2KI7B

The solution structure of rpp29-rpp21 complex from pyrococcus furiosus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
b'EKKRIAKERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCKKCHAFLVPGINARVRLRQKRMPHIVVKCLECGHIMRYPYIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 1
publication title Solution structure of an archaeal RNase P binary protein complex: formation of the 30-kDa complex between Pyrococcus furiosus RPP21 and RPP29 is accompanied by coupled protein folding and highlights critical features for protein-protein and protein-RNA interactions.
pubmed doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
total genus 23
structure length 97
sequence length 97
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2ki7B01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ki7B02
2B87B 4ZNCA 1DEEG 2ZAEB 2OTKE 1X0TA 1NVOA 2M0BA 2JWDA 1H0TB 2LXCB 4MN4C 3PH0A 1OVVA 5CBNA 2RKLA 3MHVA 4IOIH 1JMBA 2KZIA 2KIKA 2M5AB 4WWIA 1BDDA 5DJTB 2B87A 5DJUB 5EFWB 2Q1KA 5CBOA 4JBZA 1Y47A 3S1KA 1EDJA 2HR3A 4ASVA 4ASWA 4GOFA 4NPDA 4EYYQ 2LR2A 1EDIA 4GOEA 2KZJA 1EDLA 1LP1A 2QRXA 1OVUA 2WMMA 1ZXGA 3QWOC 4K35A 4HKZH 1LT1A 4CPGA 1Q2NA 1MFTA 2UWJE 2R44A 1EDKA 2B88A 3RGUA 1BDCA 3MZWB 4HJGH 3ZDMA 5K5GB 3FXEA 1H0TA 5C39A 2KUBA 4K3AA 2SPZA 4HB1A 2M5AA 1SS1A 1U7JA 4KJMA 2QVAA 4BXLA 2KS1B 2LXBA 4GODA 1EC5A 2P58A 1U7MA 1S3JA 2B89A 4NPEA 2KI7B 1FC2C 2K3RA 1ZW0A 4NPFX 1LP1B 1JM0A 3FXDA 4ZMDA 2I8DA 1OVRA
chains in the Genus database with same CATH superfamily
1NU1D 4A3MI 2WPQA 1MUUA 3LW5H 1USDA 1JY3O 1NJI1 2M48A 5C4XI 3CCEZ 2AEFA 1X0TA 2IV2X 2V4HA 3P8CE 1KILA 3U1CA 2BJOA 4A93I 2KNCA 2I1KA 4B86A 3JCUE 3E7KA 3L74E 4EWCA 3V2NA 5H2FE 1BDDA 3GTGI 2R6MA 3VP8A 3U1AA 1M57D 3HE5A 1GW3A 1SQQG 2HODA 1FS0E 3CCL1 2FYUG 4PD4E 3H1HJ 3D6ZA 1VQ9Z 3S1KA 3MIWA 3LUSA 3H1KD 2R93I 2WZ7A 1KQSY 3CMEP 1CI6B 1SQPJ 3EFFK 2FXPA 1M7LA 1P84E 2HG5D 4GKGA 2OARA 1LQLA 1VL2A 4O9BA 3NMDA 1LP1A 1H88A 2YO3A 2JMOA 1SQPK 1FZGA 3BRVB 3KZIE 4LC1A 1EZVI 1IFMA 4IL6E 2E75D 3H1JE 4H13C 3M9QA 1OIPA 5C3EI 1VQNP 1KILB 2ZYGA 1YHQP 3PHLA 2KNCB 2NRGA 3I561 3CCJZ 4MXUA 2KUBA 3GTKI 3OW2Z 1FZAA 4MD9A 2IBZD 2IZ0A 1YIJP 2K5RA 3RL0g 1N86A 1GU4A 3S2HI 3GG2A 3B5NA 2W90A 2HODB 2DE7A 5APTA 1VLAA 2IYOA 1VQMP 3VTNA 1NYHA 2E43A 1U7MA 5KTBA 2HPCA 1P84I 3ESWA 1LJ2A 4TLFA 5APYA 1LP1B 1ZOYC 1HF9A 3L75D 1NTZE 2ZVOB 4A3DI 3CXCZ 3IAOA 5CM2M 4PV1D 3GW6A 3KIFA 2DE5A 2Y9YA 4A3II 4QTTA 2HF1A 4L73A 3JAMf 3L72D 1OX3A 1RF1C 1W2BY 2K1AA 5AVTB 2OTJZ 1N8RQ 2JA6I 4N78E 2QA4Z 5AVZB 2NPSB 1HVVA 1VF5D 2PFXA 1YTZT 3H1IJ 2JR8A 1L0NE 3G4SP 3CCMZ 4UB8H 1SQVG 2AEJA 2D2CD 2YIUC 4L75A 1NTKG 1RY3A 1K04A 3RK3B 3CC7P 3CD61 1M1K2 3C9IA 4NPDA 1JY2N 4EYYQ 1DX7A 3V6IA 1EZVD 2PM9A 1FZEA 1PGOA 1A02F 2QRXA 1ZRTD 3N4XA 3GTMS 5AW6B 3L74D 4YXDC 2Y0SA 2QEXP 1Z02A 1NTME 3AECC 1BDCA 4HJGH 2WSFJ 1SVFA 2OYHB 1G2CA 2KPIA 3L70D 1TWGI 3U59A 2G3AA 3SSUA 1N7SD 3H1LD 4Y99C 3H3VJ 3CCSP 2W04A 1IFDA 1KRLA 2EGTA 2Q4ZA 1AA6A 1DD3A 3RL0D 1M8OB 1BE3G 4GODA 1NAFA 2DW3A 4A3CI 2B63I 2ZJSE 4WBAA 3PRJA 3H1JD 1VQ8P 2ZYDA 3V4QA 3S14I 4JYCA 3HKZA 1HGVA 2W03A 3VTPC 1VQ41 2J58A 2W8ZA 3A0HE 1SQQJ 5KLIC 2FYUJ 2KSJA 1QVFZ 1YUKA 3HE4A 1QLED 1SP4A 2OZKA 4LGDE 2KZIA 1Q81Q 1SQQK 2FYUK 3L37A 1ZP0C 2N9BA 1ZB9A 5AW9B 3L73G 1JY2P 4H0LD 2HU9A 3EWKA 3HTKA 2LR2A 2OYIC 3K7AI 1HUCA 2JUBA 3H1HD 2FXMA 2I3CA 2M6NA 1QEXA 4H13B 5GTIE 1X3ZA 1SQPD 4K35A 1G1JA 3T97A 1PFIA 3D9XA 4HKZH 3VMXA 1NH4A 3F89A 2YKOA 1Q2NA 4NBHA 1VQPP 3NFQA 3W67A 3MUDA 5KAIH 1M901 4NBBA 1URQD 1QVGO 3CMEZ 5K5GB 3BVHA 2G8YA 2R5DA 1PP9E 5AVQB 1JWHC 3GTQI 5T64A 1I6HI 2JKVA 1QVGZ 2E2II 2YO2A 3CC21 3M0DC 3D6YA 4GIFA 2W6BA 1X79B 3HTKB 1VQNZ 3CMAP 3A0HH 3Q5PA 1FBMA 1VQL1 1Q822 1T3JA 1QF8A 3IFUA 1E79H 1KQSO 1S1CX 2W6AA 1Q7Y2 1YIJZ 1KB9E 1NTMD 2FXOA 4PJ0E 1RF1B 1XTGB 1VQMZ 2BCCJ 3I551 1NJI2 1SQVJ 5CCGD 1NVOA 1NTKJ 2WT7B 2AXTE 1L4AA 1N8R1 2WSFH 1SQVK 2M3EA 3O8ZA 2YIUB 3M4OI 1RO2A 1OW8A 2B9BA 3A0BH 3VOPA 3KYQA 1VQO1 1AJYA 1NTKK 3P8MC 2QIWA 3H1ID 2NVYI 4XA4A 2Y0CA 3HOYI 4GOFA 2JIRA 1EDIA 2P28A 3FKII 3CC4P 1YIT1 1SQBG 4A3BI 2IFNA 1KB9I 3OAKA 5KJ7D 1YHQ1 1SLQA 3MONA 3CXCY 2QE7H 1GZLA 2XDJA 4RKUJ 2XV5A 3I5CA 5B5EE 3G711 1WIIA 1ZN5A 3J81b 3CC7Z 3CPWZ 1H0TA 3O6QB 2JIOA 2OYOA 4NBDA 4U3FE 1RE4A 4HB1A 4R4MA 3R2PA 3WU2E 1KB9H 1VDFA 3TSIA 2BCCE 3S1NI 5CCHD 3L71E 2OYIA 1OXZA 1VQ5P 4RVHA 1JMMA 2QLVB 1KN7A 2QEXZ 3GF3A 4A3KI 2A06D 2JP3A 1WT6A 5GTHH 2O01J 1T8ZA 5AW0B 1LTGC 5KKZC 5KLIB 1HWTC 1GL2D 1OWAA 2R32A 4NFRA 4BRYA 3G4S1 1PP9D 1R8EA 2V45A 1DEBA 3NTNA 1S5LH 4A3FI 1JCDA 1H0TB 1MV8A 3FQQA 3KXDA 2OTJP 1OW6A 3M91A 3PH0A 4DQYB 2LIYA 4WVZA 3S1QI 1OMIA 1VQ8Z 2KIKA 2JO1A 1SQQD 3H1KE 3M0DA 2FYUD 1IFIA 3I4MI 2B87A 4D6TG 5A2Qb 2PP6A 1FZFA 3RL0C 2OYIB 3CCU1 3A7OA 3IX0A 1KB9D 1W2EA 3RBZA 3FWLA 4AQRD 1EDLA 5T67A 1JY2O 2JS4A 1DL6A 3HOXI 3QWOC 3EERA 2JA5I 3TNUA 2FKWB 1BCCG 1ZB8A 4BRYB 3WU2H 2JA8I 4CPGA 5C44I 