3DZFA 3EXHA 2RGEA 3CKKA 3PEVA 5FBQB 2PXAA 3T7CA 4E1AA 2BEWB 1UANA 3G2NA 4DIMA 1U0EA 4MPTA 1DJNA 1XA0A 2PJUA 1D2HA 4WZAB 3PQ8A 4CQMB 1CF4A 3BWYA 4U8HA 5LZ9A 2ONJA 1G2QA 4M8LA 1X2EA 3KOXA 1IN8A 3N87A 4DA8A 2FDCA 1Q0QA 4C01A 3BWCA 3TXAA 2PZFA 5T8KC 3ZV5A 1PSDA 3PHCA 1DELA 2XNCA 3W2EA 1P0CA 3CUKA 1LPSA 2NWQA 2QD3A 1PD0A 3PR2B 4FR0A 1KZ1A 1BDMA 1VQ9Z 1QAMA 3GPDG 2Q1XA 3ISJA 4LY6A 5FFFA 1J56A 2HF8A 2AMYA 1GILA 2AT1A 3Q9LA 2KSQA 4A3JI 5AQ1A 1EVYA 3JAKB 3NNNA 5BOVA 3SM9A 1MHPA 1MABB 4ZALA 4JLUA 1VE9A 2GXSA 3P94A 3VX4A 4KMMA 1JG7A 1A97A 5ALTA 4POOA 1ZRMA 3BGSA 5BSKA 1USVA 1I36A 2QBYB 2GCIA 4NCHA 1MC5A 3EGXB 4ZVKA 4ZQBA 4QRIA 5IMSA 2VUTA 5KWJA 1TRKA 2GETA 2JLZA 3VDRA 3BDVA 4K2AA 1SUCA 2XQKA 3VOAA 2NZVG 3QXHA 3H8VA 4DABA 3HXTA 2VNIA 4BWVA 2VAXA 2QR3A 1L3CA 1E3JA 4HH1A 3AX6A 1GLGA 4DHWA 5JS1A 2LIVA 1O9HA 4OMUA 5H9VA 1D3AA 5IXJA 2Y1DA 4I4IA 1XMVA 3OT5A 1NXSA 4TMXA 3HP4A 1IMJA 3SMQA 2NT3A 3I34X 2AN1A 3KR0A 4XYEA 4HXEB 1BSVA 2GN9A 4NZNA 1IY8A 2K6GA 3GGJA 5FTJA 3WL6A 5E3JA 4BDTA 4DV3B 4WRRA 1N2SA 2KX7A 1U3DA 2WLSA 1QF7A 2P2DA 3C7AA 1ZJ4A 4GP9A 1R74A 1A2BA 3QX7A 1V3TA 3MZ0A 2OO3A 5IP5A 3EWAA 2EGHA 1OH7A 1L4YA 4XUDA 3ZX4A 2F8MA 4H9GA 4XVUA 1CULC 1N2FA 1S0UA 3AB7A 3MWDB 1G8AA 4OXQA 3PA8A 2GBLC 1R8QA 4OGKA 4WWHA 3A11A 5EIHA 4W5OA 2VPWA 1D1QA 1QGOA 2HDWA 3ECCA 3JVEA 1JF8A 4Q00A 4BPRA 1QLHA 1UK6A 1E1LA 3QRWA 1ILWA 4KITB 3CCMZ 4ENUA 3TFWA 2W0MA 1Z5VA 3L4KA 5D86A 1GRNA 1MR3F 2D59A 4L85A 1N7GA 4DIOA 2A9PA 2AA3A 1M1NA 3LCRA 4YCCA 4D0SA 1DIGA 2H85A 1Y0BA 2ZK7A 4P81A 5KVAA 3TGPA 3H6HA 4DLAA 1Q7GA 2DU8A 3PL5A 3ZDQA 2O2SA 2O2DA 2WK1A 3KYBA 4UCFA 3REQB 4B0PA 3LVRE 2R3SA 4RK1A 1GL9B 1YUAA 1YFZA 1EFRA 3OH8A 3ECSA 4O0LA 1L9KA 3MTIA 1R10A 4YRJA 1QRTA 4DCNA 2EJVA 2I99A 4MGHA 2B8NA 2RHGB 3FWYA 5KX5A 3KQHA 1E2EA 1DG1G 2WMDA 3OECA 4UHBA 3BIXA 4V0KA 5TPZA 1RBZA 2ZQ5A 4QATA 2IV3A 2F1HA 2ZRAA 3A4IA 3NUGA 4DIDA 3U1TA 4E12A 2OZPA 3O21A 1JLLB 1HDRA 3KWJA 2K87A 4MQEA 4OQMA 4PZLA 4REOA 4BJHB 1UADA 5CFRA 3ICEA 3F90A 1CRLA 1MC4A 3MJTA 3TIXB 2AXQA 1Y8ZA 4LZAA 1Q6YA 3A10A 3NALA 3U7RA 5HQ3A 3OD1A 3HV2A 1Y1TA 1X9IA 3TCKA 1JWHC 4ZDJA 7REQA 1NFRA 4IGAA 4NEGA 4Q9DA 4YB8A 4LXIA 3DZBA 4YLGA 3KJZA 1UDCA 2PKCA 1BQEA 2I6UA 3IE2A 4L5CA 1U8TA 4J3NA 3B3QA 4KNWA 4MYSA 3BT7A 3DMTA 1ENOA 3SYNA 1W29A 4YDHB 5BT9A 4IEEA 5AUNB 5KIAA 1L7BA 5GIOE 1G8HA 1H4SA 2G08A 3IQXA 4BLPA 3UB3A 4O4JF 4RORA 4DM7A 5IJ0B 1I2ZA 2RGNC 4L8GA 4N8EA 4QNNA 5LP6F 1PLLA 1KH2A 5IF9A 1OLSA 2V59A 4MVJI 3S1AB 1FU7A 4NZZA 3PXEA 3TZKA 3GT7A 1W1IA 3G2QA 3AVTA 4TROA 1O96A 2I6SA 1UMKA 1KTVA 2C7BA 3KX2A 5A0FA 4IX9A 3VZSA 3P4UA 3L7JA 3THRA 4CM8B 1I3KA 4DR5B 4PE5B 1AD2A 1Z6GA 4LJAA 1K7SN 3USZA 4LG1A 4QQ8A 4DSZA 1VQK1 3CIFA 4GWKA 3THYB 4F7DA 1TW3A 4DC1A 1JBEA 3WZ2A 3TZEA 1IXKA 3KHTA 4TVSA 3RTCA 2ONCA 1ZNZA 1G55A 1UJCA 4IGEA 3RYIA 1DAFA 3VVLA 4ZTZB 2YR0A 4GOLD 4UOZA 1PJSA 4GEKA 2C59A 4RTNA 2VDRB 4AC9A 1H93A 1KY2A 2BHTA 3A9SA 3PTLA 3B3FA 1SOAA 2MSLA 2IZ4A 4XCVA 5CD9A 4EG1A 3AVPA 5GJVC 1AY0A 2ERXA 3B9BA 4TQGA 4DLZA 1KF0A 1OOEA 1SO8A 4EY4A 3PPWA 2OSVA 3V48A 3HBAA 2OFPA 3R7NA 2HGSA 2EQ5A 2ISQA 3NVKI 3NH4A 1P0FA 4KI7A 1DC4A 1RHJA 2J3DA 2K5RA 4AMBA 4WNAA 4C4SA 2HIGA 3S8YA 1NBIA 2V7GA 4OGGA 1O6GA 4R40A 4KSCA 3ZX5A 5CP8A 3VNAA 5L95A 1QE0A 4EUFA 1J1IA 2ORIA 4CCAA 3I2YX 1YVDA 1XAJA 3CKYA 4L50A 4JIMA 1QGDA 2P62A 1EK0A 4JBXA 4TVOA 2XMSA 3CLRD 5DNAA 4BB9A 4P0PB 4L28A 3PD7A 5J2TF 4XEUA 3S2HI 2HL6A 1FTNA 2O8VA 4QC2A 5DJ5A 4ENWA 5HIAA 3ZVKA 1EP9A 3O90A 2Z3VA 3WRXA 4G0VA 4GSYA 1HWYA 1CBUA 5B4TA 2HNAA 4G5FA 5JAZA 3WWYA 4H3SA 6CHYA 4WBNB 1LEHA 3NVMB 3P0EA 4HMOA 4YJDA 1LY1A 5KCZA 1CY2A 1UK9A 1W76A 3D6AA 4NOLA 1SUPA 4PGGA 4DCMA 3I4MI 3PHHA 1Q1QA 5EOVA 4XYGA 5GONB 1YB7A 1KEWA 3U40A 3VO9A 1E60A 4Q3EA 2AD5A 3GJTA 5F78A 4DW8A 4P98A 2VH1A 3QWUA 3IEMA 4NCAA 4Z8XA 5JXHA 4I2NA 5LL6P 4FDAA 3BF8A 4RH0A 5JC1A 1WMEA 4UNQA 5C32A 2RC6A 2JGKA 1VPVA 1ZN7A 2WHEA 1N5IA 2G5CA 2XMDA 2YWRA 2Z04A 3S28A 2FEOA 3OU6A 4YQYA 1YI2Z 4QDJA 1FDWA 1I4OA 3IUPA 4MP8A 4PG5A 5GOZA 5JS2A 1QWOA 4CKBB 4BRZA 3DDZX 1VCOA 2R6DA 4V24A 4A3MI 4GPEA 4BX9A 5PNTA 1KSFX 2CC2A 1UBSB 2G70A 1OX5A 4OQDA 2A4MA 1YV9A 2WJ3A 2YS6A 3IUJA 4FMCF 1OPXA 4UXIA 2QG6A 4PRLA 2HPVA 2JGNA 1QGYA 1NJ6A 3IJPA 2BM0A 2OKGA 3EVTA 1HLPA 2FN3A 2BFDB 5CIQA 4LYAA 3UK2A 1M2JA 1REQA 3O8OA 4HNSA 5COBA 5EUMA 4O6VA 2EJUA 4ETMA 4DJTA 4N7BA 3ICOA 1U11A 4NECA 2Q7XA 1F4VA 1KI1A 3HUDA 3IPAA 3EZLA 2M1XA 2RBGA 3DXFA 4LVCA 2NTEA 