2KI7B

The solution structure of rpp29-rpp21 complex from pyrococcus furiosus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
EKKRIAKERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCKKCHAFLVPGINARVRLRQKRMPHIVVKCLECGHIMRYPYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 1
publication title Solution structure of an archaeal RNase P binary protein complex: formation of the 30-kDa complex between Pyrococcus furiosus RPP21 and RPP29 is accompanied by coupled protein folding and highlights critical features for protein-protein and protein-RNA interactions.
pubmed doi rcsb
source organism Pyrococcus furiosus dsm 3638
total genus 23
structure length 97
sequence length 97
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2ki7B01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ki7B02
4KJMA 5EFWB 1EDJA 4K3AA 4HB1A 2M5AB 1H0TB 2B87B 2M0BA 1SS1A 4NPDA 2K3RA 3PH0A 1EDLA 2UWJE 3QWOC 2HR3A 4EYYQ 2B87A 1MFTA 5DJUB 1EDKA 4GOFA 2R44A 4CPGA 1OVRA 2P58A 1ZXGA 4WWIA 2Q1KA 1JMBA 1X0TA 2KIKA 1EDIA 3RGUA 4JBZA 4ASWA 2RKLA 5CBNA 5C39A 1Y47A 2QVAA 4GODA 2JWDA 3S1KA 4NPFX 1DEEG 2LXBA 3FXDA 2B89A 4HJGH 5K5GB 1LP1B 4MN4C 3MZWB 3FXEA 2QRXA 1OVVA 4NPEA 4ZMDA 4K35A 2B88A 1LP1A 2ZAEB 1OVUA 2KI7B 5CBOA 4BXLA 1LT1A 1EC5A 2I8DA 2KUBA 2KZIA 1NVOA 2OTKE 1Q2NA 1ZW0A 1BDDA 1BDCA 1FC2C 4ASVA 2KS1B 3MHVA 1U7MA 2LR2A 4HKZH 3ZDMA 1S3JA 2WMMA 1U7JA 4GOEA 2SPZA 5DJTB 1JM0A 2M5AA 4ZNCA 1H0TA 4IOIH 2KZJA 2LXCB
chains in the Genus database with same CATH superfamily
2E43A 3CXCZ 3P32A 3P8CD 2O1KA 1QLED 3M3YI 1IFIA 2JP3A 2Q5UA 3S1MI 2IFNA 2W8ZA 4W7YA 2C0XA 5AVRB 3RZDI 1M1JB 1RO0A 1XTCC 2XDJA 4DOJA 2JIMA 5CCHA 4MD8A 1JY3P 3I4MI 1S5LE 1JTHA 4TNUA 5GTIE 1NOHA 2E74C 3A2AA 2Q1KA 1DEBA 1VQ4Z 2IX7C 3S1NI 4JBZA 1LWUA 1TWAI 1EZVE 2E5TA 4BXXI 2YO3A 1LGHB 3CX5E 2JIQA 2YNYA 2A06D 5H2FE 2HFED 3CWBG 1KILC 2JWDA 1Q861 3BATA 2PAJA 2V7QH 3FXDA 3IFMA 4HJGH 5TISH 4EWCA 2OYOA 3L72D 1MZ9A 1GD2E 5CCGA 3PRJA 2JIRA 3MZWB 1GW3A 3K5BA 1OMIA 4YPCA 3D9XA 2V8KA 3A0BE 2KI7B 4TT3H 3Q5SA 2JA8I 3HUSB 4AUWA 1T3JA 2ZYGA 1VQN1 1VQ9P 2OTKE 5B5EE 2E9HA 1BSHA 3CMA1 3MHVA 2D2CD 3PLNA 1ZH1A 1VQM1 1VQ6P 1BCCJ 2BCCE 4I6MC 2YKPA 2JUBA 3CCRP 1SQPK 2JJLA 1GTWA 2N1TD 2LXCB 3W68A 3G4SP 3W67A 3G6E1 1SQBK 4O9BA 2RIQA 2RH0A 2O01H 3JCUE 3CCVZ 4Y52I 3I55Z 1MV8A 3HTKA 2B9BA 2FBWC 5KAIH 3IF8A 1PPJD 1KQSO 1IFMA 1SIWA 1ZR4A 1VQ7Z 1VF5B 1LTSC 3S2HI 4JYCA 1NWQA 4L75A 1OWAA 3CXHH 2XKMA 1FS0E 3CC2Z 1KB9I 1SQQD 2E75C 1JTHB 3H1JG 3NFZA 1Y1VI 3CCV1 1Y47A 2LXBA 3CC4P 2ZXXA 5CJ0A 4RESB 5B66E 3L75D 2AEJA 2NVTI 1LP1B 3CCQP 1RY3A 1VQ71 1NP6A 3BRTB 2JR6A 2JEEA 2WSCJ 2YIUC 4I7ZB 3B5NA 2QJPC 3H1JJ 3PTZA 2GTHA 3CXHD 3T97B 2Q9IA 2LFUA 1JB0J 1TWCI 3CC21 2IDBA 1Q7Y1 3SSUA 5CCHD 3TGUG 4YTPC 2AEFA 5AVUB 1YJ9Z 3KDPB 3AEFC 2JA5I 4PD4E 1K05A 2VPXA 3KIHA 4OGQD 1T6AA 1RE3A 1SQPD 2FYUG 5AW6B 1VQKZ 3IN6A 3TGUJ 3GTPI 3NMDA 3WUTA 1JM0A 1L0NG 4BWNA 4U3FD 3I4NI 4C46A 2RMZA 2FYUJ 2Y0EA 3S4RA 3CCR1 1LTBC 2QSIA 3CPWY 3AE3C 5T6BA 1YJ91 1PIXA 3JAMb 4X6AI 3M4OI 2WB1A 1OXZA 2IBZD 2J58A 2K3RA 3M91A 4RVFA 1H88A 1NTKE 3RK3D 3WU2E 1WJ2A 1VQ81 3HOXI 2ZT9D 3QWOC 2B87A 2JNYA 1MFTA 2WITA 2PFXA 3CD6Z 4PJ0H 3NDIA 3IFUA 3HTKB 1KQSZ 1NTMJ 4XX2A 1RF0C 5AW7B 4H13B 2RT9A 1NAFA 1WMKA 5CBNA 1K8AQ 5FLMI 3FQMA 1Y8AA 2Y0CA 4R4LA 5L8RJ 5KJ7C 2WWWA 3VP8A 1S9KD 1HTLC 2CPSA 3NFQA 3MZKB 1ZB8A 1K732 3GCFA 3CD61 5BU8B 4QTTA 2K9JA 1RO2A 5AVTB 1MKMA 2L91A 4NBDA 3BCCE 1PFTA 3H1KD 1KRLA 3NH5A 3OW2O 3J81f 4WY4A 3VMGA 1BDDA 2V8JA 3LUSA 4ZKUA 4PV1C 2GA1A 2I1JA 2KPIA 4H0LB 1IC2A 4NOZA 5E79H 1NU1D 5DJTB 5AW9B 4BBRI 1M1K2 3GKQA 1QXFA 5EFWB 4NH1C 3KXDA 3MUDC 2EGTA 2FYZA 3F3FC 2Z5IA 2JS4A 3B5ND 1Q81Q 2WSEH 5KLIB 4N78E 1USPA 3IR9A 1GDTA 3RBZA 4A3FI 3G711 1SQPE 2E5YA 4W80A 4Y99C 3I5CA 4WWIA 1QVFZ 1PFIA 4DCKA 3MGNA 1S1CX 1W2BO 2DE5A 1SQBE 1Z03A 4UB8E 2HU9A 5AVSB 2FKWB 2GUVA 3L73E 5APSA 1NJI2 1CI6A 3PHLA 3V6IA 4YXDC 4GODA 1R8EA 4C7NB 3EEDA 3USSA 3H1ID 2HG5D 3S2DI 3VOPA 3H1LJ 5KLVG 5A2Qf 3Q87A 1T8ZA 3FKII 1Y1WI 3A0HH 5AN9F 4UB6E 4RO0A 1URQD 1QF8A 3FXEA 1VQLZ 4D6TD 2KXPB 3BCCG 4N6JA 1BGYD 1ZMEC 3CCMZ 1L0LD 1NYHA 4OWFA 3WUUA 2FFDC 1LT9C 1NTZD 3L74G 4W7ZA 1JJ2Z 1HUCA 3CCJP 2E2JI 1BE3E 1Q2NA 2RHBA 3MP7B 2O01N 1G1JA 2K9YA 1SFOI 1JO5A 1S5LH 1L2PA 2O3JA 1HGVA 5GTIH 2OTLZ 4HKZH 1YIJP 1N7SD 1RF1B 2QJYB 1FZCC 1VQL1 4WY4B 1K73Q 2W6BA 1L0NK 4RVDA 4PJ0E 3CCM1 3CX5H 2W03A 3MTUE 3CLQA 2NPSB 2BASA 1RQVA 1G1IA 5KAFE 5KJ7D 1Q16A 4MRIA 4HGZA 2QJKC 1MUUA 2OYIA 2OTL1 4R4MA 1RQUA 2QRDB 3B8EB 2A45H 3A0BH 3E7KA 1EZVD 1YJN1 3G9RA 3HOUI 2K88A 2P58A 1X9VA 3L75J 1ML8A 3CX5D 1USPB 5IP7I 3S9OA 2E2HI 1KQGB 5B5EH 4QTUA 1HH0A 1MFZA 1W2BZ 3Q3DA 1WRGA 4DT0A 3GF3A 3L70G 1BSNA 3BG0B 3BASA 4IL6E 1Y8CA 2D2CC 1NAYA 3PO3I 4E2YA 1SFCD 2POHA 2JA6I 4OVNF 4TLFA 1P84I 4GDOA 3RK2D 2N1TC 3L70J 1J1DB 4I1LA 1VQ5Z 2AKLA 2LEXA 3JCUH 3F3PC 4BRYA 1LT1A 1K731 1T2KD 1NUIA 1FDIA 3CWBE 1NVOA 2QM8A 1J1EB 2Y9ZA 3H32B 