4A3EI 4WY4D 3B5NC 2E5TA 1Q16A 3CCS1 3NH4A 1HTLC 1QVFY 4I1LA 3CWBG 1KYOI 2JWAA 2JDIH 4HGYA 2OTL1 3KPEA 5AW8B 1S7MA 2QJYC 4BXLA 2Q3IA 1X9VA 4S1TA 3NDJA 1AA0A 3L75E 3BG0B 2AXCA 5E79E 3CCR1 1LT9A 1LTIC 2WPVB 4NPEA 1FDOA 1YQ4C 2RHBA 2E75B 3L72E 2I8DA 1VQK1 4H44C 1KYOH 3CCVP 2O01N 2H85A 1BGYJ 1KD1Q 4ZKUA 1L0LJ 2P2UA 4U7JA 1TWCI 3CMAZ 2LXCB 1S5LX 3CXHH 2GM4A 1WRGA 3CI9A 4XE5B 2JIPA 2QRCB 4GT1A 3G6EP 2BCCD 3H25A 2N1TD 1KQGB 1SQBJ 4TNUA 2J6AA 1L0LK 5APUA 1DIPA 3H6PA 2Q1KA 1NTKD 1QVGY 5CBOA 4RO0A 2QREB 2A45G 1QYPA 1EZVE 2IPPA 1LT9B 1SQBK 1LWUA 4RVDA 4CL1A 2G2KA 2GTHA 1K9M1 1ZRTE 1VQP1 2HLOA 3J80f 2BEQD 1OVUA 2O01H 1N7LA 1NUIA 4NB9A 3WUVA 1KC82 4BWNA 3Q5RA 2NAPA 1VF5B 3L70E 2OGUA 1KYOD 1M902 3QH9A 3H1LE 3RK2D 5E79H 1JJ2Y 1N7SA 3AE3C 3CC4Z 3II6A 1AVYA 1Q86Q 4KHXA 4UB8E 1SFCD 3M06A 3OW2O 3B71A 1LWUB 1FE6A 1BGYE 1KTMA 1L0LE 1Q90D 3BCCG 2KI7B 1K732 3HD7D 3VMZA 3CCE1 5KKZB 4NBCA 1NO4A 4OGQD 3AE2C 1TU3F 4RESB 1JOCA 1PPJG 3P5JB 3HE5B 1LTJA 3T4NB 4D6TJ 1X3WA 2RN0A 5TISH 1VQ5Z 1L1OC 1N7SB 4IFMA 1VQ91 5CBNA 2RKLA 1YJ9P 5AW5B 5CHXA 3S9OA 3RL0B 5KLVG 3D70A 1KORA 1NHLA 5AW7B 1NGMB 2E76D 1M56D 5CCHC 2ZVNB 1Y47A 3H1HE 3C1LA 1BCCJ 5AVRB 4IFFA 1T6AA 1RNIA 2YXRB 1SQPE 2MJZA 3P7KA 2JJLA 1AVOA 3MUDC 2WVRA 2QJKC 3TE5B 5D1OA 1AFOA 3CWBJ 2WPSA 3CCJ1 2YMYA 3B5NB 1DD4A 1Y8CA 1LTJB 3AEGC 1URQA 1I50I 1LT1A 4A3LI 2HPCB 4NH1C 1QX8A 2QJYB 2W83C 1QL1A 2AYDA 5B66E 2SPZA 3S1RI 3TGUG 1USPA 4H0LB 1R5LA 1NU1G 2XNXA 4E2XA 3AEDC 3KHUA 4NOZA 2PGDA 4H44B 1OZHA 3SWFA 2WSCJ 3HRNA 3KDPB 1FC2C 2K3RA 4E33A 5D1OB 1JM0A 3AE8C 3FXDA 3IFMA 3S17I 2OTJ1 2QA41 1L4AC 3J7A4 2Y9ZA 3L36A 1T2KD 3TDKA 1M1KQ 5KAIE 1VQ6P 3CCM1 4EIJA 1RQFA 2RPRA 1KD11 3AE5C 3HOVI 3CQZI 2E42A 1JMBA 2WAQA 3H1IE 1MZ9A 1BGYD 1SQXG 1QVFO 1L0LD 2Z5IA 3CCVZ 2KSEA 3PJSK 5KJ7A 3ITKA 3AE4C 3HOUI 5AW1B 1G2CB 4I2LC 1YJWP 3G6EZ 1IK9A 1GK4A 2FY8A 1AQTA 2KB7P 1ZXGA 2R3CA 2IBZG 2NPSD 5B66H 1YQ3C 1RE4C 1RF0A 1JUNA 1MFTA 2P7JA 3TYYA 2C0XA 1J1DB 2WQYC 2B88A 4UB6H 3ZDMA 2YADA 2L91A 5C39A 1YI2P 2J59M 3F3FC 1VQ7Z 1JY3N 1BSNA 1PGJA 2N1TC 3BCCJ 3RK3D 3GKQA 2YKPA 2PRRA 3A0BE 2E74D 3TDHB 1SS1A 5CCHA 2E7ZA 1Q861 2A06E 4Y28J 5APQA 1TWFI 3M0AA 3RZOI 3HE4B 5IT9b 1FJPA 3D6WA 3HOZI 1RE3A 1MFZA 1GL2A 3OA7A 1FOSF 1Y9BA 1DH3A 5KLVJ 4BBSI 2RBLA 5AVWB 1LGHB 2KS1A 5APXA 1U57A 2Q51A 1SQQE 3BATA 1JEKA 1WMKA 2FYUE 2Q3EA 4MN4C 1OVVA 1ZR4A 3MZLB 5KLVK 1WCMI 1HBWA 4D6TD 3CCLP 3E1IA 5DJUB 3T97B 1YYCA 2IZ1A 5EFWB 1K8AQ 4EOTA 2E75C 1RH5B 1FZCA 3PO3I 2QJKB 2LEXA 4W80A 3L74G 2QJPC 2KLUA 2K9JA 5GTHE 1QGKB 1K9M2 1YJ9Z 1GL2B 2WSCH 3NXSA 3OW2Y 1BCCD 3CME1 2WSEJ 2M8RA 2YXQB 2VUMI 4WY4A 3RBXA 3I56P 5BU8B 4HYTB 1PV3A 1WZNA 2RIQA 1Q82Q 1S5LE 3GTPI 3F3PC 1IFPA 3CWBD 1KFMA 2FBWC 3JAMb 1Q7YQ 1JY3P 4OH8B 1NP6A 2A45H 3C8VA 2E2JI 2FYNC 1LT9C 1VQN1 4PV1C 3H1JG 2QR1B 2YU9I 3MZKB 3CPWO 3G9RA 1OFCX 1PGQA 1YIJ1 3S1MI 4H13D 1IC2A 4JF7A 4MONA 4X6AI 2K9JB 2DE6A 2Y0EA 1BE3J 2O53A 1VQM1 5BVZA 1VF5C 1L4AB 3FGAD 2QM7A 2AKLA 4QMAA 4WY4B 2OOXB 1IFJA 3IR7A 2D2CC 3QWUA 1SQXJ 4DGLA 1SQVE 2H88C 3NH8A 3NFZA 4NBFA 2N1TA 1NTZG 5IP9I 1S4XA 1NTKE 4NBEA 1SQXK 1RO0A 4QTUA 1HJBA 1LWUC 3AEEC 2VPXA 3H32A 2IDBA 4MD7A 1T3UA 4R4LA 2J5UA 3CD6P 4E31A 3PLNA 1W2BZ 1SIWA 2V7QJ 2VRSA 1VQ6Z 4L74A 2JA7I 1LNQA 3L73J 1JCCA 3BRTB 4OWFA 1L0NG 2OOYB 4DCKA 2GUVA 3GMAA 1H8AA 1CSBA 1IK7A 1KYOE 3CC71 1N7SC 1Q811 3AE6C 1TFIA 3CX5I 1YJNZ 2N1TB 2NVXI 1W5CE 3CXHE 1CW5A 1YTZI 1BE3E 3VYIA 1Y1VI 3H32B 1SFCA 2QEX1 1YJWZ 1H89A 4MD8A 3D71A 5AN9F 3GHGA 3NH5A 4BBRI 1S72Z 1J2JB 2YNYA 1NTMG 3Q2YA 2FYZA 1EQ7A 3HD7A 2FFDC 2LXBA 2H43A 1LTJC 3CX5H 2VUGA 1NOHA 3MTUE 2N9YB 5C4JI 4RVFA 1FJKA 3CCQZ 1YI2Z 1VQ4P 1PPJD 4ZMDA 3OJAB 2B87B 1ZMEC 2NVTI 2WSEH 3Q5SA 2OTKE 1VQ81 1RQVA 3JSVC 4Y7NI 3CXHI 3W68A 4H0LC 2H8PD 3VMAA 4C46A 3TK1A 3Q87A 5FLXb 3JC22 4DZOA 3HUSA 3L73E 1YUAA 2XU6A 2WB1A 5AVYB 3EFGA 1KD12 2PMZA 1JB0J 1PFTA 1GDTA 3S2DI 2P67A 3Q3DA 3GHGB 2KLVA 4I7ZC 3TNUB 3MP7B 3VP9A 1IFNA 2QJPB 3HD7B 5CMZA 3K5BA 1K8A1 4OGQB 1LTAC 5M1BA 2MKVA 1URQC 3KIHA 3AEBC 5IP7I 2GU2A 3CX5D 3CCLZ 1SQVD 2PK7A 2KYVA 2VPZA 3U50C 3WMM0 4E30A 3AEFC 4W7ZA 1GK6A 3H1JJ 5KAFE 5TISE 1QL2A 4Y52I 2JIQA 2XNDH 2H7HA 2FYNB 2IYPA 3HUSB 3IF4A 3FX0A 1Q821 1CI6A 1X8YA 4PV1B 1NAYA 2IZ3A 2W27A 5TJHA 3F5HA 1Q7Y1 1VQ7P 3CC2P 1FDMA 2P3YA 2XZRA 2HFED 4XX2A 1Q862 2VF1A 1VQLP 3I56Z 3MD0A 3SWYA 1KILE 2M3BA 5CCGC 1JTHA 2Q5UA 4A3JI 1G1IA 2O1KA 1PP9G 2B89A 2V7QH 3WUTA 2JIMA 1ZW0A 2WTYA 2I1JA 1NTZJ 2D2CB 1J1DC 3I55P 3IR9A 1RHZB 3CMA1 3CXHD 3AE1C 2WITA 1DEEG 1BE3D 5IT9f 1NTZK 2Z4EA 2KOGA 2ZFCA 2KK7A 1I3QI 1QXFA 4YXWH 3R4YA 2LFUA 1FOSE 1VQOP 1KC8Q 1SQXD 5KJ7C 1L0NJ 1CZQA 4YTPC 1SQBE 3VN0A 1PL5A 2ZT9D 2FFDA 1Z56A 1M90Q 2RT9A 1XTCC 1GTWA 1YITP 3IF8A 1JTHB 1S9KD 1L0NK 5KAFH 1EDJA 4JQ0D 2YMKA 1RF0C 1IJDB 1M1JA 3IN6A 3M9HA 2NPSA 1KV4A 3CPWY 5APSA 1IZNB 3G71P 1R9TI 1N8R2 2Z5HA 2CPSA 5LL6f 1LTBC 4PD4I 4E2YA 3CC41 3L73D 3CD6Z 3USSA 1K73Q 3SFEC 3RK3E 2UWJE 