2H85A

Crystal structure of nsp 15 from sars
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
347
structure length
347
Chain Sequence
HQSLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGESVKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCGCSVIDLLLGDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Putative orf1ab polyprotein
publication title Crystal structure and mechanistic determinants of SARS coronavirus nonstructural protein 15 define an endoribonuclease family.
pubmed doi rcsb
source organism Sars coronavirus
total genus 87
structure length 347
sequence length 347
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2h85A01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h85A02
2GTIA 2H85A 4RS4A 2OZKA 2RHBA 4S1TA 2GTHA
chains in the Genus database with same CATH superfamily
5F4BA 3ZW7A 2ZM5A 3PC2A 4FN5A 4ID9A 1DVRA 4PYNA 3E9NA 3ZVMA 1N3IA 2YOHA 4KQ2A 2AJDA 4EB6A 2E87A 3NFZA 3I5AA 4RPKA 3EIWA 3SZOA 4WXYB 5DNVA 2BMFA 1OV4A 2GBFA 2VJAA 2DBRA 2H2DA 4LDRA 3N6RA 1M34A 2DX7A 3EBLA 1R6TA 4XWAA 3ZQJA 3H7IA 3MIIA 1Y81A 4F12A 1E3DA 3DE1X 3A6PC 3AM1A 3SN6A 4L0MA 2BEUA 4D9KA 3QBVA 4MUJA 1RKVA 4P3NA 1T9ZA 2EG5A 2JCYA 3ZDEA 4OK6A 4HHEA 3OQMA 3EXIB 1I6LA 2ID8A 2PMCA 4H1HA 1UKEA 4UVEA 4EYKA 5H3HA 3ROPA 1KQSY 2XQFA 4TQUS 2P4QA 3N8DA 2F67A 3AETB 3OF3A 4M7RA 4RTJA 3KQMA 3ZJ4A 3IHKA 1WMEA 1AA9A 1COWA 5BVHB 3STUA 5A9SA 2XMBA 2JEZA 4FFOA 1V9SA 5EIWA 2RI0A 4FHGA 1K6MA 1Z08A 1ZN8A 2V0NA 3A6GA 1NE7A 3NX4A 4LNHA 1M6YA 4XPIA 4TROA 1IUOA 3RTAA 3E3OA 5DLPA 1VQ5Z 1FF9A 4ERNA 1QK4A 3HDTA 4E5YA 1T8WA 1NX9A 4YCLA 4Z7OB 5F23A 4Q7EA 4YC7A 1JDBC 2IYUA 3LZDA 1XD9A 5BP7A 3HUTA 4E22A 2W6IA 1ZEJA 1G7CA 3EEOA 1XK7A 3T1YB 1J33A 1FXUA 1RRFA 2AMYA 5FEUA 4POOA 1I32A 5HBRA 4HQKA 3MB5A 2P77A 2PY6A 2ZSDA 4M0CA 1B73A 4K6GA 2YXNA 5IMBA 4BO3A 2P1RA 1DU4A 1BMDA 2CZCA 3L7BA 5F4ZA 1JAYA 4PW0A 3BK1A 2H7CA 2W6NA 3AFGA 5EPUA 4BVEA 1M6VA 5DCWA 3EXEA 1XVUA 1V39A 1KU0A 4G3XA 4N0MA 2EZTA 1LLDA 2OHJA 4FOLA 1B3BA 3ZWPA 2D74A 2JGFA 1W2WB 4ZXPA 1RWQA 4BLVA 1EFCA 1L5WA 3QOWA 1YQTA 3EVTA 4MR9A 4NI5A 2Q9BA 3CC2Z 1DSSG 4TV8B 3OZWA 3BILA 5LDHA 2D13A 1A3CA 1EX6A 1GZ5A 2ST1A 3IEIA 4JL5A 2VS1A 1E2PA 2NSDA 4KOAA 1ZC3A 3F5DA 1XZCA 4JMPA 1VFNA 5B1DA 3ZDBA 4G84A 1SCUA 3MJDA 5TX7A 1OILA 2RK3A 3KQPA 4REMA 2IQ5A 1CWUA 1R0LA 3LY5A 4JI1B 2C9BA 2X2OA 2ZZKA 3KOUA 2R97A 4UE3S 3WV4A 5EUMA 3RPEA 1Q6ZA 2BRUA 1U5CA 4D41A 4RKWA 3VO8A 1XVTA 5HM6A 4U2DA 3ETJA 2PE5A 3OZVA 1JHUA 4DSNA 4ZC8A 3WK4A 1P44A 1TK2A 4FI3F 4IHJA 3F6EX 3TDHB 1MD9A 3VZSA 3D9QX 3B48A 1NI3A 1R00A 4Z4HA 4JYCA 1P1RA 3EVCA 3WYCA 5FR2A 1GAXA 1EDEA 3OJLA 3WMRA 2VDUE 3IOMA 1TT5B 1VQKZ 2WAAA 4IXMA 1R18A 1FX0A 1VG1A 1M7BA 1ODKA 4ENVA 1UQUA 4HX9A 4KAAA 5AUOB 2G4CA 1DC7A 4XFKA 3UH0A 1KEEA 1USIA 1YB1A 1IOLA 4MX8A 3FNBA 4IUBS 1RAIA 1MB2A 1P1BA 1Q1BA 1VHWA 2Q3JA 3L0SA 4WOKA 1GGMA 1PZHA 2D8MA 1JAZA 2P1ZA 3HB9A 1DXYA 4RIEA 4TM7A 4TKVB 4MULA 4RVSA 4ACAA 5HVNA 1O7JA 1P60A 3HLYA 5C1BA 1MT3A 4HH0A 2FWJA 2R6HA 3B82A 5T8KA 3T1VA 3WKCA 2MSNA 1E0JA 3A7EA 3PUJA 3HOWI 4RVOA 3OPYA 1JT2A 1S8FA 1Z36A 2UYHA 3C97A 4BQFA 3WQSB 4UKDA 1GSAA 1JFSA 5AHRA 1U5BB 1EFVA 3SYLA 2IYNA 2G1UA 4J4TA 4Y1RA 2JG3A 1G21E 4MA0A 1FB5A 1SXJA 2QMZA 1IN5A 2P7IA 3N59A 4IS2A 3R7WA 3UMGA 1TM2A 3R7NA 5LQDA 1RWBA 1TDJA 2AOUB 3OE7D 4KB5A 1CNMA 3O7MA 4B3XA 5JSYA 4BX9A 5C5IA 5DGXA 2C96A 3OU6A 1W4LA 3EBOA 2Q5FA 3GVIA 3R5SA 5G2OA 1QHIA 3A2KA 3HDGA 2NZWA 1T8RA 2IEDA 4NECA 1A5AB 3DBIA 3F3YA 4UE2A 2AB0A 5JATA 2DYKA 3HU1A 3D4NA 2YHIA 4TLMB 3E0QA 4DPLA 4PN3A 5AVQA 1F9EA 2FFQA 4YCNA 5AQEA 1BDHA 4YJKA 1WLSA 3DO5A 4V39A 1TMOA 4JP5A 1GRVA 3SKYA 5L7WA 5B6IA 2ZXEA 3ZDYB 2JB9A 4R2JA 2QVYX 2C1ZA 3P5JB 2C84A 3OLCX 2X8LA 1IZ0A 3JY6A 1J5PA 2YS6A 3QLVA 3NTQA 2XUIA 1EIZA 4CM6A 2BGTA 4GZ5A 5AW9A 3FPHA 3II6X 3LC1O 4Q3BA 2O8BB 3PSAA 2XYRA 4HNUA 4I55A 4N8DA 4TSFD 5LKAA 5LN1A 1NRJB 2EGGA 5BWOA 3JARA 4V0QA 5DBIA 2CUZA 2IPLA 1XZGA 3FVWA 4IV0A 4EX7A 4N7RA 1OV6A 2PD6A 2YYZA 3PT5A 1W47A 1IC6A 3DEYX 5EMKA 1FIUA 3BWDD 1JLKA 2CJYA 2EKZA 1XEXB 3EVBA 1E5VA 1L5KA 5G3YA 5E3HA 4QOFA 2W90A 4OLBA 1DXQA 1ZL2A 1WW2A 2ZU0C 3QE0A 4B45A 3HN6A 2DBQA 3ENNA 4C7OB 2RAFA 4U9UA 3IA2A 1CV2A 5DYTA 3UMJA 3S68A 1TE2A 3VMHA 2FW0A 1ULAA 3MK31 1CUAA 2AKEA 1WZNA 1DAOA 1A5BB 1Z37A 2QRNA 3EISA 3GP3A 2QL9A 3FDIA 3GRVA 1POWA 2AR7A 3NORA 1O95D 2DSNA 3KE8A 3Q9SA 4K9NA 3E81A 5K0ZA 2Q1UA 1W2HA 1W0JA 3C6QA 4TXNA 2OORA 4DV4B 1S0UA 4EHNA 2ZREA 3RYIA 3O03A 1Q0HA 4CT0A 4LX0A 5CITA 2O8VA 4P35A 3GCWA 3H86A 3CMEZ 1BKDR 2OHXA 2WNIA 3DO8A 2XSZD 3H5WA 4Y9DA 4A91A 2J08A 1DP4A 1XTKA 3ILVA 3SC2A 1OD6A 5GM2A 1JBKA 5DT2A 1RIFA 2GPAA 4XSGA 1A0OA 2JD1A 3L06A 1XXHB 3RIXA 5AM1A 1T29A 1GXSB 4Z49A 5TGDA 3DP7A 4CF7A 5F7ZA 4IYRA 1QQ6A 4DUGA 4IDGA 1TC1A 1G20E 1H6DA 3T9BA 1PGPA 1YOBA 2C1XA 2IKQA 5KWJA 1K6IA 1Q22A 3QU4A 4ZQIA 1DBVO 3LUCA 3CLKA 4UNSA 4YMLA 3OCVA 3V97A 3A9WA 1F8FA 2CMKA 3IR6A 3HYTA 4MV5A 3KBBA 3U9SA 5JDCA 2O6LA 4EG8A 1PQYA 4LOAA 2LCQA 4ZMBA 3SXJA 1LS6A 1Q0ZA 4QPNA 5EKUA 4DLBA 1GZUA 1VHLA 3BE5A 4P4UA 3AKCA 2OZEA 3CH7A 3GB9A 2JIBA 2LR0A 5JANA 2AFVA 1PT8A 2F6RA 2F7SA 3IBSA 3Q3IA 3JQ7A 