2BCCD 4KT0J 5D1PA 1USDA 1X8YA 3GTKI 1S721 3VB9A 3OW2Y 5IT9f 3V4QA 1VPCA 1VQNP 4GOEA 1K9M2 5AVWB 1VLAA 3N4XA 2OYHB 4IOIH 1BCCE 1KZUB 1RE4C 1GL2D 3CMAP 3KHUA 3VMZA 1VQMP 1PP9G 2IFMA 3L4FA 1JCDA 4GIFA 3Q5RA 5APTA 5B66H 1W5CE 1KB9E 1M1K1 1SQXG 5APUA 5CHXA 2VUMI 2UWJE 4H44D 3G6EP 1GMJA 2PGDA 3CC7Z 2O53A 4EYYQ 4EIJA 1JCCA 1PP9J 1VQOZ 3HD7D 3NTNA 1AA6A 4A3CI 2ZYAA 3MONA 4A3MI 2R7ZI 2K5RA 4AYCA 1SQXJ 5CCHC 4PD4H 1L4AB 4WVZA 2KNCA 3CL3D 2VRSA 3GF7A 5M1BA 1Z56A 4KHXA 1DX7A 1N73B 3M9HA 3QH9A 2ZVOB 1CW5A 2XNDH 1ZOYC 4OGQC 3RL0D 4XA4A 1LWUC 2HYNA 3LIDA 3RBXA 3C9IA 1YQ3C 5KLVK 2R93I 3CC71 1N2FA 1JUNA 3A5TA 1VQO1 2KLUA 1NJI1 2R6MA 3V2PA 3CCVP 3CMEZ 4ZMDA 5KKZC 2K37A 2AYDA 5TJHA 2E76B 5AW8B 1IZNB 1LP1A 1NU1J 4PD4D 3U50C 3H1JE 1LTGC 1VQ7P 3S15I 1YI2Z 1KTMA 2H88C 3T97A 3WU2H 4A3JI 1KFNA 1WIIA 3CC2P 4BRYB 3RK3C 1AJYA 2ZT9C 2PP6A 2WSFJ 2FXMA 1YYCA 1S3JA 1VQ41 4E2XA 3HRNA 1M901 5APWA 1IFDA 1H89A 1BCCG 1P9NA 2P3YA 2BJOA 3TGUE 3AE1C 2P67A 2Q3IA 3PP5A 3HOVI 2JIPA 1YI21 1FAVA 1R5SA 3Q5PA 1NTKD 3FGAD 2ZVNB 1SS1A 2FYUE 4B86A 2JIOA 2NZ2A 5AW4B 2W04A 1Q7YQ 3Q2YA 3L36A 1L0NE 2NVQI 2HR3A 4RVHA 1QGKB 3PO3S 1YJ9P 1S7MA 4EDFA 1TU3F 1OVRA 2FYNB 3LW5J 2AXTE 5T67A 2V3VA 3SFEC 5C4JI 2M6NA 1LQLA 3II6A 1SP4A 1VQ8P 3CXCY 3FX0A 1KMIZ 1LTJB 3CCSZ 3S16I 2IZ4A 1W2EA 1YBKA 1ZB9A 1R9TI 1TWHI 3EQ2A 1QYPA 2KNCB 4E30A 2QG4A 3BCCD 3IF4A 2G2KA 3I07A 4NBFA 3E1IA 5AW3B 3K7AI 1X79B 4L73A 2M3EA 3NDJA 2KYVA 1EC5A 3I551 3CD6P 3HE4B 3BRVB 1XTGB 3CCS1 4DQYB 3S17I 3B5NC 1FDOA 4L76A 1HJ0A 1HJBA 2Q6QA 1NO4A 1VF5D 2SPZA 4UB8H 3TK1A 5GTHE 4AQRD 2XNXA 1VQ9Z 2E74B 4NBAA 3L37A 4N78D 2Q3EA 1K9M1 1K83I 1EDJA 3V2NA 2W6JH 3S1QI 3H3VJ 1ZR2A 2M0BA 3CQZI 4UB6H 1VQ6Z 3LIEA 1RH5B 1SQXK 1KILB 3PH0A 2QEXZ 4BY7I 3MIWA 1SQVG 1URQC 2IV2X 1SQBD 5AVXB 2VUGA 3VN0A 4Z1MH 4EI2A 1IO4A 3SFDC 3G4SZ 3L73D 1DIPA 5CCGD 2JA7I 2Q51A 2KSEA 1LJ2A 1HBWA 3G71P 3D6ZA 1NTMG 2IZ0A 4RS4A 3GHGC 1SQVJ 3I56Z 1VQK1 3V2QA 2K1AA 4A3EI 3H1HG 1AQ5A 5AVYB 1G2CA 2YKQA 1QVFO 2QEX1 2IYOA 3EFFK 1N7SC 4A3II 1GW4A 4C7NA 3GTQI 1OW7A 3SWYA 1K04A 2E2II 2ZXEB 1N8R2 3U1CA 2OOXB 5KAFH 2B88A 1BE3D 3H1HJ 4IFDK 1NH4A 1KN7A 3KIFA 1FZFA 4RV9A 1QVGO 1FZBA 3I561 3CC4Z 1NHLA 5CM2M 2YADA 3EFGA 3FQQA 3L71G 5A2Qb 5KLVE 1PGOA 3AE9C 2P1JA 1PGJA 3FWLA 1EXIA 4NBGA 2J59M 1FBMA 3HE5B 3VMAA 1RF0A 2Q4ZA 4CL1A 1YHQZ 1H0TA 4H13D 2PRRA 5FLXf 2IPPA 3L74E 3L71J 2H43A 4IL6H 1RF1A 3QWUA 5BU5A 1VQLP 5T64A 3C1LA 1S2EA 2WZ7A 2V8IA 2E75B 3CCMP 2NPSA 3D70A 4GKGA 5D1OB 1SFCC 4A3GI 1FE6A 5DJUB 1A02J 2A06G 3RK2C 1YHQ1 3HOWI 3ESWA 3GW6A 3CCEZ 3GLMA 1KYOI 2KIKA 5AW1B 1VQPZ 3SWKA 2LKMA 2OTLP 2YIUB 1P84E 4ASWA 2QJPB 1T2KC 4A7PA 5APXA 3U59A 1WCMI 2OTJZ 1YJNP 1Q90D 2VPWA 1AFOA 3U1AA 2WPRA 4XFJA 3IR7A 2QVAA 4H0LD 2AXCA 2JDIH 2KOGA 2B89A 3PJSK 3TDKA 2Z4EA 3L72J 3H1LG 2WTYA 3CCE1 1KQSY 1YTZI 2I1KA 3CWBD 1G2CB 1VQP1 2V4HA 1YITZ 1GL2C 2WQYC 3MUDA 3KZIH 4HH2A 1LNQA 1KB9H 2I8DA 3L70E 2OTJ1 1T3UA 5CMZA 1YJWZ 3Q1MA 2QA4Z 1QVGZ 5C4XI 3NH4A 2V7QJ 3P5JB 1NTKJ 1RNIA 2DE7A 1OZHA 4H44C 1KQFB 3B71A 3OJAB 4BY1I 1BCCD 1RLYA 2WMMA 3HD7C 3TE5B 3H32A 2O4HA 1KILE 4U7JA 1YIT1 2PM9A 1S72P 1N8RQ 3VTNA 1KB9D 1S5LX 1PL5A 2GTIA 1PPJG 1M902 2O1JA 3M0DA 3E1RA 1H0TB 2OYHA 1I50I 3RL0C 2FYUK 2VPZA 2QA41 1N7LA 5IT9b 1Y9BA 2N9YB 1CSBA 4IFFA 1EDLA 1SQQG 1KFMA 3TSIA 4DGLA 3HKZA 1SQVK 2E42A 1EDKA 2Q7CA 2FFDA 1M7LA 2WSCH 2OYIC 4NB9A 1EDIA 1PP9E 3RGUA 1JY2N 3G3ZA 3L75G 3TYYA 1NTMK 1I6HI 5LL6f 1SQQJ 3AE5C 1M1JC 2O01J 2GU2A 1EXJA 1NKZB 1SQXE 2JKVA 1DH3A 3H6PA 1L4AA 4JF7A 1N73A 4PV1B 4WY4D 3CI9A 2QRXA 3H1JD 1M1KQ 2NPSD 2ZJSE 1S4XA 1QVFY 3CC7P 2HODA 1N86A 2RN0A 1VQOP 2KZIA 2W6AA 1N8R1 4ASVA 4U3FG 5KTBA 1N2DC 1SQPJ 2AXTH 4NBEA 3KPEA 3TGUD 3J7A4 4ZNCA 2KLVA 4Y99B 2C9LY 2IBZG 3CXHI 2YO2A 2H8PD 2FYUD 3HUSC 4U3FJ 1JJ2Y 1VQ4P 1NJIQ 1KORA 3D6WA 2H89C 1JY2O 1L0ND 1OX3A 2M8RA 1FZAA 4AYBA 2YKOA 2JO1A 1HF9A 3IX0A 1YI2P 3EWKA 1CZQA 4NFRA 2AEMA 2N1TA 2YU9I 1QL2A 3VMHA 1FOSF 3WUVA 1VQ51 3FWNA 1NTMD 1ZXGA 2WAQA 3CCLZ 2KSJA 2QIWA 2G3AA 3KZIE 1M90Q 2FFDB 1LT9B 1YQ4C 2NVYI 3S1KA 2H85A 2IBZI 2Z5HA 1VF5C 1QX8A 5GTHH 1GK6A 1LTJA 1R5LA 2XU6A 1TFIA 2WVRA 3CCL1 3J80f 1FZCB 1QEXA 2ZAEB 1JY3O 1OVUA 3H1KJ 1W2BY 2BEQD 1ZRTE 1NU1G 4E33A 1IFPA 2R32A 4EOTA 2HLOA 1EQ7A 2HODB 5AVQB 2QJKB 3HE4A 3I55P 4I7ZC 3CCSP 3D71A 4Y7NI 3ABVC 2HPCA 2M5AA 5CCGC 2ZYDA 1L4AD 1WW9A 2R3CA 2RPRA 1AA0A 2YMYA 1Z01A 1GZLA 1KD11 1KV4A 4RVGA 1VQNZ 3CME1 3VMYA 1H8AA 1U57A 5AW5B 1SQQK 2F4MA 2D2CB 1USEA 3CMAZ 2E76D 1FU1A 3ITKA 3S1RI 3AE8C 1D7MA 1JNMA 1VQMZ 1JMBA 3H1IG 4DJGA 3AE2C 1KILA 2PMZA 1PZQA 2N1TB 4E31A 2OQQA 2C9NY 4Y28J 3CWBJ 2RKLA 2B63I 3CCUZ 1J2JB 4D6TG 3RL0g 1BGYG 2WSEJ 1L0LG 3G6EZ 2NRGA 2WSSH 1M8OB 3H1IJ 3H1LD 1PV3A 1SQVE 1NTZG 2E7ZA 3M06A 2NVXI 3O6QB 5K5GB 1IK7A 1JWHC 1K9MQ 2MJZA 1VQKP 2XZRA 1NKNA 4H13C 4NB8A 4D6TJ 1OW6A 2XV5A 1NTME 1BGYJ 1L0LJ 3F89A 1HGZA 2QEXP 1E79H 5KLVD 4MD7A 1NTZJ 3R2PA 3CPWZ 3CCU1 3GTMS 1Q822 1DL6A 3D2LA 1K8A2 3H1HE 4IFMA 