1NTMJ 2NVQI 1EDKA 1EXJA 2HYNA 3MGNA 2C9NY 1MKMA 3FWNA 1L2PA 3JCUH 1EXIA 1NTMK 5H2FH 2FFDB 1RE3C 2QVAA 1GL2C 2RMZA 4HH4A 3LIEA 4PD4H 1EC5A 3S16I 2P58A 2V8IA 3HOWI 1M1JB 4U3FG 4M3LA 1P84H 2OYHA 1HH0A 1VQ51 2BCCG 4A3GI 3L71G 4JPZB 3KZIH 3ABVC 2QKDA 3J81f 4IL6H 4L76A 4D6TE 4UB6E 1AQ5A 1JO5A 3NDIA 1ZLLA 2E74B 2C9LY 2JEEA 1FZCC 3MHVA 4I7ZB 2GUSA 4BY1I 5AW2B 2CPBA 1VQ4Z 1KILD 3CCUP 1ML8A 5CJ0A 4IFDK 3P8CD 1FU1A 5CCGA 1URQB 4RS4A 4BY7I 2WPRA 4JBZA 4RVGA 4WY4C 3CL3D 2HR3A 1BCCE 2R5BA 2V8JA 4ASVA 4I6MC 3M3YI 3H1KG 3AEAC 4GOEA 4PD4D 3LIDA 2POHA 1USPB 3CWBE 3VMHA 3L4FA 1P84D 2JR6A 3S4RA 1YJNP 1Q812 2K9YA 2OTLP 1SQBD 3FXEA 2V3VA 5AVVB 1N2DC 1PP9J 1PGPA 4K3AA 4C7RA 1HJ0A 5A2Qf 2M5AA 2F4OA 1U7JA 3CCRP 4KJMA 3GF7A 1S72P 2QG4A 3UIAA 1K05A 1IO4A 4E2ZA 3B5ND 2O4HA 2Q9IA 1VQKP 3PO3S 1S3JA 3PO2I 2IZ4A 3CCQP 3CC2Z 2R3SA 2WSSH 4EDFA 3J80b 1YBKA 3L75G 3GTMI 1LTTC 4DK1A 4AYBA 2ZAEB 1VQLZ 3A2AA 1NTZD 1N73C 4IL6X 2JWDA 4E32A 2VPYA 3CCV1 2GA1A 3L72G 5AVUB 1KZUB 1KC81 2M5AB 3I55Z 4H44D 1RF1A 4DT0A 4N78D 1NWQA 3G6E1 3SWKA 5FLXf 3GLMA 1L0ND 1K8A2 1PIXA 3RK2C 4ASWA 4NB8A 2E9HA 2WT7A 3V5BA 1VQOZ 2KZJA 2AEMA 1OW7A 1TWHI 3H0GI 1EZVG 4A7PA 1VQ71 1SFCC 3Q1MA 4NBAA 3S15I 1FDIA 2IX7C 2ZXEB 4HH2A 1YITZ 3GHGC 2A45I 3RGUA 1YHQZ 1K731 5AVSB 3I4NI 3HD7C 4C7NA 3D2LA 3VMGA 4OGQC 2KP8A 1R5SA 4U3FJ 3V4WA 3BCCE 3V2QA 2O3JA 3G71Z 1HGZA 2ZT9C 2E5YA 3L70G 1K83I 1P9NA 2F4MA 3TGUJ 3H1LG 3L71J 2KS1B 4GDOA 3CCEP 1KQSZ 4W7YA 1PPJE 2RH0A 1NU1J 1JJ2Z 3EQ2A 1ZH1A 3GTLI 4AUWA 3AE7C 1TWAI 3O6QA 1BSHA 4AYCA 2V8KA 4DOJA 3HUSC 1J1EC 4DJGA 1Y8AA 1NU1K 2VPWA 2L5GB 1NJIQ 5GTIH 4WB4A 1BGYG 2H89C 5KLVE 1VQ9P 2E76C 1L0LG 1FZCB 5APVA 1X22A 1K9MQ 4OVNF 2JNYA 3E1RA 1GD2E 1KFNA 3V2RA 4C7NB 4YPCA 3H1KJ 3G3ZA 3A5TA 1Y1VS 3G4SZ 2GTIA 1YJ91 3V2PA 3L35A 3VB9A 5FLMI 3M9BA 4RV9A 3CX5E 2XKMA 4Z1MH 1M1K1 2WWWA 3EEDA 1WW9A 2CK3H 3CCJP 1RQUA 1Z01A 2YKQA 4Y99B 3RZDI 4XFJA 2O1JA 2PAJA 3PTZA 1W2BO 2IFMA 3B4SA 3LW5J 3CCUZ 3VMYA 1D7MA 2BASA 3H1HG 3B8EB 1N73A 5T6BA 4PJ0H 2ITAA 4RJTA 1RLYA 5L8RJ 2QM8A 3TGUE 1JNMA 1SQPG 1Z03A 2R44A 1NU1E 3MZWB 1A02J 1SFOI 2Q6QA 1FAVA 2ZYAA 2AXTH 1KILC 5AVXB 2R7ZI 3AE9C 5CJ4A 3CCSZ 5APWA 1E5WA 1T2KC 1VPCA 3L75J 2OTLZ 2QA4P 3WUUA 3VMIA 1AV1A 1Y1WI 1UIXA 4NPFX 3L72J 4E2WA 1OVRA 1N73B 4BXXI 3CCMP 3BG1B 1ZR2A 4ZNCA 3I07A 3KQGA 4NBGA 3CCRZ 3TF5A 1GMJA 4N3YB 1SQXE 3GTOI 3BCCD 1UIIA 5B5EH 2M0BA 5AW3B 1VQKZ 1USEA 3A3YB 2QSIA 1KQLA 1GU5A 4IOIH 4MH4A 1VQ61 1S9KE 1KMIZ 4WWIA 1ZV8A 5DJTB 1M1JC 2NPSC 3CLQA 2NZ2A 1L4AD 3PP5A 3BASA 3RK2B 2IBZE 1KQFB 1NKZB 3FQMA 2BEZF 2OQQA 1YJN1 4LLHA 3H1IG 3N7NA 5D1PA 2P1JA 5KLVD 4JYBA 3L74J 1SFCB 4KT0J 3P32A 3RK3C 2KXPB 2K37A 4HGZA 2WMMA 2C0WA 2E74C 1PZQA 2P10A 2ZXXA 2QRDB 1YJW1 3L70J 1VQPZ 3GTJI 2LKMA 3H1LJ 1WJ2A 1FZBA 1S721 4ZKPA 4TT3H 2E2HI 2W6JH 3GCFA 4N6JA 2ZT9B 2R92I 1N2FA 1NKNA 4EI2A 5BU5A 3SFDC 2Q7CA 3CCQ1 2OYHC 1YI21 2K88A 2IBZI 4U3FD 4MRIA 1S2EA 2Y0DA 1LTSC 1RO4A 1J1EB 1GW4A 3TGUD 3L71D 2A06G 2E76B 5AW4B
chains in the Genus database with same CATH topology
4A3GI 4A3MI 4BBSI 2RBLA 1NJI1 2QKDA 4NFRA 2M48A 3J81f 5C4XI 3G4S1 3CCEZ 2Q51A 4A3FI 1X0TA 3NDIA 1H0TB 3FQQA 2BJOA 4A93I 4MN4C 3PH0A 4DQYB 1OVVA 3MZLB 1WCMI 2LIYA 3MHVA 4BY1I 3S1QI 4EWCA 1VQ4Z 1VQ8Z 2KIKA 1ML8A 1BDDA 3GTGI 2R6MA 3I4MI 2B87A 5DJUB 5A2Qb 5EFWB 4RS4A 4BY7I 4JBZA 3CCL1 1VQ9Z 4RVGA 3CCU1 3S1KA 3PO3I 3LUSA 2HR3A 3IX0A 2R93I 1KQSY 2V8JA 4ASVA 3M3YI 4GOEA 1K9M2 1YJ9Z 1LQLA 1EDLA 1LP1A 5T67A 3OW2Y 3CME1 1USPB 2JS4A 2JMOA 3VMHA 2VUMI 1DL6A 3HOXI 3QWOC 3EERA 2JA5I 2JR6A 1ZB8A 1Q812 2RIQA 2JA8I 4CPGA 5C44I 4A3EI 3GTPI 5C3EI 3F3PC 3CCS1 3NH4A 3JAMb 1NP6A 3FXEA 3I561 3CCJZ 1QVFY 4MXUA 2E2JI 2KUBA 3GTKI 3OW2Z 4K3AA 4MD9A 1VQN1 4HGYA 5A2Qf 2OTL1 2K5RA 2M5AA 3S2HI 2QR1B 1S7MA 2F4OA 2YU9I 1U7JA 3MZKB 2DE7A 4KJMA 4BXLA 1VLAA 4S1TA 3NDJA 1YIJ1 3VTNA 3S1MI 3BG0B 4E2ZA 2O4HA 4MONA 1U7MA 3PO3S 3CCR1 1S3JA 4X6AI 3ESWA 2DE6A 4NPEA 3PO2I 2O53A 1VQM1 2IZ4A 1LP1B 2RHBA 3CC2Z 2AKLA 2I8DA 3CXCZ 1VQK1 4A3DI 5CM2M 2OOXB 3J80b 3KIFA 3GTMI 2DE5A 4DK1A 3QWUA 4AYBA 4A3II 2ZAEB 4QTTA 2HF1A 1VQLZ 4DGLA 3JAMf 2H85A 3NH8A 1W2BY 3NFZA 2JWDA 1TWCI 4E32A 4NBFA 2LXCB 3CMAZ 3CCV1 5IP9I 2OTJZ 2JA6I 2QA4Z 4NBEA 1RO0A 4QTUA 2QRCB 1KC81 2M5AB 3I55Z 4MD7A 4TNUA 2J6AA 3CCMZ 4E31A 2Q1KA 1QVGY 5CBOA 3G6E1 2QREB 1W2BZ 5FLXf 1QYPA 1VQ6Z 1K8A2 4RVDA 3CD61 2JA7I 4CL1A 1M1K2 4ASWA 4NPDA 4EYYQ 2G2KA 2GTHA 1K9M1 4NB8A 2E9HA 2OOYB 1VQOZ 2KZJA 1VQP1 3J80f 1TWHI 2PM9A 2QRXA 3CC71 1OVUA 1NUIA 4NB9A 1KC82 3H0GI 1Q811 1VQ71 4NBAA 1TFIA 1YJNZ 3S15I 3GTMS 1YITZ 2Y0SA 1Z02A 3RGUA 1YHQZ 1BDCA 1M902 2NVXI 1K731 4HJGH 1JJ2Y 3I4NI 3CC4Z 3VMGA 1Y1VI 2KPIA 2QEX1 1YJWZ 1TWGI 3G71Z 4MD8A 5AN9F 1K83I 3H3VJ 2W04A 1P9NA 3NH5A 4BBRI 1S72Z 2F4MA 1KRLA 2EGTA 2Q4ZA 2KS1B 1KQSZ 2LXBA 4GODA 1JJ2Z 1ZH1A 3GTLI 2VUGA 4A3CI 2B63I 5C4JI 1TWAI 2KI7B 1K732 4RVFA 3CCQZ 3CCE1 4NBCA 1YI2Z 4ZMDA 2V8KA 2B87B 3S14I 3P5JB 2NVTI 3HKZA 3T4NB 