2KI7B

The solution structure of rpp29-rpp21 complex from pyrococcus furiosus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
EKKRIAKERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCKKCHAFLVPGINARVRLRQKRMPHIVVKCLECGHIMRYPYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 1
publication title Solution structure of an archaeal RNase P binary protein complex: formation of the 30-kDa complex between Pyrococcus furiosus RPP21 and RPP29 is accompanied by coupled protein folding and highlights critical features for protein-protein and protein-RNA interactions.
pubmed doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
total genus 23
structure length 97
sequence length 97
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2ki7B01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ki7B02
2KI7B 1S3JA 1BDCA 2RKLA 1JMBA 1U7MA 4NPEA 5C39A 1ZW0A 2HR3A 2M0BA 1H0TB 2P58A 4K35A 1U7JA 1EDJA 1JM0A 1EDLA 4IOIH 2B89A 1H0TA 3ZDMA 4NPDA 2R44A 2LR2A 2UWJE 1SS1A 2QRXA 1OVUA 2WMMA 4NPFX 4HB1A 2I8DA 3MHVA 4ZNCA 2KZJA 2QVAA 2SPZA 2ZAEB 2Q1KA 2B88A 3FXDA 3RGUA 1ZXGA 5CBNA 1OVVA 4ZMDA 5EFWB 4MN4C 2M5AB 1DEEG 1LP1B 1FC2C 2KZIA 4EYYQ 2K3RA 1OVRA 2KS1B 1X0TA 1LP1A 4GOEA 1EC5A 3FXEA 5DJTB 1NVOA 2B87B 3QWOC 4WWIA 1EDKA 1EDIA 2JWDA 4GOFA 2OTKE 2LXBA 5CBOA 2B87A 4HJGH 4BXLA 4GODA 4JBZA 4CPGA 4ASVA 4ASWA 2KUBA 1BDDA 2M5AA 4K3AA 3S1KA 2LXCB 5K5GB 2KIKA 4KJMA 4HKZH 3PH0A 5DJUB 1LT1A 1Y47A 3MZWB 1Q2NA 1MFTA
chains in the Genus database with same CATH superfamily
1VQ4Z 1QYPA 3E1IA 1K83I 5IP7I 3GTGI 4DQYB 2A06G 1Z01A 2R93I 2JJLA 4I6MC 2I1JA 5KJ7A 2K5RA 3FGAD 1NAYA 1R5LA 2BCCE 2DE7A 1RQUA 2WWWA 1H89A 5C39A 2Q5UA 4A3FI 3B5NA 2V4HA 4GIFA 2YMYA 1RE4A 4BY1I 2Q4ZA 2KK7A 2R44A 3F3FC 2O1KA 4RS4A 2Y0SA 2LKMA 1NU1J 2NPSC 1JWHC 1SQQJ 1SQBE 4NB8A 1SQBK 2N1TC 3TNUB 3BRVB 4H0LB 1M8OB 3KHUA 1AQ5A 2OOYB 2Y0DA 1AV1A 4E32A 1P84H 2ZVOB 3CMA1 1NHLA 2B63I 3CXCZ 2KZIA 1NTKJ 1RY3A 1S7MA 3TGUG 4X6AI 4MD7A 3L71G 3I56Z 3TDKA 1EC5A 1K8A2 3A0BE 4Y28J 4A3LI 3G4SP 3CCRP 3L72E 4DCKA 2E76B 1HVVA 4BXLA 5KJ7D 1KD11 1HGZA 3JSVC 2QRDB 2FFDA 3RK3C 2KUBA 1KFNA 4WB4A 3GW6A 4K3AA 4LC1A 3RZDI 4MXUA 1URQD 1M1K1 1P84E 3HE5A 1SQXJ 3O6QA 1YI2Z 1Y47A 5CCHA 1VQOP 1SQVK 3RK2D 2IZ1A 2Q3IA 2FKWB 1VQK1 1FJKA 1DIPA 1Q812 2R3CA 1RLYA 2R32A 2P67A 1AVYA 2YU9I 1AQTA 1ZW0A 1N86A 1WRGA 1GDTA 2VF1A 1YHQ1 1JNMA 1W2BO 5FLXb 3CCJZ 2JS4A 1VQM1 1EZVI 2BJOA 2QSIA 2P10A 1Y8AA 4RESB 5CCGA 2LR2A 1BGYD 1JOCA 1HTLC 4NBCA 3P8CD 3G711 2E2II 1VQ4P 3VTNA 1VQ5P 1LT9A 1VF5D 1YIJ1 1RF0C 3LIDA 3S1MI 2RHBA 3J80b 3M9BA 3H1HD 3HD7D 3VMGA 3OAKA 1HBWA 1IZNB 1YJWP 1MUUA 2AYDA 2FYUE 3P8MC 3Q2YA 3PO3I 1Y9BA 3Q5SA 3GHGA 5AW4B 2YKPA 3GG2A 1LGHB 1XTCC 2KLUA 1AJYA 2Q6QA 1L0ND 3B4SA 1R9TI 3NFQA 3CD61 3B71A 2IZ0A 3SFEC 2G8YA 1NVOA 3B5NC 2JIOA 5CCHD 5AW5B 2RIQA 1Y8CA 3GTJI 1Q7YQ 5BVZA 2F4MA 2Z4EA 2WSFH 2NZ2A 1SVFA 2JIQA 4WY4C 4S1TA 3D6ZA 2J6AA 1S72P 4OVNF 1PP9D 1VQ7Z 1LT1A 1PFTA 4BXXI 5AW3B 5CCGD 1FJPA 3L73D 1KILA 3NDJA 5AVYB 1VQL1 3E1RA 4QTUA 1OX3A 3S1QI 1RF1B 2KNCA 4HGZA 2CK3H 3KIFA 4DJGA 1VQ8Z 3H1JD 4I2LC 1SQBG 3EWKA 1LWUC 3M3YI 1IFNA 1KTMA 1YI2P 1BGYE 3T4NB 1G1IA 4W7ZA 3P8CE 3MHVA 2WPSA 1CW5A 1Q811 1NTMD 3SSUA 3CPWZ 2QA4P 1SFCC 5IT9b 4JQ0D 3V5BA 3JCUH 2MKVA 3S1RI 1GL2D 2R7ZI 3H1HE 5H2FE 1L0LD 1FDIA 3SWFA 2QJKB 1GTWA 4D6TD 2K3RA 3I4MI 4RKUJ 3L72G 1L0NE 3MTUE 1NTZE 3FWLA 1PFIA 4A3JI 2W6JH 2B87B 3EFGA 2QJYC 1L0NK 3NTNA 4A3MI 3IN6A 3RBZA 2NVQI 2JWDA 2LXBA 4AQRD 1GU5A 2WAQA 3LUSA 2YKQA 2I1KA 3CC7P 4IFMA 3H1LD 3VMHA 4JBZA 3C1LA 2MJZA 4ASVA 1SQVG 1URQB 3K7AI 1LT9C 3JCUE 5FLXf 2HLOA 4EDFA 1YITP 4KJMA 2ZYAA 3RK2B 1JUNA 1HWTC 3U59A 2O1JA 2HYNA 5AVZB 3CXHD 1YQ4C 1W5CE 4MH4A 3L73E 2ZXXA 3CC4P 3H3VJ 2Q51A 3MP7B 3V2RA 3GHGC 1PP9J 2CPBA 3MGNA 2N9YB 3J80f 1BE3D 2PM9A 3H1JE 5AVQB 4OGQC 1OVUA 1Q7Y1 4EWCA 3CCSP 2AEFA 2QEXZ 2W83C 2GM4A 2E5TA 2KZJA 1KYOI 5FLMI 2Q1KA 3H1KD 1GZLA 3HD7B 3CCMP 1KYOD 3L70J 1NUIA 1NTME 1BCCJ 3SWYA 1E5WA 3AEEC 3OW2Z 3L36A 2OTLP 1KILC 3VTPC 1H88A 1YQ3C 1WCMI 3CCQZ 1L0LE 3PP5A 1WZNA 1TWFI 2NAPA 2JUBA 1L0LK 2QJPB 3KYQA 3CXHH 1KQSZ 2RH0A 5DJTB 2ZT9D 1NH4A 1Y1WI 2O01N 1MFZA 4Y99B 4QTTA 2L91A 3F5HA 3V6IA 1GU4A 3I07A 1JJ2Y 3CCEZ 2JA5I 2IZ3A 4H13D 1OWAA 1BDDA 3H1LE 1Z56A 4AYCA 3S1KA 1CI6A 4A3CI 1K04A 3HUSA 2IX7C 4YPCA 1OXZA 3T97A 3CCL1 1FZCB 1WT6A 3EQ2A 5BU8B 3CXHE 2V7QH 3D6YA 2NPSA 1U7MA 2FXMA 1ZN5A 3EFFK 2N1TA 2JA8I 3Q1MA 1X8YA 3GTMS 5IT9f 3TGUJ 2O4HA 3L71J 3M0DC 4MRIA 3P7KA 3CCVP 1JM0A 3M91A 4IOIH 1M7LA 2AEMA 3OA7A 1BE3E 1H0TA 1VQ91 3CMEP 2OTJZ 2BCCD 5KKZC 1VQ6Z 1I50I 4C46A 4ZKPA 1JY3O 3H1HG 3NH4A 3H1KE 2JIMA 5KLVD 1GL2B 1YUKA 4ZMDA 1IO4A 2YXRB 5L8RJ 1JY3N 1KQGB 3VMIA 2LEXA 4A3EI 4NOZA 1KD1Q 1GD2E 1L0NG 4RJTA 3CWBD 1FC2C 4BY7I 2ZYDA 1K73Q 2WT7B 4GDOA 1A02F 2PMZA 2KP8A 1RH5B 4W80A 1NJIQ 2P1JA 1PPJD 1M1KQ 4GOEA 5KLIB 2RN0A 3HE4A 2K9JA 3VP9A 5CBOA 3F3PC 2NPSD 4HJGH 2V45A 2XZRA 3W68A 4H0LC 3PTZA 2N1TD 1PP9G 