3AL3A 4HHEA 1U0FA 4OMFG 5ICGA 3GFVA 1AURA 1X9GA 4NLLA 4PXYA 3ZZNA 1OWOA 1YJQA 1FDSA 1XR3A 2M2IA 4E6PA 1XD8A 4M4SA 1SCDA 5DN6D 2IZOA 2G72A 2PU7A 1EP2B 1XE3A 2Q5CA 3VKVA 2QREB 1J9GA 2WVHA 3H9BA 5GINE 1BWSA 2JHCA 2QYTA 2XMZA 4HOYA 3OCVA 2VBFA 3HWRA 5EJ9A 3PC6A 1DAIA 3WV4A 3KV1A 2F9FA 5M7EA 4LHVA 1B6SA 2NUTB 2VJAA 2WTBA 4IVQA 2LCIA 3DVRX 4WJKB 3K0AA 1Z22A 4PO3X 3SIXA 4C7MA 2VKQA 4ZV4A 1KK1A 1X3SA 1J8DA 2E2WA 1G6KA 4GKBA 2ODEA 3P5SA 3HKDB 1P8AA 4TRNA 1M2OB 2W6ID 4LHSA 1G66A 2AFIB 3M9XA 3OIVA 1PR4A 2F4MA 2CLMB 4YUZA 1G9XA 4YDQA 2A0YA 5HFAA 3A1TA 1R6VA 4BNDB 4NBKA 1QDUA 5DHUA 3CVXA 1EUDB 2X0RA 4TS9A 4AO8A 2HTEA 3V4RA 3A6KA 3T9DA 2XYVA 4TT3A 1BE6A 1I7QB 2OZEA 2W9XA 5CT5A 4P7BA 1GG9A 3FI9A 1Y8RB 3TZLA 4NMHA 4X60A 1Z0JA 4NCIA 4RHEA 3TLAA 2XT6A 1HT2E 3BD9A 4F3RA 5JRJA 1ENPA 2IUYA 2VT6A 2WM3A 4YJ3B 1GRCA 3A6PC 4FHGA 1VKRA 4JU8A 5CYGA 1YAJA 1XZAA 3OZRA 3GGSA 3H19A 4CW7A 3LT0A 3VR6D 1Z7YA 3VR5A 1R5JA 4IUBS 3RRJA 1UJ4A 1D2MA 2R1UA 4V39A 3I4CA 4U7JA 3IXQA 3C6KA 3LRPA 4XJXA 4MEAA 4DV4B 1RI3A 4PAWA 2OCPA 4YAEA 3JSAA 5C8YB 2V0CA 3HDYA 5AVTA 2CT8A 3PNMA 1QQAA 1I7PA 1W88B 5B3JA 3I9NA 2AG0A 1YS2X 1Q3TA 3NFRA 4IVPA 2AG1A 3CKMA 5I7FA 1VQ71 1X1AA 2EFGA 1KSHA 3PXGA 3RYFA 2I91A 3T7SA 4JFRA 5EWJB 3T34A 4F6CA 1AQJA 5B36A 4MGYR 6ABPA 4D8TA 1BVRA 3PYLA 4AN0A 3OP4A 2YVAA 1M0SA 2H2IA 2I4NA 2JIDA 1O6FA 3NHWA 5DH9A 2PMKA 3M3HA 4S1TA 2DE5A 3NTLA 4DSAA 3V1YA 2QW1A 1UEJA 4L95C 4OBBA 3EFOB 5LP6A 2C4KA 2X40A 2VJLA 4RS3A 1W581 5JYDA 1ULAA 3ZU5A 3CUYA 5E95A 5CFPA 2ETVA 3AVYA 1AV6A 4B44A 4R2HA 1ZMBA 2QW0X 4ETWA 1UWCA 5MHTA 3EBPA 1CS0A 2R7ZI 1B3BA 4JYMA 1ZH6A 5GWXA 5JE8A 3ZXSA 3BXOA 3GZJA 4YRQA 2WU0A 1L1FA 1AGNA 4W5HA 1JR2A 3RWMB 1G5IA 2BWJA 2ZB3A 2IUSA 2YNMC 4DCOA 3JZIA 5EGSA 3IA2A 2RCNA 1VE6A 2YYSA 3VZQA 3BIOA 1G5PA 2PQ0A 4YAUA 2XGMA 3VDXA 3LO5A 5FH9A 5IKOA 5D8DA 1TAQA 4MYDA 3S99A 2DXIA 1VGQA 2IYZA 2WU4A 4GLLA 4KBGA 1X8XA 5ANRB 4QPPA 4D4KA 2WJWA 1JHAA 1TM2A 1AZTA 1LPNA 1U5BB 1XN1A 2B34A 2MMCA 2ZWVA 4FZ5A 3WBJA 3WYAA 4C43A 5ALXA 5TMDA 1PW7A 2OCLA 4F5ZA 4ZT3A 5BV8A 1HG0A 1Q0RA 4H7HA 3RM3A 4M60A 3RVOA 4PTZA 3EC1A 1C3VA 2ZQZA 3Q0EA 2L19A 1VQMZ 3OZ7A 5EEHA 1SCAA 3F96A 1QIGA 2FPMA 2VJYA 1K731 3B5JA 4LSMA 1VQ61 1LBQA 1ODJA 1FK8A 1PR3A 3F78A 4IJMA 5J43A 3VH4A 1C0PA 5D2CA 1EIWA 1Z2DA 2QR5A 3EE6A 5F2KA 1ZDMA 5J2TA 3B2NA 1VQ1A 3LC7O 5TMEA 5KYNA 2H07A 2DPXA 3Q0IA 4OD0A 4OQEA 2BEKA 4PNHA 1VHJA 3T0IA 4LJRA 4EW1A 3F5SA 3ESCA 3MTQA 4OA5A 5T41A 4AQDA 4YYZA 1OY1A 1OXUA 4WUVA 5AW0A 5L3VA 4EYEA 4CLOB 4B8WA 1J8MF 1UT6A 5K3EA 4PHGA 3ESQA 1E1MA 4RGBA 2RHBA 3A4TA 1VL1A 3G5MA 4BEWA 3D6FA 4LC9A 1QG0A 1CF2O 3VTZA 1NRIA 4O2BB 1LNQA 1W94A 2O7SA 2CWWA 3HFSA 4MP3A 1RHKA 5EA2A 5FHRA 3OAAA 3DPSA 4NABA 2WBLC 2YC2C 4AJLA 3AG6A 1UBHS 3ND9A 1CTQA 2NOAA 4KQXA 1M2VA 3D3JA 3NHRA 4PGFA 2F59A 4DR6B 4J0IA 4BVLA 2BGGA 4AD8A 2IZ0A 2PGIA 4NATA 1EE1A 1HYEA 4OUDB 1YR2A 3ETCA 3ZU6A 3BICA 4TMWA 1WO8A 3QA9A 4CU2A 4EFDA 2DWOA 5HP4A 1C50A 4WUTA 1A3CA 3EMBA 2D4HA 3QLJA 5IC6A 4YP7A 1O9BA 3IHTA 3TB4A 3WWOA 4AJKA 3AXTA 4MW9A 1SC6A 4N54A 2EQAA 4PBRA 1D07A 4JI1B 4BP3A 5AHKA 4X92A 4PRYA 1D2CA 3MZLB 2Z8YM 4OBEA 1HOXA 1I5RA 1AA9A 2VDJA 4FHZA 4FQ5A 4HWKA 4Q4AA 3K9FC 1F6WA 1Q1ZA 2DAPA 4DLRA 3I2HA 4G24A 3IAS6 2VF1A 1O2DA 1N2CA 1XDZA 3CBQA 2X3YA 3IKVA 1IHOA 3LSTA 3PUXA 4QO8A 4X84A 1SFRA 1EUCA 4B8ZA 1QWSA 4IO0A 4MO9A 4DDVA 3Q3EA 1KZ4A 5I7UA 3DGFC 1E0JA 1YR6A 3G17A 4JN6B 4B6QA 5KNDA 1LRLA 3K9CA 3S40A 3UMRA 3USCS 1EINA 4EA6A 2V7BA 4GM0A 2WG1A 3SX2A 5F2NA 4MW1A 2D2FA 1GDHA 4N5NA 3DYVA 4QQRA 4XXHA 3L7BA 2DP4E 4DDWA 3A3KA 4BU1A 4DR2B 2J48A 4HJXA 2XXJA 2G1UA 3R5HA 3T0GA 3GMSA 1ABEA 4AU1A 4KUGA 1SCUB 3HEBA 2C9YA 1NMYA 3GLRA 1P2SA 3DM9B 1QVWA 3EVEA 3ED1A 4M1QA 4TN1A 4Y52I 4RH3A 3T1NA 3JALA 4BO8A 3DT9A 1IXZA 1M7HA 1SXJC 2P9QA 3OM9A 4B7XA 2Y1EA 1M74A 3CNNA 2VZEA 3N5KA 3LPLA 5LDDC 3QEJA 4MW7A 2RARA 1PU2A 2WYOA 4MJ7A 4XASA 4PF1A 4CMGA 3AP1A 3RS2A 2G17A 2R7KA 1P9OA 3DEIA 1SUWA 1QUEA 3OW2Z 1RQRA 1QJCA 2I54A 2OHFA 3IIJA 3V1KA 1VLVA 1W73A 1QOZA 1D2NA 1F2UB 2B99A 3HMKA 4BZPA 4JUDX 4OXXA 3EEBA 2V8KA 3UKJA 4Q1CA 2C58A 5IVKA 1ZGJA 2FJPA 2QZJA 3H3FA 3KE9A 4MKGA 4MV7A 2QRVB 4I4NA 1MH1A 5IF3A 3HJFA 4RVHA 4B4WA 4B7CA 2B8WA 2IYSA 1YDMA 4EDHA 1WVMA 3FPCA 4EHLA 1Q0PA 5HKKA 2UYQA 1RO4A 3R7FA 2CV1A 2A84A 1GTZA 3KTOA 1RC8A 3KYDA 4NF2A 3C6QA 2A88A 1JU4A 3FLAA 2VP3A 3IR7A 1A4IA 3HI4A 3OZAA 3PX2A 4BRWA 1P8JA 5FI5A 2H8KA 4DKJA 4DFDA 3H18A 3WDLA 