5DZSA 2WHXA 4IDOA 4JJKA 1WR8A 2VDPB 4B7CA 4H7PA 2FQWA 5JI3E 1MH1A 1GKYA 3I0ZA 4C4PA 4D82A 4GOND 1E6UA 1GADO 4TQGA 1YDGA 3VH1A 3VQTA 2IYPA 4HY3A 4A27A 1ODSA 2C5FA 3LFUA 4J6EA 4JXKA 1D6SA 1SOMA 4HZGA 2QZJA 4HS4A 1SC6A 4EABA 2HK7A 1ESNA 1ZL0A 1QG6A 3L49A 4GOXA 2RHCA 2H4YA 2AMFA 1CS4C 4R9RA 1WXXA 5LLDA 3EVFA 2GN4A 3A3NA 3DOEA 3RC7A 3T7EA 2FYTA 4DDTA 1QF7A 1Y5MA 1NP7A 3G711 1KQFA 3KEOA 1AB6A 2IT1A 4GLBA 4BY9E 5K45A 3V6MA 3NHBA 1X1BA 2WUFA 3SE0A 1Z0DA 1V26A 2G04A 5CT4A 5FPSA 2VDVE 3VDQA 4EB6B 1CZUA 3DS8A 3B78A 2G28A 16PKA 3RYFA 5B3AA 3NBYC 4MWBA 1U3GA 4L4SA 4KN9S 4Y6PA 4NG4A 4W7HA 2HSZA 1GGJA 5CYFA 3WZ2A 1M34B 3QIAA 3GFFA 4ESEA 1K9M2 3CUTA 5FULA 3I07A 5J4LA 2R84A 3Q8WA 4JITA 1E5QA 4P2BA 3TAXA 5JHGB 1EX7A 4OQNA 5AK4A 3EFBA 4KAJA 3I2GA 3R3YA 5AM3A 1AXGA 2BEUB 3DQQA 3FNIA 2PX3A 4F3NA 3TR0A 1PJZA 2QUBA 2ZB3A 3PLNA 4LIPD 3RSLA 1RXIA 1HDOA 2JA1A 2KLHA 5IF3A 4K87A 4AF6A 3TRHA 3O2NA 1BD4A 3RWMB 2KBFA 3SJCA 1JSRA 5HCNA 5IBQA 3H2KA 3MPOA 3NBQA 4YALA 4B40A 4EI7A 1O6BA 2JUBA 3PNMA 4RHCA 2FPWA 2VUTA 3ELDA 5A9SB 1SMKA 4MDYA 4NCJA 3GRRA 4NHEA 1AQYA 3LYUA 4WN9A 5JMPA 1JLSA 1KR2A 4HDRA 4PZDA 4RD3A 4TYNA 4I1UA 3SLRA 1ECLA 1KSJA 2ZVJA 3FGNA 1N0WA 3OTQA 4BKPA 2D62A 1QXFA 1MO5A 4OGGA 5D5HA 2VF5X 2PBLA 3ZI4A 2R68A 3QVWA 1Q74A 3PC3A 1QHYA 1E7SA 4FFDA 4Z2YA 1SZJG 1YZFA 2I99A 1EE2A 3DMHA 3GJZA 4OHYA 3MWDA 1U2EA 3QU9A 2JK0A 4Q1CA 2WTAA 3O0TA 4CQNA 1LK5A 2O0LA 3OQJA 3KJEA 1Y1TA 2MR6A 4BNVA 2IYTA 2ON6A 3UWDA 4BMSA 3P9XA 1WG8A 3GLHA 3LTEA 3Q3EA 1M6VB 4M88A 2ZYUX 4RADA 3EXEB 3RYHA 2UYOA 1XX6A 4G65A 1G2QA 4GQAA 4ZJUA 1N0HA 4XJVA 1T4BA 1KMMA 1DXHA 3PGJA 4MB6A 1USKA 3WJ7A 4PYJA 5H59A 1AQJA 4OX9B 2WWFA 5LMZA 1NM5C 3F98A 4PG4A 4JHLA 2HJGA 4MR9B 2A9RA 5FP0A 2BGLA 2E18A 2OE2A 4GPEA 2FG6C 3R0VA 1H2HA 4W5WA 2VF8A 2BJOA 1FS6A 1IYZA 1HQKA 4H3VA 4X90A 4CM5A 3ITKA 3B2EA 1SCUB 4C0AC 4YUYA 4M1EA 3R4CA 4IJ5A 4IWYA 4BQNA 3DW1X 4QBKA 1W48A 4DLWA 5D1HA 1N2CE 3D8NA 2D3TA 3IAS1 4QSHA 2P5YA 5EXPA 4OHRA 2NTVA 2VSNA 1G1MA 4L9AA 1C2YA 4NFLA 2XMDA 1CRZA 3V8PA 3CUEF 3QUSA 1NRIA 2QUHA 2FW6A 3AHIA 4IHJB 4DSTA 2ODNA 3FZQA 4WZBE 3FKJA 1XTSA 3GPCA 3IAS6 1U0LA 3C8HA 4UNPA 2H2IA 2YW2A 5LFAA 4OM7A 2G6BA 4LS3A 4YP6A 4B17A 4FK8A 1XQVA 2BJWA 3IR7A 1FLNA 2H7VA 3OCUA 4FBGA 3QWIA 3IEXA 2A9VA 1JAHA 1QM5A 3K6RA 4EFMA 3Q3VA 3H84A 3PIIA 3QE3A 1FX0B 4I3GA 4QWMA 2R8BA 4DIUA 1DCFA 1M2GA 1I9GA 1PR4A 2ATXA 2VP5A 1KEEB 4LC0A 2WSBA 1BVYF 5CXXA 1SCKA 3WZMA 4DIOA 4EGCB 4HN2A 1L4BA 1KAOA 2ECKA 3F6BX 2ZK7A 1ISJA 1Z38A 1JTFA 3D6AA 3JQAD 3WLRA 3C5HA 3UICA 2DT8A 2FDXA 4HDCA 2A5GA 2OL4A 4UHEA 4CMBA 1WM1A 4FDTA 1S5PA 1K0UA 4AY3A 2ZIEA 5TJHA 1B00A 3D02A 2V6JA 1PJTA 5JW6A 3AB3A 2NU9A 3OPYB 3AR2A 2PMKA 3K71B 3OX3A 4H18A 1X7XA 1B8OA 4GGPA 4YRAA 1SR8A 1LX6A 1EFVB 1SXHA 1TNDA 4DM4A 4Y1RB 5TJ9A 2J48A 1E0AA 1KKMA 2GN2A 3FB1A 1K06A 5FBZA 1SXJB 4K1XA 1DB3A 4JBNA 3ZGOA 3R7WB 3MA0A 1VMIA 3TB4A 3ZGLA 5DX0A 1EXMA 4RWZA 4IM7A 2XCQA 4HQ6A 2XYVA 3WRYA 2DPHA 5TMEA 1VI5A 621PA 4C5CA 5BN3A 1H66A 2VJYA 2QVZX 1P17A 1NVEA 2RGDA 2PT9A 2VT7A 1EVIA 1ZD9A 4M1ZA 5AUPB 1V2GA 3URKA 1RMQA 2JIZA 1LVGA 4ER0A 4LJLA 4LSZA 4WZAA 3TKYA 2YHIB 3UIEA 4WBXC 1A8PA 1DKQA 3IMGA 1OAOA 3GG9A 1IEXA 1QLWA 3O83A 5HMMA 5E7IA 4R9UC 1G5FA 4R6XA 2FE1A 2PLAA 4ZQGA 1KMIY 1ZEMA 3FVQA 1YRBA 3RVKA 3LCCA 2B4TO 1I13A 2C7OA 2W2XA 4KO3S 1B6GA 4G97A 1IY2A 4RYDA 2FWNA 3NHYA 4XM2A 3L18A 2FSHA 4NXNB 4UJ3A 3THWA 3IOBA 4NDNE 4D45A 3AVWA 4E5VA 1VJ0A 3BOSA 2Q27A 4XIGS 4E08A 1A69A 3UWKA 3DD1A 4MUBA 4I55B 2WM8A 2PMWB 3LW8A 4WGFA 4ONEA 2PGNA 4HTAA 3L46A 3K9GA 4P81A 4YI3A 4DW8A 1WXFA 3JARB 4W82A 2WF6A 5FQNA 5HR5A 2E2II 2H7XA 3EW9A 3PFIA 2IYVA 2QGFA 3UMBA 4CR7A 1MZPA 1WHSA 1ZX1A 4JJFA 3OEWA 1E3JA 3SZMA 2ZDGA 2WINI 2FPMA 4DVJA 2B69A 2CJPA 4AJEA 5JAHA 2FWMX 3LQ2A 2O7QA 4UTVA 1BOOA 1J2JA 3E8SA 4MW2A 5ELXA 3ZDXB 2KB0A 3PXGA 4DLLA 1CK4A 1PF7E 2B9EA 2P3OA 1Q7RA 4Y8VA 3PPIA 1OSNA 3ZWDA 4E1BA 1KMQA 4OQYA 5TMPA 3NTOA 2DFKB 2MMCA 1P3JA 1ZK2A 1ZKMA 5AHKA 5EZSA 5P8WA 4BB0A 5JH7F 5JT1A 2E2JI 1FTNA 2CNBA 1Z9BA 2IHYA 4NU8X 4ZGBA 1E1YA 3RYIB 5ADVA 4U7HA 1ZO8A 3FPEA 4E5NA 1CUXA 5EFOA 5G0SA 2II6A 3ZBTA 1F7VA 3S29A 5JNVA 1G5QA 1NNSA 3C8MA 1WUHS 3ST7A 5TV2A 3RSCA 4KO1S 2RHTA 1QIKA 5AK6A 5EMLA 3SC2B 3SLGA 4PQRA 1XIVA 1DBPA 4KR2A 4JLUA 5DXAA 3T94A 2HLPA 3LWNA 1TCAA 3M6UA 4N76A 4KKVA 1IRIA 4TMXA 5AESA 5HNKA 2V6FA 4RCVA 4E03A 2XQIA 3CCBA 3E3NA 5EXDA 4Z1MA 4NEQA 2NVWA 4MPRA 3F1LA 4TZ6A 4Y2UA 1L1FA 4XX2A 4ZT4A 3FFXA 3TZKA 3EGCA 3DV2A 4OI2A 3NOVA 4A5SA 4BO7A 4FGUA 2CD9A 3UV7A 1RLOA 3W8DA 3ZE2B 4C6TA 1OA1A 1LUAA 4XIIA 3BIWA 4WCVA 1G8GA 5IASA 2GYWA 3P32A 4PAGA 2NGRA 3MLEA 1JX6A 1SC3A 3RKUA 1W5TA 4MQEA 3DOFA 3GJRA 3OPVA 4QUIA 5IVIA 5EJ9A 4GRAA 2KWIA 4FNAA 5LWQA 1ZH6A 1H9BA 4BTVA 5C8XA 1XQ6A 3B51X 3JQ7B 4JJ6A 2BTOA 3WB1A 1GPLA 1WIWA 5A2GA 2EJCA 3GH3A 3HA2A 5I4CA 4JT4A 1O0BA 1PFKA 1QV9A 4G85A 1IOZA 3ZGXA 1JMVA 3W2GA 3U60B 4U5XA 1QRDA 3IT1A 3KPUA 4A8TA 1NNEA 4JJIA 4PVCA 3U80A 5JHHB 2Z57A 3STVA 1U3FA 5EWMA 5L45A 3A3PA 3N87A 4G5OA 1VJ5A 4COOA 4MRPA 3OO0A 5TVKA 4PX3A 3HUFA 4BUZA 1Y89A 2JBHA 2QAIA 3VMGA 2PT6A 3H5VA 5IH7A 1TUEA 1J2TA 4OHZA 2Q1XA 3M70A 4N3AA 