2W03A 2OTKE 1VQ41 1VQ81 1X3WA 4Y7NI 1VQ5Z 1QVFZ 1YUKA 2JNYA 3Q87A 5FLXb 1L1OC 1YUAA 1VQ91 2OZKA 5CBNA 2WB1A 2RKLA 1KD12 2PMZA 2KZIA 1PFTA 3S2DI 1Y1VS 3G4SZ 2GTIA 1YJ91 1ZB9A 3VB9A 5FLMI 1Y47A 4RV9A 1K8A1 2HU9A 1RNIA 1M1K1 3EEDA 1WW9A 3KIHA 2LR2A 1Z01A 3K7AI 3RZDI 5IP7I 2GU2A 3TE5B 2JUBA 5D1OA 3CCLZ 2PK7A 2I3CA 2M6NA 3CCUZ 3CCJ1 1X3ZA 3U50C 4E30A 4K35A 5T6BA 3D9XA 1I50I 4HKZH 1RLYA 1LT1A 1Z03A 1Q2NA 4NBHA 4Y52I 4A3LI 2R44A 1M901 4NH1C 4NBBA 3MZWB 3CMEZ 1Q821 5K5GB 1SFOI 2IZ3A 1Q7Y1 2R7ZI 2SPZA 1JWHC 3S1RI 3GTQI 5T64A 1USPA 1I6HI 2P3YA 1QVGZ 2E2II 3CCSZ 4XX2A 1Q862 2VF1A 3CC21 3I56Z 4E2XA 4A3JI 1VQNZ 4NOZA 2B89A 2OTLZ 3VMIA 1VQL1 1FC2C 2K3RA 1Y1WI 4E33A 1Q822 1ZW0A 1QF8A 5D1OB 4NPFX 3IFUA 1JM0A 3FXDA 1Q7Y2 4E2WA 3CMA1 1YIJZ 3S17I 1OVRA 2OTJ1 2QA41 4BXXI 3BG1B 4ZNCA 3I07A 4NBGA 3CCRZ 1DEEG 3J7A4 5IT9f 1VQMZ 3I551 1NJI2 3GTOI 3CCM1 1NVOA 2M0BA 1I3QI 1VQKZ 1RQFA 2LFUA 2RPRA 1KD11 3HOVI 3CQZI 4MH4A 4IOIH 1VQ61 1N8R1 1JMBA 2WAQA 4WWIA 3M4OI 5DJTB 1RO2A 1VQO1 3CCVZ 2RT9A 3IF8A 3FQMA 1EDJA 2NVYI 3HOYI 1YJN1 4GOFA 1EDIA 2P28A 3FKII 5D1PA 3HOUI 1YIT1 4A3BI 3CPWY 3G6EZ 1YHQ1 1R9TI 4HGZA 1N8R2 2WMMA 1ZXGA 3MONA 3CXCY 5LL6f 4E2YA 2QRDB 3CC41 3CD6Z 1YJW1 3G711 1VQPZ 1MFTA 2UWJE 3GTJI 1WIIA 2NVQI 1EDKA 2B88A 3J81b 1S721 3ZDMA 3CC7Z 3CPWZ 1H0TA 2E2HI 2YADA 5C39A 3GCFA 2R92I 1N2FA 3F3FC 1VQ7Z 4NBDA 3GKQA 4HB1A 3TDHB 1SS1A 1Q861 3CCQ1 2QVAA 1YI21 3S1NI 4HH4A 1EC5A 4MRIA 4RVHA 2P58A 3S16I 2QLVB 1TWFI 2V8IA 3RZOI 2QEXZ 4A3KI 5IT9b 3D6WA 3HOWI 1RO4A 3HOZI 1VQ51
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B87 B;  4ZNC A;  1DEE G;  2ZAE B;  2OTK E;  1X0T A;  1NVO A;  2M0B A;  2JWD A;  1H0T B;  2LXC B;  4MN4 C;  3PH0 A;  1OVV A;  5CBN A;  2RKL A;  3MHV A;  4IOI H;  1JMB A;  2KZI A;  2KIK A;  2M5A B;  4WWI A;  1BDD A;  5DJT B;  2B87 A;  5DJU B;  5EFW B;  2Q1K A;  5CBO A;  4JBZ A;  1Y47 A;  3S1K A;  1EDJ A;  2HR3 A;  4ASV A;  4ASW A;  4GOF A;  4NPD A;  4EYY Q;  2LR2 A;  1EDI A;  4GOE A;  2KZJ A;  1EDL A;  1LP1 A;  2QRX A;  1OVU A;  2WMM A;  1ZXG A;  3QWO C;  4K35 A;  4HKZ H;  1LT1 A;  4CPG A;  1Q2N A;  1MFT A;  2UWJ E;  2R44 A;  1EDK A;  2B88 A;  3RGU A;  1BDC A;  3MZW B;  4HJG H;  3ZDM A;  5K5G B;  3FXE A;  1H0T A;  5C39 A;  2KUB A;  4K3A A;  2SPZ A;  4HB1 A;  2M5A A;  1SS1 A;  1U7J A;  4KJM A;  2QVA A;  4BXL A;  2KS1 B;  2LXB A;  4GOD A;  1EC5 A;  2P58 A;  1U7M A;  1S3J A;  2B89 A;  4NPE A;  2KI7 B;  1FC2 C;  2K3R A;  1ZW0 A;  4NPF X;  1LP1 B;  1JM0 A;  3FXD A;  4ZMD A;  2I8D A;  1OVR A; 
#chains in the Genus database with same CATH topology
 1NU1 D;  4A3M I;  2WPQ A;  1MUU A;  3LW5 H;  1USD A;  1JY3 O;  1NJI 1;  2M48 A;  5C4X I;  3CCE Z;  2AEF A;  1X0T A;  2IV2 X;  2V4H A;  3P8C E;  1KIL A;  3U1C A;  2BJO A;  4A93 I;  2KNC A;  2I1K A;  4B86 A;  3JCU E;  3E7K A;  3L74 E;  4EWC A;  3V2N A;  5H2F E;  1BDD A;  3GTG I;  2R6M A;  3VP8 A;  3U1A A;  1M57 D;  3HE5 A;  1GW3 A;  1SQQ G;  2HOD A;  1FS0 E;  3CCL 1;  2FYU G;  4PD4 E;  3H1H J;  3D6Z A;  1VQ9 Z;  3S1K A;  3MIW A;  3LUS A;  3H1K D;  2R93 I;  2WZ7 A;  1KQS Y;  3CME P;  1CI6 B;  1SQP J;  3EFF K;  2FXP A;  1M7L A;  1P84 E;  2HG5 D;  4GKG A;  2OAR A;  1LQL A;  1VL2 A;  4O9B A;  3NMD A;  1LP1 A;  1H88 A;  2YO3 A;  2JMO A;  1SQP K;  1FZG A;  3BRV B;  3KZI E;  4LC1 A;  1EZV I;  1IFM A;  4IL6 E;  2E75 D;  3H1J E;  4H13 C;  3M9Q A;  1OIP A;  5C3E I;  1VQN P;  1KIL B;  2ZYG A;  1YHQ P;  3PHL A;  2KNC B;  2NRG A;  3I56 1;  3CCJ Z;  4MXU A;  2KUB A;  3GTK I;  3OW2 Z;  1FZA A;  4MD9 A;  2IBZ D;  2IZ0 A;  1YIJ P;  2K5R A;  3RL0 g;  1N86 A;  1GU4 A;  3S2H I;  3GG2 A;  3B5N A;  2W90 A;  2HOD B;  2DE7 A;  5APT A;  1VLA A;  2IYO A;  1VQM P;  3VTN A;  1NYH A;  2E43 A;  1U7M A;  5KTB A;  2HPC A;  1P84 I;  3ESW A;  1LJ2 A;  4TLF A;  5APY A;  1LP1 B;  1ZOY C;  1HF9 A;  3L75 D;  1NTZ E;  2ZVO B;  4A3D I;  3CXC Z;  3IAO A;  5CM2 M;  4PV1 D;  3GW6 A;  3KIF A;  2DE5 A;  2Y9Y A;  4A3I I;  4QTT A;  2HF1 A;  4L73 A;  3JAM f;  3L72 D;  1OX3 A;  1RF1 C;  1W2B Y;  2K1A A;  5AVT B;  2OTJ Z;  1N8R Q;  2JA6 I;  4N78 E;  2QA4 Z;  5AVZ B;  2NPS B;  1HVV A;  1VF5 D;  2PFX A;  1YTZ T;  3H1I J;  2JR8 A;  1L0N E;  3G4S P;  3CCM Z;  4UB8 H;  1SQV G;  2AEJ A;  2D2C D;  2YIU C;  4L75 A;  1NTK G;  1RY3 A;  1K04 A;  3RK3 B;  3CC7 P;  3CD6 1;  1M1K 2;  3C9I A;  4NPD A;  1JY2 N;  4EYY Q;  1DX7 A;  3V6I A;  1EZV D;  2PM9 A;  1FZE A;  1PGO A;  1A02 F;  2QRX A;  1ZRT D;  3N4X A;  3GTM S;  5AW6 B;  3L74 D;  4YXD C;  2Y0S A;  2QEX P;  1Z02 A;  1NTM E;  3AEC C;  1BDC A;  4HJG H;  2WSF J;  1SVF A;  2OYH B;  1G2C A;  2KPI A;  3L70 D;  1TWG I;  3U59 A;  2G3A A;  3SSU A;  1N7S D;  3H1L D;  4Y99 C;  3H3V J;  3CCS P;  2W04 A;  1IFD A;  1KRL A;  2EGT A;  2Q4Z A;  1AA6 A;  1DD3 A;  3RL0 D;  1M8O B;  1BE3 G;  4GOD A;  1NAF A;  2DW3 A;  4A3C I;  2B63 I;  2ZJS E;  4WBA A;  3PRJ A;  3H1J D;  1VQ8 P;  2ZYD