1PGJA 5IP9I 4A3KI 2OYHB 1ZOYC 4RO0A 3IR7A 3FX0A 2PK7A 2IBZD 3L73G 4I1LA 4E2WA 5DJUB 4AUWA 2K9YA 2QRCB 2V8JA 3D6WA 1USDA 1RO0A 2GUSA 3AE9C 3CX5H 2HG5D 4NPEA 1P84I 2KXPB 5D1OA 1PZQA 1RF0A 2C9LY 1ZB8A 3H1JG 3TDHB 1P84D 1RQVA 2F4OA 3AE5C 3G4S1 1JTHA 4R4MA 3CCR1 1J2JB 3K5BA 3AE1C 1PGOA 1LTBC 1AFOA 3TK1A 3NH5A 4E2YA 4N78D 3G3ZA 2WMMA 3LW5J 1TWGI 1NTMG 1QX8A 4NBAA 2R3SA 2I8DA 2O01J 4ZNCA 1UIXA 4JF7A 2M3EA 3RGUA 1VQO1 4RVFA 1L0LG 1RE3C 5CJ4A 1QVGO 2E2HI 3CX5E 4D6TG 5KLVE 3HUSC 5APQA 2BCCJ 5KLVK 1N7SD 3I55P 4C7NB 3CMAZ 1YJNP 3LIEA 5APVA 3M9HA 2HODB 1S1CX 4DT0A 1X3ZA 3EEDA 1VQPP 2R5BA 4WY4A 3CWBE 1T3UA 2KS1B 2OTJP 1NOHA 1VQ6P 3FXEA 1PPJE 3CCUP 3U1CA 3H1LG 1K8AQ 1WW9A 2FYUD 1VQ41 1LTAC 1SQBJ 1VQ51 1L4AB 4H13B 4IFFA 1NYHA 3GTPI 3PRJA 1QVFY 2OYIA 1G2CB 4RVDA 1HJ0A 1QXFA 2WSEH 3HTKA 3H32A 1AVOA 1PGQA 1M902 1YJW1 2IBZE 1M1JB 2V8IA 4LLHA 1N7LA 1LWUA 4PD4D 1SQPD 3GCFA 2FYNC 1VQKZ 2KB7P 3V2QA 5CJ0A 1Y1VI 2HU9A 1JMBA 5AVXB 2YADA 1SFOI 5TISH 1T6AA 3GTOI 1K731 1Q81Q 1BE3G 3B5ND 1YHQZ 3L72J 2ZVNB 1VQMZ 1NJI1 2M6NA 1SFCA 4GKGA 2KSJA 1FDMA 3G6EP 1EDJA 2LIYA 5C44I 3BASA 4N3YB 1MZ9A 3S4RA 3VMYA 1S4XA 4PJ0H 3G71Z 2WZ7A 4N78E 4I7ZB 4WY4D 3H1KG 3RK3E 1EQ7A 1S721 2QM8A 2OZKA 1YIJZ 5APWA 1X9VA 1SQVJ 3MUDC 2ZAEB 1GMJA 1ZMEC 4U3FD 3SFDC 3KPEA 3Q5PA 1VQNP 3CPWO 3U50C 2YIUB 1CZQA 2YMKA 4MN4C 5TISE 3FWNA 3A3YB 1LP1B 1LTJB 3S2DI 4XE5B 1EXJA 4RVHA 1LTTC 1S2EA 3JC22 2KYVA 3CD6Z 3T97B 4PD4H 1AA0A 2GTHA 2K1AA 2JNYA 3CI9A 3VP8A 4BBSI 1N8R2 1QVGZ 4NH1C 1YI21 2NPSB 4NBHA 1USPB 2WVRA 2WB1A 1NAFA 2N1TB 4IL6H 1EXIA 2G3AA 2W6BA 3S2HI 2C0XA 2FYUK 2QE7H 2NVYI 2QA41 1NTZD 1SFCD 2RT9A 4HKZH 1JY3P 2FYUJ 1N73A 2E7ZA 1X79B 3ABVC 1Q2NA 1QL2A 3C9IA 1S3JA 4W7YA 1YJ9Z 1VQLZ 4PD4E 4HH4A 1SQPE 2RBLA 3ESWA 1SQPK 1JB0J 1L1OC 5AW8B 1PV3A 2W8ZA 3BCCE 3N4XA 4IL6X 4IL6E 3IR9A 3CC71 3I56P 2BCCG 1M901 4BWNA 1GW4A 1D7MA 3TYYA 1K8A1 1VDFA 1SLQA 4NPFX 2FXPA 2Z5HA 1YIT1 3M0AA 5KLVG 5AVSB 2BEQD 3AEDC 1DX7A 2OYIC 2E75C 5T64A 1R8EA 1I6HI 1N7SB 4U3FE 5AW6B 3CWBG 3HOYI 3WMM0 5AW7B 2QKDA 3CC41 1NKZB 4BRYB 3VN0A 2VRSA 3OW2O 2JR8A 3RZOI 4EYYQ 3AE6C 5APTA 5LL6f 1RO2A 1N2DC 2WSFJ 3R4YA 5AVTB 2WPVB 3L74E 1M56D 3L75D 4WBAA 1KQSO 1S9KD 1Q822 1BGYJ 3RL0D 4TLFA 3HOUI 2HFED 3CCJP 3CCS1 3HD7C 1LJ2A 1RNIA 3IFMA 5E79H 4H44D 2IBZG 3CCM1 3VB9A 2JR6A 3R2PA 3GTKI 2VUMI 2K88A 3C8VA 3H1HJ 3M0DA 1TU3F 1P9NA 4XFJA 1NTZK 2QJPC 2OTL1 2Q3EA 1I3QI 1KILD 2OGUA 1Q862 2KI7B 3IX0A 1X22A 1JY2O 2WQYC 1L0NJ 3B5NB 2WSCJ 3D2LA 1RO4A 2VUGA 1K9M2 3AE7C 1ZR2A 3L35A 1JY2N 2PGDA 2ZJSE 2P58A 3S15I 3CXHI 1K05A 2IPPA 2Y9YA 2M3BA 1IFPA 4WY4B 1PL5A 2QIWA 2UWJE 4R4LA 2O53A 1HUCA 1YJ9P 3S1NI 1LNQA 1FZCC 1TWCI 1Z02A 5GTHH 2GUVA 2B88A 1N2FA 2L5GB 3MD0A 3IFUA 3L73J 2N9BA 5AW2B 5KTBA 2NVTI 5CBNA 2R5DA 3HOXI 1N73C 5CMZA 3FQQA 1VQ7P 4GT1A 3TNUA 3AEGC 2VPYA 3HTKB 1VF5B 1ZB9A 3S14I 1OMIA 3A5TA 2FYZA 3H1ID 3HOWI 4PV1C 3CCV1 3H1JJ 2H85A 2FYUG 1XTGB 3QWOC 3L75E 1YYCA 2FFDB 1S9KE 1QGKB 4GOFA 3CME1 1NTMK 3GTQI 1VQ8P 1FS0E 5GTHE 1NP6A 2B9BA 3L37A 4MD9A 3GF7A 3GMAA 1SFCB 2KPIA 4ASWA 3HE5B 1NTMJ 1IK9A 3O6QB 3SWKA 1AA6A 1IFDA 4E31A 3KZIH 3UIAA 2K37A 1SQPG 1KC82 4WVZA 3CCLZ 1L0LJ 4OH8B 2YO2A 4XA4A 1MV8A 5AVWB 4NFRA 4D6TJ 2IYOA 1FE6A 4NBGA 1KILE 2XKMA 4AYBA 5BU5A 2GA1A 2QLVB 2QJYB 1KORA 5C4XI 3II6A 3PLNA 1J1DC 2J59M 3BRTB 4NBDA 1RE3A 1VL2A 1W2BY 3CPWY 4YTPC 1LT9B 4H0LD 3H1LJ 1VQ9Z 1Q861 2FY8A 3KZIE 1OIPA 3GF3A 1HGVA 4U3FG 2J58A 1L2PA 2E74C 3J81b 1LQLA 1K9M1 5APUA 2H43A 1ZV8A 1BGYG 3TSIA 5AW1B 3GHGB 3GLMA 5APYA 2D2CC 3V2NA 2A45H 4A3II 2OQQA 4E30A 3Q3DA 3RBXA 4EI2A 1FBMA 2XV5A 5AVVB 1VPCA 1X0TA 2Z5IA 3CX5I 1KRLA 3RL0B 1BE3J 3H1IE 2YO3A 3CX5D 2IFMA 4DOJA 2AXCA 1EDIA 3E7KA 4RVGA 4A7PA 2VPXA 2OTKE 2W04A 1QVFZ 2M48A 4H44B 1FZGA 2VPZA 1LTIC 1NTZG 1T2KC 3H1KJ 5A2Qb 3J7A4 1NU1D 1GK6A 1SQQD 2QEXP 4L75A 1KILB 4TT3H 1IFMA 3I551 1GK4A 1YJN1 1WIIA 2KNCB 1VQP1 2OYOA 2OTJ1 3I4NI 4E33A 3FKII 2FBWC 1VQ61 3MUDA 2BASA 1NTKD 1L4AC 2IBZI 2JIPA 1S5LH 3CCQP 3G4SZ 1HH0A 3CC2Z 3CCU1 1IJDB 1BSHA 3CCRZ 2ZFCA 3VOPA 1CSBA 3Q5RA 3WUTA 2Y9ZA 3A7OA 4Y7NI 1A02J 4HB1A 1IFIA 3VMZA 3OW2Y 2QREB 3PHLA 2QVAA 2JIRA 2SPZA 2E76C 3CCEP 3FXDA 1VQOZ 1ZP0C 3KQGA 2H88C 3O8ZA 1SQXD 1JEKA 3HRNA 2DE6A 3AE4C 3RK3D 1S5LX 1U57A 1KB9D 1JY2P 3L75G 1OVRA 1X3WA 2Y0EA 3GTMI 3G6E1 2DW3A 2JA6I 3KIHA 1KZUB 5KKZB 1EDKA 2E2JI 1VQ5Z 2Q7CA 2B87A 1DL6A 1KV4A 3KXDA 2E43A 3PO2I 2YIUC 1ZH1A 4JPZB 3IF8A 1VQN1 5KLVJ 3USSA 3W67A 1LTJC 2ZT9B 2QM7A 1NU1E 4JYBA 1URQA 3PH0A 1YJWZ 1SQQE 1NU1K 1SQQK 1M90Q 3CWBJ 3A0BH 1TWHI 5AW9B 3AEBC 2IDBA 4A3DI 2QG4A 1IK7A 1Q90D 3HOZI 3PO3S 3J81f 1M57D 2PFXA 3NXSA 5B66H 1NTKE 5APXA 1KQFB 1NTKK 2GTIA 4PD4I 1KB9H 3VMXA 4NBFA 2JWAA 2QRXA 5T6BA 4HYTB 1FZBA 3HKZA 5D1PA 4C7RA 1S72Z 5AN9F 3BCCD 2KSEA 4Z1MH 4RV9A 1UIIA 2JP3A 3TF5A 1RHZB 3CC2P 4JYCA 1OVVA 3HD7A 1OZHA 2W90A 1SQXE 5B66E 4BBRI 5A2Qf 1Q16A 3H1IG 2YNYA 1SQXK 1NWQA 1J1EB 3B8EB 3CLQA 1KB9E 3D71A 4E2ZA 4XX2A 3I561 2P2UA 1RF1C 