2KI7B

The solution structure of rpp29-rpp21 complex from pyrococcus furiosus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
EKKRIAKERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCKKCHAFLVPGINARVRLRQKRMPHIVVKCLECGHIMRYPYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of an archaeal RNase P binary protein complex: formation of the 30-kDa complex between Pyrococcus furiosus RPP21 and RPP29 is accompanied by coupled protein folding and highlights critical features for protein-protein and protein-RNA interactions.
pubmed doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 1
total genus 23
structure length 97
sequence length 97
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2ki7B01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ki7B02
1EC5A 2LXBA 4K35A 2KZJA 4IOIH 4JBZA 1JMBA 4HKZH 2M5AA 1Y47A 2JWDA 2KZIA 1EDIA 2B88A 3S1KA 4HB1A 4HJGH 2QRXA 5CBOA 2KIKA 1LT1A 4EYYQ 1JM0A 3FXDA 3ZDMA 1Q2NA 2QVAA 4GOFA 2B89A 2B87B 4CPGA 1ZXGA 4GODA 4ASWA 1OVVA 1X0TA 5C39A 3QWOC 1ZW0A 1BDDA 1LP1B 2UWJE 1H0TA 1FC2C 5EFWB 4WWIA 2LXCB 3RGUA 1MFTA 2R44A 1EDLA 2B87A 3PH0A 3MZWB 4BXLA 2KS1B 4NPFX 1OVRA 2K3RA 1U7MA 2M0BA 4NPEA 4KJMA 3MHVA 1S3JA 1EDKA 4K3AA 2HR3A 5DJUB 5K5GB 5DJTB 1EDJA 2RKLA 1U7JA 4ZNCA 1OVUA 1H0TB 2Q1KA 1NVOA 4NPDA 2OTKE 2KI7B 3FXEA 4GOEA 2I8DA 2WMMA 2SPZA 2LR2A 4ASVA 2P58A 2M5AB 2KUBA 4ZMDA 4MN4C 5CBNA 1LP1A 2ZAEB 1SS1A 1BDCA 1DEEG
chains in the Genus database with same CATH superfamily
1IJDB 2Q6QA 1LWUB 4DOJA 4U3FG 1DIPA 2KNCA 3AE9C 5CCHD 1YIJP 2FYUG 4WVZA 2KS1A 2FYNC 1HGVA 1JTHB 1M1KQ 1JEKA 4CL1A 2GUVA 4PD4D 2FXOA 1KD1Q 3P8CE 1LTJC 3L70J 2P10A 4N78E 2P3YA 2QVAA 3CWBD 1G1JA 3H1JG 2W03A 1UIXA 1YI2Z 1SQXJ 2JEEA 3S1MI 3L73J 2QR1B 1FDMA 1RF1B 1ZW0A 3QH9A 1Q862 1Q16A 3L73E 1EXIA 2ZT9C 2ZT9D 3H1HE 3U59A 3O6QB 3L70G 3D71A 3CX5H 1MFTA 2OYHB 1R9TI 1U7MA 3VB9A 1NU1J 3IR9A 3NH8A 2M6NA 3VN0A 2KSEA 1X3ZA 4OGQB 3CCSP 1K8AQ 2XU6A 1HVVA 1NAYA 1N2FA 1SFCA 2R92I 1HWTC 3GF3A 5H2FE 4WB4A 5AVRB 3PTZA 3L71E 2G2KA 1VQ4P 1GL2A 1Q90D 1FDIA 1PIXA 4NOZA 1YJNP 3KPEA 2ZJSE 5CCHA 3G4SP 1SVFA 3CXHH 2WSEJ 3L71J 1YJ9Z 1BCCD 2N1TA 2QJYB 4AUWA 4NB9A 3CC2P 4LGDE 1E79H 3RL0g 3SWFA 1G2CA 2KLUA 2XDJA 1KB9D 4HKZH 3JCUE 1YHQP 3BASA 2P7JA 1M1K2 4O9BA 2J6AA 1VQN1 1JY2P 2FXMA 4R4LA 1Q82Q 1OW8A 4A3EI 5AVWB 1H8AA 1DH3A 4MD8A 1GK6A 1S9KE 4GKGA 3KXDA 4GOFA 2YMKA 4RKUJ 1N7SC 1ZXGA 4YXWH 1HF9A 1RNIA 2E7ZA 1LP1B 3G3ZA 3V4QA 3CI9A 1AFOA 2FFDA 3CCL1 3AEEC 3CMAZ 3O8ZA 3AE5C 1KQLA 2A06E 3CPWZ 3FWLA 1YI2P 5IP7I 4NFRA 3HOVI 3CME1 1Q861 1LJ2A 1OVRA 2RIQA 1PPJE 5BU8B 2I3CA 1JNMA 3HTKA 3IR7A 1EDKA 4K3AA 3HOWI 2L91A 3H1KJ 1VLAA 2N1TC 3GTMS 1EDJA 4RVGA 4H44B 3R4YA 1QEXA 1SQVG 3M9QA 3LW5H 3V4WA 3PP5A 4XE5B 4DK1A 2RMZA 3A5TA 2HU9A 1OIPA 3S16I 1IK9A 4I7ZC 2ZVOB 1DD3A 1KN7A 2DE7A 2JR8A 3VOPA 3T4NB 1BGYJ 3S14I 3NH4A 1UIIA 3L74J 1T6AA 3HOYI 1IFIA 1RE4A 3CCSZ 1N73C 1OMIA 3H1IJ 1JY3P 3S2HI 1Y47A 2Y0DA 3CPWY 3A0HE 3HUSC 1SFCC 2W83C 1VQOP 1NTKG 1BGYG 2A45I 4EYYQ 4HGYA 1LT9C 2RPRA 3L74G 1FE6A 3HE5A 3ZDMA 4BRYB 3I5CA 2FFDB 1L0LE 1QF8A 3LIDA 3CXHD 3S1NI 3BATA 3VMXA 1LT9B 1P9NA 3FQQA 2CK3H 2C0WA 1SQQJ 1H0TA 2IV2X 3PLNA 2WB1A 3USSA 3AEBC 2R3SA 1NTKE 2IBZI 5C44I 1VQ81 3H1KE 1YUAA 1RF0C 2YO3A 4JQ0D 4E2WA 1VQ91 4KHXA 3CCS1 3TK1A 2QJPB 1USDA 3TNUB 1KYOH 3CCE1 3AEDC 3PO2I 1NTMD 3NFZA 3C9IA 3Q3DA 2IFNA 3AEAC 2BEZF 2XZRA 3TF5A 3H0GI 4A3II 3PJSK 2E74D 4D6TJ 3CC21 4DZOA 4H13D 4JYCA 4RJTA 4RESB 3H1IE 3D6ZA 2KUBA 1YYCA 4UB8H 4ZMDA 4C7NB 2ZAEB 1QVFO 1L4AB 1VQNP 1NKNA 2VRSA 1X8YA 3U1AA 1S4XA 4E32A 3WU2H 1K8A1 3HE4B 3RK3C 3CX5D 2NPSD 3L75E 4HJGH 3IX0A 1YUKA 1JY3O 2RH0A 3NXSA 1OFCX 3HOUI 1W2BO 2KIKA 1ML8A 3KQGA 3H1ID 3FXDA 1KQSY 2H85A 3IN6A 1L2PA 5B5EH 3HD7D 2H88C 3J80b 4KT0J 4NBGA 2JUBA 1WMKA 1FZBA 2O01N 5AVQB 2IDBA 1Y9BA 3CCVZ 1M901 1KYOD 2QLVB 4WY4D 2KXPB 5B66E 1SQQK 1Q812 3GCFA 2WVRA 1Z02A 4LC1A 1URQD 2AYDA 3CQZI 1FOSE 5AVVB 4JPZB 2KNCB 5APWA 3GTKI 3RL0B 2NPSA 2WSFH 2QJKC 2R32A 1JWHC 2K3RA 2FBWC 1USPB 4I6MC 3I07A 3MHVA 1I50I 4Y99C 3VTPC 3KZIH 4E2ZA 1WW9A 3NH5A 3I55P 2AKLA 5IT9b 2GU2A 2H7HA 2VF1A 1LWUC 3LIEA 4A3GI 1TU3F 2WT7B 4WBAA 2L5GB 1VQP1 2V45A 1N7LA 3KDPB 1Y8CA 1MUUA 1KYOE 5KAIH 1M1JC 1YQ3C 3L36A 4L74A 4MN4C 3G711 1FU1A 2H89C 1BSHA 3KIFA 1GL2D 3AE2C 3GTLI 1VQO1 2KZJA 4IOIH 4NBFA 4L73A 1PV3A 3TNUA 4PJ0E 5CHXA 4I1LA 5APSA 4WY4A 1Q822 1IFNA 1NGMB 1EZVI 1OX3A 1AVYA 1RQUA 1FZAA 1IFMA 2POHA 2H43A 1IO4A 4NBDA 1U57A 1RE4C 1SQXG 1PP9J 1S721 2M3BA 4I7ZB 3L73G 2NVQI 2AEFA 1VDFA 2B63I 3AEGC 1OWAA 4PJ0H 1SQXK 5D1PA 1L0LD 4PD4I 4H44C 1K05A 1X0TA 3QWOC 2E75C 2WSSH 2QJKB 4C7NA 2WQYC 1KQSZ 3MP7B 2WSCJ 3RK2D 2HPCA 1EXJA 1K73Q 1IFDA 3RK2C 1YITZ 1KORA 1K9M1 4GT1A 1K8A2 1BSNA 2F4OA 1EDLA 3KZIE 4XX2A 1FZCB 4NPFX 3RK3D 2M0BA 1VQKP 3CCLZ 1DD4A 5KAIE 1VF5D 1RE3A 3M9HA 5DJTB 1NTZD 2KYVA 4JYBA 1XTGB 1MZ9A 3V2PA 1RLYA 3CC7P 2DE5A 2O01J 4MRIA 3OJAB 1I6HI 1BE3G 1HH0A 3EERA 4MXUA 