5K8CA 4XPIA 5C4GB 2OCKA 2ZEJA 3RNLA 4FBLA 4U6NA 1Z16A 2PGDA 2TYSB 3F8TA 3U7QB 2WR8A 5D1PA 1PKEA 1SBQA 5MN6A 3N6RA 4N8SA 4OTZA 2FVYA 4Q4DA 3I8SA 3JD4A 1FFBA 3KFXA 5SV2A 2QTAA 4S2EA 5C5DA 5JY1A 5D7BA 4MV4A 4C4PA 2O48X 2R66A 2I8AA 3LX8A 4MV8A 5DRTA 3CX6A 5SZIA 1YJW1 1E3SA 4FEEA 2JS7A 3CBGA 2OXCA 1L5GB 3TQQA 1HTTA 3QPDA 4GZMA 2QNIA 4OHWA 4DANA 1TC1A 2A1IA 2NYAA 2I6QA 4HFRA 4MA0A 4NULA 4KSBA 5CXSA 1A5AB 2Z2XA 1BN7A 2PUWA 1U7TA 2H48A 4ZWNA 2AEJA 2AD1A 4K7JA 1YQDA 1G16A 2BZ1A 3K5PA 1VA4A 1K9M2 1S2LA 4V02A 1FDRA 1SOUA 4HD8A 1XEXB 1IJKA 2QN9A 2Y2UA 5FPSA 5KSPA 5JXJA 2E3JA 2JLAA 2B5OA 3VU9B 1TWAI 3D54D 1V1MA 1HTBA 3QF4A 1W36D 3P96A 1JQKA 5EIFA 2H8GA 2JRCA 3GNLA 3FNHA 2QLTA 2PL9A 2XKAA 3CH5A 3HJHA 1FUKA 1NWHA 2W4IA 2X2FA 1DCTA 4OX9Y 4XWYA 3S1RI 2BSAA 4CMIB 1ND5A 4PHFA 3CX8A 4R0NA 2GRUA 3KUUA 2BBWA 3CYFA 1KSGA 4YRNA 5E0OA 1TCAA 5GQSA 1QIFA 3VI3B 3W4JA 2VTVA 3N2GA 2ZB4A 3OF5A 3C6ZA 3OJFA 4WY2A 1PG5A 2IP4A 5K3SA 5CHEA 4MQUA 4NFLA 4HNAA 3MJHA 1MW9X 3A4VA 4X44A 3D7NA 3MK31 1YR8A 3QYFA 5AW7A 2NVOA 1NSYA 3KU4A 1GQYA 1WHTB 4PSVA 3H8WA 4WCDA 1UEIA 1G21B 2F67A 1MV8A 1M0EA 1J0DA 2LR0A 2IUUA 3EPHA 4F4FA 4IP0A 3I30X 1AVTA 1E77A 2I87A 1J22A 1M1ZA 1K97A 1F4LA 4WCVA 4FE7A 3IOBA 4Z3KA 3MZKB 1ZI9A 3TTXA 5EXEA 2AI2A 3D8RA 2VBCA 1E1DA 1XFAA 3H4TA 4B75A 1Y4ZA 1V7QA 2OQ2A 1NN3A 2Q3BA 4CEJB 1VJDA 1ZS9A 1KZGB 2V74B 2NZYA 3WSVA 5AVXA 1FDOA 2GZRA 4DBZA 1WMDA 2K7FA 4I55B 3HP7A 2TECE 1SHKA 1E1QA 2VUMI 5G40A 1NGSA 4XX0A 2FLKA 5KYXB 1C4WA 1KAMA 3IMCA 4UDXX 5HM8A 2DERA 2B7CA 1JALA 3MRXA 3X1ZA 5IZCC 1I1HA 2OTL1 3E8XA 4ZVVA 3K32A 5LOVB 1SU8A 1V9LA 2IUFA 1VRCA 2PX4A 1LJ8A 2VIIA 3EXEA 4HSEA 5CT6A 3SR0A 4UBJA 4BMOB 3H2JA 1ZH0A 2UYHA 4E5MA 1XD2B 3NKFA 1YKSA 3O4IA 2C5FA 4RIEA 2Y71A 2Y9MB 4JQZA 2FN4A 1N5JA 3H5IA 3JWJA 4XVQA 4QLBA 5INTA 1ORWA 2O8DA 3JR3A 4BX0A 4FFPA 4DMKA 5EXSA 3RS9A 2NUAA 3N8HA 3QKRA 2PLWA 1CIVA 1G98A 1G4HA 2DECA 3OPVA 1JFLA 2GPJA 3BYZA 4RIGA 1Z13A 5HJ2A 1IONA 3IP1A 3PSHA 1E8DA 2Q21A 2PVPA 1ZNYA 2FRXA 3CF4G 3RHZA 3WY9A 4DNPA 4RY0A 2W90A 4M46A 1GQ2A 5AI9A 5BSGA 3THWA 4ZI3A 3K0HA 2YYZA 2Q1SA 4CETA 4XIFA 3OQIB 4MKRA 4PC6A 4GX0A 3VPAA 3ZBPA 4PNEA 3IFUA 4EEXA 2PQMA 4C4XA 5B7PA 1KRWA 4UTZA 1EJ2A 2QMQA 1WL8A 1J0XO 1D4FA 3RAJA 1C3EA 2VTKA 3IO5A 3UNXA 3KALA 4BEVA 1N8SA 1A9YA 3BRSA 3Q6MA 5JJBA 4NOZA 2GF0A 2XEXA 4XRGA 5LBTA 5IJXA 1EFVA 5HKOA 1E9RA 1ZA2A 3V46A 2ERCA 3PGA1 2LFUA 2CF5A 1H0RA 3UY4A 4AKSA 1N0HA 2GX6A 3C3CA 3KB1A 3C1AA 3BGVA 3GQVA 3K1AA 4XM1A 4B3SB 4NYMQ 1NN0A 2PFGA 2QAGB 4V2IA 2A59A 2PR2A 4HRAA 2OV2A 1PFWA 1TFUA 3GTKI 2PO5A 2WU8A 3H2YA 5UKDA 1ESNA 1NKSA 4EGSA 1NW5A 3EZ7A 5IBCA 3EX7C 1Y81A 3D9XA 3NVAA 2GEBA 4JD5A 4R9UC 2OK8A 1ZG3A 2QE7A 4BQRA 3QNUA 4H4CA 2BUCA 4E2WA 3DF9A 1ZRSA 5JH7F 4BQPA 2OD7A 4X1IA 1DRWA 2F3UA 1I3MA 4S1VA 4EY7A 2F6RA 3AV3A 3DBHB 4CF7A 3A7EA 5J58A 4TXNA 5K0CA 4N1AA 2VJPA 4C06A 1B6RA 4K28A 2HBZA 3QHPA 1XKXA 3FWPA 1NXOA 5HE9A 2ECOA 2BELA 2F3SA 5I7WA 3CMA1 1W8IA 4YQEA 4ZKEA 4TUYF 4DJFC 1YJN1 3LZCA 1N9GA 4DSUA 2I7DA 4JCCA 3IDOA 1MLDA 4I4CA 1Q92A 4RULA 3EC7A 2CCGA 1LRKA 4RSHA 1U2ZA 3E3MA 2YHAA 3T95A 1RM4A 3QBVA 3WGLA 5BXQC 4KR7A 1V37A 2DPMA 4KC0A 4PWZA 1LW7A 3DLPX 1VSQA 4MQ5A 2XNDA 1IM2A 2E85A 4QG7A 3QW2A 3FYHA 5TY0A 3G7SA 1UAGA 2Z2ZA 5EMNA 2FETA 1YFKA 2IZ6A 4FMPA 1IM8A 2YINC 1U1DA 2WD8A 2Z98A 1DTWA 2ZSEA 3FOAA 4YC7A 4JYAB 1XZLA 4IW3B 3FPAA 3DTVA 1BNCA 4YR9A 1K06A 2JD1A 4EECA 2I2FA 1YU6A 2WJJA 1UR5A 1H2RS 3FYDA 4RETA 5GVSA 2EBWA 3SQLA 4DUGA 3QVMA 2PL3A 4CJXA 4QDUA 1SKUA 1DC8A 2EX4A 5BVGA 5I7RA 2GOYA 2OZLB 1QRDA 3I45A 4FZ3A 1E5XA 2V6GA 4A3EI 1D03A 3MLBA 4WXPA 2BHRA 3LY8A 1IIRA 1E1YA 1FRQA 2HJHA 4IF6A 1GCAA 4NU6A 1AMUA 1DWQA 5DBGA 3O8DA 1BXRA 2YJTD 3EW7A 1XCBA 1WU7A 2XB4A 2QA5A 5ECYA 4HB4A 4W7IA 5H4HA 3LQ2A 2PD4A 2FR8A 4L5AA 4AJHA 3DZGA 4UOQA 3UGKA 1USIA 2BUBA 2CKDA 4PXSA 2Z6UA 5DI3B 2XNHA 1HMPA 1E7MA 5C1DA 3PEFA 4DA9A 1NL3A 4NL4H 1H65A 1HQKA 2IPAB 5AVYA 3AL2A 3W5UA 2LDXA 3P9YA 4W63A 1F3LA 1JI0A 1PK9A 3DPIA 3DV9A 3W3AH 1JJ2Z 2M1ZA 3RD5A 3ZI7A 5BN3A 3GELA 1Q3HA 4NC9A 3WWEA 4ZMBA 5DYGA 1P4AA 5AKGA 1PD1A 4B83A 4OJTA 5CFLA 1EAMA 2I4TA 4MQBA 3V5NA 1ZM9A 2E9SA 5EKSA 1XWFA 1N34B 3SJZA 3ITEA 1XTIA 1FJHA 2OHJA 5J4HA 1DS6A 1Y37A 3D8HA 1TTPB 3EDQA 2F1KA 2I34A 2IP2A 4NMLA 2VN8A 2I2XB 3GK3A 3RC9A 3PUKA 2DM6A 2R48A 1O7JA 1YBMA 1HDYA 4MKHA 1KE1A 5AOCA 4NJMB 1AO3A 3H5NA 4HUQA 3G23A 1NV8A 2P2GA 3MRSA 4LX8A 3U26A 2IOFK 2CJYA 1JSCA 2FOIA 3FJYA 2IPLA 