1SQVE 2WSEJ 5KAFH 1JCCA 2OARA 1N8RQ 5CM2M 1FAVA 3A0HH 2A45G 1CI6B 2P3YA 2XDJA 1N7SC 1PGPA 2IV2X 2QA4Z 2QR1B 2AXTH 2E75D 3MZLB 3HUSB 3L74D 1JO5A 1DD4A 3BATA 4L74A 1IC2A 2RPRA 4A93I 3MIWA 4PJ0E 1EZVD 2YKOA 1RQFA 3NFZA 4TNUA 1BDCA 3IAOA 1FZCA 1G1JA 2W03A 1SP4A 5KAFE 3CMAP 2QJKC 1H0TB 2V8KA 1JMMA 1DH3A 3AEAC 3A0HE 3NH8A 3CCJ1 4K35A 3CC7Z 1U7JA 2AXTE 1SS1A 5T67A 2HPCA 3AE2C 1YITZ 5KJ7C 1DEBA 3M4OI 2W27A 4KHXA 2P7JA 2RMZA 5AVRB 3KDPB 4YXWH 3P32A 3D70A 2FYNB 3Q87A 1URQC 1SQPJ 3M9QA 3VMAA 3VYIA 1RE4C 3RK3B 3CC4Z 3S9OA 2V3VA 1GL2A 3RK2C 4EIJA 3MONA 2JO1A 4HH2A 1KN7A 3BCCJ 1KMIZ 1VQKP 4M3LA 3HE4B 4HGYA 2K9JB 3CXCY 2WT7A 2H8PD 4WWIA 1YHQP 1Q7Y2 1H8AA 1VQMP 1R5SA 3CCSZ 1Q82Q 1YJ91 3V2PA 1DD3A 1NU1G 3S16I 1FZEA 1SQQG 3S17I 2H7HA 3CCMZ 1YBKA 1PPJG 5H2FH 2M5AA 4EOTA 3BG1B 3G71P 4U3FJ 1VF5C 1VQ71 1YIJP 2GU2A 4A3BI 1JJ2Z 2OYHA 2OTLZ 3L70D 3MZWB 2EGTA 4MD8A 1BCCD 1MFTA 4OGQD 1MKMA 3BVHA 3FQMA 2WSCH 1EZVE 5D1OB 1LTSC 1Q86Q 1NTKG 2RKLA 3L74J 1JTHB 4PV1D 2FFDC 2AEJA 2POHA 2A06D 3AE8C 1W2BZ 5B5EH 2M0BA 2PRRA 1K9MQ 1ZLLA 5C3EI 3EERA 1VQ81 3CD6P 2B89A 3N7NA 4NPDA 3ZDMA 5CCHC 1N8R1 1T8ZA 1NTZJ 1WJ2A 2WPQA 4Y99C 1TFIA 1GW3A 2P28A 4B86A 4NBBA 4UB8H 1SQXG 4QMAA 1QF8A 1KFMA 2DE5A 5AVUB 1JCDA 2IZ4A 1ZR4A 5E79E 5EFWB 3OJAB 5CCGC 1QVGY 3V4QA 5B5EE 1W2EA 2CPSA 4KT0J 3WUUA 1VQLP 2R6MA 2M8RA 3CCVZ 4C7NA 2KOGA 2HODA 3CL3D 2JMOA 2YXQB 4O9BA 3U1AA 1ZRTD 4L73A 1PP9E 4DK1A 2KS1A 3TGUD 3CMEZ 2ZXEB 3L71D 1VLAA 4YXDC 2OYIB 3IF4A 2VPWA 2E75B 4GODA 4CL1A 4UB8E 1QVFO 2Q9IA 4CPGA 2I3CA 3H32B 2PAJA 2E74D 1L4AA 3RL0g 1LWUB 2AKLA 1FZFA 2D2CD 1G2CA 1KC8Q 1PIXA 3RL0C 2JKVA 3L70E 1BCCE 1M1JA 1GL2C 2A45I 4L76A 4DGLA 3L75J 1FDOA 4H44C 1ML8A 1TWAI 2HR3A 2A06E 4E2XA 3P5JB 2C0WA 3V4WA 1T2KD 3JAMb 1Q821 5KLIC 2NVXI 4UB6H 3BCCG 1USEA 4D6TE 2QEX1 4U7JA 1OW6A 5M1BA 2G2KA 2HF1A 1QL1A 2NRGA 2JA7I 2E5YA 2PP6A 2E9HA 1ZXGA 3L4FA 2OYHC 1T3JA 1WMKA 1OW7A 1DEEG 2XNXA 3GKQA 1L4AD 3CCQ1 1FOSF 2WITA 1LP1A 1LTJA 1SIWA 3NMDA 1YTZT 4Y52I 3F89A 1YTZI 4UB6E 3M06A 1ZRTE 3AEFC 3AECC 3H0GI 3TGUE 3L71E 1NGMB 2JEEA 2C9NY 1KYOH 3L74G 2WSSH 1USPA 3CCE1 2E76D 2FXOA 5TJHA 2O3JA 3AE3C 5APSA 2OOXB 3QH9A 1FOSE 4ZKUA 4OWFA 1N73B 2E42A 2LXCB 1EZVG 2KIKA 1YUAA 4OGQB 2HPCB 3I55Z 4NB9A 1YJNZ 4LGDE 3BG0B 2LFUA 1VQPZ 1QLED 4PV1B 2XU6A 3NDIA 2XNDH 2ITAA 3H1IJ 5KAIH 2V7QJ 1E79H 3CCUZ 3H25A 5AW0B 1FZAA 2IFNA 3HOVI 1KYOE 1EDLA 3G9RA 2ZT9C 1OFCX 1HJBA 3GTLI 1KQLA 1SQBD 3WU2H 4DZOA 1OW8A 2R92I 4H13C 2JDIH 1RF1A 1IFJA 1KD12 4A3GI 4IFDK 3H6PA 3LW5H 5KAIE 1Z03A 1J1DB 3A2AA 2M5AB 1KC81 3D9XA 2J5UA 1K732 5GTIH 1QEXA 2WTYA 3TE5B 1NO4A 2O01H 3MZKB 1N7SA 5C4JI 3CCLP 1HF9A 1Y1VS 1M1JC 1NJI2 1M1K2 5CHXA 1BSNA 4BRYA 2ZYGA 3PJSK 2Y0CA 3G6EZ 4MONA 3CQZI 1LTGC 3L72D 3WU2E 4N6JA 1KQSY 3I5CA 2E74B 1KB9I 2BEZF 1S5LE 3ITKA 2W6AA 3WUVA 4NBEA 1VQ9P 3QWUA 1VQNZ 2D2CB 2KLVA 2WPRA 1FU1A 3L70G 3CC21 2IYPA 5K5GB 1NKNA 1BCCG 1SQVD 4I7ZC 5GTIE 1J1EC 3JAMf 2H89C
chains in the Genus database with same CATH topology
3CCL1 2KI7B 3NFZA 1QYPA 1RQFA 3IX0A 1VQ4Z 4TNUA 5IP7I 1K83I 3GTGI 4DQYB 1BDCA 1Z01A 2R93I 2K5RA 1U7MA 2W03A 1RO4A 2DE7A 2VUGA 1K9M2 5C39A 2JA8I 3GTMS 5IT9f 4A3FI 1H0TB 2V8KA 2P58A 2O4HA 3NH8A 4MRIA 3CCJ1 4K35A 3S15I 4BY1I 3CC7Z 1U7JA 1JM0A 2Q4ZA 4IOIH 1H0TA 2R44A 2UWJE 1SS1A 2O53A 3F3FC 5T67A 1VQ91 4RS4A 2OTJZ 2Y0SA 3S1NI 1YITZ 1JWHC 3M4OI 1VQ6Z 1TWCI 1Z02A 1I50I 4NB8A 2B88A 1N2FA 3NH4A 3Q87A 3IFUA 2NVTI 5CBNA 3HOXI 3CC4Z 1YUKA 4ZMDA 3FQQA 2OOYB 4A3EI 3VMIA 4E32A 4NOZA 3CMA1 2B63I 1ZB9A 1FC2C 3CXCZ 2KZIA 3S14I 4BY7I 3MONA 2PMZA 1S7MA 3HOWI 3CCV1 4HGYA 4X6AI 4MD7A 3I56Z 4GOEA 3CXCY 2H85A 1EC5A 1K8A2 3QWOC 4WWIA 4A3LI 1Q7Y2 4GOFA 3CME1 3CCSZ 3GTQI 5CBOA 1YJ91 3F3PC 4HJGH 4BXLA 1NP6A 1KD11 4MD9A 3S16I 2QRDB 2KPIA 3S17I 4ASWA 3CCMZ 2KUBA 5IP9I 4A3KI 2M5AA 4K3AA 3BG1B 3RZDI 4MXUA 2PK7A 4E31A 1M1K1 1VQ71 4E2WA 5DJUB 1KC82 2GU2A 4A3BI 1JJ2Z 2OTLZ 1YI2Z 2EGTA 1Y47A 3MZWB 4MD8A 1MFTA 3CCLZ 3FQMA 4NFRA 2QRCB 5D1OB 2V8JA 4NBGA 3D6WA 1VQK1 1RO0A 4AYBA 1Q812 2RKLA 2QLVB 1RLYA 4NPEA 5C4XI 5D1OA 2YU9I 1ZB8A 1ZW0A 3TDHB 1W2BZ 2VF1A 2M0BA 2F4OA 3G4S1 1YHQ1 4NBDA 3CCR1 5FLXb 1VQM1 3CCJZ 2JS4A 5C3EI 2BJOA 3EERA 1VQ81 1W2BY 2B89A 3ZDMA 4NPDA 3NH5A 4E2YA 3CPWY 2LR2A 1N8R1 1VQ9Z 2WMMA 4NBCA 1Q861 3G711 2E2II 1TWGI 3VTNA 4NBAA 2I8DA 1TFIA 4ZNCA 2P28A 1YIJ1 4NBBA 3J81b 3S1MI 1LQLA 3RGUA 2RHBA 1VQO1 1K9M1 1QF8A 2DE5A 3J80b 4RVFA 2E2HI 2IZ4A 3VMGA 5EFWB 1QVGY 4A3II 3CMAZ 4E30A 3PO3I 1X3ZA 3EEDA 2KS1B 2R6MA 3CCVZ 1X0TA 1R9TI 3CD61 2JMOA 1KRLA 3FXEA 1NVOA 4DK1A 3CMEZ 1EDIA 1VLAA 2RIQA 4RVGA 2OTKE 1WW9A 1VQ41 2W04A 1QVFZ 1VQ51 2M48A 3GTJI 2F4MA 4GODA 4CL1A 4CPGA 2I3CA 3GTPI 5A2Qb 1QVFY 3J7A4 4S1TA 4RVDA 2J6AA 2AKLA 1VQ7Z 1M902 1LT1A 1YJW1 1PFTA 4BXXI 3I551 2V8IA 1YJN1 1WIIA 3GCFA 1VQKZ 3NDJA 1VQP1 1VQL1 1Y1VI 2OTJ1 4QTUA 2HU9A 3S1QI 3I4NI 1JMBA 2YADA 4DGLA 4E33A 3FKII 4HGZA 1SFOI 1VQ61 3GTOI 1K731 3KIFA 1ML8A 1TWAI 3CCU1 2HR3A 3G4SZ 3CC2Z 1YHQZ 