3QU7A 1E9SA 4HOYA 3H9EO 4E5UA 2NZ8A 3KUKA 3W6UA 4OUKX 1NZFA 4NQRA 4UHDA 1P3DA 3BX1A 4CV2A 1A98A 3FCSB 1H1LA 3PT9A 2ZRGA 3RYFB 5IM4A 1RRMA 2GU2A 3GRUA 5LA6A 4V0NA 3EIHA 1VSUA 3BERA 5CDYA 4WK2B 2YJ3A 4LJ5A 1ATZA 1JIIA 4ZI7A 5FPYA 1PK7A 4QAJA 4NBEA 4YCCA 1U8CB 1VE1A 4ID3A 3EIEA 1DDOA 3QPAA 1OX5A 2I3GA 3GGSA 4J7XA 4BLPA 1E64A 4EHFA 2I4TA 2QU7A 3AI3A 3RIMA 1VCHA 1VTKA 4EI9A 4JOCA 4UTPA 4MQLA 2VK1A 3BSFA 4FINA 1YDWA 4FEAA 4NFHA 4WADA 4RE5A 5C4MA 4GDFA 2G1KA 1M6HA 2VIIA 1Z7WA 4GI2A 1XZ8A 2X41A 3EEBA 4QVGA 2EHDA 4NULA 2AI1A 1IY8A 4FSXA 1GTVA 4KMRA 1AHNA 2XB9A 3CGGA 3D6NB 3QOXA 3M3HA 3PFFA 4P36A 5EC8A 3X2EA 3W1WA 1XKXA 3HPRA 1XZMA 1Y7TA 4WN9B 1X92A 2DM6A 4NZ9A 4II7A 4QGFA 5THQA 5BWBA 4HDRB 1PNOA 2VP2A 2YZ2A 3SJ7A 5IC5A 3W2IA 2HV9A 3IAFA 4L7VA 3L7KA 1PJQA 4N39A 5BMOA 4S0ZA 1ZUNA 2HA5A 3T35A 4GVLA 5GIPE 4BNTA 1EESA 3MWDB 4URUR 1A5SB 1PWXA 2G08A 4N5HX 1LPNA 3B85A 1CJKC 2C57A 2F1JA 1P7CA 1XPOA 4JXZA 4IMRA 4NZNA 2P2SA 3QLTA 4TWBA 4KOEC 1YR6A 5BR7A 3OFSA 2HM7A 3ZXSA 4EHIA 3KR9A 4NY1A 4RLHA 5JO0A 1II8A 4K6CA 3RYHB 3PQDA 1OW3B 1FSGA 3OOYA 1PWYE 2KQUA 3KETA 1ES9A 4LHVA 1ZI9A 3LX5A 5TARA 5J9FA 5JYEA 3L6RA 5FUMA 3UN1A 1P7VA 1E9BA 1YZGA 4XWYA 3G4SZ 1ENZA 3Q11A 5DJ5A 4MNTA 3TQHA 3T7KA 4CR8A 1F20A 2OCYC 1SZCA 3H8WA 1OYYA 3AHJA 4B46A 4MV7A 3NYQA 4V03A 4CWAA 2C9ZA 5DGTA 3VZBA 1YDFA 4Q4LA 4TX1A 1Y82A 3T7TA 3UXYA 5JR3A 1RXWA 2Q4TA 2WK1A 3L77A 4A5OA 1JEJA 4MICA 1ESEA 4PPNA 3K1YA 2OBNA 4KWCA 2LP4Y 2DWQA 1MG0A 2FP4B 1AUXA 4MB2A 1FFBA 3F90A 4B80A 2CXHA 4KX5A 2J9ZB 1TZKA 2ZR8A 1E1KA 1JQKA 1F2UA 4U63A 3W5UA 2FWIA 4NBNA 1Q7Y1 1R9MA 1YBVA 1RXSA 3TL3A 4BX0A 5CDSA 5IVHA 3ITDA 1OHHD 2RBKA 2ZW9A 3T5CA 1BJKA 1RYZA 4G41A 3F71A 1Z6TA 1FRZA 4J0EA 1DAEA 4BO2A 2H31A 3F3SA 2HHAA 3CYFA 4RH0A 1A8UA 5JD5A 2IHTA 2IRWA 5D6OA 1JA0A 4RAQA 2IYOA 2HF2A 4D99A 1XRPA 4AXBA 5A5EA 1HFKA 3H1BA 2PBZA 3H5OA 1T8UA 2VPZA 2WOOA 3PWTA 4GECA 3W5SA 3SYMA 4CLOA 1IBLB 4LI0A 1Z83A 1YNSA 2LPMA 3OZCA 1DIAA 1LQLA 4RTLA 3O84A 5FBVB 1NBIA 2JLBA 4QM7A 1OWMA 4WWHA 2NU9B 3A1FA 4QYTA 3SOPA 4JLDA 2E9SA 1R6DA 1MIOA 1X7XB 2XUZA 3E15A 3IIMA 3QMPA 2I65A 2QX6A 2FEWB 3IVCA 4HB0A 4KNVA 4CKYA 3I9KA 1LFDB 2R4TA 2GF9A 4JIGA 4KITB 2RARA 1VCIA 2BSQA 2GZDA 3VC3A 4G5SA 1PS0A 2R8EA 3CCMZ 1OGIA 1P2SA 4J94A 4LW8A 2B7BA 4AQYB 5FLXA 5LIRA 1Z0AA 2OLKA 5BN3B 5IM5A 3N0VA 2X2PA 3ZWAA 4U6QA 1D2EA 1XCGB 2ZIVB 4N8SA 3GX1A 2ONYA 5T3UA 2OV1A 3DLAA 4C0BA 4L51A 2G5TA 3IP5A 4XDGA 2FR1A 4HKTA 4WZAB 5KQRA 2P30A 4DMRA 2RT9A 1TADA 3NTVA 3PPWA 4RQTA 4F86A 2SKDA 1NVTA 4K9LA 4PGHA 4K46A 2OOYB 1U1IA 3ZVRA 2ZAEB 2AW3A 1Y1LA 1HQCA 1XYVA 2C5AA 3AU8A 1H0KA 3CSSA 4BWFB 4EGAA 5C7LO 1ULTA 1ZK1A 1CY4A 1YMVA 2EW1A 4JI7B 5B1HA 1RXCA 1E3SA 1DX9A 3CEPB 3RG8A 4EW1A 5JYCA 4MW6A 4O2LA 4WIAA 5HIKA 3EXAA 1M2FA 3THWB 5F98A 2XGJA 2CFTA 1UXKA 5HWSA 4YRIA 2IPXA 2RH5A 3H2IA 1O08A 3NDIA 2K87A 2ZRNA 4BWYA 4EO9A 1UK7A 4OSOA 4L57A 3WWCA 3W5BA 2IUTA 3ADOA 1M8JA 2O3SA 2PLRA 3IEUA 2VCYA 4CMCA 3A1WA 1YJ9Z 2RIRA 4X3CA 4YRTA 1YJ5A 1WHSB 1S7CA 1NR7A 5IJZA 1PYDA 1ZR4A 2UU9B 5TC4A 3JRXA 3QP9A 1MHTA 1D5CA 1N6PA 3G2JA 4IVNA 4RYLA 3GNSA 4G4SO 2QLFA 1AC5A 2GJAA 5H1YA 4HFRA 4BV8A 1ZPDA 2XDAA 4UTNA 3LYHA 4OVKA 1ZH2A 3ZCTA 2OZLA 4MQMA 4PXYA 2WAQA 3BJRA 3KUDA 2FUG6 1YRYE 1R8XA 3O8DA 2OWDA 4B2LA 3ZCUA 2IZ0A 1G8SA 3KAKA 1QIMA 1FMFA 2H6EA 4ZVUA 1GGVA 3S2ZA 1WW9A 3DDHA 4ZN6A 5BMVB 1DIRA 4JC0A 4B0PA 4K1LA 1DZIA 3SLKA 1V8FA 4CQMD 2EGUA 5A62A 4PHGA 1K75A 1YK0A 4IGAA 2IYZA 1KAMA 2RG7A 1SXIA 4J1QA 1SM4A 4V0SA 4AF7A 1E6CA 5DYWA 4D0SA 4A3EI 5CDFA 5MDHA 1AIPA 5FOSA 2O7VA 1EPUA 2CD7A 2PHZA 3DJFA 4N49A 1XNQB 5HIIA 1IONA 2QRLA 2L18A 2FN3A 4Q21A 1OR8A 4HX2A 1T0UA 2NU7A 1UOPA 1FYVA 2C29D 2LTAA 4IOLA 4EI2A 1NF8A 4GEGA 1U3TA 1FA9A 2XNKA 5AT1A 1UBSB 1Z0JA 1PJSA 2MINA 2Q0QA 3I01M 5LP6C 3ZGYA 2R66A 4ZT6A 3T4XA 2DWUA 2C0CA 4LWOA 1BWQA 2HXYA 1ZMTA 5IDVA 4ND6A 3U6KA 3TYXA 4C6TB 5K03A 4N9WA 4EWCA 4R01A 2PJRA 1JJFA 2JLYA 5F7XA 2YY7A 4R1TA 5AVXA 1G5RA 2VATA 2MSCB 1FNSA 5GZ6A 4ARAA 3FTNA 3F9CA 4MQEB 4BP9A 1JTVA 1IG0A 2O4CA 5DBFA 1M1UA 2CWWA 1R4NA 5FCDA 3O8RA 1FL9A 3X43A 1QO7A 3ASYA 4KUGA 3NMUF 2Z1NA 3EHEA 3UJHA 1T3GA 2H07A 1BZYA 3HXKA 1DAHA 5AHXA 3VI4B 1LTHR 1MAWA 3BEOA 4EHLA 1UH5A 3B3GA 5TQ0A 3NDBB 4K6HA 3CD61 3A4NA 1XZNA 3HB1A 1Z6YA 5F76A 4DLYA 4P80A 3EGDA 4HEA1 2OC4A 4WLVA 1MOZA 1Z75A 4DILA 3BXPA 3L8MA 2LNDA 3QKUA 3PJDA 4H16A 1A50B 2QMUA 1N2XA 2JVIA 4FOTA 3OJOA 4LZOA 2M2IA 2VH5R 2WG0A 4RSHA 2VLBA 3DA8A 4JJ4A 2Y05A 4AO7A 2M6NA 4JP2A 1OI3A 2NACA 1OXBB 2Y67A 3DFMA 4UU7A 2VYCA 3VNAA 2VTVA 3I9OA 5EHQA 1JKFA 3HWSA 1REQA 2L42A 3IQHX 1H1LB 1I6WA 3FNGA 3LLMA 4I7EA 1ZIYA 1QDUA 3OAAD 5LA6B 4K5QA 5DN6A 3S2GA 3F8WA 4LXGA 1FLAA 2VCHA 4S3MA 1ADBA 1V35A 2GHTA 4ZI7B 5IK2A 3M3PA 3L05A 5IDXA 1N2SA 1TEXA 1Z2PX 5BUZA 1H2RS 3MVEA 4JLNA 5AW0A 1ECBA 4S0XA 1PJ4A 1DAKA 4E07A 4N41A 1H0HA 4FLFA 2O8DA 2QT9A 3I9V6 4O08A 1HZJA 1IZZA 1KORA 1PR5A 2G4VA 5SY9A 1VKRA 3WIEA 3QVVA 3AOEC 3MCVA 1K6XA 4M0KA 4YAJA 5K3SA 3CNQS 4XRGA 4F3TA 3KDSE 4ZVVA 3MT7A 1DMSA 1SURA 3OJFA 3S7TA 4KE9A 1CJMA 2XRZA 4BKOA 2JZOA 3FWHA 4HQLA 1QIHA 2A5JA 4FE4A 5PNTA 4EA8A 5LXTB 1KJ8A 3RRMA 1HFEL 1XNGA 