1JMMA 1ZW0A 4GT1A 1FC2C 3M0AA 4JPZB 2OGUA 1YUKA 2R3SA 1U7MA 3L74D 3P7KA 4LGDE 1HWTC 3TDHB 3I56P 1RHZB 3KYQA 1A02F 4MD9A 1L1OC 1P84H 3KQGA 1FJPA 2KZJA 3HE5A 1GU4A 3NH8A 2P7JA 1KYOE 1AVYA 4HB1A 2M5AB 3L71E 2HPCB 1EZVG 2QKDA 2P10A 4H0LC 2CPBA 3P8CE 1Z02A 2GUSA 4DZOA 4OGQB 5C3EI 4S1TA 2P28A 4XE5B 1RE3C 1LWUB 5FLXb 3S14I 1P84D 3BVHA 4NBBA 1M57D 1TWGI 2QM7A 2Y0SA 1X0TA 5D1OA 3J81b 5KKZB 2A45G 3VYIA 2WT7A 1KC82 5KLIC 1YHQP 2YXQB 1SLQA 3TNUA 3CCRZ 3V5BA 5BVZA 1Q812 1FZEA 1AVOA 4A3BI 4BBSI 1UIXA 2A06E 3RK3B 1KQLA 3VMIA 3GTOI 2ZT9B 1EZVI 1VQ91 4NPEA 2IZ3A 2BCCG 3L70D 1VQ8Z 3CX5I 3NXSA 2E74D 2P2UA 4K35A 3L72E 4DK1A 5CBOA 2KS1A 4BXLA 1X22A 4E32A 4JYBA 1HVVA 1VQ61 3CCEP 1NU1K 4M3LA 2R92I 1VQPP 2FY8A 2BCCJ 4OH8B 2I3CA 1KILD 3HOZI 1URQA 3B4SA 1L0NJ 3H1LE 3ZDMA 2QE7H 2G8YA 2OTJP 1TWFI 3G4S1 2A45I 2C0WA 2KK7A 1E5WA 1U7JA 4C7RA 5TISE 1GU5A 3GHGA 4HYTB 3L35A 2YXRB 4WBAA 3BG1B 1ZP0C 3GTLI 3CCQZ 1OIPA 1YITP 1Q82Q 3TF5A 1M56D 2IYPA 1N7SA 3AEGC 3GTGI 1UIIA 1RF1C 2QJYC 1AQTA 4WY4C 3GTJI 1FJKA 4E2ZA 3AECC 4IL6X 3V2RA 1PP9D 2QR1B 1YJWP 3MZLB 2NPSC 2QA4P 1PGPA 1DD4A 1ZLLA 2WPSA 1PPJE 5KJ7A 1SQXD 3CC41 3MD0A 5AW2B 3CCQ1 1X3ZA 3AEAC 3V4WA 2BEZF 3OAKA 1DEEG 1L0LK 2KB7P 1SQQE 3B5NB 2J5UA 1NGMB 3A7OA 5CJ4A 1NTZK 2WT7B 2WSFH 4A3LI 3TNUB 3VMXA 5KAIE 3G71Z 2W90A 3L75E 3L72G 2FXPA 2LIYA 3N7NA 3O8ZA 4JQ0D 4WB4A 1LTTC 2E75D 3AE4C 3CXHE 1FZGA 3JSVC 1KC8Q 1SFCA 3C8VA 1WT6A 1IJDB 1OW8A 2KS1B 1I3QI 3JAMf 3IAOA 2GM4A 2LR2A 1Q821 1Y1VS 1K8A1 4A93I 1J1DC 1NTKG 1YTZT 1ZV8A 3LW5H 2VPYA 1URQB 3WMM0 5APVA 4PD4I 2OZKA 2VF1A 1J1EC 4KJMA 1IFNA 1VL2A 4K3AA 2B87B 4N3YB 4U3FE 3GHGB 4NPDA 1WZNA 1PGQA 1IK9A 4RKUJ 3M9QA 3M0DC 3AEEC 2OYHC 1GL2A 1KD12 1JOCA 2IBZE 2R5BA 4GOFA 3SWFA 4CPGA 1N7SB 2FXOA 2YMKA 2N9BA 1YUAA 3RK3E 1Q862 2V45A 4A3DI 1YJW1 3GG2A 1VQ5P 4L74A 2JR8A 5KLVJ 1GK4A 1X3WA 2K9JB 2IZ1A 1IFJA 3RZOI 3F5HA 1OFCX 3R4YA 3HD7A 2J6AA 1LT9A 1KC81 4MN4C 3BCCJ 2F4OA 3OW2Z 4I2LC 1OVVA 1S9KE 3L74J 1Q811 4NBCA 1ZRTD 1L4AC 4LC1A 5AW0B 2RBLA 3VP9A 1YJNZ 3UIAA 1N73C 5H2FH 3CCLP 1FZCA 2OARA 3H1KE 4HH4A 1BDCA 2PK7A 3T4NB 2MKVA 1FDMA 2KP8A 1SVFA 4A3KI 2L5GB 2H7HA 3J80b 1SFCB 2WPQA 1SQPG 2E76C 2W27A 3RK2B 2M3BA 1M1JA 2JMOA 1NU1E 1RQFA 1SQBG 3AE6C 2ZFCA 1AV1A 1QL1A 1JEKA 1QVGY 3L73G 5AVVB 3A3YB 4PV1D 1JY3N 4MONA 3PO2I 1SQBJ 3CCJZ 2R44A 2QLVB 1S72Z 3H0GI 2HF1A 3GTMI 1DD3A 1CI6B 2W83C 2DE6A 3L73J 3CMEP 5E79E 1GL2B 5APYA 2CK3H 3H25A 5C39A 1SQVD 1YIJZ 2Y0DA 5APQA 3JC22 2Y9YA 4NPFX 3D6YA 1BE3G 4QMAA 3AEDC 2QRCB 4ZKPA 2FYNC 5C44I 2OOYB 1Q7Y2 3GMAA 4H44B 3CCJ1 3H1IE 3HUSA 1KD1Q 1VDFA 3HD7B 2DW3A 3EERA 3M9BA 3H1HD 1KYOH 1JY2P 3OA7A 2M48A 5IP9I 3O6QA 1BE3J 4LLHA 1Q86Q 1LTJC 2KUBA 2WPVB 4D6TE 1YIJ1 1LTIC 1BGYE 4RJTA 2NAPA 1L0LE 3AE7C 3H1KG 4E2WA 2ITAA 3VTPC 3P8MC 1NTZE 1LTAC 3RL0B 3AEBC 1RE4A 5AVZB 1RO4A 4MXUA 4MH4A 3CCUP 2JWAA 4YXWH 3CPWO 1NTKK 1FOSE 2R5DA 1KYOD 3A0HE 3L71D 4HGYA 3HOYI 2QREB 1ZN5A 2OYIB 4NBHA
chains in the Genus database with same CATH topology
3NH8A 3CXCZ 3QWUA 3M3YI 4HB1A 2M5AB 4MRIA 3S1MI 2QKDA 5T64A 2V8IA 4HGZA 3RZDI 1Z02A 1RO0A 5D1OB 2OTL1 5C3EI 4S1TA 2P28A 4A3GI 4MD8A 2QRDB 5FLXb 3I4MI 3S14I 5DJUB 3HOUI 1YJN1 1YHQ1 3HOWI 4TNUA 2P58A 1ML8A 3ESWA 4NBBA 1TWGI 1USPB 5IP7I 3CCEZ 2Q1KA 2Y0SA 1X0TA 2KIKA 1VQ4Z 5D1OA 1VQPZ 3J81b 3S1NI 2E2HI 4JBZA 4ASWA 4QTUA 1TWAI 4BXXI 1W2BZ 1WCMI 1KC82 2OTJZ 3BG0B 3CCRZ 2QVAA 2JWDA 1Q861 1Q812 3FXDA 2B89A 3PO3I 4HJGH 4A3BI 4E2YA 4BBSI 4EWCA 2JA6I 3VMIA 3GTOI 3MZWB 1VQ91 4NPEA 3CCE1 2IZ3A 1KQSY 1VQ8Z 1VQP1 1YITZ 4K35A 3D9XA 4DK1A 2V8KA 1VQ5Z 2AKLA 5CBOA 2KI7B 3F3PC 4BXLA 1LT1A 1K731 1NUIA 4E32A 2I8DA 2OTJ1 2JA8I 1VQ61 1NVOA 1VQN1 2OTKE 2E9HA 2R92I 1YJWZ 2I3CA 5D1PA 2QA4Z 1QVGZ 5C4XI 3NH4A 3HOZI 3P5JB 1RNIA 3CMA1 2DE7A 3MHVA 3GTKI 1S721 3VB9A 3ZDMA 3OW2Y 1ZH1A 1TWFI 3G4S1 5IT9f 1VQM1 1RLYA 2WMMA 4BY1I 1U7JA 3TE5B 4GOEA 1K9M2 2O4HA 2JUBA 1VLAA 1YIT1 4IOIH 2LXCB 2PM9A 3VTNA 2GTIA 1M902 3G6E1 3BG1B 3GTLI 3CCQZ 1H0TB 2RIQA 1I50I 3CCVZ 2QA41 1M1K1 4Y52I 5IT9b 3I55Z 3GTGI 2VUMI 3IF8A 3GTJI 4E2ZA 1EDLA 2UWJE 3CC7Z 2O53A 4EYYQ 4DGLA 3HKZA 1VQOZ 1VQ7Z 1EDKA 2QR1B 3S2HI 3MZLB 4A3CI 3MONA 4A3MI 2R7ZI 4NB9A 1EDIA 3CC41 3RGUA 2K5RA 3CC2Z 1I6HI 5LL6f 1X3ZA 3CCQ1 2GU2A 3NFZA 1Y1VI 3CCV1 1Y47A 1DEEG 2LXBA 2R93I 3CC71 1N2FA 2NVTI 1LP1B 4A3LI 1VQO1 1VQ71 1NP6A 1NJI1 2R6MA 2JR6A 2QRXA 3CMEZ 4ZMDA 3G71Z 2GTHA 1QVFY 2LFUA 1TWCI 2LIYA 1LP1A 3CC21 3U50C 1Q7Y1 3S15I 1YI2Z 2KZIA 1YJ9Z 1N8R1 2JA5I 4A3JI 3KIHA 4ASVA 1WIIA 2KS1B 1I3QI 3JAMf 1VQKZ 2LR2A 4NBEA 1Q821 1Y1VS 1S3JA 1K8A1 1VQ41 4E2XA 4A93I 3J7A4 3GTPI 1M901 1JM0A 4ZNCA 1P9NA 2P3YA 3I4NI 2BJOA 2OZKA 2VF1A 4KJMA 1JJ2Y 3HOVI 3CCR1 3CPWY 1YI21 5T6BA 4K3AA 1YJ91 3JAMb 2B87B 3D6WA 4X6AI 1SS1A 3M4OI 2WB1A 4AYBA 4NPDA 2K3RA 4RVFA 2W04A 3IX0A 1VQ81 3HOXI 4NFRA 3QWOC 2NVQI 2HR3A 4RVHA 2B87A 2JNYA 2YU9I 3PO3S 1MFTA 1S7MA 3VMHA 1KD12 1VQ51 4GOFA 3CD6Z 4CPGA 1OVRA 3NDIA 1ZXGA 3IFUA 5T67A 1KQSZ 1YUAA 2WAQA 