5JJ5A 1Z0UA 3QWIA 5IT5A 3B52X 1N57A 5G02A 4B85A 4RTRA 1SC4A 3UGQA 4MITA 4UM9D 1PUIA 3GB9A 3RYHB 3T54A 1T2UA 3V8BA 5IEJA 3UBTA 3EEIA 5G3YA 3IPRA 2OLKA 4KH0A 3HY3A 3IP7A 4MGIR 3LI2A 3RU9A 3QSYA 1SG0A 1D7OA 2PRJA 3PHBE 5JRDS 2I80A 4A1FA 1SC3A 1Z29A 3JYNA 4QLAA 3KR9A 2IHKA 3QWBA 2DUUA 3CJRA 5JYEA 3IRUA 2QRZA 2CSUA 3TGWA 4WXMA 2C2MA 1N2IA 2DBQA 3O8NA 3ZBQA 4HDKB 5LQDA 5AI6A 3VAYA 1GL6A 5L3RA 4YN3A 3TYXA 1N36B 4UHCA 2FFAA 4C0JA 3AR2A 2RAPA 4KGXA 4PU0A 5J3JA 1HDXA 3R41A 2PVSA 1ZISA 3KKEA 5CLQA 4ZDKA 5M2QA 4JK3A 4LXTA 1XYVA 3GJ5A 1ENYA 1ZN9A 3L0IB 4RLSA 1KZHA 5B4VA 1RXIA 3CINA 4J9VA 5JNWA 2CLCX 1QP4A 3B48A 1U7OA 1H9BA 2IZ5A 3F4LA 4W5WA 4EHBA 2XCSB 3T1YB 4QBGB 5D00A 4D74A 5BVHA 3BJZA 3UUGA 1WHSB 1Y5NA 1CUCA 2NXCA 2RB5A 4WLFA 3TBKA 4RNCA 1NOIA 4AN1A 3IILA 2AOUB 5J63A 1JIKA 3CCU1 3DGEC 1T1GA 3HQ4O 4WCFA 5FO1A 4F8YA 3EGEA 4IYJA 1RXVA 5C0OE 5LDGA 1D0SA 1K7FB 4LHXA 2G76A 4CGYA 1TMGE 1C2YA 1XX6A 2GAJA 2PT5A 1Z62A 3QI2A 3CU5A 4NBWA 2FWMX 5EIWA 1A95A 3S2GA 3K2BA 3SE7A 3SDBA 3OE5A 2PU5A 1IOWA 2C3PA 4FGZA 2JHGA 2H1RA 4P6VF 5ICCA 4Y2TA 1DU4A 5AKKA 2EL9A 1CFJA 3F49S 3GAZA 3OTOB 3TO5A 5FPHA 2QTFA 1XVLA 1EGMB 4OAOA 1NX6A 4F2PA 5L3SB 3BHNA 1AHIA 5EKTA 1QORA 1L5HB 3ETLA 2EEPA 3R5TA 3BD8A 4BUZA 5IHPA 4ND5A 4ESVA 3VB9A 1TRHA 3DTYA 2GDJA 2J9YB 1GCIA 4FPXA 4AROA 5FUQA 2GZMA 1JKXA 2VEDA 1BQ3A 2FEXA 3FFAA 1U7UA 3PEUA 4ZT2A 2WSBA 3B6JA 4JI5B 1O8CA 1U8XX 3VR2A 5BWMA 1VGVA 1RI1A 5JH7A 4IDFA 4A8JC 2CHQA 1CY7A 1KJQA 3MMPA 3U4DA 4E88A 1RYZA 3STYA 4B7AA 3SOPA 1ZBQA 3QU9A 3CPJB 4NBCA 2Z3ZA 1X1DA 3FA2A 3NPAA 4C20A 5AW8A 4Q3LA 3W5AA 1KI9A 3A9TA 4LGCA 4TUYA 2RI0A 4TWRA 4C4OA 3R3ZA 2XDAA 2I1LA 2Y99A 1X1SA 2LBPA 5FF9A 2F3TA 4NRDA 1CETA 3OE7A 1GDTA 5LIPA 2NVXI 3U3DA 3K0CC 1YIDA 4RABA 5DTMA 2ZSUA 4AZVA 2ZJ3A 3HNRA 4J0HA 4KO3S 2YKGA 2W4QA 2X3FA 2WG2A 2OILA 2AMLA 1YZTA 2AVNA 3H84A 4GVPA 3QXJA 2ZYSA 4ZI7B 2H1HA 1BGXT 1T0UA 4KAAA 3NDRA 4BO9A 3P2MA 2WKWA 2IGBA 4C4YA 5AJTA 4LV6A 1HDEA 3VR4H 4DPMA 4GKKB 4QPDA 5KDOA 4C3OB 3NGLA 4BNTA 6Q21A 2X6RA 2W2LA 4M76B 4GBMA 1CWUA 3A1FA 2WM9B 3HG7A 4EA9A 1MENA 4YROA 4L4XA 4B3TB 4EW3A 4U9IS 5KOHB 1VGRA 4IXMA 3K35A 4EVQA 4IIJB 3FLEA 3OEEA 3FNRA 3TTVA 4N49A 2EL7A 1H2EA 2G80A 4EOGA 1ZR4A 3SC2A 3T7IA 4QHTA 4MWBA 3FKSD 1VRWA 2B2NA 4ZZIA 2JIZD 1ZCJA 1A7UA 1ZNXA 3QEOA 5DDIP 5JANA 4OREX 4Z0TA 5A3VA 1WETA 3QFHA 2QJTA 2YQ4A 4I1IA 3NXKA 1LBTA 2E4XA 4EW6A 3NH9A 3GARA 4NBFA 4A3SA 4ZHSA 2B6NA 4MLDA 3LXMA 3P0JA 2PKYX 5ADWA 3LYHA 1N5KA 3IJRA 2GVNA 3R0XA 2AF3C 1TGYA 3ZG6A 4C6TA 1EXVA 4BE4A 2XUZA 4D8VA 3AZPA 1WMFA 1RIFA 3CVWA 2DKFA 4ZT5A 2E48A 3MMZA 3M4XA 4PQGA 3W5IA 5KKNB 1S721 5DWQA 5AVVA 3EVZA 1ZJJA 4A7PA 2PS9A 5IYZB 4BB0A 4KREA 2BKXA 2H1VA 3UATA 2JFPA 3M6FA 2VDMB 4IOJA 4D8WA 1BHO1 4AURA 5BNTA 4TTRA 3A2LA 4HN9A 1CQZA 2D1QA 4CTKA 1NDUA 1POWA 4N3BA 3WR5A 5C4IA 1EMDA 3HKBA 4RU1A 3GRPA 5LPNA 4NFRA 2HWWA 3JRXA 3NXSA 5CA0F 3CR3C 4MVYA 4ER3A 4YX9A 1BEEA 1J06A 3DV0B 3WX0A 2B2CA 2W6PA 3BUSA 9GPBA 3EXIB 5M34A 1QDEA 4KJXA 4UCQA 2R6FA 1DT3A 1KJ9A 5JS6A 1CUUA 1R18A 2GSWA 2JA6I 1RQLA 1UKVY 3CLVA 1SD1A 3EF0A 3ESBA 3EULA 3HVUA 4LGMA 3SQDA 4CMAA 2EWVA 5A4IS 4EBBA 5F7OA 4CKWB 4RA6B 4GAEA 4H1VA 5TQ0A 4FGSA 1ODLA 3AEUB 3HU3A 4R9NA 5K51A 2YCLA 5SY9A 4AO6A 4CMKA 6LDHA 1ZIPA 4A16A 1FFXA 1NVDA 3JQ7A 2CK3D 2JFFA 4ILKA 4NNOA 5HS6A 3RTDA 3UJHA 1B0PA 5I5EA 1I0ZA 3FY4A 2ZRQA 3U80A 1LFDB 3WHLA 3CWCA 2R7NA 1X1BA 1OTXA 2J0VA 2WT8A 3KSDO 4K81B 3YASA 4BNIA 4PQYA 3B82A 5DYWA 3IT3A 2CMKA 3CB4A 4CIYA 1P0PA 1JLMA 1RYEA 3PE6A 2ZCJA 3KAKA 3LDFA 1RRKA 3OT1A 2WUWE 1FJ2A 3HO6A 1NKVA 2DLDA 4JYCA 2GB4A 5BPHA 2OB1A 3H5AA 1OKKA 1NSTA 1NT4A 4PX2A 4G56A 3F3SA 4AZ3A 1SVUA 3T5AA 2QTRA 2FWPA 4CUZA 2C9CA 4MD7A 8OHMA 4M1YA 1TQ4A 5BR8B 4L8WB 2CV2A 1VQLZ 2MT9A 4R2KA 2YHSA 2P2YA 5FBLB 1MHTA 1N78A 4DTCA 1LDNA 2PGOA 5AVSA 3BD7A 3IDZA 2JJ8A 3M82A 4ND8A 4XE5A 5ARCA 3V34A 1VLAA 1G8MA 5ALNA 2FZVA 2IEAA 2PMDA 2DHEA 3EXHC 3L6BA 3OPXA 5H83A 2JGAA 3PXUA 2F3RA 3E9CA 5G4LA 2QMHA 3ANTA 3TG8A 4I50F 1AZSC 2J87A 3IVMA 4ACAA 3GG9A 3UGJA 4NARA 3PD0A 5JZSA 2ZYUX 2EZUA 2C3YA 5EMJA 4D3YA 1CXZA 4BAGA 3JAWB 2HTFA 4CG2A 4E2ZA 2FSGA 3KAPA 4WKOA 4NBDA 5JNUA 2ZM5A 4X93A 4B3FX 1OAKA 1J7JA 4EKIA 1UBEA 3DZ8A 2P5SA 1ILEA 3EUWA 3F6EX 3WLMA 1LFAA 3A36A 1G19A 1QV6A 3UIEA 3MTBA 3COWA 4TYWA 1K4KA 3WNZA 2QV0A 2C98A 1PV4A 1GR1A 5FR1A 1NP6A 2YMPA 1TIPA 1XPUA 4B43A 2FFBA 2NAPA 4TTSA 3IE0A 2V5AA 4R1NA 1X8JA 5JZ9A 3IBSA 3M89A 3UQYS 2XOXA 