2QM8A 4DQYB 3J7A4 3H1IG 3A2AA 1KZUB 1NTMG 4BRYA 2HLOA 1BDCA 1DEEG 2VUMI 5TJHA 1KB9E 1BE3D 1SQVE 3L37A 1JY2N 1K9M2 2A06D 2E75B 3F89A 1VQM1 3TYYA 1ZLLA 1VQ41 1DL6A 2Q9IA 1KC82 3GHGB 1YJN1 2NVTI 5KLVK 2QSIA 2PMZA 3L72J 1QVGO 1X3WA 2JIPA 3FGAD 4MH4A 3H25A 2JIRA 5KJ7C 2HPCB 2HF1A 5LL6f 1MFZA 5C39A 1QGKB 3M9BA 2OZKA 4EOTA 2QEXZ 1KV4A 1YHQ1 1S9KD 1NU1K 3CCRZ 1L0NK 5AVZB 4BWNA 4NBCA 2YXRB 1N2DC 2P1JA 3AE8C 4HH2A 3OW2Y 1PGPA 1QVFZ 3GF7A 1ZR2A 1Q7YQ 1GTWA 2P28A 1Q81Q 2D2CD 5APTA 2IZ4A 3HD7C 5K5GB 3LUSA 1VQPP 2PGDA 2YO2A 1H0TB 5KTBA 2P2UA 2CPSA 3H1LE 4IFMA 2WSFJ 4HH4A 5GTHH 1VQ6P 1YJWZ 5IP9I 4A7PA 1AA6A 2R5DA 2VPWA 2HODA 1YI21 2P58A 4H0LD 1L1OC 1Q811 3H1LG 2W6AA 1ZR4A 3EQ2A 1L0ND 2J58A 1Y1VI 1FAVA 5AW3B 3CMEZ 3FQMA 2OYHA 1H89A 2DE6A 3S1QI 1RQVA 5D1OB 3G6EP 3A7OA 3SWKA 4NB8A 5A2Qb 3IAOA 1S72P 3BCCE 5KLVD 2XV5A 1PP9G 1DX7A 3H1HJ 1PGJA 3WUVA 3OW2Z 1M902 3IF8A 1LT1A 1JM0A 1JY2O 1Q821 2JA6I 4RVHA 2GUSA 5APXA 1KILD 3GTOI 1D7MA 2E5YA 2E43A 2IYOA 4IL6H 4CPGA 1FS0E 2PK7A 2CPBA 3F3FC 3CWBE 4WY4C 4NBBA 1J1DC 1KTMA 2A45H 3I561 3MIWA 3S4RA 3CWBJ 4DGLA 3C1LA 1AA0A 3ITKA 3RBXA 1VL2A 3HKZA 1RHZB 2R5BA 2VPXA 2OGUA 1FZGA 4GDOA 1M7LA 2PM9A 3TGUE 2KB7P 3QWUA 1PP9E 2FY8A 2ZFCA 1SQVJ 4KJMA 3B8EB 1W2BZ 3CC71 1JTHA 3WUTA 3U50C 1W5CE 1RO2A 2I1JA 5L8RJ 2NZ2A 3G9RA 5KJ7D 3BRVB 3FXEA 4BBRI 2I8DA 2V8JA 5CCHC 3TGUD 2AXCA 4ASVA 5CCGA 1VQ9P 3S2DI 3V2QA 1J1DB 3S17I 4QMAA 3CCVP 4U3FD 1NYHA 1W2BY 1FJKA 3P5JB 4JF7A 3JAMb 5AW9B 1Z01A 2WTYA 5KLIB 3UIAA 3CL3D 2O1KA 3RL0D 2JWAA 2K1AA 2LEXA 3MUDA 4QTTA 3H1JD 2FYUK 3CX5I 2YKPA 1GW4A 3GMAA 2Z5IA 3CX5E 3G6EZ 4TNUA 4L75A 2Q7CA 2HG5D 2MKVA 1JB0J 5E79E 2YIUC 2RBLA 3CCMZ 3H32A 1VQ5P 2OYHC 3H1HD 2E2HI 2IBZE 3SFDC 2A45G 2QIWA 3I4NI 2E42A 3JAMf 1S1CX 2OTLP 2AEJA 1WZNA 2Q3IA 1N8R2 2E76D 2E76B 3R2PA 1LTGC 5AW4B 2C9LY 4IFDK 1TWFI 4BXLA 3WMM0 2PFXA 1KC81 2WPSA 4U3FE 1FBMA 1L0NG 1KILA 2J5UA 2KSJA 1GZLA 4W80A 3TE5B 1U7JA 2N1TB 2Q1KA 1M90Q 4TLFA 1MKMA 1OW6A 1R8EA 3H1JJ 2KI7B 3JCUH 1NU1E 1KILE 1WJ2A 1NTMJ 1BE3E 1NAFA 2FYUJ 4DJGA 1PPJG 2WMMA 1VQ5Z 1T3UA 3G6E1 2E2JI 5AW7B 1RF0A 5A2Qf 3SFEC 1J2JB 4EIJA 1Z56A 2PAJA 3D9XA 4R4MA 1QL2A 4K35A 1M8OB 2R7ZI 4B86A 4HGZA 3D70A 3H32B 4NBHA 2V8KA 1L0NE 2QM7A 2GM4A 4Y99B 3TGUJ 1NKZB 1ZRTD 5KAFE 2FKWB 2GTHA 2WWWA 2WPVB 1X79B 4DT0A 3G71P 3I56P 4GIFA 1Q7Y2 1EZVD 1BGYE 3ESWA 3I4MI 2QEX1 3B5NA 3FKII 1SQVD 1NTZK 1S5LE 4Y52I 3T97A 2JMOA 2V8IA 1IK7A 1GD2E 4L76A 1HGZA 2WZ7A 1K732 1JJ2Z 2K9JB 1WT6A 5EFWB 1FDOA 1Q86Q 4OVNF 3V2RA 2PP6A 2DW3A 3PH0A 3CCUZ 3RZDI 2R93I 1L4AA 2VUGA 3NDJA 4Z1MH 1HBWA 2HYNA 2ZYGA 1S3JA 1SQBJ 1YTZT 1QVGZ 3D6YA 5KLVG 2OYIA 4ZNCA 1VQLP 1CI6A 3HRNA 3E1RA 1EZVE 2M8RA 3NFQA 3W68A 1RO0A 2ITAA 3HOZI 4DCKA 4E2YA 1LGHB 1YIJZ 3AE1C 3RK3E 2NAPA 4Y7NI 4H13B 1CSBA 2HODB 2GA1A 1HJ0A 1J1EC 1GK4A 2SPZA 1N86A 3GHGC 2QA4P 3A0BH 2Q3EA 2NPSC 2V3VA 1VQK1 1SS1A 3M0DA 3MZLB 2JA8I 2OTJP 1CW5A 4A3CI 1N7SD 2Q5UA 2WAQA 4IL6E 2IZ1A 5CM2M 1T2KD 1KRLA 3J81b 3L70E 2KZIA 1EDIA 2ZXEB 1PFTA 3CC41 1Y1VS 2RHBA 1S5LH 1T8ZA 5AVYB 1LT9A 1NP6A 2W6BA 2N9YB 3IF4A 1AJYA 2BJOA 1NTZJ 2IBZG 4E33A 5CCGC 4UB6E 5AVTB 2QREB 2YKQA 3CWBG 2OTL1 4A3JI 1ZMEC 1SQBD 1URQA 2BCCG 3VMZA 3VTNA 2YU9I 2E5TA 1L0LG 2W90A 1YJ9P 1WRGA 1ZN5A 2YXQB 3SSUA 4AYCA 3P8CD 1VQMP 3VMIA 4XFJA 3EEDA 3RK3B 5H2FH 2OARA 2R3CA 5BVZA 1NTKK 3GG2A 2B87A 1W2EA 2KS1B 3MUDC 4PV1C 2IZ0A 2JKVA 4PD4H 4MD9A 2IYPA 4D6TD 2BCCJ 1VQOZ 1NTKJ 4RVDA 1KD12 2JJLA 3GKQA 2RKLA 4A3MI 1N8RQ 2WSEH 4Y28J 1NTZG 4NPDA 5FLMI 1USEA 3M06A 3M4OI 1GL2C 2O01H 4GOEA 1AV1A 1N73B 2OTLZ 2LFUA 3NMDA 3CPWO 1M1JA 1VF5C 5GTHE 1HUCA 4D6TE 5B5EE 3CCJZ 1GL2B 1AQTA 3JC22 1K731 3H1HG 2JIOA 1N8R1 3A3YB 1VQ4Z 3H1LD 2QRCB 2F4MA 5B66H 1NO4A 4TT3H 5AVXB 1YTZI 2R6MA 3G4SZ 1QVFY 1VQ61 2A06G 2OQQA 1FOSF 2ZVNB 1NH4A 1RQFA 3OW2O 3L75J 2B87B 4UB8E 2W6JH 5C4XI 1LTSC 4GODA 4C7RA 3CCM1 2C0XA 1JCDA 4A3BI 1IZNB 2NVYI 2V7QJ 2JA5I 5KLVJ 1WIIA 4YXDC 5AW5B 1K83I 5APVA 1VQ9Z 4WWIA 2RT9A 4A3LI 1G2CB 1X22A 1ZB8A 5AW2B 5APUA 3U1CA 3II6A 3C8VA 1VQL1 4RO0A 1KB9H 1VF5B 1WCMI 1Z03A 1QLED 1TFIA 5T6BA 2JIMA 2G8YA 2AEMA 1SQQG 3B4SA 3PHLA 1LQLA 1YJW1 1YQ4C 2LIYA 5CCGD 2AXTH 2QA41 3TDHB 1LWUA 4W7ZA 2OTJ1 2OYIB 1PZQA 1SQPG 1LTJA 1KYOI 4BXXI 2M5AB 3VMGA 1P84I 3P32A 5AVSB 1QVGY 1HTLC 3J81f 1S72Z 2IBZD 3CC4P 1SQPD 3TGUG 2BCCD 2QKDA 3VMAA 1L0LJ 2GTIA 1KILB 1Y1WI 2JP3A 3S1RI 1A02J 2WPQA 4EDFA 1JMMA 1CZQA 2W04A 3CCJ1 1Q2NA 3B5ND 2M3EA 2O4HA 2B9BA 3CCV1 1YJ91 2QA4Z 3L72D 2KPIA 3RZOI 1FZCC 3LW5J 3S9OA 2XNXA 1KQSO 2M48A 3GTQI 1KMIZ 4C46A 2V4HA 5CMZA 2ZYDA 3CC4Z 3L72G 2N9BA 1ZB9A 1T2KC 2JS4A 2JA7I 3CC7Z 2NVXI 3RGUA 1R5LA 1NTKD 3L74D 5BU5A 2NPSB 1RE3C 1VQ51 5E79H 3BVHA 3CD6Z 1OVUA 2K9YA 3F3PC 1YIJ1 3EFFK 4AQRD 2JDIH 4YTPC 4OGQD 4OWFA 2Q51A 1GMJA 1NOHA 3Q2YA 3CMAP 4OGQC 3T97B 3JSVC 3D2LA 3IFMA 1RH5B 3HUSB 5CBNA 2Y0CA 3CCEZ 1LP1A 1SLQA 3E7KA 4PD4E 3J80f 1M1JB 2Y0EA 4JBZA 1SQQE 1JMBA 1KILC 2JWDA 2QE7H 3MD0A 3PRJA 5APYA 3H1LJ 1KFNA 1QL1A 