A;  3V4Q A;  3S14 I;  4JYC A;  3HKZ A;  1HGV A;  2W03 A;  3VTP C;  1VQ4 1;  2J58 A;  2W8Z A;  3A0H E;  1SQQ J;  5KLI C;  2FYU J;  2KSJ A;  1QVF Z;  1YUK A;  3HE4 A;  1QLE D;  1SP4 A;  2OZK A;  4LGD E;  2KZI A;  1Q81 Q;  1SQQ K;  2FYU K;  3L37 A;  1ZP0 C;  2N9B A;  1ZB9 A;  5AW9 B;  3L73 G;  1JY2 P;  4H0L D;  2HU9 A;  3EWK A;  3HTK A;  2LR2 A;  2OYI C;  3K7A I;  1HUC A;  2JUB A;  3H1H D;  2FXM A;  2I3C A;  2M6N A;  1QEX A;  4H13 B;  5GTI E;  1X3Z A;  1SQP D;  4K35 A;  1G1J A;  3T97 A;  1PFI A;  3D9X A;  4HKZ H;  3VMX A;  1NH4 A;  3F89 A;  2YKO A;  1Q2N A;  4NBH A;  1VQP P;  3NFQ A;  3W67 A;  3MUD A;  5KAI H;  1M90 1;  4NBB A;  1URQ D;  1QVG O;  3CME Z;  5K5G B;  3BVH A;  2G8Y A;  2R5D A;  1PP9 E;  5AVQ B;  1JWH C;  3GTQ I;  5T64 A;  1I6H I;  2JKV A;  1QVG Z;  2E2I I;  2YO2 A;  3CC2 1;  3M0D C;  3D6Y A;  4GIF A;  2W6B A;  1X79 B;  3HTK B;  1VQN Z;  3CMA P;  3A0H H;  3Q5P A;  1FBM A;  1VQL 1;  1Q82 2;  1T3J A;  1QF8 A;  3IFU A;  1E79 H;  1KQS O;  1S1C X;  2W6A A;  1Q7Y 2;  1YIJ Z;  1KB9 E;  1NTM D;  2FXO A;  4PJ0 E;  1RF1 B;  1XTG B;  1VQM Z;  2BCC J;  3I55 1;  1NJI 2;  1SQV J;  5CCG D;  1NVO A;  1NTK J;  2WT7 B;  2AXT E;  1L4A A;  1N8R 1;  2WSF H;  1SQV K;  2M3E A;  3O8Z A;  2YIU B;  3M4O I;  1RO2 A;  1OW8 A;  2B9B A;  3A0B H;  3VOP A;  3KYQ A;  1VQO 1;  1AJY A;  1NTK K;  3P8M C;  2QIW A;  3H1I D;  2NVY I;  4XA4 A;  2Y0C A;  3HOY I;  4GOF A;  2JIR A;  1EDI A;  2P28 A;  3FKI I;  3CC4 P;  1YIT 1;  1SQB G;  4A3B I;  2IFN A;  1KB9 I;  3OAK A;  5KJ7 D;  1YHQ 1;  1SLQ A;  3MON A;  3CXC Y;  2QE7 H;  1GZL A;  2XDJ A;  4RKU J;  2XV5 A;  3I5C A;  5B5E E;  3G71 1;  1WII A;  1ZN5 A;  3J81 b;  3CC7 Z;  3CPW Z;  1H0T A;  3O6Q B;  2JIO A;  2OYO A;  4NBD A;  4U3F E;  1RE4 A;  4HB1 A;  4R4M A;  3R2P A;  3WU2 E;  1KB9 H;  1VDF A;  3TSI A;  2BCC E;  3S1N I;  5CCH D;  3L71 E;  2OYI A;  1OXZ A;  1VQ5 P;  4RVH A;  1JMM A;  2QLV B;  1KN7 A;  2QEX Z;  3GF3 A;  4A3K I;  2A06 D;  2JP3 A;  1WT6 A;  5GTH H;  2O01 J;  1T8Z A;  5AW0 B;  1LTG C;  5KKZ C;  5KLI B;  1HWT C;  1GL2 D;  1OWA A;  2R32 A;  4NFR A;  4BRY A;  3G4S 1;  1PP9 D;  1R8E A;  2V45 A;  1DEB A;  3NTN A;  1S5L H;  4A3F I;  1JCD A;  1H0T B;  1MV8 A;  3FQQ A;  3KXD A;  2OTJ P;  1OW6 A;  3M91 A;  3PH0 A;  4DQY B;  2LIY A;  4WVZ A;  3S1Q I;  1OMI A;  1VQ8 Z;  2KIK A;  2JO1 A;  1SQQ D;  3H1K E;  3M0D A;  2FYU D;  1IFI A;  3I4M I;  2B87 A;  4D6T G;  5A2Q b;  2PP6 A;  1FZF A;  3RL0 C;  2OYI B;  3CCU 1;  3A7O A;  3IX0 A;  1KB9 D;  1W2E A;  3RBZ A;  3FWL A;  4AQR D;  1EDL A;  5T67 A;  1JY2 O;  2JS4 A;  1DL6 A;  3HOX I;  3QWO C;  3EER A;  2JA5 I;  3TNU A;  2FKW B;  1BCC G;  1ZB8 A;  4BRY B;  3WU2 H;  2JA8 I;  4CPG A;  5C44 I;  4A3E I;  4WY4 D;  3B5N C;  2E5T A;  1Q16 A;  3CCS 1;  3NH4 A;  1HTL C;  1QVF Y;  4I1L A;  3CWB G;  1KYO I;  2JWA A;  2JDI H;  4HGY A;  2OTL 1;  3KPE A;  5AW8 B;  1S7M A;  2QJY C;  4BXL A;  2Q3I A;  1X9V A;  4S1T A;  3NDJ A;  1AA0 A;  3L75 E;  3BG0 B;  2AXC A;  5E79 E;  3CCR 1;  1LT9 A;  1LTI C;  2WPV B;  4NPE A;  1FDO A;  1YQ4 C;  2RHB A;  2E75 B;  3L72 E;  2I8D A;  1VQK 1;  4H44 C;  1KYO H;  3CCV P;  2O01 N;  2H85 A;  1BGY J;  1KD1 Q;  4ZKU A;  1L0L J;  2P2U A;  4U7J A;  1TWC I;  3CMA Z;  2LXC B;  1S5L X;  3CXH H;  2GM4 A;  1WRG A;  3CI9 A;  4XE5 B;  2JIP A;  2QRC B;  4GT1 A;  3G6E P;  2BCC D;  3H25 A;  2N1T D;  1KQG B;  1SQB J;  4TNU A;  2J6A A;  1L0L K;  5APU A;  1DIP A;  3H6P A;  2Q1K A;  1NTK D;  1QVG Y;  5CBO A;  4RO0 A;  2QRE B;  2A45 G;  1QYP A;  1EZV E;  2IPP A;  1LT9 B;  1SQB K;  1LWU A;  4RVD A;  4CL1 A;  2G2K A;  2GTH A;  1K9M 1;  1ZRT E;  1VQP 1;  2HLO A;  3J80 f;  2BEQ D;  1OVU A;  2O01 H;  1N7L A;  1NUI A;  4NB9 A;  3WUV A;  1KC8 2;  4BWN A;  3Q5R A;  2NAP A;  1VF5 B;  3L70 E;  2OGU A;  1KYO D;  1M90 2;  3QH9 A;  3H1L E;  3RK2 D;  5E79 H;  1JJ2 Y;  1N7S A;  3AE3 C;  3CC4 Z;  3II6 A;  1AVY A;  1Q86 Q;  4KHX A;  4UB8 E;  1SFC D;  3M06 A;  3OW2 O;  3B71 A;  1LWU B;  1FE6 A;  1BGY E;  1KTM A;  1L0L E;  1Q90 D;  3BCC G;  2KI7 B;  1K73 2;  3HD7 D;  3VMZ A;  3CCE 1;  5KKZ B;  4NBC A;  1NO4 A;  4OGQ D;  3AE2 C;  1TU3 F;  4RES B;  1JOC A;  1PPJ G;  3P5J B;  3HE5 B;  1LTJ A;  3T4N B;  4D6T J;  1X3W A;  2RN0 A;  5TIS H;  1VQ5 Z;  1L1O C;  1N7S B;  4IFM A;  1VQ9 1;  5CBN A;  2RKL A;  1YJ9 P;  5AW5 B;  5CHX A;  3S9O A;  3RL0 B;  5KLV G;  3D70 A;  1KOR A;  1NHL A;  5AW7 B;  1NGM B;  2E76 D;  1M56 D;  5CCH C;  2ZVN B;  1Y47 A;  3H1H E;  3C1L A;  1BCC J;  5AVR B;  4IFF A;  1T6A A;  1RNI A;  2YXR B;  1SQP E;  2MJZ A;  3P7K A;  2JJL A;  1AVO A;  3MUD C;  2WVR A;  2QJK C;  3TE5 B;  5D1O A;  1AFO A;  3CWB J;  2WPS A;  3CCJ 1;  2YMY A;  3B5N B;  1DD4 A;  1Y8C A;  1LTJ B;  3AEG C;  1URQ A;  1I50 I;  1LT1 A;  4A3L I;  2HPC B;  4NH1 C;  1QX8 A;  2QJY B;  2W83 C;  1QL1 A;  2AYD A;  5B66 E;  2SPZ A;  3S1R I;  3TGU G;  1USP A;  4H0L B;  1R5L A;  