1NVGA 3BK2A 3GJ6A 5U1PA 4W9NA 1U7XA 4KNYA 4GLOA 1SIUA 1FP4B 2R6HA 2V97A 2XNKA 5C80A 3WL5A 3W2HA 5JRZA 2FG7C 4OQXA 4UZFA 1T5HX 4J16A 1JFSA 4RK7A 4UVDA 4QQKA 2B6HA 3ZOZA 2FN9A 1Q0SA 4TRRA 4D9KA 5KZMB 2O8CB 1NTRA 1K86A 4KVGA 4OSPA 5DXAA 1MA0A 1LBHA 2D0PB 4MPJA 2CUTA 4EJMA 4PLZA 3TECE 3CN9A 5HIJA 3QG5A 2CEAA 3PC7A 4EY6A 3TSCA 4H6PA 8GPBA 1QIIA 3PGMA 3GFFA 1MORA 3F7OA 4NQRA 1F8XA 2G82A 1A7KA 2ZYIA 4JBNA 2P3YA 3H2SA 4JB0A 3VNVA 1CZLA 1MX3A 3B7PA 2FMTA 2XCUA 4CN9A 1H8HD 4U7DA 2JJ2D 2EF0A 2F3QA 2AKYA 4EATA 4JNKA 1MXFA 5F35A 5T4HA 1OFVA 1G8PA 3IDSA 1P31A 1Z2EA 2Z58A 1EK2A 1I4DD 4QFDA 2VAWA 4UAGA 3SHWA 2ODNA 2N47A 4OGLA 4WGGA 3K2QA 1DKPA 2F2TA 4R5HA 1LQUA 1GDDA 5BV0A 3IEXA 1HL3A 1GZ7A 2VQSA 3H5TA 3NBAA 2Z57A 1EX1A 1PT6A 2AK3A 3HJAA 5A9RA 5LB2A 3HA2A 1Z34A 1ZD3A 2I29A 1M1YA 1QYRA 3OKFA 3TLEA 3R3HA 1QZTA 3UW1A 1V3UA 1YE8A 3EPKA 1YA6A 1ZQ9A 3R3UA 1G6OA 5JSKA 2PBZA 3MJEA 4I8DA 1WIWA 1PK8A 1QIMA 2ZRHA 2X77A 2AOTA 3CD61 1J99A 4E94A 1K3UB 3NTXA 4TRMA 4MS3A 3T7EA 3GLFE 2J09A 4Y2QA 1UL1X 1R0RE 1G4UR 5JO9A 2WC1A 4X95A 2EFJA 3GEPA 5I7OA 3O74A 4WECA 1YRWA 3QY9A 3VSBA 4DWJA 1Q15A 1R00A 3JQGB 4ZTBA 5GOTA 3RUEA 1N6HA 1ZI6A 2Y8EA 4R16A 4UEQA 3EODA 4MQMA 4MS1A 5FTNA 1ZOSA 5CTJA 5EXPA 2NUTA 3OOEA 2YWJA 3T1TA 3QYAA 2NV0A 3R6GA 4B0OA 1GA4A 2G8NA 3DC7A 3DKRA 2AFVA 2NO4A 2FPKA 3ZHUA 4L8LA 2X8JB 2JA8I 2FTKE 3QUTA 3S7TA 2VJCA 3N8NA 4KSYA 3K5IA 3GLSA 2BEVB 3BGDA 3HS3A 3L02A 1YWGO 3NCHA 4BX2A 1W2HA 3NH5A 4LUCA 4ZCRA 2VPYA 1N92A 4PCAA 3V1UA 4P4UA 2GTHA 2HYIC 4DA4A 3AF2A 2O59A 1JDTA 1QHHB 3HJGA 4FYIA 4LC1A 3IPXA 1W9HA 1XXHE 1Y4SA 1PJRA 1Y89A 3G4SZ 2H3EA 1S02A 1ZU4A 3DMTC 3JRWA 4X7RA 1Q811 1KYQA 3NR2A 3QPUA 1RWBA 2EERA 4YRKA 3L82B 2VTDA 4FXOA 4J8PA 5CA0A 5GY7A 5TC4A 4ZHQB 3T3NA 1QCYA 1RKXA 2KI5A 3QPWA 2R8YA 3JATA 5TPWA 2YDYA 4YIHA 1OT5A 2BJVA 2BMJA 2H7YA 4M22A 5C9ZA 2XA2A 3RUCA 2B4RO 4UFOA 2C5EA 1WDTA 4RVSA 5HNKA 2QQ5A 1YQ9A 1AGYA 1Y5RA 3RC8A 3LWBA 1H8EA 1IG3A 1MAAA 3MF4A 5LYJA 3RFVA 4XWKA 2I71A 3GEHA 3RKUA 1D6NA 1TVCA 3W5CA 1UKAA 4XGIA 5TV2A 1P1IA 2FZEA 2DWQA 3GFTA 3MQFA 1S3FA 3FETA 2QTWB 3A4NA 3O3NB 1CSEE 1W93A 2BIFA 4BASA 2F1RA 1FLAA 4IIVA 1C3XA 1DRKA 3A32A 2IJGX 3Q2KA 1DDIA 1KC3A 1OWMA 2I62A 2OOKA 4HPJB 1NHWA 4NFYA 3SOZA 4OIFA 5TJ9A 5K7SA 3BOSA 4EHJA 3L8DA 1AJEA 3D5EA 4FD3A 3KETA 4ND3A 1Z28A 2PKQO 1GTJ1 1C7QA 3D3WB 4OKIA 3TE7A 5KO2A 5L53A 1D7AA 2M48A 1IEVA 1TJ4A 1DWPA 1XXLA 3OLWA 3N2LA 2JFOA 3MJDA 4MB6A 5C1IA 3I5YA 1KAOA 5B1SA 1QUFA 4HLQB 2UZAA 5A6VA 1UK8A 4P3YA 1Y9DA 1QHXA 1VG8A 2VR1A 3HSYA 4KTTE 5FL3A 4L7QA 4ALNA 3ICPA 4E15A 1H3NA 1YJ91 1CQJB 2A9FA 1L7EA 1XL0A 2W98A 1MX1A 2EZ9A 3AEZA 2C84A 1VE1A 3F71A 4J7AA 3F73A 3PFKA 1CYEA 4K0RA 1U6IA 4QT4A 5FTLA 3DDWA 3T15A 2J08A 1V6AA 3C3JA 1S5PA 4I6EA 1TGVA 5IFLA 2ZM6B 3VHRA 3IMGA 3Q1KA 4LYFA 5EHIA 4N7RA 2P2CA 2Y68A 4I50A 4D57A 4HVCA 1VPDA 3K8ZA 1CQIB 1BTOA 3DEYX 4MVJF 2P4EA 4ENQA 1ULZA 3WRXC 2GZSA 4V0MA 5K4GA 3HLYA 1K8A1 3UHPA 4L75A 4HAUA 2QVLA 3A1DA 2RE8A 3ZDDA 3KHSA 3ML1A 1G8FA 3WK9A 2CUKA 1BFDA 2DKNA 2P9JA 1ZUNA 3TCXB 5K3FB 1Q22A 4H16A 4OJKA 1Q95A 2W6CX 4M7PA 4B6RA 5F3WB 4FWTA 1ISRA 2CZQA 1TJPB 3HZHA 3QUSA 2IUTA 5AOVA 1Z38A 4YGYA 3ZY3A 4D9FA 1IDOA 4MDFA 1E1RD 1RIIA 4QO7A 2Q29A 1C14A 4HDNA 5C7YA 5MN4A 2ZULA 4O3MA 1DQSA 3EF1A 3TUJC 4CM3A 5HBRA 4BIIA 3GBSA 1I3CA 4RVDA 2IX9A 3BJMA 3MD9A 2Y2VA 2ZI4A 5ILQA 4LKOA 3TW6A 2DQKA 3ABQB 1G20B 1TK3A 5AUPB 2QZ4A 1XELA 5EJ5A 2WICA 4QTXA 1LS1A 1A9ZA 3QBEA 5HFNA 4Q3OA 1QVVA 1PGPA 2WPDA 2I5PO 3LRXA 4JQOA 1FX0B 2IQ5A 1V16A 1GADO 3M4NA 1DRVA 1Y6RA 3KR1A 2P6PA 5DLDA 1LNZA 2BEWA 2IYEA 2X4DA 1ML4A 2BEJA 2I03A 3G8CA 4G1MB 4PONA 4KWIA 3ST7A 3LLSA 3IX0A 2RGXA 3WRVA 4FIDA 2CHEA 4CQMA 3MJVA 1JG3A 4Z0HO 3T41A 2QTGA 4A3FI 1N6LA 2PKEA 3Q7IA 4NESA 1WP4A 2IWHA 3I62A 1C3OB 3FB4A 4ESHA 3FCUB 2C00A 4NYJR 1W2BZ 1ZIOA 3GLGE 1AMNA 1PGOA 5HF5A 4IDQA 1JWAB 3BSYA 4Z4CA 3Q41A 4ZCTA 1ZM3A 1E7SA 1MAVA 4AKTA 5HG0A 1KOGA 3JAKA 1MABA 1HT3A 1VJ0A 2G7MC 4LPKA 4EZEA 4YXWD 4BX3A 1VQO1 4FNMA 5M3BA 1GPJA 3CC71 1J42A 5HX7A 3HMQA 1DUSA 2QBYA 3EGXA 4HQOA 1X74A 5BOSB 4TXJA 1KYTA 4KIJA 4PYIA 3O91A 1WA5A 5KUTA 1W0JA 4UDOA 5C4XI 2WF8A 5I7SA 1F0NA 3ASUA 3LYUA 4XWWA 1JHXA 4DDTA 1DHTA 1KP3A 1RAIA 5FNZA 4IFTA 2Q6KA 3RC2A 4W8OA 4ND6A 3W2GA 1SXJB 2PAFA 4RQUA 1RXYA 3X0DA 5KCMA 3HGQA 2FEAA 3ECAA 4PBSA 4XQEA 3PYXA 3WGGA 3TNLA 3GO4A 4HEQA 3W3ZB 4E4TA 2LTAA 1E2NA 1A04A 1V6CA 3N3AC 2NPIA 3AF6A 4QAJA 1MJFA 1YULA 4P3PA 1JXMA 