3Q5PA 1K9MQ 3SWYA 2O1JA 3CCUP 4E30A 5GTIH 1S7MA 2Q4ZA 3L4FA 3CCR1 5T64A 1X9VA 2HFED 3L74E 4E31A 1TWCI 2IPPA 4BY1I 4E2XA 2P67A 3TDKA 1OVVA 3M0AA 1AVOA 5AW0B 2Y9YA 3CXCZ 2G3AA 4MONA 1ZOYC 1NJIQ 2H8PD 2VPYA 4ZKPA 1YJNZ 5T67A 3RBZA 1NHLA 2JO1A 3G4S1 1VQ6Z 3ABVC 2K9JA 3K5BA 1P84D 3OAKA 1A02F 1USPA 4H44D 5AW6B 2FYZA 2EGTA 3P7KA 3L71D 2QEXP 3V2NA 2VPZA 3I56Z 2K88A 3AE4C 3HD7A 2HR3A 2Y9ZA 3Q5SA 2WPRA 3B5NB 5AW8B 4OH8B 2PRRA 1SQPJ 3B5NC 3A0HH 3Q5RA 3OA7A 3HUSA 3BG1B 1NU1G 5TISE 3BCCD 3L71G 5KLVE 1H88A 1E5WA 1SQPE 1OW7A 2ZT9B 1VQ7P 4S1TA 4A3FI 1N7SA 3EWKA 1NUIA 4UB6H 3NDIA 5C3EI 1MV8A 2OOYB 2WSCH 1L4AD 3CD6P 1EC5A 1L4AC 2QRDB 1SQQD 3EFGA 2AXTE 2BASA 1AQ5A 2RN0A 5AN9F 1SQPK 1VQMZ 3H6PA 1VQLZ 3CCJP 1OXZA 2B88A 1ZH1A 4EWCA 3L72E 3AE6C 1BGYD 3VYIA 2WT7A 2OYIC 3PO3S 4BY7I 3CCLP 1VQKZ 1L0LK 2QJYC 1SP4A 5IT9f 1JJ2Y 3GLMA 3A0BE 4N78D 3WU2E 3GTMI 1DEBA 1J1EB 2YIUB 3AECC 1YITP 5KKZC 1Q7Y1 3Q1MA 5CJ0A 3CXCY 2B89A 3CMEP 1LTTC 5CJ4A 3GHGA 2D2CC 2I1KA 2QJPC 2J59M 3H1KD 1FZFA 3CCQ1 1VQ7Z 1NJI1 2YMYA 2OTJZ 1BDDA 2UWJE 3MZKB 1GU5A 1SQBK 2NRGA 4XA4A 3O6QA 5KLIC 2FYUE 2KK7A 2Z4EA 1SQBG 3AEFC 2E2II 3MTUE 1FZCA 4PV1B 2E75D 4PV1D 3KHUA 3HE4A 3L73D 5TISH 1QYPA 5D1OA 3GW6A 1ZP0C 2FXPA 4M3LA 1RF1C 3IFUA 2E74B 3CMA1 1TWAI 3CLQA 2WITA 3FWNA 2N1TD 2JNYA 4LLHA 1LTBC 1L0NJ 2Y0SA 3BG0B 5APQA 4YPCA 4A3DI 1KFMA 1NTMK 1PFIA 1SFCD 1LTJB 3HE5B 3CC2Z 1IC2A 3P8MC 1N7SB 3RL0C 1R5SA 1M56D 2FYNB 2KLVA 1TWGI 3D6WA 1PL5A 3BCCJ 1SQVK 5KAFH 1FZEA 2M5AA 5C4JI 2YNYA 2IX7C 3S1KA 3W67A 3GTJI 1VQNZ 3CCU1 1BCCJ 3HD7B 3I55Z 3TSIA 3CCRP 3MONA 1P84H 1VQ8Z 3CXHI 3FX0A 1VPCA 3H1JE 1VQ8P 1YBKA 4WY4B 4RVFA 1VQPZ 1GU4A 1JO5A 1JUNA 1EQ7A 1Y8AA 3Q87A 2YKOA 3E1IA 3CCEP 2ZYAA 1K04A 3M0DC 4ASWA 1GDTA 3VP8A 3L75G 2O53A 3GTGI 1KB9I 5AVUB 2LKMA 2IFMA 2KP8A 2E9HA 4W7YA 3N7NA 3V5BA 4NBAA 1RF1A 2K5RA 5GTIE 3BCCG 2OYOA 4AYBA 1NWQA 2E76C 4A93I 3L75D 1SIWA 1KC8Q 4IFFA 1URQB 3K7AI 3MZWB 3M91A 1TWHI 4NPEA 1BCCG 1QXFA 1FJPA 3KYQA 3CCMP 4RS4A 3WUUA 5DJUB 4RV9A 4D6TG 3CCQZ 1VQ71 4X6AI 3BRTB 2IZ3A 5AW1B 5FLXb 1LTIC 3CXHE 1URQC 3PO3I 1OZHA 3B71A 2K37A 1IFJA 3L70D 1PPJD 1T3JA 1SFOI 2C9NY 3H3VJ 2BEQD 3CD61 2E74C 5M1BA 4ZKUA 1NTZE 3V6IA 1EZVG 1LTAC 2XKMA 2W8ZA 1BCCE 3NTNA 4N6JA 2QG4A 4N3YB 2JIQA 1P84E 2LXBA 1M57D 1JOCA 1SQBE 1YJWP 1YIT1 4HB1A 4H13C 4NBEA 1QX8A 2QRXA 1SQXD 1IFPA 5CBOA 1ZV8A 2FFDC 1RY3A 3CCQP 2D2CB 1M1K1 4MD7A 5FLXf 2BCCE 4IL6X 1SFCB 3RK2B 5KKZB 1JY3N 1PGOA 2JR6A 1JCCA 1RO4A 2MJZA 1I3QI 1PGQA 1NU1D 1KQGB 3AE3C 3MGNA 3AE7C 3I551 3L35A 4BBSI 1CI6B 1SQXE 1FC2C 3VMYA 3GTPI 2OOXB 1S2EA 1PP9D 4H0LB 2Z5HA 2LXCB 4EI2A 3S15I 2R44A 2W27A 4A3KI 1G1IA 1LNQA 3F5HA 3KIHA 4I2LC 1HJBA 1KQFB 4HYTB 4H0LC 4U7JA 2KOGA 1ZRTE 1XTCC 4QTUA 1BE3J 1NTME 3N4XA 1N73A 3G71Z 4U3FJ 1NVOA 2XNDH 1KD11 3HTKB 4NH1C 2OTKE 3HOXI 1GW3A 1YHQZ 2YADA 2ZXXA 5KJ7A 2LR2A 3M3YI 2O3JA 1NJI2 2V7QH 2FYUD 3H1KG 1S5LX 3VMHA 3VP9A
chains in the Genus database with same CATH topology
3J80f 3D9XA 3KIFA 3GTLI 4K35A 1VQO1 2KZJA 4IOIH 4NBFA 4JBZA 2R7ZI 1JMBA 2JWDA 4HGZA 4NBHA 2V8KA 1Q822 4NBDA 4CL1A 2GTHA 1S721 4E30A 2P3YA 2QVAA 1S7MA 2Q4ZA 2NVQI 3CCR1 2B63I 5T64A 4E31A 1Q7Y2 1TWCI 2W03A 1YI2Z 3ESWA 3I4MI 4BY1I 2QEX1 4E2XA 5D1PA 1OVVA 3S1MI 1X0TA 2QR1B 3FKII 3QWOC 1ZW0A 3CXCZ 4Y52I 4MONA 2JMOA 1Q862 2V8IA 1KQSZ 1K732 1JJ2Z 1YITZ 5EFWB 1K9M1 1YJNZ 1K8A2 2F4OA 5T67A 1MFTA 1EDLA 3G4S1 1VQ6Z 3PH0A 3CCUZ 3RZDI 1R9TI 4XX2A 2VUGA 2R93I 1USPA 3NDJA 4NPFX 1U7MA 2M0BA 2EGTA 3CCLZ 3VB9A 1S3JA 3NH8A 3I56Z 2HR3A 2M6NA 1QVGZ 5DJTB 1X3ZA 4ZNCA 1N2FA 2R92I 3BG1B 1RO0A 1RLYA 2G2KA 3HOZI 2DE5A 1YIJZ 4E2YA 4MRIA 4Y7NI 4NOZA 1I6HI 3EERA 4MXUA 2SPZA 4S1TA 4A3FI 4DQYB 3J7A4 1YJ9Z 1NUIA 3NDIA 5C3EI 1VQK1 4NB9A 1SS1A 3MZLB 2JA8I 2OOYB 4A3CI 1BDCA 1DEEG 2VUMI 1EC5A 2QRDB 2WAQA 1K9M2 4HKZH 5CM2M 1KRLA 5AN9F 3J81b 1M1K2 1VQMZ 1VQLZ 2KZIA 1EDIA 2B88A 1PFTA 1ZH1A 2J6AA 4EWCA 1VQN1 3CC41 1VQM1 1Y1VS 2RHBA 3PO3S 4BY7I 1VQ41 1VQKZ 1DL6A 4A3EI 5IT9f 1JJ2Y 1KC82 1YJN1 2NVTI 3GTMI 1NP6A 2PMZA 4MD8A 1Q7Y1 1X3WA 2BJOA 4MH4A 3CXCY 4GOFA 2B89A 2HF1A 4E33A 2QREB 1ZXGA 5LL6f 1RNIA 2OTL1 4A3JI 5C39A 3CCQ1 1VQ7Z 1NJI1 2OTJZ 2OZKA 2QEXZ 3VTNA 1YHQ1 2YU9I 1BDDA 1LP1B 2UWJE 3MZKB 3CCRZ 4NBCA 3CCL1 3VMIA 3EEDA 3CMAZ 3OW2Y 1QVFZ 3CPWZ 2B87A 2E2II 5IP7I 2P28A 4NFRA 3HOVI 2KS1B 3CME1 1Q861 1OVRA 2RIQA 2I3CA 4MD9A 1QYPA 5D1OA 1VQOZ 1EDKA 4K3AA 2IZ4A 3HOWI 4RVDA 1KD12 1VLAA 3GKQA 5K5GB 3GTMS 3IFUA 3LUSA 3CMA1 1EDJA 2RKLA 1TWAI 4RVGA 4A3MI 1H0TB 2JNYA 2Y0SA 3BG0B 4NPDA 5FLMI 4DK1A 4HH4A 4A3DI 3M4OI 2HU9A 1YJWZ 5IP9I 3S16I 4GOEA 2OTLZ 3CC2Z 2LFUA 2DE7A 1YI21 2P58A 1L1OC 1Q811 3T4NB 3S14I 3NH4A 3HOYI 1TWGI 3D6WA 1Y1VI 3CCJZ 3CCSZ 3CMEZ 3FQMA 1K731 2DE6A 3S1QI 5D1OB 3S2HI 4NB8A 1N8R1 1VQ4Z 2M5AA 5C4JI 2QRCB 1Y47A 2F4MA 5A2Qb 3GTJI 3S1KA 1VQNZ 3CPWY 3CCU1 2R6MA 3G4SZ 3I55Z 3OW2Z 1M902 1QVFY 1VQ61 3MONA 3IF8A 1VQ8Z 1LT1A 4HGYA 4EYYQ 1JM0A 1Q821 2RPRA 1RQFA 4RVHA 2JA6I 3ZDMA 4RVFA 