1NU1 G;  2XNX A;  4E2X A;  3AED C;  3KHU A;  4NOZ A;  2PGD A;  4H44 B;  1OZH A;  3SWF A;  2WSC J;  3HRN A;  3KDP B;  1FC2 C;  2K3R A;  4E33 A;  5D1O B;  1JM0 A;  3AE8 C;  3FXD A;  3IFM A;  3S17 I;  2OTJ 1;  2QA4 1;  1L4A C;  3J7A 4;  2Y9Z A;  3L36 A;  1T2K D;  3TDK A;  1M1K Q;  5KAI E;  1VQ6 P;  3CCM 1;  4EIJ A;  1RQF A;  2RPR A;  1KD1 1;  3AE5 C;  3HOV I;  3CQZ I;  2E42 A;  1JMB A;  2WAQ A;  3H1I E;  1MZ9 A;  1BGY D;  1SQX G;  1QVF O;  1L0L D;  2Z5I A;  3CCV Z;  2KSE A;  3PJS K;  5KJ7 A;  3ITK A;  3AE4 C;  3HOU I;  5AW1 B;  1G2C B;  4I2L C;  1YJW P;  3G6E Z;  1IK9 A;  1GK4 A;  2FY8 A;  1AQT A;  2KB7 P;  1ZXG A;  2R3C A;  2IBZ G;  2NPS D;  5B66 H;  1YQ3 C;  1RE4 C;  1RF0 A;  1JUN A;  1MFT A;  2P7J A;  3TYY A;  2C0X A;  1J1D B;  2WQY C;  2B88 A;  4UB6 H;  3ZDM A;  2YAD A;  2L91 A;  5C39 A;  1YI2 P;  2J59 M;  3F3F C;  1VQ7 Z;  1JY3 N;  1BSN A;  1PGJ A;  2N1T C;  3BCC J;  3RK3 D;  3GKQ A;  2YKP A;  2PRR A;  3A0B E;  2E74 D;  3TDH B;  1SS1 A;  5CCH A;  2E7Z A;  1Q86 1;  2A06 E;  4Y28 J;  5APQ A;  1TWF I;  3M0A A;  3RZO I;  3HE4 B;  5IT9 b;  1FJP A;  3D6W A;  3HOZ I;  1RE3 A;  1MFZ A;  1GL2 A;  3OA7 A;  1FOS F;  1Y9B A;  1DH3 A;  5KLV J;  4BBS I;  2RBL A;  5AVW B;  1LGH B;  2KS1 A;  5APX A;  1U57 A;  2Q51 A;  1SQQ E;  3BAT A;  1JEK A;  1WMK A;  2FYU E;  2Q3E A;  4MN4 C;  1OVV A;  1ZR4 A;  3MZL B;  5KLV K;  1WCM I;  1HBW A;  4D6T D;  3CCL P;  3E1I A;  5DJU B;  3T97 B;  1YYC A;  2IZ1 A;  5EFW B;  1K8A Q;  4EOT A;  2E75 C;  1RH5 B;  1FZC A;  3PO3 I;  2QJK B;  2LEX A;  4W80 A;  3L74 G;  2QJP C;  2KLU A;  2K9J A;  5GTH E;  1QGK B;  1K9M 2;  1YJ9 Z;  1GL2 B;  2WSC H;  3NXS A;  3OW2 Y;  1BCC D;  3CME 1;  2WSE J;  2M8R A;  2YXQ B;  2VUM I;  4WY4 A;  3RBX A;  3I56 P;  5BU8 B;  4HYT B;  1PV3 A;  1WZN A;  2RIQ A;  1Q82 Q;  1S5L E;  3GTP I;  3F3P C;  1IFP A;  3CWB D;  1KFM A;  2FBW C;  3JAM b;  1Q7Y Q;  1JY3 P;  4OH8 B;  1NP6 A;  2A45 H;  3C8V A;  2E2J I;  2FYN C;  1LT9 C;  1VQN 1;  4PV1 C;  3H1J G;  2QR1 B;  2YU9 I;  3MZK B;  3CPW O;  3G9R A;  1OFC X;  1PGQ A;  1YIJ 1;  3S1M I;  4H13 D;  1IC2 A;  4JF7 A;  4MON A;  4X6A I;  2K9J B;  2DE6 A;  2Y0E A;  1BE3 J;  2O53 A;  1VQM 1;  5BVZ A;  1VF5 C;  1L4A B;  3FGA D;  2QM7 A;  2AKL A;  4QMA A;  4WY4 B;  2OOX B;  1IFJ A;  3IR7 A;  2D2C C;  3QWU A;  1SQX J;  4DGL A;  1SQV E;  2H88 C;  3NH8 A;  3NFZ A;  4NBF A;  2N1T A;  1NTZ G;  5IP9 I;  1S4X A;  1NTK E;  4NBE A;  1SQX K;  1RO0 A;  4QTU A;  1HJB A;  1LWU C;  3AEE C;  2VPX A;  3H32 A;  2IDB A;  4MD7 A;  1T3U A;  4R4L A;  2J5U A;  3CD6 P;  4E31 A;  3PLN A;  1W2B Z;  1SIW A;  2V7Q J;  2VRS A;  1VQ6 Z;  4L74 A;  2JA7 I;  1LNQ A;  3L73 J;  1JCC A;  3BRT B;  4OWF A;  1L0N G;  2OOY B;  4DCK A;  2GUV A;  3GMA A;  1H8A A;  1CSB A;  1IK7 A;  1KYO E;  3CC7 1;  1N7S C;  1Q81 1;  3AE6 C;  1TFI A;  3CX5 I;  1YJN Z;  2N1T B;  2NVX I;  1W5C E;  3CXH E;  1CW5 A;  1YTZ I;  1BE3 E;  3VYI A;  1Y1V I;  3H32 B;  1SFC A;  2QEX 1;  1YJW Z;  1H89 A;  4MD8 A;  3D71 A;  5AN9 F;  3GHG A;  3NH5 A;  4BBR I;  1S72 Z;  1J2J B;  2YNY A;  1NTM G;  3Q2Y A;  2FYZ A;  1EQ7 A;  3HD7 A;  2FFD C;  2LXB A;  2H43 A;  1LTJ C;  3CX5 H;  2VUG A;  1NOH A;  3MTU E;  2N9Y B;  5C4J I;  4RVF A;  1FJK A;  3CCQ Z;  1YI2 Z;  1VQ4 P;  1PPJ D;  4ZMD A;  3OJA B;  2B87 B;  1ZME C;  2NVT I;  2WSE H;  3Q5S A;  2OTK E;  1VQ8 1;  1RQV A;  3JSV C;  4Y7N I;  3CXH I;  3W68 A;  4H0L C;  2H8P D;  3VMA A;  4C46 A;  3TK1 A;  3Q87 A;  5FLX b;  3JC2 2;  4DZO A;  3HUS A;  3L73 E;  1YUA A;  2XU6 A;  2WB1 A;  5AVY B;  3EFG A;  1KD1 2;  2PMZ A;  1JB0 J;  1PFT A;  1GDT A;  3S2D I;  2P67 A;  3Q3D A;  3GHG B;  2KLV A;  4I7Z C;  3TNU B;  3MP7 B;  3VP9 A;  1IFN A;  2QJP B;  3HD7 B;  5CMZ A;  3K5B A;  1K8A 1;  4OGQ B;  1LTA C;  5M1B A;  2MKV A;  1URQ C;  3KIH A;  3AEB C;  5IP7 I;  2GU2 A;  3CX5 D;  3CCL Z;  1SQV D;  2PK7 A;  2KYV A;  2VPZ A;  3U50 C;  3WMM 0;  4E30 A;  3AEF C;  4W7Z A;  1GK6 A;  3H1J J;  5KAF E;  5TIS E;  1QL2 A;  4Y52 I;  2JIQ A;  2XND H;  2H7H A;  2FYN B;  2IYP A;  3HUS B;  3IF4 A;  3FX0 A;  1Q82 1;  1CI6 A;  1X8Y A;  4PV1 B;  1NAY A;  2IZ3 A;  2W27 A;  5TJH A;  3F5H A;  1Q7Y 1;  1VQ7 P;  3CC2 P;  1FDM A;  2P3Y A;  2XZR A;  2HFE D;  4XX2 A;  1Q86 2;  2VF1 A;  1VQL P;  3I56 Z;  3MD0 A;  3SWY A;  1KIL E;  2M3B A;  5CCG C;  1JTH A;  2Q5U A;  4A3J I;  1G1I A;  2O1K A;  1PP9 G;  2B89 A;  2V7Q H;  3WUT A;  2JIM A;  1ZW0 A;  2WTY A;  2I1J A;  1NTZ J;  2D2C B;  1J1D C;  3I55 P;  3IR9 A;  1RHZ B;  3CMA 1;  3CXH D;  3AE1 C;  2WIT A;  1DEE G;  1BE3 D;  5IT9 f;  1NTZ K;  2Z4E A;  2KOG A;  2ZFC A;  2KK7 A;  1I3Q I;  1QXF A;  4YXW H;  3R4Y A;  2LFU A;  1FOS E;  1VQO P;  1KC8 Q;  1SQX D;  5KJ7 C;  1L0N J;  1CZQ A;  4YTP C;  1SQB E;  3VN0 A;  1PL5 A;  2ZT9 D;  2FFD A;  1Z56 A;  1M90 Q;  2RT9 A;  1XTC C;  1GTW A;  1YIT P;  3IF8 A;  1JTH B;  1S9K D;  1L0N K;  5KAF H;  1EDJ A;  