4KVGA 5TQJA 1UXGA 1D5WA 3FOZA 1GP2A 1C1DA 1OASA 5DVZA 2R60A 1DG9A 2JBAA 3L6CA 3U4IA 4GSYA 4IYJA 1NBHA 1RKXA 3VGJA 1E60A 5HS6A 1ZUNB 3O7WA 2HOQA 4Q3OA 3LJKA 4M7OA 1R8QA 5JOQA 2ILTA 5C5DA 1E8DA 1UQRA 3HCPA 4OTZA 2XUGA 2GGSA 1TAGA 2EGTA 2CNDA 1E2UA 1MOSA 1FQJA 3GTOI 3CCL1 4TL9A 2IYXA 4PYQA 1MXHA 3G5MA 5IKOA 4OHFA 1EX9A 1NW6A 2G06A 2GPYA 2ZYAA 4KTVE 1D2MA 3GI1A 4PHFA 1II8B 3N8IA 4OA5A 4P4LA 4Q1BA 2WY2D 3LO5A 4YS6A 5IARA 5L3SB 2Z0MA 5A06A 4ZT7A 4QOHA 2VAXA 2G5GX 1YGYA 1HA3A 1X0XA 5B6JA 1W2GA 3ETDA 1YZQA 4GAEA 3F3MA 1UP4A 2FRDC 1U2SA 4KYTA 2C5SA 3JQGA 5JDIA 1E2BA 2GPTA 5IVKA 4JL6A 1P3Y1 4GOKA 3LVBA 4V0ME 3T34A 1YULA 2PKQP 1JDJA 3A3OA 3HNOA 1D0VA 4BVGA 1IULA 3KYBA 4QLAA 4LV6A 1K7CA 1VA4A 2VPXA 3IP7A 4GNRA 1W94A 4IV5A 1U7HA 4BB6A 1S8OA 4WTOA 3OJXA 4PFKA 4W99A 4A2PA 1HNZB 3V1TC 2V5UA 4UCWA 3S1AA 1CDZA 1QAOA 1AX9A 2GZ2A 4OPMA 2VG8A 5AW2A 3NBFA 4DNPA 1BX1A 3CSDA 4EY4A 4MW4A 5EXTA 2JLVA 5KMGA 1SFOI 2ZIXA 2ZT5A 1F2UB 2CFCA 4PCLA 3A3YA 1G4HA 1T5SA 3OM9A 1WCWA 2XJ4A 1O03A 1VQ1A 3B2NA 4UM5A 3NW9A 1GCOA 3HVRA 3WYNA 3GNQA 3M6LA 3U3JA 5BXQC 4TN5A 4KSBA 1Z56C 4JS0A 3NIGB 4EX6A 3BTOA 4DC9A 3HBAA 4JJAA 5FOQA 3CE9A 4ZCMA 1QRRA 2FVXA 4MHOA 1IY1A 3N3BC 2XEXA 3GELA 3UB2A 4R8VA 5FTJA 2NO4A 2I55A 2Y4OA 5A4FS 2Z98A 3I1JA 1VE5A 4GI3A 4B43A 1LFAA 2C2WA 3FE2A 2CUTA 3GTJI 1H8ED 1RQGA 2GPNA 3G85A 3QSYA 3O9ZA 1K68A 4CLOB 4CNQA 3U09A 2M98A 4IH9A 3NWEA 1NURA 4OAPA 3EDOA 2FSUA 2CL6X 2RKWA 4J1SA 3V7UA 1U0NA 3UAZA 3WLOA 2B63I 1MIOB 4EB0A 4TXHA 3RIYA 4X65B 4DUZB 4CG0A 1F4VA 2J4FA 1VM6A 1FJ2A 1HRDA 1OBCA 5CLHA 3B6MA 3Q12A 3DKKA 8AT1A 4Z3KA 1G8PA 2C2GA 1C30A 4JVMA 1T2CA 4FFRA 3DZKA 4WKPA 1GGKA 3ZKWA 2F00A 1E69A 4MI6A 5T7BA 3VKUA 2QLTA 1DBSA 4FE7A 1YZLA 1KZHA 4EGJA 2HBYA 4J3FA 4L78A 3CG4A 4RD1A 5HDQA 1FRFS 3NVDA 3EZXA 4NB8A 2D00A 5KYNA 4OXYA 2ISCA 2QX9A 3QPUA 3RVSA 2XHEA 4Y7NI 1E2LA 2NMVA 4Q48A 3VSEA 3M0EA 4TTJA 1CZLA 1N4DA 1UP7A 3QWUA 3SYRA 3CCV1 2ZZMA 3KLNA 5MGNA 1E0DA 3RS9A 2QKDA 1Z4KA 3J81f 4HWRA 1ECGA 1M5TA 4A3GI 4ZAYA 2B34A 4GGMX 4IGIA 1W36B 1GKLA 3J80f 3LK7A 1SBCA 1ZHFA 2IYLD 3GOHA 4Q3AA 5E7JA 4IO1A 4ND8A 3ONWA 4RO0A 2I8CA 4D43A 2BKAA 1PTJA 2QD2A 4AU1A 1LPBB 1DC3A 4AS3A 1DADA 3I1YA 3QKIA 3WIBA 3AONB 2HSDA 1KS2A 4U7GA 1JNXX 1BS2A 1YQQA 4M4SA 5KHAA 5KU7A 3I8XA 1AO3A 4URFA 4RJTA 3ITEA 2ZQ5A 1ZRHA 3FX2A 1AGNA 5T4FA 1CUCA 1SY7A 3GGCA 1QYWA 3IOEA 4P7BA 3TOCA 5I51A 5JU6A 4ZU6X 1HNWB 1G7SA 4MVJF 4GUAA 4EZEA 1JECA 2V8JA 2HZ7A 1VLJA 4M8KA 4ZVOA 2VZ8A 3EG9A 5FUXA 2C9OA 1H5QA 4UUNA 1QR2A 2VK8A 5FOUA 2XYQA 3VNVA 3GBSA 2GM9A 2ZYHA 3A4IA 3GNTA 1E6MA 4DSOA 1BOFA 1FMTA 1VG9B 4YI5A 4EEXA 5AVSA 1XE3A 2G9QA 5C8VA 5FA6A 1GPYA 5KPDA 3EVDA 1X38A 2ZVDA 1TW2A 3VR4D 1EP9A 1WU7A 2H2GA 4XUCA 5GV7A 1ONBA 1ULUA 3FOBA 4H60A 1NPDA 4YRSA 5JBQA 4OHPA 4OA8A 3L7CA 1U4NA 2GPSA 4BJ1A 1HORA 1Z5OA 3CVXA 1JL3A 1GUDA 3OKFA 1RDFA 5JSUA 5LDDC 4JT8A 2RAVA 1Z3CA 1TMKA 1SRQA 1ZHHA 1Y5RA 2I54A 1E3MA 2R8PA 2Y0EA 3BZWA 1WMFA 3PCRB 2HJHA 3LC2O 4N0DA 2BY4A 1EK2A 2HZBA 4HAIA 2RGCA 3T9FA 2CHQA 2NU7B 2BGJA 4NMHA 4UQOA 1A2BA 1UWKA 1OZ0A 3ND8A 1ZGAA 1XPJA 3Q3HA 1L1EA 3CLRD 4RHUA 5I7OA 4P7FA 3BGSA 3RVPA 2MINB 1IHXA 3HP1A 1Y4SA 3UT5A 1ZU5A 4ARBA 4DCNA 2XAUA 2Z5LA 4RK5A 5A3SA 2J7PA 2CB9A 2OZPA 4CTKA 4TLBA 4F7DA 1UL1X 4RIHA 1JB9A 3NC1C 4KFCA 3CVOA 3NTLA 1G2PA 2PIDA 1IXRC 4UC0A 2XX3A 2IVFA 4CM3A 3OU2A 4Q7KA 3NALA 3IAEA 5D1OA 3NATA 4NYJR 3STWA 4MCHA 1L5LA 1XL1A 1NSYA 1R4NB 3CMMA 3KU1A 1O94A 1Y3DE 3N2EA 3OT5A 2PXAA 2BH2A 1QKJA 2ACEA 2CVOA 3UHAA 4IIVA 4DNFA 4YO8A 2XRFA 5F9FA 1Y3AA 1UDBA 5TQ0B 1FSPA 4MUGA 1DBQA 1TF2A 2JJ2A 3JWJA 3U3OA 4YDQA 2EWWA 5FFNA 4XCVA 1XC7A 1NOKA 1QBGA 3LF1A 5SZHB 3EGDB 4L4UA 3IA7A 4JI4B 1W96A 5HKKD 3HS3A 2VT3A 3ELUA 1NMQA 4ZVMA 3K92A 4RESA 3CO0S 1VQPZ 1QGYA 1RPTA 1RW4A 2BI7A 4LOIA 5K4AA 3UQYS 4HMPA 2H16A 5MN4A 1W25A 2CF5A 4PAOA 1RS0A 1D3AA 3PNPA 1TYAE 1XELA 3FIUA 5DLEA 3GEDA 4NWIA 5KJFA 2QD4A 5EESA 3UK2A 5JNLA 1REQB 1TQ6A 3G8CA 4HDKA 3VU8A 4OF4A 4OK5A 4D3DA 1BXKA 2HHHB 1U6JA 1HDZA 5LUAA 2R8XA 1PX2A 4MV3A 4DLKA 4DQLA 2OECA 2ZBEA 3LCMA 4IQ4A 3TW0A 4YT8A 1Y37A 1HYGA 1V1MA 5EJ2A 1IU9A 5TNXA 2AZMA 2E55A 2J85A 4BNIA 4DDVA 4BPBA 5FI1B 4HH3C 1QFJA 5JG7A 3KXPA 2DR2A 3N2IA 4IIXA 3BDVA 2DHDA 5BV8A 4F21A 3HZHA 1C9NA 3IRUA 1KEKA 2O8DB 3WR5A 3BWXA 1DG3A 3DEAA 1OBOA 2HW8A 3DBOB 2EKDA 3JRNA 3L0PA 3LOPA 2AIRA 3THYA 4I81A 3K53A 5I3CA 3NDJA 1Q822 1KF0A 4EJSC 4GPBA 2RIPA 2PUCA 3NM4A 4RZIA 1OIVA 2H1OA 4YAUA 4I5FA 5K3CA 1AF4A 5JMWA 3BIJA 4HYQA 4OM8A 3VTAA 2Q1TA 4M1YA 3EE6A 1L7QA 1U0JA 1NHGA 4A3BI 2HNKA 5DHPA 3K5HA 1C1DB 2YY6A 3K5WA 2JBAB 1S3IA 1QIGA 3HLKA 5BV7A 1TCVA 3DZFA 1VQ9Z 2HU9A 4JEIA 4BXOA 1JEDA 5BW4A 1EK5A 3L41A 4JJ7A 3F49S 1SUFA 5A7GA 3GIWA 2X8AA 4FEYA 3FIJA 4OP1A 3TRFA 3DBRA 2CC2A 2ORED 2A5LA 1I1OA 4FGKA 1YBMA 3P0HA 2Q51A 2V7QA 3HZRA 4BATA 3ZPXA 5KYWA 4AQ7A 2TYSB 3OFNA 3GXOA 4X93A 3SQDA 4E70A 2DEUA 2DTEA 3RSZA 3A2NA 4KFRA 3S5UA 3R20A 1VIYA 4GFDA 4Y9RA 2PQ2A 1HYBA 1CUVA 5DIZA 2PUFA 4LF9B 1E2EA 3KP1A 2BELA 2AC4A 2E4VA 5K0SA 2CLEB 3B7GA 3ADDA 4IJWA 3GJ6A 3FNEA 3K16A 1DX4A 5HCUA 3JQGB 2BLLA 3CX8A 3V7WA 3HM9A 2O59A 1NDQA 4A3DI 2IZ1A 1HI9A 