1VQPZ 3GTOI 2B87B 3Q87A 4CPGA 2PK7A 1QF8A 5C4XI 3S1NI 4GODA 3CCM1 4ASWA 3F3FC 4A3BI 2NVYI 1P9NA 2O53A 3FQQA 4NBBA 3I561 3GTGI 2JA5I 1WIIA 2E9HA 4DGLA 1K83I 1H0TA 4NBAA 2K5RA 2WB1A 1VQ9Z 3HKZA 4WWIA 2RT9A 4A3LI 4AYBA 5C44I 1VQ81 1ZB8A 4A93I 1YUAA 3QWUA 2PM9A 3K7AI 4E2WA 3MZWB 1VQ91 3CCS1 1VQL1 1TWHI 4NPEA 4KJMA 3CCE1 1W2BZ 1WCMI 1Z03A 3CC71 3PO2I 3NFZA 1TFIA 4RS4A 5T6BA 5DJUB 4RV9A 3CCQZ 1VQ71 3U50C 4X6AI 1RO2A 1LQLA 2IZ3A 5FLXb 1YJW1 3PO3I 2LIYA 2QA41 3TDHB 3H0GI 4A3II 1SFOI 3FXEA 2OTJ1 4BBRI 3CC21 3H3VJ 2I8DA 3CD61 2V8JA 4ASVA 4BXXI 2M5AB 2KUBA 3VMGA 3S2DI 4ZMDA 3S17I 1QVGY 2ZAEB 3J81f 1S72Z 1W2BY 3P5JB 2LXBA 3JAMb 4E32A 1Z01A 1K8A1 1YIT1 4HB1A 4HJGH 4NBEA 3IX0A 2QKDA 2QRXA 2GTIA 1YUKA 1Y1WI 3S1RI 3HOUI 5CBOA 2KIKA 1ML8A 3FXDA 1KQSY 2H85A 2W04A 3CCJ1 1Q2NA 4QTTA 3J80b 1M1K1 2O4HA 4NBGA 2JUBA 3CCV1 1YJ91 4MD7A 5FLXf 3G6EZ 2QA4Z 4TNUA 3CCVZ 1M901 2QLVB 2KPIA 3RZOI 2JR6A 1RO4A 2RBLA 1Q812 3CCMZ 1I3QI 2M48A 3GTQI 3GCFA 2E2HI 1Z02A 3I4NI 3I551 3JAMf 4BBSI 1FC2C 3CC4Z 3CQZI 1ZB9A 3GTPI 2OOXB 2LXCB 3GTKI 1N8R2 2JS4A 2JA7I 3CC7Z 3S15I 2NVXI 3RGUA 2R44A 1TWFI 4A3KI 4BXLA 1JWHC 2K3RA 1USPB 1KC81 3I07A 3KIHA 3MHVA 1I50I 1VQ51 4E2ZA 1WW9A 3TE5B 4QTUA 3CD6Z 1U7JA 1OVUA 3NH5A 3G71Z 2Q1KA 1NVOA 1KD11 3F3PC 1YIJ1 2AKLA 4NH1C 2OTKE 5IT9b 2KI7B 2GU2A 3HOXI 1YHQZ 2VF1A 2YADA 2Q51A 4A3GI 1VQP1 2WMMA 2LR2A 1VQ5Z 3M3YI 1NJI2 3G6E1 2E2JI 4MN4C 5CBNA 3G711 3CCEZ 1LP1A 5A2Qf 3VMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EC5 A;  2LXB A;  4K35 A;  2KZJ A;  4IOI H;  4JBZ A;  1JMB A;  4HKZ H;  2M5A A;  1Y47 A;  2JWD A;  2KZI A;  1EDI A;  2B88 A;  3S1K A;  4HB1 A;  4HJG H;  2QRX A;  5CBO A;  2KIK A;  1LT1 A;  4EYY Q;  1JM0 A;  3FXD A;  3ZDM A;  1Q2N A;  2QVA A;  4GOF A;  2B89 A;  2B87 B;  4CPG A;  1ZXG A;  4GOD A;  4ASW A;  1OVV A;  1X0T A;  5C39 A;  3QWO C;  1ZW0 A;  1BDD A;  1LP1 B;  2UWJ E;  1H0T A;  1FC2 C;  5EFW B;  4WWI A;  2LXC B;  3RGU A;  1MFT A;  2R44 A;  1EDL A;  2B87 A;  3PH0 A;  3MZW B;  4BXL A;  2KS1 B;  4NPF X;  1OVR A;  2K3R A;  1U7M A;  2M0B A;  4NPE A;  4KJM A;  3MHV A;  1S3J A;  1EDK A;  4K3A A;  2HR3 A;  5DJU B;  5K5G B;  5DJT B;  1EDJ A;  2RKL A;  1U7J A;  4ZNC A;  1OVU A;  1H0T B;  2Q1K A;  1NVO A;  4NPD A;  2OTK E;  2KI7 B;  3FXE A;  4GOE A;  2I8D A;  2WMM A;  2SPZ A;  2LR2 A;  4ASV A;  2P58 A;  2M5A B;  2KUB A;  4ZMD A;  4MN4 C;  5CBN A;  1LP1 A;  2ZAE B;  1SS1 A;  1BDC A;  1DEE G; 
#chains in the Genus database with same CATH topology
 1IJD B;  2Q6Q A;  1LWU B;  4DOJ A;  4U3F G;  1DIP A;  2KNC A;  3AE9 C;  5CCH D;  1YIJ P;  2FYU G;  4WVZ A;  2KS1 A;  2FYN C;  1HGV A;  1JTH B;  1M1K Q;  1JEK A;  4CL1 A;  2GUV A;  4PD4 D;  2FXO A;  1KD1 Q;  3P8C E;  1LTJ C;  3L70 J;  2P10 A;  4N78 E;  2P3Y A;  2QVA A;  3CWB D;  1G1J A;  3H1J G;  2W03 A;  1UIX A;  1YI2 Z;  1SQX J;  2JEE A;  3S1M I;  3L73 J;  2QR1 B;  1FDM A;  1RF1 B;  1ZW0 A;  3QH9 A;  1Q86 2;  1Q16 A;  3L73 E;  1EXI A;  2ZT9 C;  2ZT9 D;  3H1H E;  3U59 A;  3O6Q B;  3L70 G;  3D71 A;  3CX5 H;  1MFT A;  2OYH B;  1R9T I;  1U7M A;  3VB9 A;  1NU1 J;  3IR9 A;  3NH8 A;  2M6N A;  3VN0 A;  2KSE A;  1X3Z A;  4OGQ B;  3CCS P;  1K8A Q;  2XU6 A;  1HVV A;  1NAY A;  1N2F A;  1SFC A;  2R92 I;  1HWT C;  3GF3 A;  5H2F E;  4WB4 A;  5AVR B;  3PTZ A;  3L71 E;  2G2K A;  1VQ4 P;  1GL2 A;  1Q90 D;  1FDI A;  1PIX A;  4NOZ A;  1YJN P;  3KPE A;  2ZJS E;  5CCH A;  3G4S P;  1SVF A;  3CXH H;  2WSE J;  3L71 J;  1YJ9 Z;  1BCC D;  2N1T A;  2QJY B;  4AUW A;  4NB9 A;  3CC2 P;  4LGD E;  1E79 H;  3RL0 g;  3SWF A;  1G2C A;  2KLU A;  2XDJ A;  1KB9 D;  4HKZ H;  3JCU E;  1YHQ P;  3BAS A;  2P7J A;  1M1K 2;  4O9B A;  2J6A A;  1VQN 1;  1JY2 P;  2FXM A;  4R4L A;  1Q82 Q;  1OW8 A;  4A3E I;  5AVW B;  1H8A A;  1DH3 A;  4MD8 A;  1GK6 A;  1S9K E;  4GKG A;  3KXD A;  4GOF A;  2YMK A;  4RKU J;  1N7S C;  1ZXG A;  4YXW H;  1HF9 A;  1RNI A;  2E7Z A;  1LP1 B;  3G3Z A;  3V4Q A;  3CI9 A;  1AFO A;  2FFD A;  3CCL 1;  3AEE C;  3CMA Z;  3O8Z A;  3AE5 C;  1KQL A;  2A06 E;  3CPW Z;  3FWL A;  1YI2 P;  5IP7 I;  4NFR A;  3HOV I;  3CME 1;  1Q86 1;  1LJ2 A;  1OVR A;  2RIQ A;  1PPJ E;  5BU8 B;  2I3C A;  1JNM A;  3HTK A;  3IR7 A;  1EDK A;  4K3A A;  3HOW I;  2L91 A;  3H1K J;  1VLA A;  2N1T C;  3GTM S;  1EDJ A;  4RVG A;  4H44 B;  3R4Y A;  1QEX A;  1SQV G;  3M9Q A;  3LW5 H;  3V4W A;  3PP5 A;  4XE5 B;  4DK1 A;  2RMZ A;  3A5T A;  2HU9 A;  1OIP A;  3S16 I;  1IK9 A;  4I7Z C;  2ZVO B;  1DD3 A;  1KN7 A;  2DE7 A;  2JR8 A;  3VOP A;  3T4N B;  1BGY J;  3S14 I;  3NH4 A;  1UII A;  3L74 J;  1T6A A;  3HOY I;  1IFI A;  1RE4 A;  3CCS Z;  1N73 C;  1OMI A;  3H1I J;  1JY3 P;  3S2H I;  1Y47 A;  2Y0D A;  3CPW Y;  3A0H E;  3HUS C;  1SFC C;  2W83 C;  1VQO P;  1NTK G;  1BGY G;  2A45 I;  4EYY Q;  4HGY A;  1LT9 C;  2RPR A;  3L74 G;  1FE6 A;  3HE5 A;  3ZDM A;  4BRY B;  3I5C A;  2FFD B;  1L0L E;  1QF8 A;  3LID A;  3CXH D;  3S1N I;  3BAT