4XX2A 3CCLZ 5C4JI 1Q862 2M6NA 1LQLA 3CXCY 4A3DI 2RT9A 1YJW1 5CBNA 5FLMI 3FQMA 3S16I 3CCSZ 2NVYI 2IZ4A 3S1KA 2H85A 1X3WA 3RZOI 1ZB9A 1R9TI 1TWHI 2J6AA 1QYPA 4E30A 3MZKB 1ZB8A 1KC81 4MN4C 2F4OA 3OW2Z 1K732 2G2KA 1TFIA 3GCFA 3I07A 4NBFA 3CD61 4QTTA 1OVVA 3K7AI 1RO2A 3CCL1 1Q811 4NBCA 3J80f 4NBDA 2RBLA 1PFTA 2ZAEB 1YJNZ 1OVUA 3NDJA 1KRLA 1EC5A 3NH5A 1W2BY 3I551 3CCS1 4DQYB 3S17I 4E33A 3J81f 4HH4A 3VMGA 1BDDA 1BDCA 2V8JA 3LUSA 2PK7A 3T4NB 2KPIA 4NOZA 4A3KI 3J80b 4Y7NI 2SPZA 5DJTB 2M5AA 4BBRI 1M1K2 3GKQA 1WW9A 1VQ9Z 2JMOA 2RPRA 4NBAA 1RQFA 1K9M1 5EFWB 1Z01A 4NH1C 1K83I 1EDJA 3S1QI 2EGTA 3H3VJ 3F3FC 2JS4A 2M0BA 1KD11 3CQZI 1QVGY 4RVGA 1USPA 1VQ6Z 1VQNZ 3CME1 3PH0A 4A3FI 2QEXZ 4BY7I 3G711 2F4MA 4MONA 3PO2I 3CMAZ 3CCJZ 2VUGA 2R44A 2QLVB 1S72Z 3H0GI 4WWIA 2HF1A 3S1RI 3GTMI 3G4SZ 1VQMZ 1JMBA 1QVFZ 2DE6A 2JA7I 2Q51A 2DE5A 2PMZA 1Z03A 4E31A 2RKLA 2HU9A 5C39A 2B63I 4RS4A 1YIJZ 3CCUZ 3I56Z 1VQK1 1NJI2 4GODA 3EEDA 4A3EI 4NPFX 3G6EZ 3S2DI 2QRCB 2QEX1 2NVXI 5A2Qf 3Q87A 5K5GB 1JWHC 3FKII 1Y1WI 5AN9F 4A3II 5C44I 2OOYB 1Q7Y2 3CCJ1 1QF8A 3FXEA 1VQLZ 3GTQI 4NB8A 2E2II 3EERA 3CCMZ 1N8R2 2OOXB 2B88A 2M48A 5IP9I 3KIFA 4MD7A 2KUBA 1JJ2Z 1YIJ1 3CPWZ 3CCU1 3GTMS 1Q822 4RV9A 1DL6A 2E2JI 1K8A2 3I561 3CC4Z 4E2WA 1Q2NA 5CM2M 2YADA 2RHBA 1ZW0A 3FQQA 5A2Qb 1FC2C 1SFOI 1YUKA 4NBGA 1U7MA 1RO4A 2OTLZ 4HKZH 4MXUA 4MH4A 3TDHB 4MD9A 1VQL1 1L1OC 2Q4ZA 4CL1A 1YHQZ 4RVDA 1H0TA 3CCM1 4HGYA 3HOYI 5FLXf 2KZJA 2W03A 2QREB 4NBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KJM A;  5EFW B;  1EDJ A;  4K3A A;  4HB1 A;  2M5A B;  1H0T B;  2B87 B;  2M0B A;  1SS1 A;  4NPD A;  2K3R A;  3PH0 A;  1EDL A;  2UWJ E;  3QWO C;  2HR3 A;  4EYY Q;  2B87 A;  1MFT A;  5DJU B;  1EDK A;  4GOF A;  2R44 A;  4CPG A;  1OVR A;  2P58 A;  1ZXG A;  4WWI A;  2Q1K A;  1JMB A;  1X0T A;  2KIK A;  1EDI A;  3RGU A;  4JBZ A;  4ASW A;  2RKL A;  5CBN A;  5C39 A;  1Y47 A;  2QVA A;  4GOD A;  2JWD A;  3S1K A;  4NPF X;  1DEE G;  2LXB A;  3FXD A;  2B89 A;  4HJG H;  5K5G B;  1LP1 B;  4MN4 C;  3MZW B;  3FXE A;  2QRX A;  1OVV A;  4NPE A;  4ZMD A;  4K35 A;  2B88 A;  1LP1 A;  2ZAE B;  1OVU A;  2KI7 B;  5CBO A;  4BXL A;  1LT1 A;  1EC5 A;  2I8D A;  2KUB A;  2KZI A;  1NVO A;  2OTK E;  1Q2N A;  1ZW0 A;  1BDD A;  1BDC A;  1FC2 C;  4ASV A;  2KS1 B;  3MHV A;  1U7M A;  2LR2 A;  4HKZ H;  3ZDM A;  1S3J A;  2WMM A;  1U7J A;  4GOE A;  2SPZ A;  5DJT B;  1JM0 A;  2M5A A;  4ZNC A;  1H0T A;  4IOI H;  2KZJ A;  2LXC B; 
#chains in the Genus database with same CATH topology
 2E43 A;  3CXC Z;  3P32 A;  3P8C D;  2O1K A;  1QLE D;  3M3Y I;  1IFI A;  2JP3 A;  2Q5U A;  3S1M I;  2IFN A;  2W8Z A;  4W7Y A;  2C0X A;  5AVR B;  3RZD I;  1M1J B;  1RO0 A;  1XTC C;  2XDJ A;  4DOJ A;  2JIM A;  5CCH A;  4MD8 A;  1JY3 P;  3I4M I;  1S5L E;  1JTH A;  4TNU A;  5GTI E;  1NOH A;  2E74 C;  3A2A A;  2Q1K A;  1DEB A;  1VQ4 Z;  2IX7 C;  3S1N I;  4JBZ A;  1LWU A;  1TWA I;  1EZV E;  2E5T A;  4BXX I;  2YO3 A;  1LGH B;  3CX5 E;  2JIQ A;  2YNY A;  2A06 D;  5H2F E;  2HFE D;  3CWB G;  1KIL C;  2JWD A;  1Q86 1;  3BAT A;  2PAJ A;  2V7Q H;  3FXD A;  3IFM A;  4HJG H;  5TIS H;  4EWC A;  2OYO A;  3L72 D;  1MZ9 A;  1GD2 E;  5CCG A;  3PRJ A;  2JIR A;  3MZW B;  1GW3 A;  3K5B A;  1OMI A;  4YPC A;  3D9X A;  2V8K A;  3A0B E;  2KI7 B;  4TT3 H;  3Q5S A;  2JA8 I;  3HUS B;  4AUW A;  1T3J A;  2ZYG A;  1VQN 1;  1VQ9 P;  2OTK E;  5B5E E;  2E9H A;  1BSH A;  3CMA 1;  3MHV A;  2D2C D;  3PLN A;  1ZH1 A;  1VQM 1;  1VQ6 P;  1BCC J;  2BCC E;  4I6M C;  2YKP A;  2JUB A;  3CCR P;  1SQP K;  2JJL A;  1GTW A;  2N1T D;  2LXC B;  3W68 A;  3G4S P;  3W67 A;  3G6E 1;  1SQB K;  4O9B A;  2RIQ A;  2RH0 A;  2O01 H;  3JCU E;  3CCV Z;  4Y52 I;  3I55 Z;  1MV8 A;  3HTK A;  2B9B A;  2FBW C;  5KAI H;  3IF8 A;  1PPJ D;  1KQS O;  1IFM A;  1SIW A;  1ZR4 A;  1VQ7 Z;  1VF5 B;  1LTS C;  3S2H I;  4JYC A;  1NWQ A;  4L75 A;  1OWA A;  3CXH H;  2XKM A;  1FS0 E;  3CC2 Z;  1KB9 I;  1SQQ D;  2E75 C;  1JTH B;  3H1J G;  3NFZ A;  1Y1V I;  3CCV 1;  1Y47 A;  2LXB A;  3CC4 P;  2ZXX A;  5CJ0 A;  4RES B;  5B66 E;  3L75 D;  2AEJ A;  2NVT I;  1LP1 B;  3CCQ P;  1RY3 A;  1VQ7 1;  1NP6 A;  3BRT B;  2JR6 A;  2JEE A;  2WSC J;  2YIU C;  4I7Z B;  3B5N A;  2QJP C;  3H1J J;  3PTZ A;  2GTH A;  3CXH D;  3T97 B;  2Q9I A;  2LFU A;  1JB0 J;  1TWC I;  3CC2 1;  2IDB A;  1Q7Y 1;  3SSU A;  5CCH D;  3TGU G;  4YTP C;  2AEF A;  5AVU B;  1YJ9 Z;  3KDP B;  3AEF C;  2JA5 I;  4PD4 E;  1K05 A;  2VPX A;  3KIH A;  4OGQ D;  1T6A A;  1RE3 A;  1SQP D;  2FYU G;  5AW6 B;  1VQK Z;  3IN6 A;  3TGU J;  3GTP I;  3NMD A;  3WUT A;  1JM0 A;  1L0N G;  4BWN A;  4U3F D;  3I4N I;  4C46 A;  2RMZ A;  2FYU J;  2Y0E A;  3S4R A;  3CCR 1;  1LTB C;  2QSI A;  3CPW Y;  3AE3 C;  5T6B A;  1YJ9 1;  1PIX A;  3JAM b;  4X6A I;  3M4O I;  2WB1 A;  1OXZ A;  2IBZ D;  2J58 A;  2K3R A;  3M91 A;  4RVF A;  1H88 A;  1NTK E;  3RK3 D;  3WU2 E;  1WJ2 A;  1VQ8 1;  3HOX I;  2ZT9 