2VF8A 4BFVA 1DQYA 1XQ1A 1U1GA 2FPGA 3DOEA 3CCJZ 4BFWA 2XZDA 5JAOA 1VLZA 3WNQA 5HK8A 3W0LB 1LDYA 1HLDA 5I5GA 4EG0A 3LPDA 4OOFA 1DX4A 3U16A 1TE2A 1F2DA 1P80A 3MWDA 1DKNA 4L16A 5B3JC 4OLFA 2R84A 1JV2B 2VDOB 5BO5A 2F9LA 3TLYA 3LUPA 1BX1A 4U0JA 4BEBA 2ZYVX 1HDGO 3LHSA 3NHSA 5FRDA 5JSHA 3DUFA 1KMMA 1DIBA 1DRUA 1Y42X 2RHCA 2PX3A 4IRXA 4OH1A 5DZSA 5T57A 1CY1A 3SJBA 2XQFA 3CWQA 3L5KA 3OOWA 4DQ0A 3EY4A 2B9EA 2C1XA 2VDKB 3B6ZA 3VJLA 3T4XA 5THQA 1K9SA 2I2WA 4E2XA 2HJWA 2ZFUA 3ES9A 3O9ZA 3C8DA 2P9FA 4JYZA 4BXOB 3CT4A 3D4BA 1VJ1A 5LP6C 1C1HA 4HGZA 2C2ZA 521PA 1VCIA 2P5YA 4NZ9A 1CB0A 2JATA 4ADSG 1E0DA 1BA3A 1QRUA 4ZAFA 1NJI2 2GRAA 1H2ZA 1FTWA 3AVOA 2HO4A 4QPCA 3GZTB 4GDFA 3HACA 5CLHA 2VYFA 4G5XA 4YBRA 4NYIR 2C2BA 1DMRA 2DPHA 1JLLA 4M8KA 2WIDA 4YAJA 2X15A 4Q6BA 1G8JA 5FWXA 5BW5A 5EIXA 1H4QA 3R0IA 3BDAA 2IYFA 3U9SA 5HJ5A 1SVNA 1BDJA 2CMDA 3MJCA 5KHLB 2BLNA 1U2GA 2PT6A 3R44A 2MYNA 2J9XB 5A9TA 1G2OA 1KXZA 2O3SA 2PGAA 3VPCA 4EELA 2GUGA 2GXAA 1W35A 4AN4A 1P18A 3CCFA 4YAWA 1V48A 1YUNA 4HZGA 3IVXA 1YAHA 3W3AA 5EIBD 5JWHA 3CGGA 1TNDA 3BL8A 4G1BA 1IJEA 4Y2SA 4YMTA 4RJIA 1CUEA 1JDBB 4Z9AA 2I7VA 1U65A 2ZJYA 3HUTA 4YAKA 4BYGA 2SHKA 3ZGOA 5CB8A 5IJ0A 5EFZA 1NT2A 4FONA 4KXVA 3SJAA 3L7NA 5MGBA 5CITA 5F98A 4AZTA 5JLAA 2C4NA 4JL8A 4KX5A 5KC8A 1Q6ZA 3W4IA 1Y4UA 3DKVA 3H4IA 4MVJA 4WLNA 4RDHA 3ROFA 1OI7A 4KO1S 4PSDA 1U0TA 1R0KA 1L6RA 3VQTA 4CM8A 2OOYB 4ZQCB 1ZM2A 4M87A 4J1QA 4XI9A 2GBGA 1R5BA 1OGJA 2CGEA 2C88A 3THYA 2VSOA 1G7RA 5KU7A 4RE5A 1JLRA 3SZUA 3K09A 1J25A 1DC5A 4ML3A 4DA7A 2E87A 2WSSA 3NAGA 1PWHA 2XYHA 3QVTA 5IABA 2CVHA 2PGXA 4IIXA 1L8XA 1XVAA 3ZHXA 1I10A 1FNDA 4GMFA 2IL1A 3L1JA 2HF1A 1RZ3A 1TU4A 3D6JA 1U31A 1YJ5A 3E70C 4ISBA 4KQWA 4WTOA 5COQA 3OEYA 1DAOA 3BTVA 4HDCA 1QU2A 2P67A 2JANA 2P75A 4BVFA 1X7WB 1RPNA 2VCHA 3JQ8B 1U6KA 2Q9UA 2BH9A 1ZR2A 1E6CA 3I2FA 3PIIA 5EIEA 1A76A 3VC1A 4F4JA 1QM5A 2C4MA 3O2SB 3CW2A 5ALFA 1PEDA 3MT0A 1QHEA 2PX6A 1TVKA 3KQTA 4PTLA 3VNSA 1T5DX 4J3FA 4D0NA 4K9MA 3KC2A 2BJHA 4QIHA 1NVAA 5ALDA 1I30A 4EZIA 4BB6A 1JILA 5JIBA 1QYIA 4WADA 3GUYA 3SCZA 3G1TA 1KBOA 2HBQA 5D3ZA 3R6TA 4IVNA 4B79A 3PRKE 2IQIA 4ZPJA 2A9RA 2FWNA 2JVIA 1PV2A 1SXIA 2QV7A 3FCOA 4MUNA 4CG3A 1DIRA 4H6VA 1J1ZA 3S2ZA 1NXWA 2JH3A 4JLOA 4Y2XA 4YS6A 3RI3A 2GCEA 2JAQA 2XODA 3AFMA 1KIFA 2FSHA 2YNMD 4WE3A 1J0BA 1R0XA 1Z7EA 1E0SA 3I6MA 4UASA 1A1SA 3E4DA 4U0KA 5K01A 2JW5A 1ZOIA 1Q862 3RSZA 1WCIB 1DARA 2VYCA 4FDLA 4QGFA 3D3KA 3BERA 1B8PA 2PT9A 3IIKA 3OTGA 5GONA 4NNPA 2JBAB 4A93I 5LFAA 5DPMA 2HFJA 1AA6A 4D5EA 3NJRA 3S8EA 1H1DA 4G63A 4O2BF 2JB9A 4HX9A 1FCJA 3LDGA 1R0SA 4KTVE 4FFNA 4INJA 3OCJA 4DV6B 2HKIA 5JNLA 4BV3A 1EHYA 3TX2A 1L4EA 4PVCA 1CZKA 1P45A 4UTNA 4QTZA 1QGUA 4Q15A 1ZVVA 4QREA 1GZVA 2Z83A 3U9LA 3ZCXA 3L7DA 1A27A 4CKBA 3WLTA 2OGWA 2WYVA 1JDVA 1QLJA 4IZ6A 3DG9A 2FCAA 5ECWA 1AQLA 4GYYA 4EA8A 4LF7B 1SXGA 3NFYA 1LBSA 4RLHA 2YZKA 3M33A 4HSGA 3BFJA 2WWYA 2BISA 3ILSA 2D62A 4K9LA 3K53A 4GT1A 1U0LA 1Z73A 1XI2A 1ZK4A 1WS6A 2BFDA 2C0CA 3NUQA 2XIQA 1C4KA 4RJLA 4KACA 2IODA 3FDZB 4OL0A 5GJBA 3FF4A 3LX4A 4LKRA 4DEYA 3FQMA 2DBVO 1QCCA 2JH8A 1TX4B 5A3QA 1WQ1R 3U1BA 3PRJA 4F85A 5JYCA 1M1K2 3U5TA 5K0SA 3VZDA 5DTRA 3UT5B 3H99A 3QWHA 2QL9A 3UBMA 2Q5IA 3PFFA 3G9XA 4H31A 4YT8A 1VLHA 2PYIA 1NUTA 3EH1A 4DUPA 1I80A 1UXJA 1PZFA 1TAGA 5EAIA 2XQJA 4GGOA 3Q7RA 4P2GA 4EEKA 1I9GA 4X54A 4UBKA 1H69A 3QJ5A 1JHDA 2E21A 3VVBA 3SJCA 4RDXA 5L51A 5TGTA 1TZJA 4YBZA 2GN2A 3L3BA 1PIWA 2Y1GA 4GP6A 1RZVA 1W1UA 2POQX 2WLTA 4HGPA 4HPXB 4JBGA 1YCHA 2O2EA 4JLBA 4P3XA 3C8HA 2VHZA 4N01A 5FOTA 1YUBA 5D1NA 3MUNA 3UHJA 4BVBA 2ZBUA 2JMOA 1II9A 3JTMA 5JCXA 4DV0B 1HZZA 5EUBA 1NWCA 3CA8A 1A8HA 3OEWA 4L07A 1XRPA 3VBEA 4AJ1A 3KB2A 1M2OA 3ACBA 1UFKA 1I9CA 2EG5A 4M0EA 3VFDA 5BV1A 5FAKA 3UENA 3NHKA 1FFYA 1KRXA 3QW4B 2AFIA 4Z1MD 3OP1A 2NO9A 4I3HA 4BVAA 5DMXA 3VHLB 3BJRA 4BNDA 3Q8KA 3CCBA 4QVIA 1EUDA 4K9QA 3VSCA 4PHHA 1QSGA 3P9PA 3EH2A 4NH0A 5JAQA 4KZPA 4IH1A 2F55A 1IPFA 1YDHA 1Y8RA 3NEAA 4KK3A 4UM5A 2NQ8A 3JSXA 3AIOA 3V2IA 4B3HA 3CGWA 3A6JA 4MHTA 3HDGA 5EEGA 4FE3A 2ORYA 2VJMA 2YWEA 5C8YA 3VVMA 1R9MA 2QM0A 2OP1A 4BKPA 1N4DA 3E23A 3TF5A 2XOKA 4KHPB 3ESWA 5DM1A 1W88A 1GGVA 3OZCA 2GEJA 3GTLI 3F6RA 1L8OA 1QZXA 3MWKA 2XDWA 1RQXA 3ONEA 5K2OA 3GEIA 4TTQA 3W1EA 3TEJA 1L4BA 3MWGA 4M88A 5EG5A 1Y8QB 5HOQA 1M6EX 2DY1A 2INGX 4ZU6X 4INAA 3UJ3X 2QTHA 1QKIA 3DL4A 3HV0A 1OXVA 3R2JA 3LL7A 5FUBA 2WZBA 5FD8A 3SEAA 4JJ6A 1J0CA 3OUTA 