A;  3VMX A;  1LT9 B;  1P9N A;  3FQQ A;  2CK3 H;  2C0W A;  1SQQ J;  1H0T A;  2IV2 X;  3PLN A;  2WB1 A;  3USS A;  3AEB C;  2R3S A;  1NTK E;  2IBZ I;  5C44 I;  1VQ8 1;  3H1K E;  1YUA A;  1RF0 C;  2YO3 A;  4JQ0 D;  4E2W A;  1VQ9 1;  4KHX A;  3CCS 1;  3TK1 A;  2QJP B;  1USD A;  3TNU B;  1KYO H;  3CCE 1;  3AED C;  3PO2 I;  1NTM D;  3NFZ A;  3C9I A;  3Q3D A;  2IFN A;  3AEA C;  2BEZ F;  2XZR A;  3TF5 A;  3H0G I;  4A3I I;  3PJS K;  2E74 D;  4D6T J;  3CC2 1;  4DZO A;  4H13 D;  4JYC A;  4RJT A;  4RES B;  3H1I E;  3D6Z A;  2KUB A;  1YYC A;  4UB8 H;  4ZMD A;  4C7N B;  2ZAE B;  1QVF O;  1L4A B;  1VQN P;  1NKN A;  2VRS A;  1X8Y A;  3U1A A;  1S4X A;  4E32 A;  3WU2 H;  1K8A 1;  3HE4 B;  3RK3 C;  3CX5 D;  2NPS D;  3L75 E;  4HJG H;  3IX0 A;  1YUK A;  1JY3 O;  2RH0 A;  3NXS A;  1OFC X;  3HOU I;  1W2B O;  2KIK A;  1ML8 A;  3KQG A;  3H1I D;  3FXD A;  1KQS Y;  2H85 A;  3IN6 A;  1L2P A;  5B5E H;  3HD7 D;  2H88 C;  3J80 b;  4KT0 J;  4NBG A;  2JUB A;  1WMK A;  1FZB A;  2O01 N;  5AVQ B;  2IDB A;  1Y9B A;  3CCV Z;  1M90 1;  1KYO D;  2QLV B;  4WY4 D;  2KXP B;  5B66 E;  1SQQ K;  1Q81 2;  3GCF A;  2WVR A;  1Z02 A;  4LC1 A;  1URQ D;  2AYD A;  3CQZ I;  1FOS E;  5AVV B;  4JPZ B;  2KNC B;  5APW A;  3GTK I;  3RL0 B;  2NPS A;  2WSF H;  2QJK C;  2R32 A;  1JWH C;  2K3R A;  2FBW C;  1USP B;  4I6M C;  3I07 A;  3MHV A;  1I50 I;  4Y99 C;  3VTP C;  3KZI H;  4E2Z A;  1WW9 A;  3NH5 A;  3I55 P;  2AKL A;  5IT9 b;  2GU2 A;  2H7H A;  2VF1 A;  1LWU C;  3LIE A;  4A3G I;  1TU3 F;  2WT7 B;  4WBA A;  2L5G B;  1VQP 1;  2V45 A;  1N7L A;  3KDP B;  1Y8C A;  1MUU A;  1KYO E;  5KAI H;  1M1J C;  1YQ3 C;  3L36 A;  4L74 A;  4MN4 C;  3G71 1;  1FU1 A;  2H89 C;  1BSH A;  3KIF A;  1GL2 D;  3AE2 C;  3GTL I;  1VQO 1;  2KZJ A;  4IOI H;  4NBF A;  4L73 A;  1PV3 A;  3TNU A;  4PJ0 E;  5CHX A;  4I1L A;  5APS A;  4WY4 A;  1Q82 2;  1IFN A;  1NGM B;  1EZV I;  1OX3 A;  1AVY A;  1RQU A;  1FZA A;  1IFM A;  2POH A;  2H43 A;  1IO4 A;  4NBD A;  1U57 A;  1RE4 C;  1SQX G;  1PP9 J;  1S72 1;  2M3B A;  4I7Z B;  3L73 G;  2NVQ I;  2AEF A;  1VDF A;  2B63 I;  3AEG C;  1OWA A;  4PJ0 H;  1SQX K;  5D1P A;  1L0L D;  4PD4 I;  4H44 C;  1K05 A;  1X0T A;  3QWO C;  2E75 C;  2WSS H;  2QJK B;  4C7N A;  2WQY C;  1KQS Z;  3MP7 B;  2WSC J;  3RK2 D;  2HPC A;  1EXJ A;  1K73 Q;  1IFD A;  3RK2 C;  1YIT Z;  1KOR A;  1K9M 1;  4GT1 A;  1K8A 2;  1BSN A;  2F4O A;  1EDL A;  3KZI E;  4XX2 A;  1FZC B;  4NPF X;  3RK3 D;  2M0B A;  1VQK P;  3CCL Z;  1DD4 A;  5KAI E;  1VF5 D;  1RE3 A;  3M9H A;  5DJT B;  1NTZ D;  2KYV A;  4JYB A;  1XTG B;  1MZ9 A;  3V2P A;  1RLY A;  3CC7 P;  2DE5 A;  2O01 J;  4MRI A;  3OJA B;  1I6H I;  1BE3 G;  1HH0 A;  3EER A;  4MXU A;  2QM8 A;  4DQY B;  3J7A 4;  3H1I G;  3A2A A;  1KZU B;  1NTM G;  4BRY A;  2HLO A;  1BDC A;  1DEE G;  2VUM I;  5TJH A;  1KB9 E;  1BE3 D;  1SQV E;  3L37 A;  1JY2 N;  1K9M 2;  2A06 D;  2E75 B;  3F89 A;  1VQM 1;  3TYY A;  1ZLL A;  1VQ4 1;  1DL6 A;  2Q9I A;  1KC8 2;  3GHG B;  1YJN 1;  2NVT I;  5KLV K;  2QSI A;  2PMZ A;  3L72 J;  1QVG O;  1X3W A;  2JIP A;  3FGA D;  4MH4 A;  3H25 A;  2JIR A;  5KJ7 C;  2HPC B;  2HF1 A;  5LL6 f;  1MFZ A;  5C39 A;  1QGK B;  3M9B A;  2OZK A;  4EOT A;  2QEX Z;  1KV4 A;  1YHQ 1;  1S9K D;  1NU1 K;  3CCR Z;  1L0N K;  5AVZ B;  4BWN A;  4NBC A;  2YXR B;  1N2D C;  2P1J A;  3AE8 C;  4HH2 A;  3OW2 Y;  1PGP A;  1QVF Z;  3GF7 A;  1ZR2 A;  1Q7Y Q;  1GTW A;  2P28 A;  1Q81 Q;  2D2C D;  5APT A;  2IZ4 A;  3HD7 C;  5K5G B;  3LUS A;  1VQP P;  2PGD A;  2YO2 A;  1H0T B;  5KTB A;  2P2U A;  2CPS A;  3H1L E;  4IFM A;  2WSF J;  4HH4 A;  5GTH H;  1VQ6 P;  1YJW Z;  5IP9 I;  4A7P A;  1AA6 A;  2R5D A;  2VPW A;  2HOD A;  1YI2 1;  2P58 A;  4H0L D;  1L1O C;  1Q81 1;  3H1L G;  2W6A A;  1ZR4 A;  3EQ2 A;  1L0N D;  2J58 A;  1Y1V I;  1FAV A;  5AW3 B;  3CME Z;  3FQM A;  2OYH A;  1H89 A;  2DE6 A;  3S1Q I;  1RQV A;  5D1O B;  3G6E P;  3A7O A;  3SWK A;  4NB8 A;  5A2Q b;  3IAO A;  1S72 P;  3BCC E;  5KLV D;  2XV5 A;  1PP9 G;  1DX7 A;  3H1H J;  1PGJ A;  3WUV A;  3OW2 Z;  1M90 2;  3IF8 A;  1LT1 A;  1JM0 A;  1JY2 O;  1Q82 1;  2JA6 I;  4RVH A;  2GUS A;  5APX A;  1KIL D;  3GTO I;  1D7M A;  2E5Y A;  2E43 A;  2IYO A;  4IL6 H;  4CPG A;  1FS0 E;  2PK7 A;  2CPB A;  3F3F C;  3CWB E;  4WY4 C;  4NBB A;  1J1D C;  1KTM A;  2A45 H;  3I56 1;  3MIW A;  3S4R A;  3CWB J;  4DGL A;  3C1L A;  1AA0 A;  3ITK A;  3RBX A;  1VL2 A;  3HKZ A;  1RHZ B;  2R5B A;  2VPX A;  2OGU A;  1FZG A;  4GDO A;  1M7L A;  2PM9 A;  3TGU E;  2KB7 P;  3QWU A;  1PP9 E;  2FY8 A;  2ZFC A;  1SQV J;  4KJM A;  3B8E B;  1W2B Z;  3CC7 1;  1JTH A;  3WUT A;  3U50 C;  1W5C E;  1RO2 A;  2I1J A;  5L8R J;  2NZ2 A;  3G9R A;  5KJ7 D;  3BRV B;  3FXE A;  4BBR I;  2I8D A;  2V8J A;  5CCH C;  3TGU D;  2AXC A;  4ASV A;  5CCG A;  1VQ9 P;  3S2D I;  3V2Q A;  1J1D B;  3S17 I;  4QMA A;  3CCV P;  4U3F D;  1NYH A;  1W2B Y;  1FJK A;  3P5J B;  4JF7 A;  3JAM b;  5AW9 