3CCRZ 1VQMZ 1NJI1 2M6NA 3P5JB 4E2XA 1VQ8Z 1EDJA 2LIYA 5C44I 4Y7NI 3M3YI 3JAMb 1Q821 2NVXI 3G71Z 4HB1A 3T4NB 1S721 3OW2Y 2QEX1 2OZKA 2QREB 3MHVA 1YIJZ 2QVAA 1Q811 2SPZA 2ZAEB 2G2KA 3FXDA 1VQOZ 2HF1A 3CPWZ 2JA7I 5IT9b 2E9HA 1ZXGA 3U50C 4MN4C 2DE6A 3S1RI 2R7ZI 1DEEG 1LP1B 3S2DI 3GKQA 3CCQ1 2K3RA 1OVRA 4RVHA 3I4MI 1X3WA 3GTMI 3CD6Z 1LP1A 2GTHA 3G6E1 2JNYA 4BBSI 4A3JI 1N8R2 1QVGZ 2B87B 2JA6I 4Y52I 3KIHA 4NH1C 4A3MI 1YI21 1EDKA 2NVQI 4NBHA 1USPB 2JWDA 3H0GI 2LXBA 2WB1A 2E2JI 2WAQA 3LUSA 1VQ5Z 2B87A 1DL6A 3VMHA 4JBZA 3PO2I 1USPA 3S2HI 3CCE1 4ASVA 1ZH1A 2OOXB 2NVYI 3IF8A 3K7AI 2QA41 5FLXf 1VQN1 2LXCB 2RT9A 2KIKA 4KJMA 1YUAA 4HKZH 3PH0A 1YJWZ 3I55Z 4NB9A 1YJNZ 1Q2NA 1S3JA 3BG0B 2LFUA 1YJ9Z 1VQPZ 1VQLZ 1TWHI 4MH4A 4HH4A 4A3DI 3H3VJ 3NDIA 2RBLA 3ESWA 2Q51A 3HOZI 3PO3S 3J81f 1L1OC 3CCUZ 3J80f 3HOVI 2GTIA 3CC71 1EDLA 2PM9A 1M901 4NBFA 1K8A1 2QRXA 5T6BA 1OVUA 3HKZA 3GTLI 1Q7Y1 4NPFX 5D1PA 1S72Z 4EWCA 2QEXZ 5AN9F 2R92I 1YIT1 2KZJA 5FLMI 2Q1KA 4RV9A 5T64A 1NUIA 1I6HI 1KD12 4A3GI 1OVVA 3HOYI 2QKDA 3CC41 1Z03A 3OW2Z 2M5AB 1KC81 3D9XA 1K732 3TE5B 4BBRI 5A2Qf 3MZKB 1WCMI 5C4JI 3RZOI 3CCQZ 1Y1VS 4EYYQ 1TWFI 1NJI2 1M1K2 2JUBA 5LL6f 1RO2A 3G6EZ 1KQSZ 4MONA 4E2ZA 4XX2A 3CQZI 3I561 5DJTB 1Q822 1Y1WI 1KQSY 3HOUI 4QTTA 5CM2M 3CCS1 3I07A 1JJ2Y 1RNIA 2P3YA 3CCEZ 2JA5I 2IZ3A 4NBEA 3CCM1 1BDDA 2QR1B 2QA4Z 3VB9A 3QWUA 3MZLB 3S1KA 1VQNZ 2JR6A 4A3CI 3CC21 3GTKI 5K5GB 2VUMI 1P9NA 2RPRA 4A93I 3JAMf 2OTL1 1I3QI 1Q862
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI7 B;  1S3J A;  1BDC A;  2RKL A;  1JMB A;  1U7M A;  4NPE A;  5C39 A;  1ZW0 A;  2HR3 A;  2M0B A;  1H0T B;  2P58 A;  4K35 A;  1U7J A;  1EDJ A;  1JM0 A;  1EDL A;  4IOI H;  2B89 A;  1H0T A;  3ZDM A;  4NPD A;  2R44 A;  2LR2 A;  2UWJ E;  1SS1 A;  2QRX A;  1OVU A;  2WMM A;  4NPF X;  4HB1 A;  2I8D A;  3MHV A;  4ZNC A;  2KZJ A;  2QVA A;  2SPZ A;  2ZAE B;  2Q1K A;  2B88 A;  3FXD A;  3RGU A;  1ZXG A;  5CBN A;  1OVV A;  4ZMD A;  5EFW B;  4MN4 C;  2M5A B;  1DEE G;  1LP1 B;  1FC2 C;  2KZI A;  4EYY Q;  2K3R A;  1OVR A;  2KS1 B;  1X0T A;  1LP1 A;  4GOE A;  1EC5 A;  3FXE A;  5DJT B;  1NVO A;  2B87 B;  3QWO C;  4WWI A;  1EDK A;  1EDI A;  2JWD A;  4GOF A;  2OTK E;  2LXB A;  5CBO A;  2B87 A;  4HJG H;  4BXL A;  4GOD A;  4JBZ A;  4CPG A;  4ASV A;  4ASW A;  2KUB A;  1BDD A;  2M5A A;  4K3A A;  3S1K A;  2LXC B;  5K5G B;  2KIK A;  4KJM A;  4HKZ H;  3PH0 A;  5DJU B;  1LT1 A;  1Y47 A;  3MZW B;  1Q2N A;  1MFT A; 
#chains in the Genus database with same CATH topology
 1VQ4 Z;  1QYP A;  3E1I A;  1K83 I;  5IP7 I;  3GTG I;  4DQY B;  2A06 G;  1Z01 A;  2R93 I;  2JJL A;  4I6M C;  2I1J A;  5KJ7 A;  2K5R A;  3FGA D;  1NAY A;  1R5L A;  2BCC E;  2DE7 A;  1RQU A;  2WWW A;  1H89 A;  5C39 A;  2Q5U A;  4A3F I;  3B5N A;  2V4H A;  4GIF A;  2YMY A;  1RE4 A;  4BY1 I;  2Q4Z A;  2KK7 A;  2R44 A;  3F3F C;  2O1K A;  4RS4 A;  2Y0S A;  2LKM A;  1NU1 J;  2NPS C;  1JWH C;  1SQQ J;  1SQB E;  4NB8 A;  1SQB K;  2N1T C;  3TNU B;  3BRV B;  4H0L B;  1M8O B;  3KHU A;  1AQ5 A;  2OOY B;  2Y0D A;  1AV1 A;  4E32 A;  1P84 H;  2ZVO B;  3CMA 1;  1NHL A;  2B63 I;  3CXC Z;  2KZI A;  1NTK J;  1RY3 A;  1S7M A;  3TGU G;  4X6A I;  4MD7 A;  3L71 G;  3I56 Z;  3TDK A;  1EC5 A;  1K8A 2;  3A0B E;  4Y28 J;  4A3L I;  3G4S P;  3CCR P;  3L72 E;  4DCK A;  2E76 B;  1HVV A;  4BXL A;  5KJ7 D;  1KD1 1;  1HGZ A;  3JSV C;  2QRD B;  2FFD A;  3RK3 C;  2KUB A;  1KFN A;  4WB4 A;  3GW6 A;  4K3A A;  4LC1 A;  3RZD I;  4MXU A;  1URQ D;  1M1K 1;  1P84 E;  3HE5 A;  1SQX J;  3O6Q A;  1YI2 Z;  1Y47 A;  5CCH A;  1VQO P;  1SQV K;  3RK2 D;  2IZ1 A;  2Q3I A;  2FKW B;  1VQK 1;  1FJK A;  1DIP A;  1Q81 2;  2R3C A;  1RLY A;  2R32 A;  2P67 A;  1AVY A;  2YU9 I;  1AQT A;  1ZW0 A;  1N86 A;  1WRG A;  1GDT A;  2VF1 A;  1YHQ 1;  1JNM A;  1W2B O;  5FLX b;  3CCJ Z;  2JS4 A;  1VQM 1;  1EZV I;  2BJO A;  2QSI A;  2P10 A;  1Y8A A;  4RES B;  5CCG A;  2LR2 A;  1BGY D;  1JOC A;  1HTL C;  4NBC A;  3P8C D;  3G71 1;  2E2I I;  1VQ4 P;  3VTN A;  1VQ5 P;  1LT9 A;  1VF5 D;  1YIJ 1;  1RF0 C;  3LID A;  3S1M I;  2RHB A;  3J80 b;  3M9B A;  3H1H D;  3HD7 D;  3VMG A;  3OAK A;  1HBW A;  1IZN B;  1YJW P;  1MUU A;  2AYD A;  2FYU E;  3P8M C;  3Q2Y A;  3PO3 I;  1Y9B A;  3Q5S A;  3GHG A;  5AW4 B;  2YKP A;  3GG2 A;  1LGH B;  1XTC C;  2KLU A;  1AJY A;  2Q6Q A;  1L0N D;  3B4S A;  1R9T I;  3NFQ A;  3CD6 1;  3B71 A;  2IZ0 A;  3SFE C;  2G8Y A;  1NVO A;  3B5N C;  2JIO A;  5CCH D;  5AW5 B;  2RIQ A;  1Y8C A;  3GTJ I;  1Q7Y Q;  5BVZ A;  2F4M A;  2Z4E A;  2WSF H;  2NZ2 A;  1SVF A;  2JIQ A;  4WY4 C;  4S1T A;  3D6Z A;  2J6A A;  1S72 P;  4OVN F;  1PP9 D;  1VQ7 Z;  1LT1 A;  1PFT A;  4BXX I;  5AW3 B;  5CCG D;  1FJP A;  3L73 D;  1KIL A;  3NDJ A;  5AVY B;  1VQL 1;  3E1R A;  4QTU A;  1OX3 A;  3S1Q I;  1RF1 B;  2KNC A;  4HGZ A;  2CK3 H;  3KIF A;  4DJG A;  1VQ8 Z;  3H1J D;  4I2L C;  1SQB G;  3EWK A;  1LWU C;  3M3Y I;  1IFN A;  1KTM