4JQ0 D;  2YMK A;  1RF0 C;  1IJD B;  1M1J A;  3IN6 A;  3M9H A;  2NPS A;  1KV4 A;  3CPW Y;  5APS A;  1IZN B;  3G71 P;  1R9T I;  1N8R 2;  2Z5H A;  2CPS A;  5LL6 f;  1LTB C;  4PD4 I;  4E2Y A;  3CC4 1;  3L73 D;  3CD6 Z;  3USS A;  1K73 Q;  3SFE C;  3RK3 E;  2UWJ E;  1NTM J;  2NVQ I;  1EDK A;  1EXJ A;  2HYN A;  3MGN A;  2C9N Y;  1MKM A;  3FWN A;  1L2P A;  3JCU H;  1EXI A;  1NTM K;  5H2F H;  2FFD B;  1RE3 C;  2QVA A;  1GL2 C;  2RMZ A;  4HH4 A;  3LIE A;  4PD4 H;  1EC5 A;  3S16 I;  2P58 A;  2V8I A;  3HOW I;  1M1J B;  4U3F G;  4M3L A;  1P84 H;  2OYH A;  1HH0 A;  1VQ5 1;  2BCC G;  4A3G I;  3L71 G;  4JPZ B;  3KZI H;  3ABV C;  2QKD A;  3J81 f;  4IL6 H;  4L76 A;  4D6T E;  4UB6 E;  1AQ5 A;  1JO5 A;  3NDI A;  1ZLL A;  2E74 B;  2C9L Y;  2JEE A;  1FZC C;  3MHV A;  4I7Z B;  2GUS A;  4BY1 I;  5AW2 B;  2CPB A;  1VQ4 Z;  1KIL D;  3CCU P;  1ML8 A;  5CJ0 A;  4IFD K;  3P8C D;  1FU1 A;  5CCG A;  1URQ B;  4RS4 A;  4BY7 I;  2WPR A;  4JBZ A;  4RVG A;  4WY4 C;  3CL3 D;  2HR3 A;  1BCC E;  2R5B A;  2V8J A;  4ASV A;  4I6M C;  3M3Y I;  3H1K G;  3AEA C;  4GOE A;  4PD4 D;  3LID A;  2POH A;  1USP B;  3CWB E;  3VMH A;  3L4F A;  1P84 D;  2JR6 A;  3S4R A;  1YJN P;  1Q81 2;  2K9Y A;  2OTL P;  1SQB D;  3FXE A;  2V3V A;  5AVV B;  1N2D C;  1PP9 J;  1PGP A;  4K3A A;  4C7R A;  1HJ0 A;  5A2Q f;  2M5A A;  2F4O A;  1U7J A;  3CCR P;  4KJM A;  3GF7 A;  1S72 P;  2QG4 A;  3UIA A;  1K05 A;  1IO4 A;  4E2Z A;  3B5N D;  2O4H A;  2Q9I A;  1VQK P;  3PO3 S;  1S3J A;  3PO2 I;  2IZ4 A;  3CCQ P;  3CC2 Z;  2R3S A;  2WSS H;  4EDF A;  3J80 b;  1YBK A;  3L75 G;  3GTM I;  1LTT C;  4DK1 A;  4AYB A;  2ZAE B;  1VQL Z;  3A2A A;  1NTZ D;  1N73 C;  4IL6 X;  2JWD A;  4E32 A;  2VPY A;  3CCV 1;  2GA1 A;  3L72 G;  5AVU B;  1KZU B;  1KC8 1;  2M5A B;  3I55 Z;  4H44 D;  1RF1 A;  4DT0 A;  4N78 D;  1NWQ A;  3G6E 1;  3SWK A;  5FLX f;  3GLM A;  1L0N D;  1K8A 2;  1PIX A;  3RK2 C;  4ASW A;  4NB8 A;  2E9H A;  2WT7 A;  3V5B A;  1VQO Z;  2KZJ A;  2AEM A;  1OW7 A;  1TWH I;  3H0G I;  1EZV G;  4A7P A;  1VQ7 1;  1SFC C;  3Q1M A;  4NBA A;  3S15 I;  1FDI A;  2IX7 C;  2ZXE B;  4HH2 A;  1YIT Z;  3GHG C;  2A45 I;  3RGU A;  1YHQ Z;  1K73 1;  5AVS B;  3I4N I;  3HD7 C;  4C7N A;  3D2L A;  3VMG A;  4OGQ C;  2KP8 A;  1R5S A;  4U3F J;  3V4W A;  3BCC E;  3V2Q A;  2O3J A;  3G71 Z;  1HGZ A;  2ZT9 C;  2E5Y A;  3L70 G;  1K83 I;  1P9N A;  2F4M A;  3TGU J;  3H1L G;  3L71 J;  2KS1 B;  4GDO A;  3CCE P;  1KQS Z;  4W7Y A;  1PPJ E;  2RH0 A;  1NU1 J;  1JJ2 Z;  3EQ2 A;  1ZH1 A;  3GTL I;  4AUW A;  3AE7 C;  1TWA I;  3O6Q A;  1BSH A;  4AYC A;  2V8K A;  4DOJ A;  3HUS C;  1J1E C;  4DJG A;  1Y8A A;  1NU1 K;  2VPW A;  2L5G B;  1NJI Q;  5GTI H;  4WB4 A;  1BGY G;  2H89 C;  5KLV E;  1VQ9 P;  2E76 C;  1L0L G;  1FZC B;  5APV A;  1X22 A;  1K9M Q;  4OVN F;  2JNY A;  3E1R A;  1GD2 E;  1KFN A;  3V2R A;  4C7N B;  4YPC A;  3H1K J;  3G3Z A;  3A5T A;  1Y1V S;  3G4S Z;  2GTI A;  1YJ9 1;  3V2P A;  3L35 A;  3VB9 A;  5FLM I;  3M9B A;  4RV9 A;  3CX5 E;  2XKM A;  4Z1M H;  1M1K 1;  2WWW A;  3EED A;  1WW9 A;  2CK3 H;  3CCJ P;  1RQU A;  1Z01 A;  2YKQ A;  4Y99 B;  3RZD I;  4XFJ A;  2O1J A;  2PAJ A;  3PTZ A;  1W2B O;  2IFM A;  3B4S A;  3LW5 J;  3CCU Z;  3VMY A;  1D7M A;  2BAS A;  3H1H G;  3B8E B;  1N73 A;  5T6B A;  4PJ0 H;  2ITA A;  4RJT A;  1RLY A;  5L8R J;  2QM8 A;  3TGU E;  1JNM A;  1SQP G;  1Z03 A;  2R44 A;  1NU1 E;  3MZW B;  1A02 J;  1SFO I;  2Q6Q A;  1FAV A;  2ZYA A;  2AXT H;  1KIL C;  5AVX B;  2R7Z I;  3AE9 C;  5CJ4 A;  3CCS Z;  5APW A;  1E5W A;  1T2K C;  1VPC A;  3L75 J;  2OTL Z;  2QA4 P;  3WUU A;  3VMI A;  1AV1 A;  1Y1W I;  1UIX A;  4NPF X;  3L72 J;  4E2W A;  1OVR A;  1N73 B;  4BXX I;  3CCM P;  3BG1 B;  1ZR2 A;  4ZNC A;  3I07 A;  3KQG A;  4NBG A;  3CCR Z;  3TF5 A;  1GMJ A;  4N3Y B;  1SQX E;  3GTO I;  3BCC D;  1UII A;  5B5E H;  2M0B A;  5AW3 B;  1VQK Z;  1USE A;  3A3Y B;  2QSI A;  1KQL A;  1GU5 A;  4IOI H;  4MH4 A;  1VQ6 1;  1S9K E;  1KMI Z;  4WWI A;  1ZV8 A;  5DJT B;  1M1J C;  2NPS C;  3CLQ A;  2NZ2 A;  1L4A D;  3PP5 A;  3BAS A;  3RK2 B;  2IBZ E;  1KQF B;  1NKZ B;  3FQM A;  2BEZ F;  2OQQ A;  1YJN 1;  4LLH A;  3H1I G;  3N7N A;  5D1P A;  2P1J A;  5KLV D;  4JYB A;  3L74 J;  1SFC B;  4KT0 J;  3P32 A;  3RK3 C;  2KXP B;  2K37 A;  4HGZ A;  2WMM A;  2C0W A;  2E74 C;  1PZQ A;  2P10 A;  2ZXX A;  2QRD B;  1YJW 1;  3L70 J;  1VQP Z;  3GTJ I;  2LKM A;  3H1L J;  1WJ2 A;  1FZB A;  1S72 1;  4ZKP A;  4TT3 H;  2E2H I;  2W6J H;  3GCF A;  4N6J A;  2ZT9 B;  2R92 I;  1N2F A;  1NKN A;  4EI2 A;  5BU5 A;  3SFD C;  2Q7C A;  3CCQ 1;  2OYH C;  1YI2 1;  2K88 A;  2IBZ I;  4U3F D;  4MRI A;  1S2E A;  2Y0D A;  1LTS C;  1RO4 A;  1J1E B;  1GW4 A;  3TGU D;  3L71 D;  2A06 G;  2E76 B;  5AW4 B; 
#chains in the Genus database with same CATH homology