B;  1Z01 A;  2WTY A;  5KLI B;  3UIA A;  3CL3 D;  2O1K A;  3RL0 D;  2JWA A;  2K1A A;  2LEX A;  3MUD A;  4QTT A;  3H1J D;  2FYU K;  3CX5 I;  2YKP A;  1GW4 A;  3GMA A;  2Z5I A;  3CX5 E;  3G6E Z;  4TNU A;  4L75 A;  2Q7C A;  2HG5 D;  2MKV A;  1JB0 J;  5E79 E;  2YIU C;  2RBL A;  3CCM Z;  3H32 A;  1VQ5 P;  2OYH C;  3H1H D;  2E2H I;  2IBZ E;  3SFD C;  2A45 G;  2QIW A;  3I4N I;  2E42 A;  3JAM f;  1S1C X;  2OTL P;  2AEJ A;  1WZN A;  2Q3I A;  1N8R 2;  2E76 D;  2E76 B;  3R2P A;  1LTG C;  5AW4 B;  2C9L Y;  4IFD K;  1TWF I;  4BXL A;  3WMM 0;  2PFX A;  1KC8 1;  2WPS A;  4U3F E;  1FBM A;  1L0N G;  1KIL A;  2J5U A;  2KSJ A;  1GZL A;  4W80 A;  3TE5 B;  1U7J A;  2N1T B;  2Q1K A;  1M90 Q;  4TLF A;  1MKM A;  1OW6 A;  1R8E A;  3H1J J;  2KI7 B;  3JCU H;  1NU1 E;  1KIL E;  1WJ2 A;  1NTM J;  1BE3 E;  1NAF A;  2FYU J;  4DJG A;  1PPJ G;  2WMM A;  1VQ5 Z;  1T3U A;  3G6E 1;  2E2J I;  5AW7 B;  1RF0 A;  5A2Q f;  3SFE C;  1J2J B;  4EIJ A;  1Z56 A;  2PAJ A;  3D9X A;  4R4M A;  1QL2 A;  4K35 A;  1M8O B;  2R7Z I;  4B86 A;  4HGZ A;  3D70 A;  3H32 B;  4NBH A;  2V8K A;  1L0N E;  2QM7 A;  2GM4 A;  4Y99 B;  3TGU J;  1NKZ B;  1ZRT D;  5KAF E;  2FKW B;  2GTH A;  2WWW A;  2WPV B;  1X79 B;  4DT0 A;  3G71 P;  3I56 P;  4GIF A;  1Q7Y 2;  1EZV D;  1BGY E;  3ESW A;  3I4M I;  2QEX 1;  3B5N A;  3FKI I;  1SQV D;  1NTZ K;  1S5L E;  4Y52 I;  3T97 A;  2JMO A;  2V8I A;  1IK7 A;  1GD2 E;  4L76 A;  1HGZ A;  2WZ7 A;  1K73 2;  1JJ2 Z;  2K9J B;  1WT6 A;  5EFW B;  1FDO A;  1Q86 Q;  4OVN F;  3V2R A;  2PP6 A;  2DW3 A;  3PH0 A;  3CCU Z;  3RZD I;  2R93 I;  1L4A A;  2VUG A;  3NDJ A;  4Z1M H;  1HBW A;  2HYN A;  2ZYG A;  1S3J A;  1SQB J;  1YTZ T;  1QVG Z;  3D6Y A;  5KLV G;  2OYI A;  4ZNC A;  1VQL P;  1CI6 A;  3HRN A;  3E1R A;  1EZV E;  2M8R A;  3NFQ A;  3W68 A;  1RO0 A;  2ITA A;  3HOZ I;  4DCK A;  4E2Y A;  1LGH B;  1YIJ Z;  3AE1 C;  3RK3 E;  2NAP A;  4Y7N I;  4H13 B;  1CSB A;  2HOD B;  2GA1 A;  1HJ0 A;  1J1E C;  1GK4 A;  2SPZ A;  1N86 A;  3GHG C;  2QA4 P;  3A0B H;  2Q3E A;  2NPS C;  2V3V A;  1VQK 1;  1SS1 A;  3M0D A;  3MZL B;  2JA8 I;  2OTJ P;  1CW5 A;  4A3C I;  1N7S D;  2Q5U A;  2WAQ A;  4IL6 E;  2IZ1 A;  5CM2 M;  1T2K D;  1KRL A;  3J81 b;  3L70 E;  2KZI A;  1EDI A;  2ZXE B;  1PFT A;  3CC4 1;  1Y1V S;  2RHB A;  1S5L H;  1T8Z A;  5AVY B;  1LT9 A;  1NP6 A;  2W6B A;  2N9Y B;  3IF4 A;  1AJY A;  2BJO A;  1NTZ J;  2IBZ G;  4E33 A;  5CCG C;  4UB6 E;  5AVT B;  2QRE B;  2YKQ A;  3CWB G;  2OTL 1;  4A3J I;  1ZME C;  1SQB D;  1URQ A;  2BCC G;  3VMZ A;  3VTN A;  2YU9 I;  2E5T A;  1L0L G;  2W90 A;  1YJ9 P;  1WRG A;  1ZN5 A;  2YXQ B;  3SSU A;  4AYC A;  3P8C D;  1VQM P;  3VMI A;  4XFJ A;  3EED A;  3RK3 B;  5H2F H;  2OAR A;  2R3C A;  5BVZ A;  1NTK K;  3GG2 A;  2B87 A;  1W2E A;  2KS1 B;  3MUD C;  4PV1 C;  2IZ0 A;  2JKV A;  4PD4 H;  4MD9 A;  2IYP A;  4D6T D;  2BCC J;  1VQO Z;  1NTK J;  4RVD A;  1KD1 2;  2JJL A;  3GKQ A;  2RKL A;  4A3M I;  1N8R Q;  2WSE H;  4Y28 J;  1NTZ G;  4NPD A;  5FLM I;  1USE A;  3M06 A;  3M4O I;  1GL2 C;  2O01 H;  4GOE A;  1AV1 A;  1N73 B;  2OTL Z;  2LFU A;  3NMD A;  3CPW O;  1M1J A;  1VF5 C;  5GTH E;  1HUC A;  4D6T E;  5B5E E;  3CCJ Z;  1GL2 B;  1AQT A;  3JC2 2;  1K73 1;  3H1H G;  2JIO A;  1N8R 1;  3A3Y B;  1VQ4 Z;  3H1L D;  2QRC B;  2F4M A;  5B66 H;  1NO4 A;  4TT3 H;  5AVX B;  1YTZ I;  2R6M A;  3G4S Z;  1QVF Y;  1VQ6 1;  2A06 G;  2OQQ A;  1FOS F;  2ZVN B;  1NH4 A;  1RQF A;  3OW2 O;  3L75 J;  2B87 B;  4UB8 E;  2W6J H;  5C4X I;  1LTS C;  4GOD A;  4C7R A;  3CCM 1;  2C0X A;  1JCD A;  4A3B I;  1IZN B;  2NVY I;  2V7Q J;  2JA5 I;  5KLV J;  1WII A;  4YXD C;  5AW5 B;  1K83 I;  5APV A;  1VQ9 Z;  4WWI A;  2RT9 A;  4A3L I;  1G2C B;  1X22 A;  1ZB8 A;  5AW2 B;  5APU A;  3U1C A;  3II6 A;  3C8V A;  1VQL 1;  4RO0 A;  1KB9 H;  1VF5 B;  1WCM I;  1Z03 A;  1QLE D;  1TFI A;  5T6B A;  2JIM A;  2G8Y A;  2AEM A;  1SQQ G;  3B4S A;  3PHL A;  1LQL A;  1YJW 1;  1YQ4 C;  2LIY A;  5CCG D;  2AXT H;  2QA4 1;  3TDH B;  1LWU A;  4W7Z A;  2OTJ 1;  2OYI B;  1PZQ A;  1SQP G;  1LTJ A;  1KYO I;  4BXX I;  2M5A B;  3VMG A;  1P84 I;  3P32 A;  5AVS B;  1QVG Y;  1HTL C;  3J81 f;  1S72 Z;  2IBZ D;  3CC4 P;  1SQP D;  3TGU G;  2BCC D;  2QKD A;  3VMA A;  1L0L J;  2GTI A;  1KIL B;  1Y1W I;  2JP3 A;  3S1R I;  1A02 J;  2WPQ A;  4EDF A;  1JMM A;  1CZQ A;  2W04 A;  3CCJ 1;  1Q2N A;  3B5N D;  2M3E A;  2O4H A;  2B9B A;  3CCV 1;  1YJ9 1;  2QA4 Z;  3L72 D;  2KPI A;  3RZO I;  1FZC C;  3LW5 J;  3S9O A;  2XNX A;  1KQS O;  2M48 A;  3GTQ I;  1KMI Z;  4C46 A;  2V4H A;  5CMZ A;  2ZYD A;  3CC4 Z;  3L72 G;  2N9B A;  1ZB9 A;  1T2K C;  2JS4 A;  2JA7 I;  3CC7 Z;  2NVX I;  3RGU A;  1R5L A;  1NTK D;  3L74 D;  5BU5 A;  2NPS B;  1RE3 C;  1VQ5 1;  5E79 H;  3BVH A;  3CD6 Z;  1OVU A;  2K9Y A;  3F3P C;  1YIJ 1;  3EFF K;  4AQR D;  2JDI H;  4YTP C;  4OGQ D;  4OWF A;  2Q51 A;  1GMJ A;  1NOH A;  3Q2Y A;  3CMA P;  4OGQ C;  3T97 B;  