1F12A 3AR9A 4JA2A 2BD0A 1A77A 3H0GI 4L02A 3U9TA 1OJLA 3UFXA 3D2CA 1ODJA 1XBTA 2JHAA 3D1VA 4F1WA 1UK8A 3S5JA 5JWRA 3WYDA 2QM0A 3KXDA 4TMZA 3VVBA 3TD2A 2R92I 3NV9A 3S1AB 5C80A 3GDOA 1SB9A 3M6FA 4LY9A 1PHRA 3VV2A 5FLKA 4C87A 6GPBA 5KMGB 3EQ2A 1UXJA 2FLKA 2ZIXB 2BM1A 2O06A 4OQZA 3FRHA 3TCKA 4ND2A 2COEA 4CVNA 3W6NA 4EY3A 4EUFA 4PX5A 4FW9A 1RWMA 3OCZA 1PGNA 4AZTA 1WX1A 2J6HA 4ZYWA 2VA9A 4LJKA 2CVHA 5KNCA 3MQ2A 4YIKA 2MYUA 2Q6KA 4DWWA 3NIFB 2JFQA 5F9MA 3WJAA 3QU5A 4UXIA 1WUKS 5KOHA 3VOTA 4DJDC 2QTNA 1FSZA 1D6NA 5HUJA 4MMYB 2CL7X 5AUQA 4MROA 4YV0A 3TLMA 2EXXA 1XXHE 2YNMC 3OQIA 4N6OA 4J90A 5DCUA 4CG2A 3BREA 1AUQA 3P2IA 2B5VA 3P97A 4FOSA 1M76A 4L50A 4BB5A 4C7XA 3IDSA 3VKVA 1E1NA 2CMGA 3NHLA 1NUHA 2BI8A 1D9XA 1YWGO 1MJNA 2HU2A 3VR0A 3ERCA 1WSWA 1PNVA 3HCBA 2N1MA 4G0PA 4IJ6A 4CDMA 3JR3A 2XMPA 4R98A 3DEIA 3N7AA 2EDCA 2GVDC 4WLNA 4EB8A 1E6LA 3L6OO 1U8AA 4DTIA 3BMQA 4MH0R 3DOHA 2XQKA 4KHZA 3IQIX 1C30B 5AW3A 2BFDA 1U8ZA 1F0PA 5BN5A 4JELA 3IYLW 3CONA 3ZKWB 4MYHA 2G63A 3G0CA 3WSTA 1YAJA 2B2XA 4IJKA 3PP8A 3SKVA 4MJ3A 4EJMA 3KKQA 2OZKA 3HWX1 1EVJA 1DINA 1P4JA 4M98A 4ZV4A 4ARCA 2DE7A 3SSNA 1XEWY 1YONA 3MJCA 3QBTA 4NBCA 3RS5A 2BCEA 3UHFA 1MMFB 4AUMA 1SEVA 4A0SA 1GSHA 2AG1A 4Z4CA 3TRKA 1YDMA 3H1FA 1RHQA 4QGBA 1H2AS 1G16A 5DV9A 3C5EA 2C8VA 4DR3B 1Y3CE 1KYZA 4PM4A 1HMYA 5JEEA 3GTLI 4CLXA 5K0NA 4Q4JA 2GJSA 4GW3A 1TFUA 1PQWA 2GM5A 2DFLA 1XMJA 1TVKA 3QEJA 2X5OA 1GLVA 5F64A 3PQ3A 5CK5A 3NYIA 1KDVA 1SFRA 1XZLA 3K6KA 4BFSA 1P4RA 4BU0A 1OLUA 4FC7A 4K2AA 3I0NA 4ND8B 3CO5A 3NM6B 3RTDA 3WB2A 1M34E 1XMSA 3JZIA 5E38A 4MGHA 1OH7A 2HEGA 1RT9A 1IWPB 1VMDA 1YO6A 3GMSA 3X2SA 1V6CA 2AYYA 3UZUA 1IK6A 2RGNA 3A1CA 1L8OA 3KJFA 2IIVA 3NVAA 3OFKA 1UDAA 3U16A 1D8TA 2J3HA 1KD12 2X7HA 1S2OA 1T43A 3LLSA 3ZHXA 3I4NI 1DJMA 1DPGA 4RH3A 5H68A 2BM0A 4YRKA 3M6AA 3R4VA 5HRUA 3MTDA 2MJLA 2YBEA 2VNSA 4R40A 3FVRA 4NNOA 1PFYA 1N7HA 4XFDA 5AICA 2NG1A 3R7SA 2QY9A 3RAPR 2FP3A 4IUCS 4X41A 4BC0A 4DA0A 4DR2B 1Y6GA 2FMIA 1G9SA 1G98A 3EG9B 2VDMB 3M9XA 4LDNA 5LOVA 1RQRA 3V2HA 1GU0A 1AQ6A 1DRVA 3G49A 3BICA 4Y2RA 1DIGA 3C3JA 1GQYA 4N9QA 5KQMA 1SVMA 3IF8A 3KWFA 3QOFA 4O63O 5AXDA 1RBQA 1NJ8A 3QVXA 4B5LA 2YV4A 1VQOZ 4MW7A 1Z18A 1BX0A 1MT0A 3I9LA 4L9RA 1KYIA 1WXIA 1D1PA 1VGRA 3K9WA 1NXVA 4MIYA 1FDIA 4J1TA 2QXYA 3O4RA 4PG7A 1J1IA 5JTUA 4Z4EA 1L4MA 3A6LA 4P7KA 3GFVA 1I51A 2G2KA 3DLBA 1H3FA 1T4DA 4BCDA 1PBTA 1D4AA 1UBCA 3QPBA 4NBTA 3EMDA 3RJMA 2OHIA 5ILQA 2REOA 4A3MI 4BNWA 4RU1A 2Q4ZA 3LQ4A 4FFPA 4I50A 3CLTC 2R5NA 4D5EA 4AKEA 4DLVA 2WTUA 1U7TA 1CFJA 1I4EB 3LDFA 4A3II 1QQTA 3H9GA 4KN6A 5H7XA 1CVLA 3DYBA 3NDPA 5GADl 1VGQA 4EMTA 2QEXZ 3ZKAA 2DPLA 2GHRA 1Q0SA 3TOVA 3T3MB 3B6KA 1Z26A 1XVAA 1DFGA 3X2FA 4DL9A 4IJQA 4X8MA 2YRXA 4YFYA 3UT5B 1GNVA 3V1KA 1BDJA 1QPBA 4G0UA 3QX3A 4DJEC 4LE0A 3EXFA 1UEJA 4HGZA 1HDIA 4F2PA 2BZ1A 3FFTA 1I7PA 3EQ6A 1ZM2A 4PGAA 3SR4A 4JXXA 3IP8A 1ZGGA 2DFVA 3DEHA 2VQ3A 3TDKA 2JAUA 3QXJA 4G0NA 3K4QA 4UEJA 4UFNA 2GJ8A 2B78A 3AOGA 3BXFA 4CM9D 1DARA 2NM0A 2GILA 3SDBA 1T26A 3QQ5A 4DV1B 2DVMA 4MWGA 4G0MA 1FTGA 2RK6A 2REQB 3FUXA 3ESXA 1VHQA 1CR1A 1LBQA 2PQ0A 3WK8A 3WAKA 4L4XA 4AO6A 4Q3KA 4TQAA 3F7TA 4WAUA 1QIIA 1QHGA 3COZA 1EE9A 1CR6A 1S02A 5ADHA 5CLJA 3OUZA 2JDIA 3Q8XB 2QTCA 4Q05A 3HSSA 3V4FA 1PQ4A 4OLHA 3TVYA 1E89A 1YDHA 2ZIAA 3O93A 1DTEA 5TGTA 5HGXA 1RHJA 5ESXA 5FL7D 1A88A 2V7TA 2YWXA 4L8YA 4NBGA 1MF7A 1QHHA 2PZ8A 2ZJ8A 2H4WA 3B1YA 4HDKB 2P11A 1QUEA 1CZOA 2X58A 4Q3CA 1BE1A 4GI1A 1Z5UA 2BMVA 2JLCA 4MWSA 5K20A 3UJ9A 4R7ZA 5F51A 4CCAA 1VHTA 3SDSA 5IYZA 1V1MB 3H9QA 3AVVA 2FRXA 5FOTA 5J63A 2AYXA 5KYUA 4C78A 3BL8A 4H3KB 1RC8A 3WFIA 4IPTA 3E2MA 3ZGNA 1CIPA 2JARA 3Q6IA 5IFLA 2VZEA 1NNI1 5FOWA 1ZNWA 3S1NI 3EJWA 3OESA 4ON9A 3SC3A 2FZWA 5KTOA 1SXJE 4D4MA 2O1XA 2PV7A 2IE0A 2RHOA 1YIJ1 3TD9A 1B3RA 3THYB 4ZPJA 1JKMA 4A3FI 4PO8A 3T7DA 3I05A 4UASA 4N0EA 2BMDA 5GONA 1COWD 4X64B 1WPQA 3R7FA 1BJTA 2EJVA 1V2HE 4TYMA 1N2FA 3PENA 2O8EA 4H27A 4Q1AA 1FQWA 3E84A 4W9NC 3ZK8A 4DWJA 4R8SA 2WKWA 4CZ2A 1NFQA 4R9NA 2PUGA 5D3MA 3TQSA 1U7WA 3TTWA 3P71T 4B8WA 1Y9ZA 3VDXA 4F8YA 3GJ7A 4BFLA 3CRMA 3K2BA 4K9SA 2BKLA 2W6ID 4K88A 2JNWA 4NFRA 1JPJA 4BXOB 3U49A 2AN4A 5AI6A 5JZSA 4I9GA 2YWRA 4QATA 2E21A 5FLEX 3SF0A 2XADA 4AFNA 2W9XA 1EHYA 4KIFA 3KSMA 3UW3A 3R5FA 1RLTA 2QPLA 3DBRB 2V3WA 3FW1A 2NO7A 4L0QA 4TT3A 4WGGA 2ZJ6A 5CH5A 1F0KA 3I4MI 2EERA 5CW2A 4DMFA 2P0AA 2B37A 3AXSA 2CV1A 5KYWB 1Y1KE 1Z33A 4C4AA 4CPDA 4FWTA 3I83A 1KQNA 1JLHA 4BLQA 4HUTA 2DXIA 1XCPA 3NBZC 2FSGA 4W5RA 4MAMA 4RD0A 1U0FA 1QU2A 1QYCA 2AZXA 3HVUA 4E7OA 2WHYA 4PNPA 4UUOA 4B7ZA 2BMJA 3KZCA 2BGKA 2O54A 4GLOA 3UF0A 1NVFA 4LX8A 1G38A 3U3MA 1OYVA 4D02A 3UJ7A 4DR6B 2NPOA 1MEOA 3RASA 4EARA 2O6HA 2I29A 3B1WA 2R48A 4IF4A 3UFXB 3CC4Z 4GZLA 3TE5B 2OGWA 2ZSUA 1VJ1A 3H5LA 2YX1A 4X62B 3RT7A 4CU5A 3TTYA 4GMDA 4U6NA 4QDUA 2ACWA 3GPLA 3TLGB 3HJHA 2AC7A 3IDFA 3IJ5A 2DPGA 3AW9A 5KSOA 2NLOA 1MQSA 3AEUA 3IPCA 4RDXA 3KQUA 3NC0C 1WW8A 4E3WA 4INZA 1KFJB 2VEOA 3HBFA 4HWKA 1NVVR 1I3LA 5GJWC 3DQPA 1ABBA 5LLSA 421PA 5CVTA 1GYQA 4QTYA 3JTMA 3C3YA 3PICA 4L75A 5LZ2A 2GFQA 1UBLS 2AOTA 2RI1A 3B3JA 3CLVA 3E70C 5B1IA 1SHJA 2XIQA 