A;  1YI2 P;  1BGY E;  3T4N B;  1G1I A;  4W7Z A;  3P8C E;  3MHV A;  2WPS A;  1CW5 A;  1Q81 1;  1NTM D;  3SSU A;  3CPW Z;  2QA4 P;  1SFC C;  5IT9 b;  4JQ0 D;  3V5B A;  3JCU H;  2MKV A;  3S1R I;  1GL2 D;  2R7Z I;  3H1H E;  5H2F E;  1L0L D;  1FDI A;  3SWF A;  2QJK B;  1GTW A;  4D6T D;  2K3R A;  3I4M I;  4RKU J;  3L72 G;  1L0N E;  3MTU E;  1NTZ E;  3FWL A;  1PFI A;  4A3J I;  2W6J H;  2B87 B;  3EFG A;  2QJY C;  1L0N K;  3NTN A;  4A3M I;  3IN6 A;  3RBZ A;  2NVQ I;  2JWD A;  2LXB A;  4AQR D;  1GU5 A;  2WAQ A;  3LUS A;  2YKQ A;  2I1K A;  3CC7 P;  4IFM A;  3H1L D;  3VMH A;  4JBZ A;  3C1L A;  2MJZ A;  4ASV A;  1SQV G;  1URQ B;  3K7A I;  1LT9 C;  3JCU E;  5FLX f;  2HLO A;  4EDF A;  1YIT P;  4KJM A;  2ZYA A;  3RK2 B;  1JUN A;  1HWT C;  3U59 A;  2O1J A;  2HYN A;  5AVZ B;  3CXH D;  1YQ4 C;  1W5C E;  4MH4 A;  3L73 E;  2ZXX A;  3CC4 P;  3H3V J;  2Q51 A;  3MP7 B;  3V2R A;  3GHG C;  1PP9 J;  2CPB A;  3MGN A;  2N9Y B;  3J80 f;  1BE3 D;  2PM9 A;  3H1J E;  5AVQ B;  4OGQ C;  1OVU A;  1Q7Y 1;  4EWC A;  3CCS P;  2AEF A;  2QEX Z;  2W83 C;  2GM4 A;  2E5T A;  2KZJ A;  1KYO I;  5FLM I;  2Q1K A;  3H1K D;  1GZL A;  3HD7 B;  3CCM P;  1KYO D;  3L70 J;  1NUI A;  1NTM E;  1BCC J;  3SWY A;  1E5W A;  3AEE C;  3OW2 Z;  3L36 A;  2OTL P;  1KIL C;  3VTP C;  1H88 A;  1YQ3 C;  1WCM I;  3CCQ Z;  1L0L E;  3PP5 A;  1WZN A;  1TWF I;  2NAP A;  2JUB A;  1L0L K;  2QJP B;  3KYQ A;  3CXH H;  1KQS Z;  2RH0 A;  5DJT B;  2ZT9 D;  1NH4 A;  1Y1W I;  2O01 N;  1MFZ A;  4Y99 B;  4QTT A;  2L91 A;  3F5H A;  3V6I A;  1GU4 A;  3I07 A;  1JJ2 Y;  3CCE Z;  2JA5 I;  2IZ3 A;  4H13 D;  1OWA A;  1BDD A;  3H1L E;  1Z56 A;  4AYC A;  3S1K A;  1CI6 A;  4A3C I;  1K04 A;  3HUS A;  2IX7 C;  4YPC A;  1OXZ A;  3T97 A;  3CCL 1;  1FZC B;  1WT6 A;  3EQ2 A;  5BU8 B;  3CXH E;  2V7Q H;  3D6Y A;  2NPS A;  1U7M A;  2FXM A;  1ZN5 A;  3EFF K;  2N1T A;  2JA8 I;  3Q1M A;  1X8Y A;  3GTM S;  5IT9 f;  3TGU J;  2O4H A;  3L71 J;  3M0D C;  4MRI A;  3P7K A;  3CCV P;  1JM0 A;  3M91 A;  4IOI H;  1M7L A;  2AEM A;  3OA7 A;  1BE3 E;  1H0T A;  1VQ9 1;  3CME P;  2OTJ Z;  2BCC D;  5KKZ C;  1VQ6 Z;  1I50 I;  4C46 A;  4ZKP A;  1JY3 O;  3H1H G;  3NH4 A;  3H1K E;  2JIM A;  5KLV D;  1GL2 B;  1YUK A;  4ZMD A;  1IO4 A;  2YXR B;  5L8R J;  1JY3 N;  1KQG B;  3VMI A;  2LEX A;  4A3E I;  4NOZ A;  1KD1 Q;  1GD2 E;  1L0N G;  4RJT A;  3CWB D;  1FC2 C;  4BY7 I;  2ZYD A;  1K73 Q;  2WT7 B;  4GDO A;  1A02 F;  2PMZ A;  2KP8 A;  1RH5 B;  4W80 A;  1NJI Q;  2P1J A;  1PPJ D;  1M1K Q;  4GOE A;  5KLI B;  2RN0 A;  3HE4 A;  2K9J A;  3VP9 A;  5CBO A;  3F3P C;  2NPS D;  4HJG H;  2V45 A;  2XZR A;  3W68 A;  4H0L C;  3PTZ A;  2N1T D;  1PP9 G;  1PGJ A;  5IP9 I;  4A3K I;  2OYH B;  1ZOY C;  4RO0 A;  3IR7 A;  3FX0 A;  2PK7 A;  2IBZ D;  3L73 G;  4I1L A;  4E2W A;  5DJU B;  4AUW A;  2K9Y A;  2QRC B;  2V8J A;  3D6W A;  1USD A;  1RO0 A;  2GUS A;  3AE9 C;  3CX5 H;  2HG5 D;  4NPE A;  1P84 I;  2KXP B;  5D1O A;  1PZQ A;  1RF0 A;  2C9L Y;  1ZB8 A;  3H1J G;  3TDH B;  1P84 D;  1RQV A;  2F4O A;  3AE5 C;  3G4S 1;  1JTH A;  4R4M A;  3CCR 1;  1J2J B;  3K5B A;  3AE1 C;  1PGO A;  1LTB C;  1AFO A;  3TK1 A;  3NH5 A;  4E2Y A;  4N78 D;  3G3Z A;  2WMM A;  3LW5 J;  1TWG I;  1NTM G;  1QX8 A;  4NBA A;  2R3S A;  2I8D A;  2O01 J;  4ZNC A;  1UIX A;  4JF7 A;  2M3E A;  3RGU A;  1VQO 1;  4RVF A;  1L0L G;  1RE3 C;  5CJ4 A;  1QVG O;  2E2H I;  3CX5 E;  4D6T G;  5KLV E;  3HUS C;  5APQ A;  2BCC J;  5KLV K;  1N7S D;  3I55 P;  4C7N B;  3CMA Z;  1YJN P;  3LIE A;  5APV A;  3M9H A;  2HOD B;  1S1C X;  4DT0 A;  1X3Z A;  3EED A;  1VQP P;  2R5B A;  4WY4 A;  3CWB E;  1T3U A;  2KS1 B;  2OTJ P;  1NOH A;  1VQ6 P;  3FXE A;  1PPJ E;  3CCU P;  3U1C A;  3H1L G;  1K8A Q;  1WW9 A;  2FYU D;  1VQ4 1;  1LTA C;  1SQB J;  1VQ5 1;  1L4A B;  4H13 B;  4IFF A;  1NYH A;  3GTP I;  3PRJ A;  1QVF Y;  2OYI A;  1G2C B;  4RVD A;  1HJ0 A;  1QXF A;  2WSE H;  3HTK A;  3H32 A;  1AVO A;  1PGQ A;  1M90 2;  1YJW 1;  2IBZ E;  1M1J B;  2V8I A;  4LLH A;  1N7L A;  1LWU A;  4PD4 D;  1SQP D;  3GCF A;  2FYN C;  1VQK Z;  2KB7 P;  3V2Q A;  5CJ0 A;  1Y1V I;  2HU9 A;  1JMB A;  5AVX B;  2YAD A;  1SFO I;  5TIS H;  1T6A A;  3GTO I;  1K73 1;  1Q81 Q;  1BE3 G;  3B5N D;  1YHQ Z;  3L72 J;  2ZVN B;  1VQM Z;  1NJI 1;  2M6N A;  1SFC A;  4GKG A;  2KSJ A;  1FDM A;  3G6E P;  1EDJ A;  2LIY A;  5C44 I;  3BAS A;  4N3Y B;  1MZ9 A;  3S4R A;  3VMY A;  1S4X A;  4PJ0 H;  3G71 Z;  2WZ7 A;  4N78 E;  4I7Z B;  4WY4 D;  3H1K G;  3RK3 E;  1EQ7 A;  1S72 1;  2QM8 A;  2OZK A;  1YIJ Z;  5APW A;  1X9V A;  1SQV J;  3MUD C;  2ZAE B;  1GMJ A;  1ZME C;  4U3F D;  3SFD C;  3KPE A;  3Q5P A;  1VQN P;  3CPW O;  3U50 C;  2YIU B;  1CZQ A;  2YMK A;  4MN4 C;  5TIS E;  3FWN A;  3A3Y B;  1LP1 B;  1LTJ B;  3S2D I;  4XE5 B;  1EXJ A;  4RVH A;  1LTT C;  1S2E A;  3JC2 2;  2KYV A;  3CD6 Z;  3T97 B;  4PD4 H;  1AA0 A;  2GTH A;  2K1A A;  2JNY A;  3CI9 A;  3VP8 A;  4BBS I;  1N8R 2;  