3JSV C;  3D2L A;  3IFM A;  1RH5 B;  3HUS B;  5CBN A;  2Y0C A;  3CCE Z;  1LP1 A;  1SLQ A;  3E7K A;  4PD4 E;  3J80 f;  1M1J B;  2Y0E A;  4JBZ A;  1SQQ E;  1JMB A;  1KIL C;  2JWD A;  2QE7 H;  3MD0 A;  3PRJ A;  5APY A;  3H1L J;  1KFN A;  1QL1 A;  3Q5P A;  1K9M Q;  3SWY A;  2O1J A;  3CCU P;  4E30 A;  5GTI H;  1S7M A;  2Q4Z A;  3L4F A;  3CCR 1;  5T64 A;  1X9V A;  2HFE D;  3L74 E;  4E31 A;  1TWC I;  2IPP A;  4BY1 I;  4E2X A;  2P67 A;  3TDK A;  1OVV A;  3M0A A;  1AVO A;  5AW0 B;  2Y9Y A;  3CXC Z;  2G3A A;  4MON A;  1ZOY C;  1NJI Q;  2H8P D;  2VPY A;  4ZKP A;  1YJN Z;  5T67 A;  3RBZ A;  1NHL A;  2JO1 A;  3G4S 1;  1VQ6 Z;  3ABV C;  2K9J A;  3K5B A;  1P84 D;  3OAK A;  1A02 F;  1USP A;  4H44 D;  5AW6 B;  2FYZ A;  2EGT A;  3P7K A;  3L71 D;  2QEX P;  3V2N A;  2VPZ A;  3I56 Z;  2K88 A;  3AE4 C;  3HD7 A;  2HR3 A;  2Y9Z A;  3Q5S A;  2WPR A;  3B5N B;  5AW8 B;  4OH8 B;  2PRR A;  1SQP J;  3B5N C;  3A0H H;  3Q5R A;  3OA7 A;  3HUS A;  3BG1 B;  1NU1 G;  5TIS E;  3BCC D;  3L71 G;  5KLV E;  1H88 A;  1E5W A;  1SQP E;  1OW7 A;  2ZT9 B;  1VQ7 P;  4S1T A;  4A3F I;  1N7S A;  3EWK A;  1NUI A;  4UB6 H;  3NDI A;  5C3E I;  1MV8 A;  2OOY B;  2WSC H;  1L4A D;  3CD6 P;  1EC5 A;  1L4A C;  2QRD B;  1SQQ D;  3EFG A;  2AXT E;  2BAS A;  1AQ5 A;  2RN0 A;  5AN9 F;  1SQP K;  1VQM Z;  3H6P A;  1VQL Z;  3CCJ P;  1OXZ A;  2B88 A;  1ZH1 A;  4EWC A;  3L72 E;  3AE6 C;  1BGY D;  3VYI A;  2WT7 A;  2OYI C;  3PO3 S;  4BY7 I;  3CCL P;  1VQK Z;  1L0L K;  2QJY C;  1SP4 A;  5IT9 f;  1JJ2 Y;  3GLM A;  3A0B E;  4N78 D;  3WU2 E;  3GTM I;  1DEB A;  1J1E B;  2YIU B;  3AEC C;  1YIT P;  5KKZ C;  1Q7Y 1;  3Q1M A;  5CJ0 A;  3CXC Y;  2B89 A;  3CME P;  1LTT C;  5CJ4 A;  3GHG A;  2D2C C;  2I1K A;  2QJP C;  2J59 M;  3H1K D;  1FZF A;  3CCQ 1;  1VQ7 Z;  1NJI 1;  2YMY A;  2OTJ Z;  1BDD A;  2UWJ E;  3MZK B;  1GU5 A;  1SQB K;  2NRG A;  4XA4 A;  3O6Q A;  5KLI C;  2FYU E;  2KK7 A;  2Z4E A;  1SQB G;  3AEF C;  2E2I I;  3MTU E;  1FZC A;  4PV1 B;  2E75 D;  4PV1 D;  3KHU A;  3HE4 A;  3L73 D;  5TIS H;  1QYP A;  5D1O A;  3GW6 A;  1ZP0 C;  2FXP A;  4M3L A;  1RF1 C;  3IFU A;  2E74 B;  3CMA 1;  1TWA I;  3CLQ A;  2WIT A;  3FWN A;  2N1T D;  2JNY A;  4LLH A;  1LTB C;  1L0N J;  2Y0S A;  3BG0 B;  5APQ A;  4YPC A;  4A3D I;  1KFM A;  1NTM K;  1PFI A;  1SFC D;  1LTJ B;  3HE5 B;  3CC2 Z;  1IC2 A;  3P8M C;  1N7S B;  3RL0 C;  1R5S A;  1M56 D;  2FYN B;  2KLV A;  1TWG I;  3D6W A;  1PL5 A;  3BCC J;  1SQV K;  5KAF H;  1FZE A;  2M5A A;  5C4J I;  2YNY A;  2IX7 C;  3S1K A;  3W67 A;  3GTJ I;  1VQN Z;  3CCU 1;  1BCC J;  3HD7 B;  3I55 Z;  3TSI A;  3CCR P;  3MON A;  1P84 H;  1VQ8 Z;  3CXH I;  3FX0 A;  1VPC A;  3H1J E;  1VQ8 P;  1YBK A;  4WY4 B;  4RVF A;  1VQP Z;  1GU4 A;  1JO5 A;  1JUN A;  1EQ7 A;  1Y8A A;  3Q87 A;  2YKO A;  3E1I A;  3CCE P;  2ZYA A;  1K04 A;  3M0D C;  4ASW A;  1GDT A;  3VP8 A;  3L75 G;  2O53 A;  3GTG I;  1KB9 I;  5AVU B;  2LKM A;  2IFM A;  2KP8 A;  2E9H A;  4W7Y A;  3N7N A;  3V5B A;  4NBA A;  1RF1 A;  2K5R A;  5GTI E;  3BCC G;  2OYO A;  4AYB A;  1NWQ A;  2E76 C;  4A93 I;  3L75 D;  1SIW A;  1KC8 Q;  4IFF A;  1URQ B;  3K7A I;  3MZW B;  3M91 A;  1TWH I;  4NPE A;  1BCC G;  1QXF A;  1FJP A;  3KYQ A;  3CCM P;  4RS4 A;  3WUU A;  5DJU B;  4RV9 A;  4D6T G;  3CCQ Z;  1VQ7 1;  4X6A I;  3BRT B;  2IZ3 A;  5AW1 B;  5FLX b;  1LTI C;  3CXH E;  1URQ C;  3PO3 I;  1OZH A;  3B71 A;  2K37 A;  1IFJ A;  3L70 D;  1PPJ D;  1T3J A;  1SFO I;  2C9N Y;  3H3V J;  2BEQ D;  3CD6 1;  2E74 C;  5M1B A;  4ZKU A;  1NTZ E;  3V6I A;  1EZV G;  1LTA C;  2XKM A;  2W8Z A;  1BCC E;  3NTN A;  4N6J A;  2QG4 A;  4N3Y B;  2JIQ A;  1P84 E;  2LXB A;  1M57 D;  1JOC A;  1SQB E;  1YJW P;  1YIT 1;  4HB1 A;  4H13 C;  4NBE A;  1QX8 A;  2QRX A;  1SQX D;  1IFP A;  5CBO A;  1ZV8 A;  2FFD C;  1RY3 A;  3CCQ P;  2D2C B;  1M1K 1;  4MD7 A;  5FLX f;  2BCC E;  4IL6 X;  1SFC B;  3RK2 B;  5KKZ B;  1JY3 N;  1PGO A;  2JR6 A;  1JCC A;  1RO4 A;  2MJZ A;  1I3Q I;  1PGQ A;  1NU1 D;  1KQG B;  3AE3 C;  3MGN A;  3AE7 C;  3I55 1;  3L35 A;  4BBS I;  1CI6 B;  1SQX E;  1FC2 C;  3VMY A;  3GTP I;  2OOX B;  1S2E A;  1PP9 D;  4H0L B;  2Z5H A;  2LXC B;  4EI2 A;  3S15 I;  2R44 A;  2W27 A;  4A3K I;  1G1I A;  1LNQ A;  3F5H A;  3KIH A;  4I2L C;  1HJB A;  1KQF B;  4HYT B;  4H0L C;  4U7J A;  2KOG A;  1ZRT E;  1XTC C;  4QTU A;  1BE3 J;  1NTM E;  3N4X A;  1N73 A;  3G71 Z;  4U3F J;  1NVO A;  2XND H;  1KD1 1;  3HTK B;  4NH1 C;  2OTK E;  3HOX I;  1GW3 A;  1YHQ Z;  2YAD A;  2ZXX A;  5KJ7 A;  2LR2 A;  3M3Y I;  2O3J A;  1NJI 2;  2V7Q H;  2FYU D;  3H1K G;  1S5L X;  3VMH A;  3VP9 A; 
#chains in the Genus database with same CATH homology