2YIJA 3K0BA 4M9XA 3OZGA 4RZSA 5KOHB 5CX4A 1H4QA 4NCAA 4P6VF 4LYJA 4N18A 1WCXA 3OQIB 3OZAA 1DDGA 1R0CA 3I2IA 4TTRA 4FKZA 2FF5A 1Q21A 3O2SB 1L6IA 3AVQA 3AHEA 4QDTA 4WN3A 2IGBA 3OMLA 1JDBB 2WF9A 3D6VA 3M7IA 3UEOA 4RMIA 2O5RA 3RIGA 3VPGA 1VBNA 2RGWA 3B9BA 4TVOA 5LQAA 4AJ1A 3S40A 1OPXA 3DOIA 3PUWA 5DM4A 2O7NA 3AR5A 3DCIA 3TRJA 4F38A 5A2QA 1UFOA 4W7SA 3NUZA 2OYSA 4QFCA 3VH4A 3TEFA 3BMQB 3WGTA 1EUYA 4NE9A 5DISB 1SXJD 5BOVA 4EA6A 3Q7EA 4BE9A 1QF8A 2BFDB 4N12A 2G71A 4O4IA 2YCLA 3HDJA 5BN5B 3JX9A 2QRUA 4GOJA 3HCFA 3W0LB 4RDHA 4KI7A 3ROZA 2ZRLA 1S96A 2XE7A 2XTMA 3EWIA 1NM5A 4Y1GA 1H93A 1M9NA 1VYVA 4ZO7A 1L5NA 1HLPA 3D81A 1M2OA 2PEZA 2BHRA 4G4IA 1WUYA 2HMYB 1Q1QA 3H5IA 4NKRA 5BNTA 1JA1A 1QLHA 2C4NA 1NFRA 2YJ6A 1KO1A 1ESMA 2CNOA 2WHPB 3KJZA 3QUTA 3R8XA 4AI6A 2DWCA 1ILEA 3HCCA 4NAHA 1Y3FE 2BBOA 4MJ7A 2HA4A 4NMMA 2B9VA 1U7UA 2FEPA 3Q2KA 2ZT6A 1QFMA 2I4RA 3P20A 4IFTA 4Q4JB 2VYFA 4R2MA 1GILA 2P3LA 5CXSA 3TW8A 2XMQA 5HBGA 3WHLA 3O4FA 4IXWA 2C3UA 1XCOA 2J32A 2XUQA 4C03A 1TVKB 3P45A 3LUKA 1KVQA 1Z6QA 3P2OA 3GW8A 4MVCA 1ZYUA 3OIWA 4MRIA 3TB6A 1E9AA 1OLUB 4FZ3A 1BHO1 1D07A 1QGOA 3U61B 1S2IA 3KELA 3PXAA 1Z2CA 3W05A 1MVOA 5BNIA 3OEED 4MKIA 1FFGA 3R75A 5H9WA 4JVOA 1T5HX 1L7PA 3ZNNA 4IGKA 3W04A 4NB9A 1N8R2 2NV0A 2PL3A 3DYIA 3TIXB 2OO3A 3ABSB 4NCXA 1XZIA 4BNLA 3LT4A 3THOA 3V4OA 3JRWA 2H59A 2G25A 1XJ0A 4GYKA 4OI1A 2W70A 1XPRA 5T4BA 1Y9DA 3CCUZ 2GN1A 2Z2ZA 5J3JA 4NBDA 1KARA 1GUAA 3PJGA 3PNQA 4CFSA 3K1AA 4LF6B 1TXGA 3I2FA 3GGOA 4MP6A 5F1KA 5LOVB 2MYPA 1GN8A 4I4TA 5CM8B 3RTBA 2BTEA 3BHNA 4PO1A 5FBWB 5T57A 4M22A 2WKSA 1MDFA 6CHYA 1U9YA 1UM9A 4OLFA 5FIUA 4CT4B 1M1ZA 1P9WA 4IILA 4TWIA 3E35A 2QDKA 3ZI0A 4FS3A 4CCYA 3LKVA 4FMPA 2NPIA 4WOJA 4AJIA 1Z63A 1KAHA 5ALGA 5F1YA 3FTEA 1W0JD 3GVHA 5C52B 3MELA 1E9CA 1EIWA 4CHTA 2BZGA 1QGUA 1J9GA 3PDHA 3WSVA 1FDSA 1GCAA 1S721 4TMVA 3PXEA 5HFAA 4DG5A 1QQ5A 1Z02A 3ES9A 4LDAA 3SZRA 1TRKA 2W2LA 4I50B 2X0FA 1C4XA 1DRJA 1N8SA 2W2QA 1IHPA 4Q7MB 2I71A 4R71A 3B8HA 3O4JA 3KOYA 2Y3IA 4DY4A 2JRCA 8ADHA 3HBLA 3GOQA 2DWOA 3PF8A 4DYDA 4B4VA 4DUGD 2X3YA 4Z4FA 3ZD7A 1NSFA 2H52A 5HIMA 1BWSA 1GHTA 2ZJ2A 3FYDA 3F67A 3OQ6A 5JCOC 4WA7A 4M9SA 1GQQA 5CDUA 2YADA 1DZ3A 1OZAA 4BNUA 2ANBA 3NHMA 3C3PA 3EXFB 3QV1A 2J0SA 1WPXA 1DAIA 3I53A 5DLDA 3OOJA 4CDRA 2IEYA 1OX4A 1UBTS 1W75A 1GY8A 1UFVA 5TF4A 5AVZA 4LY0A 3T3GA 3A6JA 2FWRA 4HNVA 3JYPA 3TI9A 5LBUA 2X7JA 2BKVA 3FHOA 3DD5A 3ILHA 3TAUA 5B1YA 3GAMA 3RI3A 2P75A 3CJTA 2F1OA 5IYZF 4BQQA 2AKYA 2QYOA 5MN6A 2CLKB 4RS4A 1Q6YA 1AKTA 1TEHA 4DJAA 2AFHE 2W2OA 2FW8A 4N5NA 1RI4A 3TBKA 2ZUSA 3W78A 5GGXA 1P6QA 2DTDA 3WLEA 2G76A 4FDMA 4ZREA 2W2VA 1CNFA 2D0DA 5EI5A 2CVQA 3SC4A 4CG3A 3W90A 3L7MA 1S01A 2YZNA 3PFGA 4RM2A 5THXA 4PBSA 4C04A 3S4YA 3PF9A 3VHRA 5BT8A 1QOZA 2G0NA 5LBTA 5AD1A 2FEXA 3I4CA 3IILA 4ZRNA 1NAHA 3USCS 4Z1OA 5L95A 3VV3A 4JJZA 1GL9B 1YCGA 4X00A 4BNJA 4A0RA 3LPDA 1I6KA 1XAJA 2J33A 1JHMA 2D7CA 2NVUA 2Q99A 1XQYA 4Z53A 3HJFA 4DDWA 1JHQA 4UVDA 3IVGA 3AJEA 4LWPA 2IOQA 4U2EA 2QRDB 1MJGA 1DO2A 5IYZB 2FU5C 1L1OC 3I9NA 3S28A 1QP8A 2MYTA 3UTDA 4R8RA 4D7AA 4QUEA 5KYUB 3QY9A 1ZAYA 2VJQA 1BX3A 3DNFA 4IEIA 4DLRA 1NNLA 2XGGA 1E61A 4B7UA 4BNXA 2PLFA 1DQZA 1WVGA 2IBSA 9LDTA 3DVRX 5M04A 5EKTA 3FOEC 1WSBA 1I4WA 2CXUA 5E4TA 3UK1A 3P0RA 4AULA 4YAGA 3LUGA 5FPTA 4MI3A 5CLIA 2FMKA 4Q9DA 2C2OA 3SCZA 2FFBA 2Z6UA 3JD4A 5E9WA 5C8YA 3EAFA 3I4LA 4GWGA 4M8SA 5JZMA 4LJRA 4FEEA 4ZO8A 2EFDB 5GONB 1FSSA 4GX2A 1HEYA 4RTOA 1NBMA 4MINA 4DZTA 2JHGA 3K2QA 4NCHA 2J31A 1NXWA 2O8EB 4KQJA 3TW4A 3EOZA 1DCKA 1H9CA 3GNLA 2XW6A 3SR0A 1RWVA 5D3MB 5EA2A 4EVIA 1JYSA 3GFPA 2XMZA 4QXQA 4FFBA 1I3QI 1DL5A 1HYHA 2ZS7A 2JGJA 5JCXA 2VSQA 3EFOA 4U6SA 4JQSA 4B34A 1KC82 5EIAA 3LV8A 3PR2B 3S2FA 4BVAA 1I5RA 1XJ5A 5TGZA 3I28A 3W7BA 3QEBZ 1VLLA 3GA7A 1C3JA 1UPFA 2Q7OE 3HJBA 4DVGA 4X20A 4UZSA 4BMCA 4BGVA 4IKPA 1L4NA 1A7JA 3FPAA 3HQ4O 1YZNA 3KEFA 3M8KA 1SELA 1JEAA 3BH6A 2Q07A 3COVA 4OYYA 2H11A 5ENVA 1UC8A 3TLEA 2XR1A 3G2PA 3SS8A 3QWFA 2I2BA 2F59A 4EUEA 2OB2A 2YINC 3IE0A 1R6XA 3A3KA 3DOJA 4DPKA 3LH5A 1NUTA 1GZ6A 1XWFA 3RQIA 2A7XA 4URWR 4QG3A 2WYUA 2V1XA 3HYSA 4FJ1A 1ND6A 3D6UA 1P77A 4MHSA 2XVXA 3E4DA 3V3TA 3ANTA 4OSEA 3GY0A 5HEKA 4H59A 3KR2A 1RI1A 3NI2A 4C2BA 1JU9A 1XAIA 2EZ9A 1YHQ1 2WIGA 2ID7A 4CIXA 1ONSA 2JGKA 3PWSA 4G4GA 3AEUB 1SN7A 3L7JA 1EJBA 3QV2A 4PQGA 2PO5A 4R8KA 4YRCA 5IAAA 2RBGA 5CNMA 4CQLA 5T6MA 3BT7A 4NF2A 2X0NA 4QQFA 2PMZA 1CTQA 1D03A 3L7DA 3KB8A 4HX5A 2I80A 1OLOA 2ZPUA 3X3HA 1O3YA 1Z47A 1NBWB 4GWKA 3QYJA 4KNWA 4NOKA 4PLWA 4I9NA 5ALXA 521PA 3RD5A 2QMHA 3V7NA 1OZGA 2AOTB 4I5GA 4Q0MA 1ECJA 2C3PA 3W5IA 1DRWA 4GYWA 4O4IF 4URHA 3WQHA 4TPKA 4ABYA 3PCTA 4N5LA 5BQXA 1W4BA 4LHEA 3RFUA 1EDZA 2VYNA 2PIAA 4K9OA 1WB5A 3HYLA 3WYEA 4LRUA 3QJYA 5CH8A 1XQWA 1YOVA 3CLSD 5G1OA 3CPEA 3JQFC 2O2YA 4JQZA 4RETA 3U7FB 1CQXA 1I1HA 1ZUWA 5JZ9A 3IQZA 3NWJA 4A2WA 4R51A 1P2BA 1Z16A 2ETXA 1E4EA 2I7VA 3DV0A 2B6NA 3BWYA 4ZKEA 5CIWA 3DMYA 3MOGA 3UAVA 1XWWA 2XYHA 1YIT1 5F2OA 1B76A 1P91A 2LV8A 2YWBA 3H87A 5MFZA 4M53A 1KOGA 3ZY4A 5IZCC 4KPUA 3PGXA 3FSGD 4C5AA 4Q4HB 3PDWA 5FNZA 4G8BA 4PVDA 2RB5A 3DXZA 4O4IB 1D1QA 1RI5A 1A1SA 