1QVG Z;  4NH1 C;  1YI2 1;  2NPS B;  4NBH A;  1USP B;  2WVR A;  2WB1 A;  1NAF A;  2N1T B;  4IL6 H;  1EXI A;  2G3A A;  2W6B A;  3S2H I;  2C0X A;  2FYU K;  2QE7 H;  2NVY I;  2QA4 1;  1NTZ D;  1SFC D;  2RT9 A;  4HKZ H;  1JY3 P;  2FYU J;  1N73 A;  2E7Z A;  1X79 B;  3ABV C;  1Q2N A;  1QL2 A;  3C9I A;  1S3J A;  4W7Y A;  1YJ9 Z;  1VQL Z;  4PD4 E;  4HH4 A;  1SQP E;  2RBL A;  3ESW A;  1SQP K;  1JB0 J;  1L1O C;  5AW8 B;  1PV3 A;  2W8Z A;  3BCC E;  3N4X A;  4IL6 X;  4IL6 E;  3IR9 A;  3CC7 1;  3I56 P;  2BCC G;  1M90 1;  4BWN A;  1GW4 A;  1D7M A;  3TYY A;  1K8A 1;  1VDF A;  1SLQ A;  4NPF X;  2FXP A;  2Z5H A;  1YIT 1;  3M0A A;  5KLV G;  5AVS B;  2BEQ D;  3AED C;  1DX7 A;  2OYI C;  2E75 C;  5T64 A;  1R8E A;  1I6H I;  1N7S B;  4U3F E;  5AW6 B;  3CWB G;  3HOY I;  3WMM 0;  5AW7 B;  2QKD A;  3CC4 1;  1NKZ B;  4BRY B;  3VN0 A;  2VRS A;  3OW2 O;  2JR8 A;  3RZO I;  4EYY Q;  3AE6 C;  5APT A;  5LL6 f;  1RO2 A;  1N2D C;  2WSF J;  3R4Y A;  5AVT B;  2WPV B;  3L74 E;  1M56 D;  3L75 D;  4WBA A;  1KQS O;  1S9K D;  1Q82 2;  1BGY J;  3RL0 D;  4TLF A;  3HOU I;  2HFE D;  3CCJ P;  3CCS 1;  3HD7 C;  1LJ2 A;  1RNI A;  3IFM A;  5E79 H;  4H44 D;  2IBZ G;  3CCM 1;  3VB9 A;  2JR6 A;  3R2P A;  3GTK I;  2VUM I;  2K88 A;  3C8V A;  3H1H J;  3M0D A;  1TU3 F;  1P9N A;  4XFJ A;  1NTZ K;  2QJP C;  2OTL 1;  2Q3E A;  1I3Q I;  1KIL D;  2OGU A;  1Q86 2;  2KI7 B;  3IX0 A;  1X22 A;  1JY2 O;  2WQY C;  1L0N J;  3B5N B;  2WSC J;  3D2L A;  1RO4 A;  2VUG A;  1K9M 2;  3AE7 C;  1ZR2 A;  3L35 A;  1JY2 N;  2PGD A;  2ZJS E;  2P58 A;  3S15 I;  3CXH I;  1K05 A;  2IPP A;  2Y9Y A;  2M3B A;  1IFP A;  4WY4 B;  1PL5 A;  2QIW A;  2UWJ E;  4R4L A;  2O53 A;  1HUC A;  1YJ9 P;  3S1N I;  1LNQ A;  1FZC C;  1TWC I;  1Z02 A;  5GTH H;  2GUV A;  2B88 A;  1N2F A;  2L5G B;  3MD0 A;  3IFU A;  3L73 J;  2N9B A;  5AW2 B;  5KTB A;  2NVT I;  5CBN A;  2R5D A;  3HOX I;  1N73 C;  5CMZ A;  3FQQ A;  1VQ7 P;  4GT1 A;  3TNU A;  3AEG C;  2VPY A;  3HTK B;  1VF5 B;  1ZB9 A;  3S14 I;  1OMI A;  3A5T A;  2FYZ A;  3H1I D;  3HOW I;  4PV1 C;  3CCV 1;  3H1J J;  2H85 A;  2FYU G;  1XTG B;  3QWO C;  3L75 E;  1YYC A;  2FFD B;  1S9K E;  1QGK B;  4GOF A;  3CME 1;  1NTM K;  3GTQ I;  1VQ8 P;  1FS0 E;  5GTH E;  1NP6 A;  2B9B A;  3L37 A;  4MD9 A;  3GF7 A;  3GMA A;  1SFC B;  2KPI A;  4ASW A;  3HE5 B;  1NTM J;  1IK9 A;  3O6Q B;  3SWK A;  1AA6 A;  1IFD A;  4E31 A;  3KZI H;  3UIA A;  2K37 A;  1SQP G;  1KC8 2;  4WVZ A;  3CCL Z;  1L0L J;  4OH8 B;  2YO2 A;  4XA4 A;  1MV8 A;  5AVW B;  4NFR A;  4D6T J;  2IYO A;  1FE6 A;  4NBG A;  1KIL E;  2XKM A;  4AYB A;  5BU5 A;  2GA1 A;  2QLV B;  2QJY B;  1KOR A;  5C4X I;  3II6 A;  3PLN A;  1J1D C;  2J59 M;  3BRT B;  4NBD A;  1RE3 A;  1VL2 A;  1W2B Y;  3CPW Y;  4YTP C;  1LT9 B;  4H0L D;  3H1L J;  1VQ9 Z;  1Q86 1;  2FY8 A;  3KZI E;  1OIP A;  3GF3 A;  1HGV A;  4U3F G;  2J58 A;  1L2P A;  2E74 C;  3J81 b;  1LQL A;  1K9M 1;  5APU A;  2H43 A;  1ZV8 A;  1BGY G;  3TSI A;  5AW1 B;  3GHG B;  3GLM A;  5APY A;  2D2C C;  3V2N A;  2A45 H;  4A3I I;  2OQQ A;  4E30 A;  3Q3D A;  3RBX A;  4EI2 A;  1FBM A;  2XV5 A;  5AVV B;  1VPC A;  1X0T A;  2Z5I A;  3CX5 I;  1KRL A;  3RL0 B;  1BE3 J;  3H1I E;  2YO3 A;  3CX5 D;  2IFM A;  4DOJ A;  2AXC A;  1EDI A;  3E7K A;  4RVG A;  4A7P A;  2VPX A;  2OTK E;  2W04 A;  1QVF Z;  2M48 A;  4H44 B;  1FZG A;  2VPZ A;  1LTI C;  1NTZ G;  1T2K C;  3H1K J;  5A2Q b;  3J7A 4;  1NU1 D;  1GK6 A;  1SQQ D;  2QEX P;  4L75 A;  1KIL B;  4TT3 H;  1IFM A;  3I55 1;  1GK4 A;  1YJN 1;  1WII A;  2KNC B;  1VQP 1;  2OYO A;  2OTJ 1;  3I4N I;  4E33 A;  3FKI I;  2FBW C;  1VQ6 1;  3MUD A;  2BAS A;  1NTK D;  1L4A C;  2IBZ I;  2JIP A;  1S5L H;  3CCQ P;  3G4S Z;  1HH0 A;  3CC2 Z;  3CCU 1;  1IJD B;  1BSH A;  3CCR Z;  2ZFC A;  3VOP A;  1CSB A;  3Q5R A;  3WUT A;  2Y9Z A;  3A7O A;  4Y7N I;  1A02 J;  4HB1 A;  1IFI A;  3VMZ A;  3OW2 Y;  2QRE B;  3PHL A;  2QVA A;  2JIR A;  2SPZ A;  2E76 C;  3CCE P;  3FXD A;  1VQO Z;  1ZP0 C;  3KQG A;  2H88 C;  3O8Z A;  1SQX D;  1JEK A;  3HRN A;  2DE6 A;  3AE4 C;  3RK3 D;  1S5L X;  1U57 A;  1KB9 D;  1JY2 P;  3L75 G;  1OVR A;  1X3W A;  2Y0E A;  3GTM I;  3G6E 1;  2DW3 A;  2JA6 I;  3KIH A;  1KZU B;  5KKZ B;  1EDK A;  2E2J I;  1VQ5 Z;  2Q7C A;  2B87 A;  1DL6 A;  1KV4 A;  3KXD A;  2E43 A;  3PO2 I;  2YIU C;  1ZH1 A;  4JPZ B;  3IF8 A;  1VQN 1;  5KLV J;  3USS A;  3W67 A;  1LTJ C;  2ZT9 B;  2QM7 A;  1NU1 E;  4JYB A;  1URQ A;  3PH0 A;  1YJW Z;  1SQQ E;  1NU1 K;  1SQQ K;  1M90 Q;  3CWB J;  3A0B H;  1TWH I;  5AW9 B;  3AEB C;  2IDB A;  4A3D I;  2QG4 A;  1IK7 A;  1Q90 D;  3HOZ I;  3PO3 S;  3J81 f;  1M57 D;  2PFX A;  3NXS A;  5B66 H;  1NTK E;  5APX A;  1KQF B;  1NTK K;  2GTI A;  4PD4 I;  1KB9 H;  3VMX A;  4NBF A;  2JWA A;  2QRX A;  5T6B A;  4HYT B;  1FZB A;  3HKZ A;  5D1P A;  4C7R A;  1S72 Z;  5AN9 F;  3BCC D;  2KSE A;  4Z1M H;  4RV9 A;  1UII A;  2JP3 A;  3TF5 A;  1RHZ B;  3CC2 P;  4JYC A;  