D;  3QWO C;  2B87 A;  2JNY A;  1MFT A;  2WIT A;  2PFX A;  3CD6 Z;  4PJ0 H;  3NDI A;  3IFU A;  3HTK B;  1KQS Z;  1NTM J;  4XX2 A;  1RF0 C;  5AW7 B;  4H13 B;  2RT9 A;  1NAF A;  1WMK A;  5CBN A;  1K8A Q;  5FLM I;  3FQM A;  1Y8A A;  2Y0C A;  4R4L A;  5L8R J;  5KJ7 C;  2WWW A;  3VP8 A;  1S9K D;  1HTL C;  2CPS A;  3NFQ A;  3MZK B;  1ZB8 A;  1K73 2;  3GCF A;  3CD6 1;  5BU8 B;  4QTT A;  2K9J A;  1RO2 A;  5AVT B;  1MKM A;  2L91 A;  4NBD A;  3BCC E;  1PFT A;  3H1K D;  1KRL A;  3NH5 A;  3OW2 O;  3J81 f;  4WY4 A;  3VMG A;  1BDD A;  2V8J A;  3LUS A;  4ZKU A;  4PV1 C;  2GA1 A;  2I1J A;  2KPI A;  4H0L B;  1IC2 A;  4NOZ A;  5E79 H;  1NU1 D;  5DJT B;  5AW9 B;  4BBR I;  1M1K 2;  3GKQ A;  1QXF A;  5EFW B;  4NH1 C;  3KXD A;  3MUD C;  2EGT A;  2FYZ A;  3F3F C;  2Z5I A;  2JS4 A;  3B5N D;  1Q81 Q;  2WSE H;  5KLI B;  4N78 E;  1USP A;  3IR9 A;  1GDT A;  3RBZ A;  4A3F I;  3G71 1;  1SQP E;  2E5Y A;  4W80 A;  4Y99 C;  3I5C A;  4WWI A;  1QVF Z;  1PFI A;  4DCK A;  3MGN A;  1S1C X;  1W2B O;  2DE5 A;  1SQB E;  1Z03 A;  4UB8 E;  2HU9 A;  5AVS B;  2FKW B;  2GUV A;  3L73 E;  5APS A;  1NJI 2;  1CI6 A;  3PHL A;  3V6I A;  4YXD C;  4GOD A;  1R8E A;  4C7N B;  3EED A;  3USS A;  3H1I D;  2HG5 D;  3S2D I;  3VOP A;  3H1L J;  5KLV G;  5A2Q f;  3Q87 A;  1T8Z A;  3FKI I;  1Y1W I;  3A0H H;  5AN9 F;  4UB6 E;  4RO0 A;  1URQ D;  1QF8 A;  3FXE A;  1VQL Z;  4D6T D;  2KXP B;  3BCC G;  4N6J A;  1BGY D;  1ZME C;  3CCM Z;  1L0L D;  1NYH A;  4OWF A;  3WUU A;  2FFD C;  1LT9 C;  1NTZ D;  3L74 G;  4W7Z A;  1JJ2 Z;  1HUC A;  3CCJ P;  2E2J I;  1BE3 E;  1Q2N A;  2RHB A;  3MP7 B;  2O01 N;  1G1J A;  2K9Y A;  1SFO I;  1JO5 A;  1S5L H;  1L2P A;  2O3J A;  1HGV A;  5GTI H;  2OTL Z;  4HKZ H;  1YIJ P;  1N7S D;  1RF1 B;  2QJY B;  1FZC C;  1VQL 1;  4WY4 B;  1K73 Q;  2W6B A;  1L0N K;  4RVD A;  4PJ0 E;  3CCM 1;  3CX5 H;  2W03 A;  3MTU E;  3CLQ A;  2NPS B;  2BAS A;  1RQV A;  1G1I A;  5KAF E;  5KJ7 D;  1Q16 A;  4MRI A;  4HGZ A;  2QJK C;  1MUU A;  2OYI A;  2OTL 1;  4R4M A;  1RQU A;  2QRD B;  3B8E B;  2A45 H;  3A0B H;  3E7K A;  1EZV D;  1YJN 1;  3G9R A;  3HOU I;  2K88 A;  2P58 A;  1X9V A;  3L75 J;  1ML8 A;  3CX5 D;  1USP B;  5IP7 I;  3S9O A;  2E2H I;  1KQG B;  5B5E H;  4QTU A;  1HH0 A;  1MFZ A;  1W2B Z;  3Q3D A;  1WRG A;  4DT0 A;  3GF3 A;  3L70 G;  1BSN A;  3BG0 B;  3BAS A;  4IL6 E;  1Y8C A;  2D2C C;  1NAY A;  3PO3 I;  4E2Y A;  1SFC D;  2POH A;  2JA6 I;  4OVN F;  4TLF A;  1P84 I;  4GDO A;  3RK2 D;  2N1T C;  3L70 J;  1J1D B;  4I1L A;  1VQ5 Z;  2AKL A;  2LEX A;  3JCU H;  3F3P C;  4BRY A;  1LT1 A;  1K73 1;  1T2K D;  1NUI A;  1FDI A;  3CWB E;  1NVO A;  2QM8 A;  1J1E B;  2Y9Z A;  3H32 B;  2BCC D;  4KT0 J;  5D1P A;  1USD A;  1X8Y A;  3GTK I;  1S72 1;  3VB9 A;  3OW2 Y;  5IT9 f;  3V4Q A;  1VPC A;  1VQN P;  4GOE A;  1K9M 2;  5AVW B;  1VLA A;  3N4X A;  2OYH B;  4IOI H;  1BCC E;  1KZU B;  1RE4 C;  1GL2 D;  3CMA P;  3KHU A;  3VMZ A;  1VQM P;  1PP9 G;  2IFM A;  3L4F A;  1JCD A;  4GIF A;  3Q5R A;  5APT A;  5B66 H;  1W5C E;  1KB9 E;  1M1K 1;  1SQX G;  5APU A;  5CHX A;  2VUM I;  2UWJ E;  4H44 D;  3G6E P;  1GMJ A;  2PGD A;  3CC7 Z;  2O53 A;  4EYY Q;  4EIJ A;  1JCC A;  1PP9 J;  1VQO Z;  3HD7 D;  3NTN A;  1AA6 A;  4A3C I;  2ZYA A;  3MON A;  4A3M I;  2R7Z I;  2K5R A;  4AYC A;  1SQX J;  5CCH C;  4PD4 H;  1L4A B;  4WVZ A;  2KNC A;  3CL3 D;  2VRS A;  3GF7 A;  5M1B A;  1Z56 A;  4KHX A;  1DX7 A;  1N73 B;  3M9H A;  3QH9 A;  2ZVO B;  1CW5 A;  2XND H;  1ZOY C;  4OGQ C;  3RL0 D;  4XA4 A;  1LWU C;  2HYN A;  3LID A;  3RBX A;  3C9I A;  1YQ3 C;  5KLV K;  2R93 I;  3CC7 1;  1N2F A;  1JUN A;  3A5T A;  1VQO 1;  2KLU A;  1NJI 1;  2R6M A;  3V2P A;  3CCV P;  3CME Z;  4ZMD A;  5KKZ C;  2K37 A;  2AYD A;  5TJH A;  2E76 B;  5AW8 B;  1IZN B;  1LP1 A;  1NU1 J;  4PD4 D;  3U50 C;  3H1J E;  1LTG C;  1VQ7 P;  3S15 I;  1YI2 Z;  1KTM A;  2H88 C;  3T97 A;  3WU2 H;  4A3J I;  1KFN A;  1WII A;  3CC2 P;  4BRY B;  3RK3 C;  1AJY A;  2ZT9 C;  2PP6 A;  2WSF J;  2FXM A;  1YYC A;  1S3J A;  1VQ4 1;  4E2X A;  3HRN A;  1M90 1;  5APW A;  1IFD A;  1H89 A;  1BCC G;  1P9N A;  2P3Y A;  2BJO A;  3TGU E;  3AE1 C;  2P67 A;  2Q3I A;  3PP5 A;  3HOV I;  2JIP A;  1YI2 1;  1FAV A;  1R5S A;  3Q5P A;  1NTK D;  3FGA D;  2ZVN B;  1SS1 A;  2FYU E;  4B86 A;  2JIO A;  2NZ2 A;  5AW4 B;  2W04 A;  1Q7Y Q;  3Q2Y A;  3L36 A;  1L0N E;  2NVQ I;  2HR3 A;  4RVH A;  1QGK B;  3PO3 S;  1YJ9 P;  1S7M A;  4EDF A;  1TU3 F;  1OVR A;  2FYN B;  3LW5 J;  2AXT E;  5T67 A;  2V3V A;  3SFE C;  5C4J I;  2M6N A;  1LQL A;  3II6 A;  1SP4 A;  1VQ8 P;  3CXC Y;  3FX0 A;  1KMI Z;  1LTJ B;  3CCS Z;  3S16 I;  2IZ4 A;  1W2E A;  1YBK A;  1ZB9 A;  1R9T I;  1TWH I;  3EQ2 A;  1QYP A;  2KNC B;  4E30 A;  2QG4 A;  3BCC D;  3IF4 A;  2G2K A;  3I07 A;  4NBF A;  3E1I A;  5AW3 B;  3K7A I;  1X79 B;  4L73 A;  2M3E A;  3NDJ A;  2KYV A;  1EC5 A;  3I55 1;  3CD6 P;  3HE4 B;  3BRV B;  1XTG B;  3CCS 1;  4DQY B;  