1MB9A 2NTEA 4P0PB 2Q3BA 2YQ4A 1HR0B 3JCZA 2W6CX 3ZLBA 1GL6A 3AFMA 1KGDA 3LCUA 1SEPA 6LDHA 1E8MA 5KVQA 1M2OB 4D6XA 2OTLZ 4AJ2A 2XUJA 1L4KA 2CXSA 3UGJA 4YCDA 5FLMI 1DUSA 2JIZD 1KSFX 2XODA 3AL3A 3IXLA 4G0YA 4IJMA 4OSPA 4Y0AA 1L7OA 3N8KA 1NZDA 3W4IA 4ZVNA 5FLXf 5C4JI 4PTYA 1OBFO 3IQWA 4QDKA 2JLAA 1KE1A 1MDBA 4E12A 4TYPA 3QLEA 4OQDA 3WB9A 3BFPA 2GEDA 1BVRA 1M7GA 1Y8ZA 1C9YA 3TW8B 4BRUA 2VL7A 4AB1A 1ZISA 4I4TF 4ZDKA 2XVZA 2E4ZA 4I4CA 1ZGBA 1BJRE 1NKVA 3B1ZA 5KREA 4AMYA 2WR8A 4PX9A 4W8OA 1YJ8A 1PS9A 2JEOA 1Z12A 5I7EA 3OECA 3BM5A 2AKAB 4J9UE 2C8KA 2XVYA 1LRKA 1Y1VI 3BE8A 2V4ZA 3TN7A 3MINA 5F73A 4A36A 4ND7A 1JZTA 4IGEA 1XA3A 3SM9A 3KR0A 4ESVA 2Y8EA 3RV4A 4X6LA 3JD2A 4FHEA 3RSFA 2OO7A 5JD6A 4ZWNA 1EXWA 2HLHA 3BF8A 3IUYA 3I55Z 1HKUA 2COKA 2M6SA 3J7TA 4MB0A 2B7CA 4P3KA 4O4JA 3QNUA 4PIVA 3BUSA 4ZOCA 2JMOA 1TFRA 3ENKA 1UWVA 3K1AB 2IWHA 5HOQA 5JZVA 3TINA 4I4TB 1BS1A 3WGQA 1PDWA 2FPSA 5J2TA 3JQRA 2M6RA 1ITZA 1UM9B 1KO7A 3PUXA 4K9KA 4MLZA 4BX8A 1Q7TA 4RF2A 2YZMA 3DULA 4WLFA 5I9NA 2BBWA 1I1NA 2JJQA 4CCYB 4IDCA 3AQ4A 1V96A 2YWJA 1SPXA 3O3MB 2IYSA 2P2NA 5IP5A 4FYXA 3T3EA 3G0IA 3T3PB 1WB4A 3B3AA 1E2FA 4RMJA 2WU3A 3TQRA 2I2WA 3KOOA 1Q57A 4TLEA 4AN1A 2GZMA 2VDQB 1QGUB 4PPYA 3A6ZA 3GJ8A 4Z7NB 2R6JA 3OHMA 4BQSA 1MRSA 1NV9A 2J7KA 1XGKA 2KYRA 4NX2A 4PYMA 5PGMA 3ME5A 5CFRA 1E20A 1KH3A 1R0ZA 3C4JA 3LBYA 4P22A 1NGSA 4BHTA 2OGUA 4EJ2A 2Q4DA 3SXUA 4N6GA 1M3SA 2EQ5A 2F1IA 5G53C 4C3UA 5JYBA 1ULHA 4O8CA 2UYYA 2ZULA 4V1CI 3ER8A 4E33A 2V0CA 3H42B 2PZAA 4HO1X 3TXXA 4Z1MD 1FDWA 1N6RA 4JP1A 3TLXA 4DCOA 5JRZA 3LFTA 2QTWB 1G1AA 5HJ7A 3URMA 1T9KA 2VPTA 4KIWA 1X14A 1W93A 1BDBA 5B37A 1XCJA 5EP4A 3WNVA 4DUYB 1D0IA 1TU3A 4RY2A 1CR0A 4K6MA 2NADA 4H6XA 4WY5A 1NG1A 5DTJA 4XJSA 3OWOA 1SVSA 1KK1A 5KWEA 2FFJA 1IN1A 5LYYA 1O6ZA 1GTG1 1OX4B 1T8PA 2QD3A 3TF5A 1H42A 5MHTA 3OSUA 4TSRA 3QE2A 4FYVA 2ODAA 4TRMA 4ZU1X 5C18A 3KB2A 2DFDA 3QE9Y 4IL5A 1MXFA 1XG5A 3T0IA 4Q37A 1EEHA 3V4RA 4FT2A 1LRJA 5K2OA 3PUIA 4OGWA 1L8XA 2WJGA 2PRJA 1WZIA 1P2GA 1SZPA 4ZVRA 3EXHC 4PLPA 3D7LA 3RR2A 1P9LA 1U0GA 2QX4A 3EN0A 3NBKA 5EUBA 5IN5A 3JQPA 3P9CA 4MDHA 4D0RA 3WFZA 3WGHA 3MXTA 1ZITA 4KLCA 1EGQA 4HXGA 3JASA 5IHPA 1QPGA 3G2KA 3IEPA 4TUYB 2C2ZA 5G0UA 5DWDA 5HF8A 2BWJA 5GTDA 2CDAA 4FNMA 3VRHA 2QSZA 1QDEA 2Q41A 2B0JA 3UK6A 3ZDDA 1VQ7Z 4XLTA 3TUJC 3A4TA 4I19A 1E3IA 2VHUA 1O8CA 3IPAA 2NVUB 3TXYA 4KZKA 2VQFB 1YA6A 1S3FA 5DGCA 3VKGA 1DLIA 1G21A 1TWHI 2ZE6A 1V45E 3H5NA 2YZ7A 4Q7JB 4XOUA 3RUDA 3ZY5A 1V5GA 5ARCA 4CT5A 2IIQA 2PBFA 4QFMA 1N9ZA 2NZ2A 1NYQA 2Q29A 3TCNA 2X2FA 1L8LA 4DEVA 3STYA 1AGXA 1TX4B 3KT0A 2G6TA 1DL6A 3L4BC 4F9EA 1DWOA 1YZKA 4PWYA 3NGXA 4MEAA 3VTZA 3ND5A 4L28A 4Q24A 4OLJA 1H94A 3OOEA 3BWCA 5CMLA 3WNDA 4C0XA 1I01A 5C8YB 2Y66A 2QGZA 3AFHA 3AW8A 3G13A 4WFJA 4C7KA 3WWOA 4EPWA 2H00A 2IHBA 4CIYA 1SQ6A 1E62A 5LP6A 2AWNA 2FN9A 3UG6A 4CEJA 3UPUA 1LA2A 3LMKA 1EBUA 2J4DA 3U39A 5IU6A 2VDKB 5DM70 5J23A 3V1LA 5J40A 1G2IA 2C3MA 4S24A 3P5BA 1N1GA 4PZAA 1ZVVA 4H7KA 4FFBB 4XFJA 2YN4A 4UVGA 3UHOA 4ZI5A 3WDMA 4ZZ0A 3K32A 4UCFA 3EFOB 4JEHA 1JWHC 3LT2A 1M2WA 3OZFA 3OTOB 3HG7A 4DJFC 3GHYA 4P2GA 4CDGA 1YUMA 1NUPA 4WKCA 1DQSA 2VHTA 3ELBA 3CZ4A 3SHOA 3WADA 5KYGA 1T2DA 4X20B 2RC5A 4Y6RA 4BLUA 2X5KO 2XCTB 2F3QA 4Q39A 1PLLA 1WLYA 4LHSA 3UCFA 1EG7A 3VH3A 3ZHRA 2YWFA 2VJOA 2WTNA 3X1MA 4LXUA 1AB5A 3O75A 3I73A 5JV5A 4KQCA 5F2EA 2EFHB 1A9QA 2LGJA 3OT1B 1CD5A 4MKHA 1ZWKA 2V8IA 3Q88A 2BDUA 3MAAC 2KM1A 4EAAA 4DEYA 1BXGA 5BQFA 4H35A 4A15A 5E7QA 4ABTA 1VQ41 1PX0A 1U1FA 1EB8A 2OAGA 2I76A 2VAWA 3KUUA 1KAGA 3PNKA 4IRUB 5KSWB 2WUDA 3GK3A 3ILSA 3QVKA 4AG3A 5D1PA 3Q5GA 1A7UA 5AK5A 3JD0A 4PZZA 5BPFA 1SVIA 5DTQA 1JR2A 1OC2A 2HWYA 3D2LA 2BOVA 3AUFA 4RQUA 4UDNA 5C37A 1I94B 5DYYA 1YRQA 1LS1A 4FYWA 2QP9X 1AA6A 3ZOZA 1LNQA 2E6KA 3BKXA 2BISA 2C5BA 4X91A 2PKXA 2CLSA 1NOIA 1VDMA 2CBZA 4CQLB 1GNQA 2QHXA 3QI7A 1OBHA 2IBTA 3ULKA 3DT6A 2EJBA 4BNYA 5K8IA 3CVVA 1CPYA 5G41A 3FF1A 3SSOA 3I1FA 2YV3A 1XU9A 3IFUA 2V65A 2WFAA 3NJRA 5FV7A 3VSBA 2PR7A 4IQ8A 4CGZA 4AL4A 5FPHA 4UFOA 3WB0A 1L4YA 2P90A 3LBHA 4X7BA 2PH5A 4RPJA 1G20A 2XWBF 4JI3B 1FK8A 5MGBA 1JALA 1TZMA 5A7HA 4ZVPA 5CDFE 5K6TA 4KXYA 3SBXA 1SG9A 2ENWA 1YOVB 4HNGA 4HDQB 2NVYI 3VR6A 4OH1A 2GCGA 3EASA 5AM2A 1GUYA 1UAAA 4AJNA 2JFXA 3C6KA 1H5UA 4Y2QA 4E32A 3CCQ1 2F8MA 2IEZA 1CZHA 2GKSA 3DV0B 1R6VA 2IHZA 1YHYA 2FW9A 5I9TA 2Z58A 2QI9F 3TNFA 4UPEA 3INRA 2BGNA 5TY0A 1XI2A 3KQOA 1M72A 2DZDA 4HXEB 3KDAA 4MXUA 4QU5A 1ZH8A 2OBFA 2CMFA 3PKZA 4C7MA 5KNBA 2ECOA 5L7YA 3UKDA 4KPUB 3CXUA 2Q9UA 4DA6A 1L1RA 3KJHA 1KK3A 5E4JA 3TVDA 4MHTA 1A2QA 1SIBE 4EJ0A 2DUJA 3N39C 4AJKA 4BAZA 1ZUIA 2AF3C 2QG4A 5ITZA 1B8UA 3CX6A 5EIBD 4BMOB 2BAGA 1I0LA 1Q2UA 1U7OA 3A4LA 1W0KA 2BBSA 1YI0A 1IFXA 2F4NA 4IMJB 3U4AA 2Q5EA 3LUJA 3L7IA 1V3TA 2O19A 2FRDA 2GX6A 2ZB2A 1TLTA 5ALYA 2CZGA 2BEVA 3FUVA 5A3QA 1UFQA 2JL1A 3BS4A 2XMCA 3FVVA 3FYHA 3NUGA 1V6SA 1H2XA 2PUBA 3UV3A 1GPJA 5AVTA 3PVSA 3PUKA 2XV1A 2OXEA 1GLGA 2IXEA 2GO1A 3ETHA 3GQVA 3HL0A 1V9LA 4G01B 3NTRA 3JQAA 1F8UA 3CS3A 3OLVA 4L4RA 4O4JF 3I37X 4HRVA 4BVLA 3BZUA 2Q5CA 1QVVA 2RG1A 1ADCA 2VWPA 2QROA 2WYWA 2X5JO 4HDSB 5F1OA 2QVBA 