3TSAA 4AX8A 2WZQA 3PJGA 3TQSA 3EFOA 3RS5A 3MYRA 5KYVA 3N0WA 2RI1A 2W71A 1QH8B 2ZJ8A 4GX5A 1EK5A 1RI2A 3EVGA 2YS7A 4QSMA 4RGQA 4CKXA 3LF2A 5CDFE 3OM0A 2CL5A 3AEKA 4Q4HB 1X1RA 4HEJA 3Q3CA 4XQ9A 2PD6A 3L84A 1AKQA 5A4KA 1C7FA 2C0PA 4M9QA 5DIFA 3UWPA 4CT4B 2YOGA 4HWTA 2XWBF 1W0KD 4O1MA 5LKAA 1VJGA 4I8IA 1DV1A 4BCDA 1DQZA 1FVHA 2DWPA 2YTZA 4N3AA 2IH4A 1K4MA 2C9MA 1KYYA 3R75A 1XHLA 4NSNA 1JKIA 5KOJA 2HW8A 1BVHA 5TX7A 4BZWA 4Q3AA 1ZMOA 2Z56A 1HDCA 1AZLA 3QU5A 3VPGA 2WA1A 1B74A 3N76A 4U2KA 1O94A 1W48A 2GM9A 1QVFZ 3EQ6A 1U5BA 1J6UA 3IDQA 3L4EA 3MSCA 2FW1A 2V6JA 3H9GA 1YQTA 1TQ8A 1OXSC 2AN3A 1G1MA 4IDHA 3GTOI 1COWD 4DMRA 2DE0X 2DFLA 2QMEA 4BFZA 2HNKA 1JJBA 4XIYA 4CL2A 5IT9f 1NA5A 1Z0SA 4WZBB 1WUTA 2ST1A 3NRBA 2UZ4A 2GCOB 4CNBA 4ZAGA 1FSZA 1F1JA 4EYOA 1U8FO 1XQVA 3MIIA 2CE7A 3KNZA 4HZIA 3UTCA 4AYWA 1Y82A 4I55F 3OTQA 1Z0ZA 4FGJA 4JEUA 4TPKA 3STHA 1LH0A 1SQGA 2OWDA 3PXCX 1HA3A 1RYHA 2JLXA 5IASA 1ZLYA 3NHLA 1VCNA 2YFQA 4PPYA 2QSJA 4CLOA 3LCUA 1IG0A 1NBHA 4QOGA 3FYTA 4MHSA 5B1DA 4GQAA 1SXQA 3TDNA 2CMHA 4RDCA 3K9LA 2CYAA 3GIWA 1PEYA 4J0QA 5A02A 3GCZA 3AHHA 3D9QX 1WAMA 4LQDA 3MCAA 1NU6A 4RUKA 4WZ6A 3W6PA 1Q1NA 4O2BA 4HQLA 3C5WP 3GZNB 4RHUA 1DUIA 1JT9A 2BGJA 3RPEA 4CL0A 4MH0R 4COOA 3U4QA 3HCAA 2QZPA 1O6BA 3I6IA 1Q0ZA 4C05A 2NTNA 1A98A 1D1TA 4N3NA 2A9QA 3MB5A 2I7TA 4UD6A 1ODIA 3RSSA 1OB2A 1P5FA 5K8JB 4N6GA 2DWUA 4CDMA 2XTNA 4YY3B 1T4DA 2ZRNA 3EIFA 5AWFC 4F5YA 1UPBA 5D6NA 4D81A 3AG5A 1RMQA 4JELA 3OEHA 4QU8A 4X3OA 3O8CA 4WXYB 3I551 2J0SA 2O8EB 3P97A 5C3UA 4PW0A 1P6UA 2I3AA 2CVQA 1CJMA 1E2FA 1ELOA 1GYPA 1P72A 3EA0A 4YRSA 4FUTA 2K3RA 1XFDA 4G1EB 1UZUA 3FWNA 4NICA 2ZS7A 3ENWA 2UUBB 1RRPA 4LFAB 4EGFA 3OCCA 2YJ6A 4L3VA 3REFA 3R6WA 4EPYA 3MGAA 5H3HA 2VQ6A 2IIQA 1NQXA 3P71T 1T1SA 2NSJA 3U4IA 2UUOA 5JECA 2G8LA 4RK5A 1KJJA 3C5EA 4XTCS 2P11A 1QE3A 1Y33E 2HBRA 1T35A 4GPIB 4YUYA 4RMJA 1YS9A 2YRWA 4E08A 3QKWA 4L2IB 3TW4A 1WR8A 1KJNA 5CT4A 3HWX1 4QDOA 1HF3A 2UYOA 4EB3A 3SFTA 1XTRA 2VP9A 3EQ9A 3L1KA 4MRAA 4ON9A 4XCQA 1XVVA 3CH4B 5F5LA 3AIMA 4JHXA 1XTPA 2P6NA 1R3DA 3DE7X 1PG0A 1B41A 2XQIA 3HUFA 3QLUA 4QOJA 4R6XA 5DGTA 4KOEC 3V8NA 4F86A 1UM9B 1UMBA 1Z5WA 4D5GA 5JXGA 3Q8MA 1ST3A 1EFCA 1ZJ6A 4G2TA 2A9JA 2X8WA 2UZIR 1MA3A 4KB5A 2G1AA 3CC4Z 4TZ0A 5EHXA 1ZH2A 2JFHA 3L92A 5KWSA 1K98A 2FFQA 3CQ9A 821PA 5CIWA 5D3KA 1P2DA 3FAZA 5AESA 1F2UA 1X1QA 5CJ2A 1F4PA 1SVIA 3LCJA 2M9MA 2HI0A 2FR8C 5JAUA 3DFIA 3ZZMA 3RASA 2QRVA 4GZLA 3C3BA 2HU5A 4F9GA 2PV0A 1FZQA 2W2OA 2RSLA 1ZGCA 4WNIA 4L0MA 1GQOA 2K7ZA 1PT5A 3CXRA 3HEMA 1IVYA 2KPOA 5CA1F 2YRFA 1QS0B 4OLJA 3W78A 2OC9A 3K4PA 3MLEA 5M04A 4Z9FA 3DP9A 3ZZ0A 4U7HA 1THTA 2GAAA 3HLTA 4ZCIA 1ZH1A 1GZ5A 2WRZA 2QMZA 3URMA 3ZZTA 2FHSA 4KL8S 1CJTC 3RFFA 4LJ6A 1MW8X 5C1BA 2XQGA 3U7QA 4U63A 1R88A 1NONA 2QN3A 2ZIXB 3OHSX 3X2EA 3QKSB 1SVSA 3A31A 3OJCA 5BRJA 2V6MA 3EZFA 4CL1A 3WA6A 5BN1A 2E4ZA 1VLQA 1AIPA 2O0MA 3DBRB 3QPBA 4HVAA 5CNMA 5CVTA 3V32A 1A4XA 3RKSA 4BJ6A 1GNPA 4PC7A 2ODBA 3CLUC 1HMYA 4QOIA 3A05A 4HH3C 1B8OA 4ZZ1A 5JAHA 4BBJA 4MP6A 2IU0A 2Y67A 1VSBA 3H4VA 1FFWA 4P92A 5H80A 2X9QA 4OO3A 1SVWA 5CXUA 5M5BA 4DRXA 2Z5VA 1GN8A 1XEXA 4MW6A 3DAHA 3RWOA 1KP2A 4FDMA 1YVRA 4II7A 4TS4A 3VU9A 2Z9CA 3BPSA 4IINA 5EJ8A 1OPRA 2E49A 2OYRA 2YHIB 1E9AA 3LU1A 1VI6A 4WERA 5ALPA 1UFVA 4PPFA 4QOEA 1DFHA 3GJ4A 3ZH9B 4RKRA 1AQ6A 1IHUA 2F3PA 3NHJA 3O3OB 4MW4A 5AVOA 4C0LA 4CMIA 1B42A 4AJJA 1Z33A 3TLXA 3BD6A 4ER7A 3RJTA 2VUUA 3BAZA 1U04A 2P3QA 1T13A 4FX2A 2A0WA 3JQAB 5FOSA 4G8JA 5I9TA 5A2GA 1HE4A 5TE9A 1WG8A 2CJWB 4D25A 2H4WA 1BIFA 1XVIA 1ZWLA 2EKZA 2WAMA 1Z0IA 4PNZA 2ERYA 2L82A 1WHTA 3CTMA 3E1SA 1QRRA 1XAIA 2VP5A 3FM9A 1G21A 4HNQA 1Z4KA 5IPFA 2BPOA 1R9NA 4MDYA 4CKCA 1QX4A 4YT2A 4ZXFA 2OXTA 3RFUA 1I2CA 3FPLA 3KUDA 4BN0A 4S05A 1QE5A 3RGWS 2AB0A 4WCFC 1V8DA 4IXDA 2JFVA 4HFMA 4BNKA 4W82A 1A4RA 3AUSA 3BMCB 4GYKA 1M66A 2FPLA 2YVKA 4UAJA 3U62A 4AL4A 3DV2A 3T5DA 3BG5A 3RG8A 3F5FA 4MARA 4CEJA 3EXHB 3GPBA 3I58A 1XRRA 2QU8A 1VQN1 1FNBA 2HUNA 3F5QA 3PNVA 4ND2A 4B34A 4OI1A 1VBMA 5CDUA 4WK0B 2WKRA 4RA9A 4I55A 4OBXA 2JFYA 5K3BA 2E37A 3ODPA 1HKHA 1QJ4A 4W9RA 4XLZA 1SFOI 1T3TA 3M1LA 4D3SA 2EW8A 3H3JA 1ZEMA 3KXKA 1TQ6A 4WT7A 5E2BA 5COAA 2DSTA 4F6RB 2FSVA 4QJIA 5DTQA 2FW6A 3JVDA 1MO3A 5T4FA 2NVTI 2C9DA 2YMQA 4D45A 3L04A 3GVIA 2J31A 3X1XA 1E8MA 2OTJZ 3FNQA 5TEWA 2ZJ0A 4ZGBA 1WE2A 4FFVA 1BRMA 2AN4A 1AHPA 1O08A 1XD2A 2B25A 3IIIA 1NATA 1P7ZA 4A0GA 5KNCD 2R6AA 3CCRZ 3EDYA 4RJ2A 