1OVV A;  3HD7 A;  1OZH A;  2W90 A;  1SQX E;  5B66 E;  4BBR I;  5A2Q f;  1Q16 A;  3H1I G;  2YNY A;  1SQX K;  1NWQ A;  1J1E B;  3B8E B;  3CLQ A;  1KB9 E;  3D71 A;  4E2Z A;  4XX2 A;  3I56 1;  2P2U A;  1RF1 C;  1SQV E;  2WSE J;  5KAF H;  1JCC A;  2OAR A;  1N8R Q;  5CM2 M;  1FAV A;  3A0H H;  2A45 G;  1CI6 B;  2P3Y A;  2XDJ A;  1N7S C;  1PGP A;  2IV2 X;  2QA4 Z;  2QR1 B;  2AXT H;  2E75 D;  3MZL B;  3HUS B;  3L74 D;  1JO5 A;  1DD4 A;  3BAT A;  4L74 A;  1IC2 A;  2RPR A;  4A93 I;  3MIW A;  4PJ0 E;  1EZV D;  2YKO A;  1RQF A;  3NFZ A;  4TNU A;  1BDC A;  3IAO A;  1FZC A;  1G1J A;  2W03 A;  1SP4 A;  5KAF E;  3CMA P;  2QJK C;  1H0T B;  2V8K A;  1JMM A;  1DH3 A;  3AEA C;  3A0H E;  3NH8 A;  3CCJ 1;  4K35 A;  3CC7 Z;  1U7J A;  2AXT E;  1SS1 A;  5T67 A;  2HPC A;  3AE2 C;  1YIT Z;  5KJ7 C;  1DEB A;  3M4O I;  2W27 A;  4KHX A;  2P7J A;  2RMZ A;  5AVR B;  3KDP B;  4YXW H;  3P32 A;  3D70 A;  2FYN B;  3Q87 A;  1URQ C;  1SQP J;  3M9Q A;  3VMA A;  3VYI A;  1RE4 C;  3RK3 B;  3CC4 Z;  3S9O A;  2V3V A;  1GL2 A;  3RK2 C;  4EIJ A;  3MON A;  2JO1 A;  4HH2 A;  1KN7 A;  3BCC J;  1KMI Z;  1VQK P;  4M3L A;  3HE4 B;  4HGY A;  2K9J B;  3CXC Y;  2WT7 A;  2H8P D;  4WWI A;  1YHQ P;  1Q7Y 2;  1H8A A;  1VQM P;  1R5S A;  3CCS Z;  1Q82 Q;  1YJ9 1;  3V2P A;  1DD3 A;  1NU1 G;  3S16 I;  1FZE A;  1SQQ G;  3S17 I;  2H7H A;  3CCM Z;  1YBK A;  1PPJ G;  5H2F H;  2M5A A;  4EOT A;  3BG1 B;  3G71 P;  4U3F J;  1VF5 C;  1VQ7 1;  1YIJ P;  2GU2 A;  4A3B I;  1JJ2 Z;  2OYH A;  2OTL Z;  3L70 D;  3MZW B;  2EGT A;  4MD8 A;  1BCC D;  1MFT A;  4OGQ D;  1MKM A;  3BVH A;  3FQM A;  2WSC H;  1EZV E;  5D1O B;  1LTS C;  1Q86 Q;  1NTK G;  2RKL A;  3L74 J;  1JTH B;  4PV1 D;  2FFD C;  2AEJ A;  2POH A;  2A06 D;  3AE8 C;  1W2B Z;  5B5E H;  2M0B A;  2PRR A;  1K9M Q;  1ZLL A;  5C3E I;  3EER A;  1VQ8 1;  3CD6 P;  2B89 A;  3N7N A;  4NPD A;  3ZDM A;  5CCH C;  1N8R 1;  1T8Z A;  1NTZ J;  1WJ2 A;  2WPQ A;  4Y99 C;  1TFI A;  1GW3 A;  2P28 A;  4B86 A;  4NBB A;  4UB8 H;  1SQX G;  4QMA A;  1QF8 A;  1KFM A;  2DE5 A;  5AVU B;  1JCD A;  2IZ4 A;  1ZR4 A;  5E79 E;  5EFW B;  3OJA B;  5CCG C;  1QVG Y;  3V4Q A;  5B5E E;  1W2E A;  2CPS A;  4KT0 J;  3WUU A;  1VQL P;  2R6M A;  2M8R A;  3CCV Z;  4C7N A;  2KOG A;  2HOD A;  3CL3 D;  2JMO A;  2YXQ B;  4O9B A;  3U1A A;  1ZRT D;  4L73 A;  1PP9 E;  4DK1 A;  2KS1 A;  3TGU D;  3CME Z;  2ZXE B;  3L71 D;  1VLA A;  4YXD C;  2OYI B;  3IF4 A;  2VPW A;  2E75 B;  4GOD A;  4CL1 A;  4UB8 E;  1QVF O;  2Q9I A;  4CPG A;  2I3C A;  3H32 B;  2PAJ A;  2E74 D;  1L4A A;  3RL0 g;  1LWU B;  2AKL A;  1FZF A;  2D2C D;  1G2C A;  1KC8 Q;  1PIX A;  3RL0 C;  2JKV A;  3L70 E;  1BCC E;  1M1J A;  1GL2 C;  2A45 I;  4L76 A;  4DGL A;  3L75 J;  1FDO A;  4H44 C;  1ML8 A;  1TWA I;  2HR3 A;  2A06 E;  4E2X A;  3P5J B;  2C0W A;  3V4W A;  1T2K D;  3JAM b;  1Q82 1;  5KLI C;  2NVX I;  4UB6 H;  3BCC G;  1USE A;  4D6T E;  2QEX 1;  4U7J A;  1OW6 A;  5M1B A;  2G2K A;  2HF1 A;  1QL1 A;  2NRG A;  2JA7 I;  2E5Y A;  2PP6 A;  2E9H A;  1ZXG A;  3L4F A;  2OYH C;  1T3J A;  1WMK A;  1OW7 A;  1DEE G;  2XNX A;  3GKQ A;  1L4A D;  3CCQ 1;  1FOS F;  2WIT A;  1LP1 A;  1LTJ A;  1SIW A;  3NMD A;  1YTZ T;  4Y52 I;  3F89 A;  1YTZ I;  4UB6 E;  3M06 A;  1ZRT E;  3AEF C;  3AEC C;  3H0G I;  3TGU E;  3L71 E;  1NGM B;  2JEE A;  2C9N Y;  1KYO H;  3L74 G;  2WSS H;  1USP A;  3CCE 1;  2E76 D;  2FXO A;  5TJH A;  2O3J A;  3AE3 C;  5APS A;  2OOX B;  3QH9 A;  1FOS E;  4ZKU A;  4OWF A;  1N73 B;  2E42 A;  2LXC B;  1EZV G;  2KIK A;  1YUA A;  4OGQ B;  2HPC B;  3I55 Z;  4NB9 A;  1YJN Z;  4LGD E;  3BG0 B;  2LFU A;  1VQP Z;  1QLE D;  4PV1 B;  2XU6 A;  3NDI A;  2XND H;  2ITA A;  3H1I J;  5KAI H;  2V7Q J;  1E79 H;  3CCU Z;  3H25 A;  5AW0 B;  1FZA A;  2IFN A;  3HOV I;  1KYO E;  1EDL A;  3G9R A;  2ZT9 C;  1OFC X;  1HJB A;  3GTL I;  1KQL A;  1SQB D;  3WU2 H;  4DZO A;  1OW8 A;  2R92 I;  4H13 C;  2JDI H;  1RF1 A;  1IFJ A;  1KD1 2;  4A3G I;  4IFD K;  3H6P A;  3LW5 H;  5KAI E;  1Z03 A;  1J1D B;  3A2A A;  2M5A B;  1KC8 1;  3D9X A;  2J5U A;  1K73 2;  5GTI H;  1QEX A;  2WTY A;  3TE5 B;  1NO4 A;  2O01 H;  3MZK B;  1N7S A;  5C4J I;  3CCL P;  1HF9 A;  1Y1V S;  1M1J C;  1NJI 2;  1M1K 2;  5CHX A;  1BSN A;  4BRY A;  2ZYG A;  3PJS K;  2Y0C A;  3G6E Z;  4MON A;  3CQZ I;  1LTG C;  3L72 D;  3WU2 E;  4N6J A;  1KQS Y;  3I5C A;  2E74 B;  1KB9 I;  2BEZ F;  1S5L E;  3ITK A;  2W6A A;  3WUV A;  4NBE A;  1VQ9 P;  3QWU A;  1VQN Z;  2D2C B;  2KLV A;  2WPR A;  1FU1 A;  3L70 G;  3CC2 1;  2IYP A;  5K5G B;  1NKN A;  1BCC G;  1SQV D;  4I7Z C;  5GTI E;  1J1E C;  3JAM f;  2H89 C; 
#chains in the Genus database with same CATH homology