2ZJ3A 4L95C 1EJ2A 4GE0A 3U19A 3M5CA 4JNCA 5JPCA 1SQ5A 2Z9BA 3DHWC 3KOZA 1QCCA 3OG9A 5FTWA 2NYRA 3ZDZB 3B1FA 3R3HA 1Y9JA 2CUNA 5CDGA 1W36D 3DAFA 4JI5B 1DNPA 4RY9A 4X3PA 2B25A 4TMKA 4C76A 1NXXA 2O23A 3PEUA 2XOKD 3AUYA 3DCNA 3O8LA 2NUBA 1H65A 4RY0A 4UUAA 3RIEA 4QTUB 5KB3A 4BIMA 4LF5B 1FUUA 1E9DA 5DSZA 4NENA 3U4QA 2XYPA 5I48A 1YFZA 2CNNA 2Q6VA 1VE6A 3ZDQA 3L40A 2GZRA 2W37A 1P80A 4G81A 5DEOA 4YJGA 5AKLA 3RSSA 5JFOA 3C15C 4ETNA 4NHOA 1HK7A 4O4JB 5BURA 1YF3A 1SCBA 2EFCB 3WC4A 3PHHA 2I1WA 4L4YA 2IPNA 2R1ZA 2ZWVA 2G3YA 2VF2A 4L5JA 5ERYA 4QXMA 2XOXA 3ET5A 3AY7A 2XOEA 4CL3A 3O8CA 4K6FA 4EG3A 5J2TB 1PBNA 1XQ9A 4IDAA 3NHUA 1B7GO 3RABA 3KM0A 1RAHA 5DB4A 3L0YA 1G7RA 1YT5A 2IU3A 1S2LA 4U7TB 3LO8A 4D0NA 2Z43A 4FLMA 2XWQA 5AXAA 2Y1XA 2EBHX 4DAEA 2Z5VA 1D2RA 3TQIA 1K7EB 4JSRA 4P31A 3SZGA 3B13B 2QUJA 2GBPA 2LCIA 4H7FA 3ZTYA 3E9RA 3QYAA 4LSWA 1E1DA 1RLJA 1DOZA 1H8HA 1SBYA 2GZHA 4YAKA 4YPOA 1DTSA 1KOJA 3EVNA 4DLPA 1E2NA 4XYMA 4Z3OA 2VUSA 2V3VA 1ENPA 3ADPA 1M8GA 1SUPA 3CT4A 3PQFA 5M5BA 5AM5A 1OMOA 4FC6A 1G55A 4L27A 1NMXA 2VBIA 1FFCA 4MO9A 4MZDA 3SXUB 4LMBA 5FKJA 2O2XA 4E5SA 3W5DA 1EGVB 1HTBA 3CJRA 3DMRA 3ISJA 5E1OA 2HMVA 1U8UA 2FXIA 2ZYVX 5CT9A 1A4UA 1PN3A 3IULA 4QUGA 4JC4A 4JT2A 3I42A 3FHJA 3GP8A 3AF2A 2YC2C 3D8BA 3M1YA 4FXOA 4NRDA 4YRQA 3NH8A 1U31A 2H85A 3PUYA 1QFZA 4NYJQ 3IBGA 3RFXA 3TM5A 4W5TA 1UKZA 1Y4ZA 4ENSA 1JQLB 2OXFA 3AIOA 3AHFA 4KO2S 3RF6A 1JPUA 4JFRA 1TIBA 2FSSA 1TQDA 1AVTA 3N3AC 1Z4IA 4ZANA 3QPVA 1G3UA 3HJNA 3OIFA 1XVVA 4K9PA 4KVAA 1NW8A 2P9ZA 1TMGE 2NUTA 1EUQA 2A7QA 2EKLA 3N2NA 3RK4A 3J80A 1UEXC 3LVRE 2YMPA 3Q9LA 2ZYTX 3ILYA 3IERA 1AHHA 1HEUA 2PXHA 3SHVA 4EJ6A 3ZLUA 2XBUA 1YE3A 1IY9A 2XVMA 2GEFA 3H1AA 3MJSA 3F3PC 3AL2A 4RSRA 3VPHA 1TU4A 4C7BA 3ESDA 5F9HA 2V6BA 1W5AA 1QWSA 1QB8A 4FTWA 1YL7A 4CQJA 1YIDA 6AT1A 3DEJA 5ICFA 4B33A 5HYVA 1S2NA 3PQ4A 2ZCJA 1V43A 2Y0PA 1VHJA 2HUNA 4ERXA 2Q4BA 3QFHA 4URYR 4C6RA 2R7LA 3G8AA 1NAIA 2DCUA 3S7ZA 1X15A 1PJ2A 2PS1A 1ZD3A 3JASB 2ZSEA 4J0JA 3WICA 1RBYA 2XMRA 2ZJOA 4HNAA 5EGSA 3LX8A 3ONFA 4E2FA 4GPZA 5ABPA 4PC2A 1VRCA 4YV1A 5KSYA 1L3CA 1AMOA 1GNRA 1PEAA 3T38A 2RSLA 2P5TB 1YJN1 3S2HI 4B4KA 1DKLA 1NUQA 5FWDA 2ROQA 4TNUA 2VPPA 5DN6D 3OEHA 5UKDA 1U0BB 1G21B 3AEQA 2QW1A 4WOPA 2IHJA 1BA3A 1L1QA 2X0KA 5DBEX 5EN4A 5I7FA 2ZSFA 2NO9A 3O21A 5IK2D 1XU4A 5AJYA 3BXXA 3RV3A 4C01A 3AXTA 3WWDA 2OK7A 4HN4B 3ZQ6A 4D9CA 5B57C 5BR8B 5FO0A 3N5CA 4BP8A 5HF6A 1THGA 1YZUA 2H3HA 1YZHA 4Q1FA 5CTAA 3PJFA 3TL2A 2VF4X 2P9QA 2CE2X 2GZ1A 3N0WA 3CMAZ 1A27A 5CW1A 2PX5A 3ROMA 3I5XA 2QTVA 3ESZA 3THXA 5I8PA 5GIOE 1QH0A 3TE7A 1QCZA 2KJQA 3Q85A 5ALOA 1PZEA 3JXEA 4MVJP 4B7AA 5AW4A 1J2RA 5LP6B 3E03A 4UZEA 3S15I 1E8NA 1XK6A 2DJ5A 2B1GA 4CEJB 2NO0A 1CVRA 4GP9A 4QU0A 2IU4A 1U9JA 3WGZA 3UH1A 3HYCA 5P21A 2VWHA 4PN7A 2Q4EA 2M6LA 1F8YA 1UMDA 5TB5A 5DCLA 3ZHOA 3B5IA 4JYMA 4OH7A 1C8KA 4PCVA 1USPA 2VRCA 1ZBQA 1OC4A 3FYCA 4F3RA 1GQFA 2C03A 2XITA 3EZ2A 3PD1A 4R1LA 4HZUA 3EUEA 4CKBA 3FKSD 1GKKA 1IQRA 5H83A 4F5YA 1MB4A 3CISA 4XDZA 5CFLA 5LNK1 4RPIA 1TM5E 3PPVA 1JEOA 1HMPA 4OHBA 3KKMA 2QKYA 5DSXA 1JVNA 3KIFA 3RSQA 2YJZA 1NVWQ 1GOTA 2FKNA 3D9XA 3KQKA 4DE5A 1A04A 4DQXA 5IABA 2A1UA 2EV9A 2RB4A 1T1GA 3OZXA 3FWYA 3DZHA 3H9JA 3DHNA 4BBSI 2JGNA 1KK2A 1QYRA 1V3QE 2JFVA 3VJLA 4QYMA 2QRQA 1Q0RA 1V8PA 4JLWA 1QVWA 3IJPA 4Y3UA 1TAUA 2O8NA 1K4MA 2Z2IA 4ZVQA 3HR4A 3ZVLA 7AT1A 1DO8A 2B8TA 4P58A 2JHFA 1UF9A 1BXGB 1M54A 3KFLA 4ZOAA 1T0BA 4KQ6A 4ML3A 3S1LA 1OE0A 4WJKB 1WCYA 2OXTA 2NZJA 1B14A 2YJGA 3E0XA 3A06A 2I7DA 3PXBA 3FTDA 5AI4A 1VQ81 4HVAA 2IXGA 5A0VA 1Z07A 1JIXA 3BA6A 5BSGA 2QLBA 2NT4A 1W30A 5KZMB 4YJ2F 1XD8A 5FTNA 3PXDA 5J5CA 1W44A 1XDBA 1LW7A 3IDOA 1EBBA 2G83A 2G4LA 3DDNA 3O26A 4J2TA 4M0MA 4O6VA 3VVMA 4FGZA 3WDLA 5L53A 1IHYA 3ASZA 4YIHA 1HTTA 3S99A 1LDMA 3ZY2A 1QZXA 1OT5A 4ZMSA 5LU9A 5DGHA 4CLDA 2ORVA 3JTEA 1GQRA 2EGHA 3ENVA 3AI7A 4A0HA 3I45A 5D84A 4UNQA 5EY5B 4WERA 4C0WA 4OKSA 1STOA 4MVXA 1T1SA 4NV1A 4RD6A 2O3JA 1UT6A 4RELA 3HLTA 2QVLA 3UY4A 4OX9Y 2V9ZA 3LZ6A 1G20B 4P5PA 2ZT7A 3KUXA 3C3EA 4HGRA 5HKOA 2GXAA 1O5OA 2JEYA 4E5MA 1CCWA 1OGJA 1ZUHA 4B47A 3F7NA 4D6YA 5G1NA 1UBHS 4RZXA 2A0XA 2QD1A 1AMNA 3Q8MA 2F2TA 4K0KB 3RG2A 3O4HA 3WVNA 2IZ4A 3GV0A 2E2WA 5I8ZA 2OM2A 3BULA 3CZAA 3IE2A 1WCIA 4P98A 5KAPA 3L7YA 3NQ41 2O7SA 1VLAA 5E6RA 5DOVA 2WSIA 1K27A 1X94A 1ZJJA 2XQGA 3A26A 1ZXXA 1HC7A 4URZR 5FTKA 1AMUA 4B6SA 2C7QA 4MEJA 4RBNA 4KQKA 2FCRA 3G88A 1IN8A 2VDOB 1R12A 2VQDA 2FR0A 5FORA 4WUVA 2R2AA 5ENZA 5K8CA 3DUFA 2C4KA 4OK3A 5ITZB 5K0JA 5ILOA 1BQ4A 2J1LA 2TMKA 1JXMA 3LKDA 4LJSA 4M9QA 1TI7A 1K2WA 4QVKA 4OXNA 3G2IA 3WRVA 3CLUC 4P4SB 1UBJS 4GL2A 2VCEA 4CMAA 4GX1A 1IG3A 2LDXA 4L85A 4ZVKA 4EF5A 1JJIA 3JW8A 1JU4A 3ILXA 2BEVB 1CQZA 2NPFA 3AKYA 3RE1A 2CLIB 2EDAA 2OSBA 4RF4A 5BPHA 4K26A 4OXRA 4L07A 3AL0C 4QOJA 1CUWA 1UDXA 2DQSA 4UREA 5KVCA 1QYPA 3T5AA 1C4KA 2BV3A 2OPHA 4ZCRA 4QT0A 1Y6ZA 4LF4B 3MWFA 1FX1A 3S1RI 3OIDA 4ENUA 3U26A 4BDTA 4FQ5A 1AGYA 3MN1A 2PCLA 5DP2A 4PPGA 4FHZA 4YJ3A 1QH8A 4NL4H 1GIAA 3RVDA 4DLTA 2XB2A 4M1WA 5JS1A 5EFZA 3G82C 3PHGA 4LRWA 1A9TA 4NE2A 5BV0A 2I6UA 4RCYA 4UHCA 4CIAA 3PJEA 1JIUA 2ZJ0A 1KR