3S17 I;  3B5N C;  1FDO A;  4L76 A;  1HJ0 A;  1HJB A;  2Q6Q A;  1NO4 A;  1VF5 D;  2SPZ A;  4UB8 H;  3TK1 A;  5GTH E;  4AQR D;  2XNX A;  1VQ9 Z;  2E74 B;  4NBA A;  3L37 A;  4N78 D;  2Q3E A;  1K9M 1;  1K83 I;  1EDJ A;  3V2N A;  2W6J H;  3S1Q I;  3H3V J;  1ZR2 A;  2M0B A;  3CQZ I;  4UB6 H;  1VQ6 Z;  3LIE A;  1RH5 B;  1SQX K;  1KIL B;  3PH0 A;  2QEX Z;  4BY7 I;  3MIW A;  1SQV G;  1URQ C;  2IV2 X;  1SQB D;  5AVX B;  2VUG A;  3VN0 A;  4Z1M H;  4EI2 A;  1IO4 A;  3SFD C;  3G4S Z;  3L73 D;  1DIP A;  5CCG D;  2JA7 I;  2Q51 A;  2KSE A;  1LJ2 A;  1HBW A;  3G71 P;  3D6Z A;  1NTM G;  2IZ0 A;  4RS4 A;  3GHG C;  1SQV J;  3I56 Z;  1VQK 1;  3V2Q A;  2K1A A;  4A3E I;  3H1H G;  1AQ5 A;  5AVY B;  1G2C A;  2YKQ A;  1QVF O;  2QEX 1;  2IYO A;  3EFF K;  1N7S C;  4A3I I;  1GW4 A;  4C7N A;  3GTQ I;  1OW7 A;  3SWY A;  1K04 A;  2E2I I;  2ZXE B;  1N8R 2;  3U1C A;  2OOX B;  5KAF H;  2B88 A;  1BE3 D;  3H1H J;  4IFD K;  1NH4 A;  1KN7 A;  3KIF A;  1FZF A;  4RV9 A;  1QVG O;  1FZB A;  3I56 1;  3CC4 Z;  1NHL A;  5CM2 M;  2YAD A;  3EFG A;  3FQQ A;  3L71 G;  5A2Q b;  5KLV E;  1PGO A;  3AE9 C;  2P1J A;  1PGJ A;  3FWL A;  1EXI A;  4NBG A;  2J59 M;  1FBM A;  3HE5 B;  3VMA A;  1RF0 A;  2Q4Z A;  4CL1 A;  1YHQ Z;  1H0T A;  4H13 D;  2PRR A;  5FLX f;  2IPP A;  3L74 E;  3L71 J;  2H43 A;  4IL6 H;  1RF1 A;  3QWU A;  5BU5 A;  1VQL P;  5T64 A;  3C1L A;  1S2E A;  2WZ7 A;  2V8I A;  2E75 B;  3CCM P;  2NPS A;  3D70 A;  4GKG A;  5D1O B;  1SFC C;  4A3G I;  1FE6 A;  5DJU B;  1A02 J;  2A06 G;  3RK2 C;  1YHQ 1;  3HOW I;  3ESW A;  3GW6 A;  3CCE Z;  3GLM A;  1KYO I;  2KIK A;  5AW1 B;  1VQP Z;  3SWK A;  2LKM A;  2OTL P;  2YIU B;  1P84 E;  4ASW A;  2QJP B;  1T2K C;  4A7P A;  5APX A;  3U59 A;  1WCM I;  2OTJ Z;  1YJN P;  1Q90 D;  2VPW A;  1AFO A;  3U1A A;  2WPR A;  4XFJ A;  3IR7 A;  2QVA A;  4H0L D;  2AXC A;  2JDI H;  2KOG A;  2B89 A;  3PJS K;  3TDK A;  2Z4E A;  3L72 J;  3H1L G;  2WTY A;  3CCE 1;  1KQS Y;  1YTZ I;  2I1K A;  3CWB D;  1G2C B;  1VQP 1;  2V4H A;  1YIT Z;  1GL2 C;  2WQY C;  3MUD A;  3KZI H;  4HH2 A;  1LNQ A;  1KB9 H;  2I8D A;  3L70 E;  2OTJ 1;  1T3U A;  5CMZ A;  1YJW Z;  3Q1M A;  2QA4 Z;  1QVG Z;  5C4X I;  3NH4 A;  2V7Q J;  3P5J B;  1NTK J;  1RNI A;  2DE7 A;  1OZH A;  4H44 C;  1KQF B;  3B71 A;  3OJA B;  4BY1 I;  1BCC D;  1RLY A;  2WMM A;  3HD7 C;  3TE5 B;  3H32 A;  2O4H A;  1KIL E;  4U7J A;  1YIT 1;  2PM9 A;  1S72 P;  1N8R Q;  3VTN A;  1KB9 D;  1S5L X;  1PL5 A;  2GTI A;  1PPJ G;  1M90 2;  2O1J A;  3M0D A;  3E1R A;  1H0T B;  2OYH A;  1I50 I;  3RL0 C;  2FYU K;  2VPZ A;  2QA4 1;  1N7L A;  5IT9 b;  1Y9B A;  2N9Y B;  1CSB A;  4IFF A;  1EDL A;  1SQQ G;  1KFM A;  3TSI A;  4DGL A;  3HKZ A;  1SQV K;  2E42 A;  1EDK A;  2Q7C A;  2FFD A;  1M7L A;  2WSC H;  2OYI C;  4NB9 A;  1EDI A;  1PP9 E;  3RGU A;  1JY2 N;  3G3Z A;  3L75 G;  3TYY A;  1NTM K;  1I6H I;  5LL6 f;  1SQQ J;  3AE5 C;  1M1J C;  2O01 J;  2GU2 A;  1EXJ A;  1NKZ B;  1SQX E;  2JKV A;  1DH3 A;  3H6P A;  1L4A A;  4JF7 A;  1N73 A;  4PV1 B;  4WY4 D;  3CI9 A;  2QRX A;  3H1J D;  1M1K Q;  2NPS D;  2ZJS E;  1S4X A;  1QVF Y;  3CC7 P;  2HOD A;  1N86 A;  2RN0 A;  1VQO P;  2KZI A;  2W6A A;  1N8R 1;  4ASV A;  4U3F G;  5KTB A;  1N2D C;  1SQP J;  2AXT H;  4NBE A;  3KPE A;  3TGU D;  3J7A 4;  4ZNC A;  2KLV A;  4Y99 B;  2C9L Y;  2IBZ G;  3CXH I;  2YO2 A;  2H8P D;  2FYU D;  3HUS C;  4U3F J;  1JJ2 Y;  1VQ4 P;  1NJI Q;  1KOR A;  3D6W A;  2H89 C;  1JY2 O;  1L0N D;  1OX3 A;  2M8R A;  1FZA A;  4AYB A;  2YKO A;  2JO1 A;  1HF9 A;  3IX0 A;  1YI2 P;  3EWK A;  1CZQ A;  4NFR A;  2AEM A;  2N1T A;  2YU9 I;  1QL2 A;  3VMH A;  1FOS F;  3WUV A;  1VQ5 1;  3FWN A;  1NTM D;  1ZXG A;  2WAQ A;  3CCL Z;  2KSJ A;  2QIW A;  2G3A A;  3KZI E;  1M90 Q;  2FFD B;  1LT9 B;  1YQ4 C;  2NVY I;  3S1K A;  2H85 A;  2IBZ I;  2Z5H A;  1VF5 C;  1QX8 A;  5GTH H;  1GK6 A;  1LTJ A;  1R5L A;  2XU6 A;  1TFI A;  2WVR A;  3CCL 1;  3J80 f;  1FZC B;  1QEX A;  2ZAE B;  1JY3 O;  1OVU A;  3H1K J;  1W2B Y;  2BEQ D;  1ZRT E;  1NU1 G;  4E33 A;  1IFP A;  2R32 A;  4EOT A;  2HLO A;  1EQ7 A;  2HOD B;  5AVQ B;  2QJK B;  3HE4 A;  3I55 P;  4I7Z C;  3CCS P;  3D71 A;  4Y7N I;  3ABV C;  2HPC A;  2M5A A;  5CCG C;  2ZYD A;  1L4A D;  1WW9 A;  2R3C A;  2RPR A;  1AA0 A;  2YMY A;  1Z01 A;  1GZL A;  1KD1 1;  1KV4 A;  4RVG A;  1VQN Z;  3CME 1;  3VMY A;  1H8A A;  1U57 A;  5AW5 B;  1SQQ K;  2F4M A;  2D2C B;  1USE A;  3CMA Z;  2E76 D;  1FU1 A;  3ITK A;  3S1R I;  3AE8 C;  1D7M A;  1JNM A;  1VQM Z;  1JMB A;  3H1I G;  4DJG A;  3AE2 C;  1KIL A;  2PMZ A;  1PZQ A;  2N1T B;  4E31 A;  2OQQ A;  2C9N Y;  4Y28 J;  3CWB J;  2RKL A;  2B63 I;  3CCU Z;  1J2J B;  4D6T G;  3RL0 g;  1BGY G;  2WSE J;  1L0L G;  3G6E Z;  2NRG A;  2WSS H;  1M8O B;  3H1I J;  3H1L D;  1PV3 A;  1SQV E;  1NTZ G;  2E7Z A;  3M06 A;  2NVX I;  3O6Q B;  5K5G B;  1IK7 A;  1JWH C;  1K9M Q;  2MJZ A;  1VQK P;  2XZR A;  1NKN A;  4H13 C;  4NB8 A;  