 3J80 f;  3D9X A;  3KIF A;  3GTL I;  4K35 A;  1VQO 1;  2KZJ A;  4IOI H;  4NBF A;  4JBZ A;  2R7Z I;  1JMB A;  2JWD A;  4HGZ A;  4NBH A;  2V8K A;  1Q82 2;  4NBD A;  4CL1 A;  2GTH A;  1S72 1;  4E30 A;  2P3Y A;  2QVA A;  1S7M A;  2Q4Z A;  2NVQ I;  3CCR 1;  2B63 I;  5T64 A;  4E31 A;  1Q7Y 2;  1TWC I;  2W03 A;  1YI2 Z;  3ESW A;  3I4M I;  4BY1 I;  2QEX 1;  4E2X A;  5D1P A;  1OVV A;  3S1M I;  1X0T A;  2QR1 B;  3FKI I;  3QWO C;  1ZW0 A;  3CXC Z;  4Y52 I;  4MON A;  2JMO A;  1Q86 2;  2V8I A;  1KQS Z;  1K73 2;  1JJ2 Z;  1YIT Z;  5EFW B;  1K9M 1;  1YJN Z;  1K8A 2;  2F4O A;  5T67 A;  1MFT A;  1EDL A;  3G4S 1;  1VQ6 Z;  3PH0 A;  3CCU Z;  3RZD I;  1R9T I;  4XX2 A;  2VUG A;  2R93 I;  1USP A;  3NDJ A;  4NPF X;  1U7M A;  2M0B A;  2EGT A;  3CCL Z;  3VB9 A;  1S3J A;  3NH8 A;  3I56 Z;  2HR3 A;  2M6N A;  1QVG Z;  5DJT B;  1X3Z A;  4ZNC A;  1N2F A;  2R92 I;  3BG1 B;  1RO0 A;  1RLY A;  2G2K A;  3HOZ I;  2DE5 A;  1YIJ Z;  4E2Y A;  4MRI A;  4Y7N I;  4NOZ A;  1I6H I;  3EER A;  4MXU A;  2SPZ A;  4S1T A;  4A3F I;  4DQY B;  3J7A 4;  1YJ9 Z;  1NUI A;  3NDI A;  5C3E I;  1VQK 1;  4NB9 A;  1SS1 A;  3MZL B;  2JA8 I;  2OOY B;  4A3C I;  1BDC A;  1DEE G;  2VUM I;  1EC5 A;  2QRD B;  2WAQ A;  1K9M 2;  4HKZ H;  5CM2 M;  1KRL A;  5AN9 F;  3J81 b;  1M1K 2;  1VQM Z;  1VQL Z;  2KZI A;  1EDI A;  2B88 A;  1PFT A;  1ZH1 A;  2J6A A;  4EWC A;  1VQN 1;  3CC4 1;  1VQM 1;  1Y1V S;  2RHB A;  3PO3 S;  4BY7 I;  1VQ4 1;  1VQK Z;  1DL6 A;  4A3E I;  5IT9 f;  1JJ2 Y;  1KC8 2;  1YJN 1;  2NVT I;  3GTM I;  1NP6 A;  2PMZ A;  4MD8 A;  1Q7Y 1;  1X3W A;  2BJO A;  4MH4 A;  3CXC Y;  4GOF A;  2B89 A;  2HF1 A;  4E33 A;  2QRE B;  1ZXG A;  5LL6 f;  1RNI A;  2OTL 1;  4A3J I;  5C39 A;  3CCQ 1;  1VQ7 Z;  1NJI 1;  2OTJ Z;  2OZK A;  2QEX Z;  3VTN A;  1YHQ 1;  2YU9 I;  1BDD A;  1LP1 B;  2UWJ E;  3MZK B;  3CCR Z;  4NBC A;  3CCL 1;  3VMI A;  3EED A;  3CMA Z;  3OW2 Y;  1QVF Z;  3CPW Z;  2B87 A;  2E2I I;  5IP7 I;  2P28 A;  4NFR A;  3HOV I;  2KS1 B;  3CME 1;  1Q86 1;  1OVR A;  2RIQ A;  2I3C A;  4MD9 A;  1QYP A;  5D1O A;  1VQO Z;  1EDK A;  4K3A A;  2IZ4 A;  3HOW I;  4RVD A;  1KD1 2;  1VLA A;  3GKQ A;  5K5G B;  3GTM S;  3IFU A;  3LUS A;  3CMA 1;  1EDJ A;  2RKL A;  1TWA I;  4RVG A;  4A3M I;  1H0T B;  2JNY A;  2Y0S A;  3BG0 B;  4NPD A;  5FLM I;  4DK1 A;  4HH4 A;  4A3D I;  3M4O I;  2HU9 A;  1YJW Z;  5IP9 I;  3S16 I;  4GOE A;  2OTL Z;  3CC2 Z;  2LFU A;  2DE7 A;  1YI2 1;  2P58 A;  1L1O C;  1Q81 1;  3T4N B;  3S14 I;  3NH4 A;  3HOY I;  1TWG I;  3D6W A;  1Y1V I;  3CCJ Z;  3CCS Z;  3CME Z;  3FQM A;  1K73 1;  2DE6 A;  3S1Q I;  5D1O B;  3S2H I;  4NB8 A;  1N8R 1;  1VQ4 Z;  2M5A A;  5C4J I;  2QRC B;  1Y47 A;  2F4M A;  5A2Q b;  3GTJ I;  3S1K A;  1VQN Z;  3CPW Y;  3CCU 1;  2R6M A;  3G4S Z;  3I55 Z;  3OW2 Z;  1M90 2;  1QVF Y;  1VQ6 1;  3MON A;  3IF8 A;  1VQ8 Z;  1LT1 A;  4HGY A;  4EYY Q;  1JM0 A;  1Q82 1;  2RPR A;  1RQF A;  4RVH A;  2JA6 I;  3ZDM A;  4RVF A;  1VQP Z;  3GTO I;  2B87 B;  3Q87 A;  4CPG A;  2PK7 A;  1QF8 A;  5C4X I;  3S1N I;  4GOD A;  3CCM 1;  4ASW A;  3F3F C;  4A3B I;  2NVY I;  1P9N A;  2O53 A;  3FQQ A;  4NBB A;  3I56 1;  3GTG I;  2JA5 I;  1WII A;  2E9H A;  4DGL A;  1K83 I;  1H0T A;  4NBA A;  2K5R A;  2WB1 A;  1VQ9 Z;  3HKZ A;  4WWI A;  2RT9 A;  4A3L I;  4AYB A;  5C44 I;  1VQ8 1;  1ZB8 A;  4A93 I;  1YUA A;  3QWU A;  2PM9 A;  3K7A I;  4E2W A;  3MZW B;  1VQ9 1;  3CCS 1;  1VQL 1;  1TWH I;  4NPE A;  4KJM A;  3CCE 1;  1W2B Z;  1WCM I;  1Z03 A;  3CC7 1;  3PO2 I;  3NFZ A;  1TFI A;  4RS4 A;  5T6B A;  5DJU B;  4RV9 A;  3CCQ Z;  1VQ7 1;  3U50 C;  4X6A I;  1RO2 A;  1LQL A;  2IZ3 A;  5FLX b;  1YJW 1;  3PO3 I;  2LIY A;  2QA4 1;  3TDH B;  3H0G I;  4A3I I;  1SFO I;  3FXE A;  2OTJ 1;  4BBR I;  3CC2 1;  3H3V J;  2I8D A;  3CD6 1;  2V8J A;  4ASV A;  4BXX I;  2M5A B;  2KUB A;  3VMG A;  3S2D I;  4ZMD A;  3S17 I;  1QVG Y;  2ZAE B;  3J81 f;  1S72 Z;  1W2B Y;  3P5J B;  2LXB A;  3JAM b;  4E32 A;  1Z01 A;  1K8A 1;  1YIT 1;  4HB1 A;  4HJG H;  4NBE A;  3IX0 A;  2QKD A;  2QRX A;  2GTI A;  1YUK A;  1Y1W I;  3S1R I;  3HOU I;  5CBO A;  2KIK A;  1ML8 A;  3FXD A;  1KQS Y;  2H85 A;  2W04 A;  3CCJ 1;  1Q2N A;  4QTT A;  3J80 b;  1M1K 1;  2O4H A;  4NBG A;  2JUB A;  3CCV 1;  1YJ9 1;  4MD7 A;  5FLX f;  3G6E Z;  2QA4 Z;  4TNU A;  3CCV Z;  1M90 1;  2QLV B;  2KPI A;  3RZO I;  2JR6 A;  1RO4 A;  2RBL A;  1Q81 2;  3CCM Z;  1I3Q I;  2M48 A;  3GTQ I;  3GCF A;  2E2H I;  1Z02 A;  3I4N I;  3I55 1;  3JAM f;  4BBS I;  1FC2 C;  3CC4 Z;  3CQZ I;  1ZB9 A;  3GTP I;  2OOX B;  2LXC B;  3GTK I;  1N8R 2;  2JS4 A;  2JA7 I;  3CC7 Z;  3S15 I;  2NVX I;  3RGU A;  2R44 A;  1TWF I;  4A3K I;  4BXL A;  1JWH C;  2K3R A;  1USP B;  1KC8 1;  3I07 A;  3KIH A;  3MHV A;  1I50 I;  1VQ5 1;  4E2Z A;  1WW9 A;  3TE5 B;  4QTU A;  3CD6 Z;  1U7J A;  1OVU A;  3NH5 A;  3G71 Z;  2Q1K A;  1NVO A;  1KD1 1;  3F3P C;  1YIJ 1;  2AKL A;  4NH1 C;  2OTK E;  5IT9 b;  2KI7 B;  2GU2 A;  3HOX I;  1YHQ Z;  2VF1 A;  2YAD A;  2Q51 A;  4A3G I;  1VQP 1;  2WMM A;  2LR2 A;  1VQ5 Z;  3M3Y I;  1NJI 2;  3G6E 1;  2E2J I;  4MN4 C;  5CBN A;  3G71 1;  3CCE Z;  1LP1 A;  5A2Q f;  3VMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...