3VH3A 3VR6H 3QVSA 3E3AA 1LJUA 2VSXA 1GTMA 5CW1A 3UUWA 4F5WA 4H0CA 2FU5C 1VQ81 2ZUVA 1VE5A 2C82A 4YP9A 2W03A 4JH0A 3OPQA 4CF6A 1U3CA 1P1CA 2XOEA 4DILA 5KTNA 3BH7A 5J4KA 1NQUA 3F6YA 1OBHA 1YMVA 2XVMA 4GPD1 1DIOB 5C8XA 1FU4A 1QVGZ 1N1MA 4RIIA 5DRYA 3U3OA 2QJRA 1ISPA 1MC8A 2E4UA 2GM5A 3F6SA 3LVBA 3MERA 4PZYA 5BSWA 3NAZA 621PA 4P3OA 3HVRA 1XF1A 1R8YA 5EP1A 1R5NA 1YC2A 2NSYA 1R27A 2EZ4A 1SUIA 1X77A 2P28A 3CFYA 4RIFA 4RIHA 2AR9A 1DJOA 5SY6A 4RE6A 4J1TA 3CRNA 4MUHA 1ADCA 1I6KA 1NULA 2JDID 4U3JB 5HIKA 1L4NA 3O75A 1Q0TA 4D8YA 2NMVA 2VDWA 4IV5A 1YJ8A 3K4HA 5B6IA 2HC9A 3WXMA 1P5HA 2ZR8A 1MZVA 4DNOA 3A14A 4JL6A 2ZRMA 3CONA 3P2IA 2BKAA 5JD5A 1FA9A 3GN1A 2VBIA 4HDSB 5HQTA 2ZTUA 1RLOA 1I3LA 3KM0A 2B78A 2Q8NA 3G9QA 3NASA 1RJFA 5AM0A 1PYOA 4UMVA 4ZDWA 3WGYA 4CLRB 4F92B 5I4KA 1UODA 1RPZA 3WK8A 2AF4C 2CLDX 5H3CA 1K75A 5D85A 5DV9A 3G88A 1U3TA 1FJGB 1M1NB 5FNVF 3UOWA 1V2GA 1KI6B 2EX1A 4QM6A 3KT8A 2HLDA 1TKBA 1UBNA 4IIGA 4RKFA 4FB4A 2C42A 3IUMA 1VRVA 3HB9A 5CYPA 4MV5A 2QPLA 2R6JA 3KHKA 4G36A 3JCZA 1JEYB 4RQBA 4ITVA 2Z1NA 1TYEB 1SQ0A 4J29A 3BL5A 5F4BA 4C2AA 5L8VA 3ANNA 1P19A 1DBIA 4QUHA 2OZVA 4QJ3A 1XMIA 3AR7A 3HOVI 4WH0A 4IMJB 3NDBB 2YCBA 1UC5B 1JTVA 2IS2A 1PBTA 4LTNA 3S16I 3R6DA 2O8BA 2E0IA 1Z4PX 3ISVA 4G5RA 1P2FA 3VTNA 1T36B 3OZBA 3RIMA 2BF4A 2JLRA 2XDYA 2ZG6A 1J7KA 1DG9A 4ZI7F 3J80f 1B76A 1GQFA 2EX0A 5CA1A 2ZRDA 4XFKA 1ECGA 4ZJZA 4Z9YA 3S5UA 4NBBA 3GEBA 3KDPA 3CVOA 4OXNA 4QBTA 3QEAZ 1Q11A 2EV9A 2AJBA 1GKLA 1KVSA 4GI2A 5F7JA 2Z6AA 5CYFA 4URZR 5BQPA 4ERNA 3K31A 4JEHA 4XPZA 3D02A 1DINA 5HQ3B 1SU7A 3AT1A 2C2OA 3H1PA 3IT2A 1EFPB 1OV6A 3ILXA 3R1IA 2QTNA 3TRDA 1GGEA 3WA7A 1Z01A 5JPIA 5JJLA 3BIWA 2HIHA 1O87A 3UO8B 1LBEA 1PYDA 5AK5A 2MYTA 2Z8XA 3SC4A 4U7FA 1DX6A 4B17A 5KJCA 5HZMA 3PUHA 4AYXA 2ZRLA 3OFSA 2KS6A 3P9IA 2BFPA 2QPTA 2OZLA 4QULA 3QE0A 2ONZA 3E5NA 4XSHA 4ZT7A 5LWHA 1WOMA 4XD7A 5A03A 3N05A 4YJGA 3AWIA 1OZHA 1E63A 3FD8A 1WVGA 3MMXA 3ORHA 4FSHA 4DUZB 4Y2RA 1LKZA 2V58A 4YVFA 4QU9A 3MT7A 4IRMA 2C94A 2FPOA 3PFBA 2AI1A 2VHYA 1XP8A 3N6VA 3EEQA 4R3NA 2FZ4A 3OQMA 4ZP1A 3DDNA 5CHYA 3C15C 4GXRA 4JUAA 4QDXA 4X24A 3VGPA 4EMTA 1EGVB 4RTOA 4M2LA 4DRZA 4DV5B 1KH1A 3G6E1 1E99A 1TYAE 4O2AF 3IS3A 5F9HA 3FFBA 5IYZF 2Y1FA 1U0SY 3B6MA 4Z8YA 4FCTA 4RK4A 1AHHA 2XBUA 2DH6A 5EQFA 3HU5A 4D99A 1WMAA 1XCOA 2F62A 3GDOA 2QVZX 4G0PA 4ZRMA 3NLLA 4P35A 4A15A 1CVLA 1G9SA 2Y77A 1Y7TA 4A3BI 3FOCA 4NJEA 2JI4A 3SC6A 1BMFA 1KYIA 1K1EA 3E1KA 1O4VA 3HHPA 3F3PC 3QQPA 4EJSB 4YMGA 1J8QA 3K70C 1L5FA 1RWNA 4FYWA 5DI9A 1S7GA 3PX7A 2I4MA 1YF3A 1NLZA 2FUNB 3LGAA 4TN5A 5EE9A 2FOLA 3BFVA 1Y3AA 3OF3A 1POXA 2FDRA 4B31A 2XTJA 1WLYA 4V0SA 2NXNA 4C08A 1PGQA 1A2QA 2WAXA 4F3NA 2QYSA 3PNKA 1YZKA 1K8QA 1X87A 1DWOA 1XNJA 1RBMA 2QM8A 2JPDA 3FHCB 3CRMA 2FRDA 3MTJA 4PZAA 3SSNA 2IHVA 1E3DA 1C80A 1CUSA 2II6A 3QV2A 3R3SA 1J1UA 4S0XA 1YDFA 1T9DA 3K3PA 4B35A 2NYRA 2B83A 3FG9A 1Z25A 4X0EA 1UDAA 4X8MA 1CQPA 1VMEA 2OBFA 3AEYA 1VG0B 4E70A 4GQBA 5H16A 1PVOA 3E22B 3WNVA 1FZTA 1YE5A 4JT8A 4JLWA 4ALIA 2BT4A 2JRLA 4Q1AA 1JQBA 4IQ8A 3O0TA 1L3BA 1C7EA 2BBTA 2IHUA 3BA1A 3IV6A 3ZZUA 1CHNA 1ZSNA 1K88A 1BEUB 4JFAA 4RYDA 4GMKA 1WPRA 1TKRA 5KYYB 2LVBA 3L0SA 3PNSA 4UTVA 2O0LA 1CDZA 5IXSA 1VE7A 2J6BA 4FM9A 1ACJA 4HDKA 4QQNA 3EGIA 2X8LA 3UMJA 4RJKA 3F1KA 4XQGA 2XKJE 1Z37A 2RAFA 1Z6AA 2COKA 4MMXB 1QOQB 1UPTA 4W9NC 2JNYA 2EATA 3AF4A 4WLEA 4WL0A 5TQJA 4EW2A 5ADUS 1I7DA 2ENUA 3QENA 4J16C 5DHSA 2R8EA 3EEOA 4QYSA 4YRZA 1ZY2A 1NF3A 1WHSA 2ID9A 1S7MA 2DEUA 3LQYA 4Z3DA 1ZWKA 1JUDA 2XRMA 4AF8A 3BZUA 3FMIA 4PPNA 3A37A 4KYTA 2GN4A 1RBQA 3RRMA 3NOVA 1FP1D 3QV1A 4DMLA 5IKXA 3TKYA 5KVQA 4NHEA 4HAXA 3CLSD 4C7JA 1AS2A 2QRCB 2O0JA 4IJ6A 2UXCB 4JENA 1CJUC 3CJTA 3DW3X 3IXMA 1DCFA 3OETA 1QG4A 1DXHA 4AW9A 1U0HC 5I9NA 1XK6A 4M37A 5JZVA 3J80A 4OHMA 3AUYA 1FDTA 2FZKA 4LTDA 3RRNA 1YVEI 5C7LO 3BWEA 4F8JA 1YKGA 1JDZA 1Y6JA 4JEIA 4MRPA 1C9MA 3B89A 4QJ4A 4ZOEA 2JEZA 3LOPA 3RIEA 2H4ZA 1JIXA 3RK0A 1ODKA 2P0EA 5K0TA 3U4MA 1WX1A 2CNOA 2PFSA 4MV3A 1HEYA 2YWDA 4XA8A 2H2GA 1P75A 4ZVNA 5CRIA 1L5HA 2O53A 2WINI 4HNUA 2PUHA 4UJ3A 5DHAA 3VYUB 1PLKA 3GLIE 4I1PA 2D7DA 1NVUQ 3H8JA 2JGDB 4EPWA 1DC7A 1QHGA 2A8YA 3VHQA 1UBGA 4JOBA 1LF0A 4UAVA 2EW1A 2HSWA 3A1UA 4FHFA 1ULHA 5F9FA 1D1SA 1GFSA 1F8GA 2FQXA 3QVJA 4W7HA 1PZXA 1EHCA 1SHJA 1UCFA 2ORED 3LFUA 4Q9HA 5JZMA 1GPBA 5JW6A 4R71A 5ELMA 3FTFA 1KJIA 2P35A 3AM4A 5SYAA 1T9ZA 1KH3A 1ECJA 4XOIA 1E4EB 3HDJA 1GT91 3FGNA 1VPEA<