4D6T J;  1OW6 A;  2XV5 A;  1NTM E;  1BGY J;  1L0L J;  3F89 A;  1HGZ A;  2QEX P;  1E79 H;  5KLV D;  4MD7 A;  1NTZ J;  3R2P A;  3CPW Z;  3CCU 1;  3GTM S;  1Q82 2;  1DL6 A;  3D2L A;  1K8A 2;  3H1H E;  4IFM A;  1JMM A;  1ZW0 A;  4GT1 A;  1FC2 C;  3M0A A;  4JPZ B;  2OGU A;  1YUK A;  2R3S A;  1U7M A;  3L74 D;  3P7K A;  4LGD E;  1HWT C;  3TDH B;  3I56 P;  1RHZ B;  3KYQ A;  1A02 F;  4MD9 A;  1L1O C;  1P84 H;  3KQG A;  1FJP A;  2KZJ A;  3HE5 A;  1GU4 A;  3NH8 A;  2P7J A;  1KYO E;  1AVY A;  4HB1 A;  2M5A B;  3L71 E;  2HPC B;  1EZV G;  2QKD A;  2P10 A;  4H0L C;  2CPB A;  3P8C E;  1Z02 A;  2GUS A;  4DZO A;  4OGQ B;  5C3E I;  4S1T A;  2P28 A;  4XE5 B;  1RE3 C;  1LWU B;  5FLX b;  3S14 I;  1P84 D;  3BVH A;  4NBB A;  1M57 D;  1TWG I;  2QM7 A;  2Y0S A;  1X0T A;  5D1O A;  3J81 b;  5KKZ B;  2A45 G;  3VYI A;  2WT7 A;  1KC8 2;  5KLI C;  1YHQ P;  2YXQ B;  1SLQ A;  3TNU A;  3CCR Z;  3V5B A;  5BVZ A;  1Q81 2;  1FZE A;  1AVO A;  4A3B I;  4BBS I;  1UIX A;  2A06 E;  3RK3 B;  1KQL A;  3VMI A;  3GTO I;  2ZT9 B;  1EZV I;  1VQ9 1;  4NPE A;  2IZ3 A;  2BCC G;  3L70 D;  1VQ8 Z;  3CX5 I;  3NXS A;  2E74 D;  2P2U A;  4K35 A;  3L72 E;  4DK1 A;  5CBO A;  2KS1 A;  4BXL A;  1X22 A;  4E32 A;  4JYB A;  1HVV A;  1VQ6 1;  3CCE P;  1NU1 K;  4M3L A;  2R92 I;  1VQP P;  2FY8 A;  2BCC J;  4OH8 B;  2I3C A;  1KIL D;  3HOZ I;  1URQ A;  3B4S A;  1L0N J;  3H1L E;  3ZDM A;  2QE7 H;  2G8Y A;  2OTJ P;  1TWF I;  3G4S 1;  2A45 I;  2C0W A;  2KK7 A;  1E5W A;  1U7J A;  4C7R A;  5TIS E;  1GU5 A;  3GHG A;  4HYT B;  3L35 A;  2YXR B;  4WBA A;  3BG1 B;  1ZP0 C;  3GTL I;  3CCQ Z;  1OIP A;  1YIT P;  1Q82 Q;  3TF5 A;  1M56 D;  2IYP A;  1N7S A;  3AEG C;  3GTG I;  1UII A;  1RF1 C;  2QJY C;  1AQT A;  4WY4 C;  3GTJ I;  1FJK A;  4E2Z A;  3AEC C;  4IL6 X;  3V2R A;  1PP9 D;  2QR1 B;  1YJW P;  3MZL B;  2NPS C;  2QA4 P;  1PGP A;  1DD4 A;  1ZLL A;  2WPS A;  1PPJ E;  5KJ7 A;  1SQX D;  3CC4 1;  3MD0 A;  5AW2 B;  3CCQ 1;  1X3Z A;  3AEA C;  3V4W A;  2BEZ F;  3OAK A;  1DEE G;  1L0L K;  2KB7 P;  1SQQ E;  3B5N B;  2J5U A;  1NGM B;  3A7O A;  5CJ4 A;  1NTZ K;  2WT7 B;  2WSF H;  4A3L I;  3TNU B;  3VMX A;  5KAI E;  3G71 Z;  2W90 A;  3L75 E;  3L72 G;  2FXP A;  2LIY A;  3N7N A;  3O8Z A;  4JQ0 D;  4WB4 A;  1LTT C;  2E75 D;  3AE4 C;  3CXH E;  1FZG A;  3JSV C;  1KC8 Q;  1SFC A;  3C8V A;  1WT6 A;  1IJD B;  1OW8 A;  2KS1 B;  1I3Q I;  3JAM f;  3IAO A;  2GM4 A;  2LR2 A;  1Q82 1;  1Y1V S;  1K8A 1;  4A93 I;  1J1D C;  1NTK G;  1YTZ T;  1ZV8 A;  3LW5 H;  2VPY A;  1URQ B;  3WMM 0;  5APV A;  4PD4 I;  2OZK A;  2VF1 A;  1J1E C;  4KJM A;  1IFN A;  1VL2 A;  4K3A A;  2B87 B;  4N3Y B;  4U3F E;  3GHG B;  4NPD A;  1WZN A;  1PGQ A;  1IK9 A;  4RKU J;  3M9Q A;  3M0D C;  3AEE C;  2OYH C;  1GL2 A;  1KD1 2;  1JOC A;  2IBZ E;  2R5B A;  4GOF A;  3SWF A;  4CPG A;  1N7S B;  2FXO A;  2YMK A;  2N9B A;  1YUA A;  3RK3 E;  1Q86 2;  2V45 A;  4A3D I;  1YJW 1;  3GG2 A;  1VQ5 P;  4L74 A;  2JR8 A;  5KLV J;  1GK4 A;  1X3W A;  2K9J B;  2IZ1 A;  1IFJ A;  3RZO I;  3F5H A;  1OFC X;  3R4Y A;  3HD7 A;  2J6A A;  1LT9 A;  1KC8 1;  4MN4 C;  3BCC J;  2F4O A;  3OW2 Z;  4I2L C;  1OVV A;  1S9K E;  3L74 J;  1Q81 1;  4NBC A;  1ZRT D;  1L4A C;  4LC1 A;  5AW0 B;  2RBL A;  3VP9 A;  1YJN Z;  3UIA A;  1N73 C;  5H2F H;  3CCL P;  1FZC A;  2OAR A;  3H1K E;  4HH4 A;  1BDC A;  2PK7 A;  3T4N B;  2MKV A;  1FDM A;  2KP8 A;  1SVF A;  4A3K I;  2L5G B;  2H7H A;  3J80 b;  1SFC B;  2WPQ A;  1SQP G;  2E76 C;  2W27 A;  3RK2 B;  2M3B A;  1M1J A;  2JMO A;  1NU1 E;  1RQF A;  1SQB G;  3AE6 C;  2ZFC A;  1AV1 A;  1QL1 A;  1JEK A;  1QVG Y;  3L73 G;  5AVV B;  3A3Y B;  4PV1 D;  1JY3 N;  4MON A;  3PO2 I;  1SQB J;  3CCJ Z;  2R44 A;  2QLV B;  1S72 Z;  3H0G I;  2HF1 A;  3GTM I;  1DD3 A;  1CI6 B;  2W83 C;  2DE6 A;  3L73 J;  3CME P;  5E79 E;  1GL2 B;  5APY A;  2CK3 H;  3H25 A;  5C39 A;  1SQV D;  1YIJ Z;  2Y0D A;  5APQ A;  3JC2 2;  2Y9Y A;  4NPF X;  3D6Y A;  1BE3 G;  4QMA A;  3AED C;  2QRC B;  4ZKP A;  2FYN C;  5C44 I;  2OOY B;  1Q7Y 2;  3GMA A;  4H44 B;  3CCJ 1;  3H1I E;  3HUS A;  1KD1 Q;  1VDF A;  3HD7 B;  2DW3 A;  3EER A;  3M9B A;  3H1H D;  1KYO H;  1JY2 P;  3OA7 A;  2M48 A;  5IP9 I;  3O6Q A;  1BE3 J;  4LLH A;  1Q86 Q;  1LTJ C;  2KUB A;  2WPV B;  4D6T E;  1YIJ 1;  1LTI C;  1BGY E;  4RJT A;  2NAP A;  1L0L E;  3AE7 C;  3H1K G;  4E2W A;  2ITA A;  3VTP C;  3P8M C;  1NTZ E;  1LTA C;  3RL0 B;  3AEB C;  1RE4 A;  5AVZ B;  1RO4 A;  4MXU A;  4MH4 A;  3CCU P;  2JWA A;  4YXW H;  3CPW O;  1NTK K;  1FOS E;  2R5D A;  1KYO D;  3A0H E;  3L71 D;  4HGY A;  3HOY I;  2QRE B;  1ZN5 A;  2OYI B;  4NBH A; 
#chains in the Genus database with same CATH homology