 3CCL 1;  2KI7 B;  3NFZ A;  1QYP A;  1RQF A;  3IX0 A;  1VQ4 Z;  4TNU A;  5IP7 I;  1K83 I;  3GTG I;  4DQY B;  1BDC A;  1Z01 A;  2R93 I;  2K5R A;  1U7M A;  2W03 A;  1RO4 A;  2DE7 A;  2VUG A;  1K9M 2;  5C39 A;  2JA8 I;  3GTM S;  5IT9 f;  4A3F I;  1H0T B;  2V8K A;  2P58 A;  2O4H A;  3NH8 A;  4MRI A;  3CCJ 1;  4K35 A;  3S15 I;  4BY1 I;  3CC7 Z;  1U7J A;  1JM0 A;  2Q4Z A;  4IOI H;  1H0T A;  2R44 A;  2UWJ E;  1SS1 A;  2O53 A;  3F3F C;  5T67 A;  1VQ9 1;  4RS4 A;  2OTJ Z;  2Y0S A;  3S1N I;  1YIT Z;  1JWH C;  3M4O I;  1VQ6 Z;  1TWC I;  1Z02 A;  1I50 I;  4NB8 A;  2B88 A;  1N2F A;  3NH4 A;  3Q87 A;  3IFU A;  2NVT I;  5CBN A;  3HOX I;  3CC4 Z;  1YUK A;  4ZMD A;  3FQQ A;  2OOY B;  4A3E I;  3VMI A;  4E32 A;  4NOZ A;  3CMA 1;  2B63 I;  1ZB9 A;  1FC2 C;  3CXC Z;  2KZI A;  3S14 I;  4BY7 I;  3MON A;  2PMZ A;  1S7M A;  3HOW I;  3CCV 1;  4HGY A;  4X6A I;  4MD7 A;  3I56 Z;  4GOE A;  3CXC Y;  2H85 A;  1EC5 A;  1K8A 2;  3QWO C;  4WWI A;  4A3L I;  1Q7Y 2;  4GOF A;  3CME 1;  3CCS Z;  3GTQ I;  5CBO A;  1YJ9 1;  3F3P C;  4HJG H;  4BXL A;  1NP6 A;  1KD1 1;  4MD9 A;  3S16 I;  2QRD B;  2KPI A;  3S17 I;  4ASW A;  3CCM Z;  2KUB A;  5IP9 I;  4A3K I;  2M5A A;  4K3A A;  3BG1 B;  3RZD I;  4MXU A;  2PK7 A;  4E31 A;  1M1K 1;  1VQ7 1;  4E2W A;  5DJU B;  1KC8 2;  2GU2 A;  4A3B I;  1JJ2 Z;  2OTL Z;  1YI2 Z;  2EGT A;  1Y47 A;  3MZW B;  4MD8 A;  1MFT A;  3CCL Z;  3FQM A;  4NFR A;  2QRC B;  5D1O B;  2V8J A;  4NBG A;  3D6W A;  1VQK 1;  1RO0 A;  4AYB A;  1Q81 2;  2RKL A;  2QLV B;  1RLY A;  4NPE A;  5C4X I;  5D1O A;  2YU9 I;  1ZB8 A;  1ZW0 A;  3TDH B;  1W2B Z;  2VF1 A;  2M0B A;  2F4O A;  3G4S 1;  1YHQ 1;  4NBD A;  3CCR 1;  5FLX b;  1VQM 1;  3CCJ Z;  2JS4 A;  5C3E I;  2BJO A;  3EER A;  1VQ8 1;  1W2B Y;  2B89 A;  3ZDM A;  4NPD A;  3NH5 A;  4E2Y A;  3CPW Y;  2LR2 A;  1N8R 1;  1VQ9 Z;  2WMM A;  4NBC A;  1Q86 1;  3G71 1;  2E2I I;  1TWG I;  3VTN A;  4NBA A;  2I8D A;  1TFI A;  4ZNC A;  2P28 A;  1YIJ 1;  4NBB A;  3J81 b;  3S1M I;  1LQL A;  3RGU A;  2RHB A;  1VQO 1;  1K9M 1;  1QF8 A;  2DE5 A;  3J80 b;  4RVF A;  2E2H I;  2IZ4 A;  3VMG A;  5EFW B;  1QVG Y;  4A3I I;  3CMA Z;  4E30 A;  3PO3 I;  1X3Z A;  3EED A;  2KS1 B;  2R6M A;  3CCV Z;  1X0T A;  1R9T I;  3CD6 1;  2JMO A;  1KRL A;  3FXE A;  1NVO A;  4DK1 A;  3CME Z;  1EDI A;  1VLA A;  2RIQ A;  4RVG A;  2OTK E;  1WW9 A;  1VQ4 1;  2W04 A;  1QVF Z;  1VQ5 1;  2M48 A;  3GTJ I;  2F4M A;  4GOD A;  4CL1 A;  4CPG A;  2I3C A;  3GTP I;  5A2Q b;  1QVF Y;  3J7A 4;  4S1T A;  4RVD A;  2J6A A;  2AKL A;  1VQ7 Z;  1M90 2;  1LT1 A;  1YJW 1;  1PFT A;  4BXX I;  3I55 1;  2V8I A;  1YJN 1;  1WII A;  3GCF A;  1VQK Z;  3NDJ A;  1VQP 1;  1VQL 1;  1Y1V I;  2OTJ 1;  4QTU A;  2HU9 A;  3S1Q I;  3I4N I;  1JMB A;  2YAD A;  4DGL A;  4E33 A;  3FKI I;  4HGZ A;  1SFO I;  1VQ6 1;  3GTO I;  1K73 1;  3KIF A;  1ML8 A;  1TWA I;  3CCU 1;  2HR3 A;  3G4S Z;  3CC2 Z;  1YHQ Z;  3CCR Z;  1VQM Z;  1NJI 1;  2M6N A;  3P5J B;  4E2X A;  1VQ8 Z;  1EDJ A;  2LIY A;  5C44 I;  4Y7N I;  3M3Y I;  3JAM b;  1Q82 1;  2NVX I;  3G71 Z;  4HB1 A;  3T4N B;  1S72 1;  3OW2 Y;  2QEX 1;  2OZK A;  2QRE B;  3MHV A;  1YIJ Z;  2QVA A;  1Q81 1;  2SPZ A;  2ZAE B;  2G2K A;  3FXD A;  1VQO Z;  2HF1 A;  3CPW Z;  2JA7 I;  5IT9 b;  2E9H A;  1ZXG A;  3U50 C;  4MN4 C;  2DE6 A;  3S1R I;  2R7Z I;  1DEE G;  1LP1 B;  3S2D I;  3GKQ A;  3CCQ 1;  2K3R A;  1OVR A;  4RVH A;  3I4M I;  1X3W A;  3GTM I;  3CD6 Z;  1LP1 A;  2GTH A;  3G6E 1;  2JNY A;  4BBS I;  4A3J I;  1N8R 2;  1QVG Z;  2B87 B;  2JA6 I;  4Y52 I;  3KIH A;  4NH1 C;  4A3M I;  1YI2 1;  1EDK A;  2NVQ I;  4NBH A;  1USP B;  2JWD A;  3H0G I;  2LXB A;  2WB1 A;  2E2J I;  2WAQ A;  3LUS A;  1VQ5 Z;  2B87 A;  1DL6 A;  3VMH A;  4JBZ A;  3PO2 I;  1USP A;  3S2H I;  3CCE 1;  4ASV A;  1ZH1 A;  2OOX B;  2NVY I;  3IF8 A;  3K7A I;  2QA4 1;  5FLX f;  1VQN 1;  2LXC B;  2RT9 A;  2KIK A;  4KJM A;  1YUA A;  4HKZ H;  3PH0 A;  1YJW Z;  3I55 Z;  4NB9 A;  1YJN Z;  1Q2N A;  1S3J A;  3BG0 B;  2LFU A;  1YJ9 Z;  1VQP Z;  1VQL Z;  1TWH I;  4MH4 A;  4HH4 A;  4A3D I;  3H3V J;  3NDI A;  2RBL A;  3ESW A;  2Q51 A;  3HOZ I;  3PO3 S;  3J81 f;  1L1O C;  3CCU Z;  3J80 f;  3HOV I;  2GTI A;  3CC7 1;  1EDL A;  2PM9 A;  1M90 1;  4NBF A;  1K8A 1;  2QRX A;  5T6B A;  1OVU A;  3HKZ A;  3GTL I;  1Q7Y 1;  4NPF X;  5D1P A;  1S72 Z;  4EWC A;  2QEX Z;  5AN9 F;  2R92 I;  1YIT 1;  2KZJ A;  5FLM I;  2Q1K A;  4RV9 A;  5T64 A;  1NUI A;  1I6H I;  1KD1 2;  4A3G I;  1OVV A;  3HOY I;  2QKD A;  3CC4 1;  1Z03 A;  3OW2 Z;  2M5A B;  1KC8 1;  3D9X A;  1K73 2;  3TE5 B;  4BBR I;  5A2Q f;  3MZK B;  1WCM I;  5C4J I;  3RZO I;  3CCQ Z;  1Y1V S;  4EYY Q;  1TWF I;  1NJI 2;  1M1K 2;  2JUB A;  5LL6 f;  1RO2 A;  3G6E Z;  1KQS Z;  4MON A;  4E2Z A;  4XX2 A;  3CQZ I;  3I56 1;  5DJT B;  1Q82 2;  1Y1W I;  1KQS Y;  3HOU I;  4QTT A;  5CM2 M;  3CCS 1;  3I07 A;  1JJ2 Y;  1RNI A;  2P3Y A;  3CCE Z;  2JA5 I;  2IZ3 A;  4NBE A;  3CCM 1;  1BDD A;  2QR1 B;  2QA4 Z;  3VB9 A;  3QWU A;  3MZL B;  3S1K A;  1VQN Z;  2JR6 A;  4A3C I;  3CC2 1;  3GTK I;  5K5G B;  2VUM I;  1P9N A;  2RPR A;  4A93 I;  3JAM f;  2OTL 1;  1I3Q I;  1Q86 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...