 3NH8 A;  3CXC Z;  3QWU A;  3M3Y I;  4HB1 A;  2M5A B;  4MRI A;  3S1M I;  2QKD A;  5T64 A;  2V8I A;  4HGZ A;  3RZD I;  1Z02 A;  1RO0 A;  5D1O B;  2OTL 1;  5C3E I;  4S1T A;  2P28 A;  4A3G I;  4MD8 A;  2QRD B;  5FLX b;  3I4M I;  3S14 I;  5DJU B;  3HOU I;  1YJN 1;  1YHQ 1;  3HOW I;  4TNU A;  2P58 A;  1ML8 A;  3ESW A;  4NBB A;  1TWG I;  1USP B;  5IP7 I;  3CCE Z;  2Q1K A;  2Y0S A;  1X0T A;  2KIK A;  1VQ4 Z;  5D1O A;  1VQP Z;  3J81 b;  3S1N I;  2E2H I;  4JBZ A;  4ASW A;  4QTU A;  1TWA I;  4BXX I;  1W2B Z;  1WCM I;  1KC8 2;  2OTJ Z;  3BG0 B;  3CCR Z;  2QVA A;  2JWD A;  1Q86 1;  1Q81 2;  3FXD A;  2B89 A;  3PO3 I;  4HJG H;  4A3B I;  4E2Y A;  4BBS I;  4EWC A;  2JA6 I;  3VMI A;  3GTO I;  3MZW B;  1VQ9 1;  4NPE A;  3CCE 1;  2IZ3 A;  1KQS Y;  1VQ8 Z;  1VQP 1;  1YIT Z;  4K35 A;  3D9X A;  4DK1 A;  2V8K A;  1VQ5 Z;  2AKL A;  5CBO A;  2KI7 B;  3F3P C;  4BXL A;  1LT1 A;  1K73 1;  1NUI A;  4E32 A;  2I8D A;  2OTJ 1;  2JA8 I;  1VQ6 1;  1NVO A;  1VQN 1;  2OTK E;  2E9H A;  2R92 I;  1YJW Z;  2I3C A;  5D1P A;  2QA4 Z;  1QVG Z;  5C4X I;  3NH4 A;  3HOZ I;  3P5J B;  1RNI A;  3CMA 1;  2DE7 A;  3MHV A;  3GTK I;  1S72 1;  3VB9 A;  3ZDM A;  3OW2 Y;  1ZH1 A;  1TWF I;  3G4S 1;  5IT9 f;  1VQM 1;  1RLY A;  2WMM A;  4BY1 I;  1U7J A;  3TE5 B;  4GOE A;  1K9M 2;  2O4H A;  2JUB A;  1VLA A;  1YIT 1;  4IOI H;  2LXC B;  2PM9 A;  3VTN A;  2GTI A;  1M90 2;  3G6E 1;  3BG1 B;  3GTL I;  3CCQ Z;  1H0T B;  2RIQ A;  1I50 I;  3CCV Z;  2QA4 1;  1M1K 1;  4Y52 I;  5IT9 b;  3I55 Z;  3GTG I;  2VUM I;  3IF8 A;  3GTJ I;  4E2Z A;  1EDL A;  2UWJ E;  3CC7 Z;  2O53 A;  4EYY Q;  4DGL A;  3HKZ A;  1VQO Z;  1VQ7 Z;  1EDK A;  2QR1 B;  3S2H I;  3MZL B;  4A3C I;  3MON A;  4A3M I;  2R7Z I;  4NB9 A;  1EDI A;  3CC4 1;  3RGU A;  2K5R A;  3CC2 Z;  1I6H I;  5LL6 f;  1X3Z A;  3CCQ 1;  2GU2 A;  3NFZ A;  1Y1V I;  3CCV 1;  1Y47 A;  1DEE G;  2LXB A;  2R93 I;  3CC7 1;  1N2F A;  2NVT I;  1LP1 B;  4A3L I;  1VQO 1;  1VQ7 1;  1NP6 A;  1NJI 1;  2R6M A;  2JR6 A;  2QRX A;  3CME Z;  4ZMD A;  3G71 Z;  2GTH A;  1QVF Y;  2LFU A;  1TWC I;  2LIY A;  1LP1 A;  3CC2 1;  3U50 C;  1Q7Y 1;  3S15 I;  1YI2 Z;  2KZI A;  1YJ9 Z;  1N8R 1;  2JA5 I;  4A3J I;  3KIH A;  4ASV A;  1WII A;  2KS1 B;  1I3Q I;  3JAM f;  1VQK Z;  2LR2 A;  4NBE A;  1Q82 1;  1Y1V S;  1S3J A;  1K8A 1;  1VQ4 1;  4E2X A;  4A93 I;  3J7A 4;  3GTP I;  1M90 1;  1JM0 A;  4ZNC A;  1P9N A;  2P3Y A;  3I4N I;  2BJO A;  2OZK A;  2VF1 A;  4KJM A;  1JJ2 Y;  3HOV I;  3CCR 1;  3CPW Y;  1YI2 1;  5T6B A;  4K3A A;  1YJ9 1;  3JAM b;  2B87 B;  3D6W A;  4X6A I;  1SS1 A;  3M4O I;  2WB1 A;  4AYB A;  4NPD A;  2K3R A;  4RVF A;  2W04 A;  3IX0 A;  1VQ8 1;  3HOX I;  4NFR A;  3QWO C;  2NVQ I;  2HR3 A;  4RVH A;  2B87 A;  2JNY A;  2YU9 I;  3PO3 S;  1MFT A;  1S7M A;  3VMH A;  1KD1 2;  1VQ5 1;  4GOF A;  3CD6 Z;  4CPG A;  1OVR A;  3NDI A;  1ZXG A;  3IFU A;  5T67 A;  1KQS Z;  1YUA A;  2WAQ A;  4XX2 A;  3CCL Z;  5C4J I;  1Q86 2;  2M6N A;  1LQL A;  3CXC Y;  4A3D I;  2RT9 A;  1YJW 1;  5CBN A;  5FLM I;  3FQM A;  3S16 I;  3CCS Z;  2NVY I;  2IZ4 A;  3S1K A;  2H85 A;  1X3W A;  3RZO I;  1ZB9 A;  1R9T I;  1TWH I;  2J6A A;  1QYP A;  4E30 A;  3MZK B;  1ZB8 A;  1KC8 1;  4MN4 C;  2F4O A;  3OW2 Z;  1K73 2;  2G2K A;  1TFI A;  3GCF A;  3I07 A;  4NBF A;  3CD6 1;  4QTT A;  1OVV A;  3K7A I;  1RO2 A;  3CCL 1;  1Q81 1;  4NBC A;  3J80 f;  4NBD A;  2RBL A;  1PFT A;  2ZAE B;  1YJN Z;  1OVU A;  3NDJ A;  1KRL A;  1EC5 A;  3NH5 A;  1W2B Y;  3I55 1;  3CCS 1;  4DQY B;  3S17 I;  4E33 A;  3J81 f;  4HH4 A;  3VMG A;  1BDD A;  1BDC A;  2V8J A;  3LUS A;  2PK7 A;  3T4N B;  2KPI A;  4NOZ A;  4A3K I;  3J80 b;  4Y7N I;  2SPZ A;  5DJT B;  2M5A A;  4BBR I;  1M1K 2;  3GKQ A;  1WW9 A;  1VQ9 Z;  2JMO A;  2RPR A;  4NBA A;  1RQF A;  1K9M 1;  5EFW B;  1Z01 A;  4NH1 C;  1K83 I;  1EDJ A;  3S1Q I;  2EGT A;  3H3V J;  3F3F C;  2JS4 A;  2M0B A;  1KD1 1;  3CQZ I;  1QVG Y;  4RVG A;  1USP A;  1VQ6 Z;  1VQN Z;  3CME 1;  3PH0 A;  4A3F I;  2QEX Z;  4BY7 I;  3G71 1;  2F4M A;  4MON A;  3PO2 I;  3CMA Z;  3CCJ Z;  2VUG A;  2R44 A;  2QLV B;  1S72 Z;  3H0G I;  4WWI A;  2HF1 A;  3S1R I;  3GTM I;  3G4S Z;  1VQM Z;  1JMB A;  1QVF Z;  2DE6 A;  2JA7 I;  2Q51 A;  2DE5 A;  2PMZ A;  1Z03 A;  4E31 A;  2RKL A;  2HU9 A;  5C39 A;  2B63 I;  4RS4 A;  1YIJ Z;  3CCU Z;  3I56 Z;  1VQK 1;  1NJI 2;  4GOD A;  3EED A;  4A3E I;  4NPF X;  3G6E Z;  3S2D I;  2QRC B;  2QEX 1;  2NVX I;  5A2Q f;  3Q87 A;  5K5G B;  1JWH C;  3FKI I;  1Y1W I;  5AN9 F;  4A3I I;  5C44 I;  2OOY B;  1Q7Y 2;  3CCJ 1;  1QF8 A;  3FXE A;  1VQL Z;  3GTQ I;  4NB8 A;  2E2I I;  3EER A;  3CCM Z;  1N8R 2;  2OOX B;  2B88 A;  2M48 A;  5IP9 I;  3KIF A;  4MD7 A;  2KUB A;  1JJ2 Z;  1YIJ 1;  3CPW Z;  3CCU 1;  3GTM S;  1Q82 2;  4RV9 A;  1DL6 A;  2E2J I;  1K8A 2;  3I56 1;  3CC4 Z;  4E2W A;  1Q2N A;  5CM2 M;  2YAD A;  2RHB A;  1ZW0 A;  3FQQ A;  5A2Q b;  1FC2 C;  1SFO I;  1YUK A;  4NBG A;  1U7M A;  1RO4 A;  2OTL Z;  4HKZ H;  4MXU A;  4MH4 A;  3TDH B;  4MD9 A;  1VQL 1;  1L1O C;  2Q4Z A;  4CL1 A;  1YHQ Z;  4RVD A;  1H0T A;  3CCM 1;  4HGY A;  3HOY I;  5FLX f;  2KZJ A;  2W03 A;  2QRE B;  4NBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...