 4A3G I;  4A3M I;  4BBS I;  2RBL A;  1NJI 1;  2QKD A;  4NFR A;  2M48 A;  3J81 f;  5C4X I;  3G4S 1;  3CCE Z;  2Q51 A;  4A3F I;  1X0T A;  3NDI A;  1H0T B;  3FQQ A;  2BJO A;  4A93 I;  4MN4 C;  3PH0 A;  4DQY B;  1OVV A;  3MZL B;  1WCM I;  2LIY A;  3MHV A;  4BY1 I;  3S1Q I;  4EWC A;  1VQ4 Z;  1VQ8 Z;  2KIK A;  1ML8 A;  1BDD A;  3GTG I;  2R6M A;  3I4M I;  2B87 A;  5DJU B;  5A2Q b;  5EFW B;  4RS4 A;  4BY7 I;  4JBZ A;  3CCL 1;  1VQ9 Z;  4RVG A;  3CCU 1;  3S1K A;  3PO3 I;  3LUS A;  2HR3 A;  3IX0 A;  2R93 I;  1KQS Y;  2V8J A;  4ASV A;  3M3Y I;  4GOE A;  1K9M 2;  1YJ9 Z;  1LQL A;  1EDL A;  1LP1 A;  5T67 A;  3OW2 Y;  3CME 1;  1USP B;  2JS4 A;  2JMO A;  3VMH A;  2VUM I;  1DL6 A;  3HOX I;  3QWO C;  3EER A;  2JA5 I;  2JR6 A;  1ZB8 A;  1Q81 2;  2RIQ A;  2JA8 I;  4CPG A;  5C44 I;  4A3E I;  3GTP I;  5C3E I;  3F3P C;  3CCS 1;  3NH4 A;  3JAM b;  1NP6 A;  3FXE A;  3I56 1;  3CCJ Z;  1QVF Y;  4MXU A;  2E2J I;  2KUB A;  3GTK I;  3OW2 Z;  4K3A A;  4MD9 A;  1VQN 1;  4HGY A;  5A2Q f;  2OTL 1;  2K5R A;  2M5A A;  3S2H I;  2QR1 B;  1S7M A;  2F4O A;  2YU9 I;  1U7J A;  3MZK B;  2DE7 A;  4KJM A;  4BXL A;  1VLA A;  4S1T A;  3NDJ A;  1YIJ 1;  3VTN A;  3S1M I;  3BG0 B;  4E2Z A;  2O4H A;  4MON A;  1U7M A;  3PO3 S;  3CCR 1;  1S3J A;  4X6A I;  3ESW A;  2DE6 A;  4NPE A;  3PO2 I;  2O53 A;  1VQM 1;  2IZ4 A;  1LP1 B;  2RHB A;  3CC2 Z;  2AKL A;  2I8D A;  3CXC Z;  1VQK 1;  4A3D I;  5CM2 M;  2OOX B;  3J80 b;  3KIF A;  3GTM I;  2DE5 A;  4DK1 A;  3QWU A;  4AYB A;  4A3I I;  2ZAE B;  4QTT A;  2HF1 A;  1VQL Z;  4DGL A;  3JAM f;  2H85 A;  3NH8 A;  1W2B Y;  3NFZ A;  2JWD A;  1TWC I;  4E32 A;  4NBF A;  2LXC B;  3CMA Z;  3CCV 1;  5IP9 I;  2OTJ Z;  2JA6 I;  2QA4 Z;  4NBE A;  1RO0 A;  4QTU A;  2QRC B;  1KC8 1;  2M5A B;  3I55 Z;  4MD7 A;  4TNU A;  2J6A A;  3CCM Z;  4E31 A;  2Q1K A;  1QVG Y;  5CBO A;  3G6E 1;  2QRE B;  1W2B Z;  5FLX f;  1QYP A;  1VQ6 Z;  1K8A 2;  4RVD A;  3CD6 1;  2JA7 I;  4CL1 A;  1M1K 2;  4ASW A;  4NPD A;  4EYY Q;  2G2K A;  2GTH A;  1K9M 1;  4NB8 A;  2E9H A;  2OOY B;  1VQO Z;  2KZJ A;  1VQP 1;  3J80 f;  1TWH I;  2PM9 A;  2QRX A;  3CC7 1;  1OVU A;  1NUI A;  4NB9 A;  1KC8 2;  3H0G I;  1Q81 1;  1VQ7 1;  4NBA A;  1TFI A;  1YJN Z;  3S15 I;  3GTM S;  1YIT Z;  2Y0S A;  1Z02 A;  3RGU A;  1YHQ Z;  1BDC A;  1M90 2;  2NVX I;  1K73 1;  4HJG H;  1JJ2 Y;  3I4N I;  3CC4 Z;  3VMG A;  1Y1V I;  2KPI A;  2QEX 1;  1YJW Z;  1TWG I;  3G71 Z;  4MD8 A;  5AN9 F;  1K83 I;  3H3V J;  2W04 A;  1P9N A;  3NH5 A;  4BBR I;  1S72 Z;  2F4M A;  1KRL A;  2EGT A;  2Q4Z A;  2KS1 B;  1KQS Z;  2LXB A;  4GOD A;  1JJ2 Z;  1ZH1 A;  3GTL I;  2VUG A;  4A3C I;  2B63 I;  5C4J I;  1TWA I;  2KI7 B;  1K73 2;  4RVF A;  3CCQ Z;  3CCE 1;  4NBC A;  1YI2 Z;  4ZMD A;  2V8K A;  2B87 B;  3S14 I;  3P5J B;  2NVT I;  3HKZ A;  3T4N B;  2W03 A;  2OTK E;  1VQ4 1;  1VQ8 1;  1X3W A;  4Y7N I;  1VQ5 Z;  1QVF Z;  1YUK A;  2JNY A;  3Q87 A;  5FLX b;  1L1O C;  1YUA A;  1VQ9 1;  2OZK A;  5CBN A;  2WB1 A;  2RKL A;  1KD1 2;  2PMZ A;  2KZI A;  1PFT A;  3S2D I;  1Y1V S;  3G4S Z;  2GTI A;  1YJ9 1;  1ZB9 A;  3VB9 A;  5FLM I;  1Y47 A;  4RV9 A;  1K8A 1;  2HU9 A;  1RNI A;  1M1K 1;  3EED A;  1WW9 A;  3KIH A;  2LR2 A;  1Z01 A;  3K7A I;  3RZD I;  5IP7 I;  2GU2 A;  3TE5 B;  2JUB A;  5D1O A;  3CCL Z;  2PK7 A;  2I3C A;  2M6N A;  3CCU Z;  3CCJ 1;  1X3Z A;  3U50 C;  4E30 A;  4K35 A;  5T6B A;  3D9X A;  1I50 I;  4HKZ H;  1RLY A;  1LT1 A;  1Z03 A;  1Q2N A;  4NBH A;  4Y52 I;  4A3L I;  2R44 A;  1M90 1;  4NH1 C;  4NBB A;  3MZW B;  3CME Z;  1Q82 1;  5K5G B;  1SFO I;  2IZ3 A;  1Q7Y 1;  2R7Z I;  2SPZ A;  1JWH C;  3S1R I;  3GTQ I;  5T64 A;  1USP A;  1I6H I;  2P3Y A;  1QVG Z;  2E2I I;  3CCS Z;  4XX2 A;  1Q86 2;  2VF1 A;  3CC2 1;  3I56 Z;  4E2X A;  4A3J I;  1VQN Z;  4NOZ A;  2B89 A;  2OTL Z;  3VMI A;  1VQL 1;  1FC2 C;  2K3R A;  1Y1W I;  4E33 A;  1Q82 2;  1ZW0 A;  1QF8 A;  5D1O B;  4NPF X;  3IFU A;  1JM0 A;  3FXD A;  1Q7Y 2;  4E2W A;  3CMA 1;  1YIJ Z;  3S17 I;  1OVR A;  2OTJ 1;  2QA4 1;  4BXX I;  3BG1 B;  4ZNC A;  3I07 A;  4NBG A;  3CCR Z;  1DEE G;  3J7A 4;  5IT9 f;  1VQM Z;  3I55 1;  1NJI 2;  3GTO I;  3CCM 1;  1NVO A;  2M0B A;  1I3Q I;  1VQK Z;  1RQF A;  2LFU A;  2RPR A;  1KD1 1;  3HOV I;  3CQZ I;  4MH4 A;  4IOI H;  1VQ6 1;  1N8R 1;  1JMB A;  2WAQ A;  4WWI A;  3M4O I;  5DJT B;  1RO2 A;  1VQO 1;  3CCV Z;  2RT9 A;  3IF8 A;  3FQM A;  1EDJ A;  2NVY I;  3HOY I;  1YJN 1;  4GOF A;  1EDI A;  2P28 A;  3FKI I;  5D1P A;  3HOU I;  1YIT 1;  4A3B I;  3CPW Y;  3G6E Z;  1YHQ 1;  1R9T I;  4HGZ A;  1N8R 2;  2WMM A;  1ZXG A;  3MON A;  3CXC Y;  5LL6 f;  4E2Y A;  2QRD B;  3CC4 1;  3CD6 Z;  1YJW 1;  3G71 1;  1VQP Z;  1MFT A;  2UWJ E;  3GTJ I;  1WII A;  2NVQ I;  1EDK A;  2B88 A;  3J81 b;  1S72 1;  3ZDM A;  3CC7 Z;  3CPW Z;  1H0T A;  2E2H I;  2YAD A;  5C39 A;  3GCF A;  2R92 I;  1N2F A;  3F3F C;  1VQ7 Z;  4NBD A;  3GKQ A;  4HB1 A;  3TDH B;  1SS1 A;  1Q86 1;  3CCQ 1;  2QVA A;  1YI2 1;  3S1N I;  4HH4 A;  1EC5 A;  4MRI A;  4RVH A;  2P58 A;  3S16 I;  2QLV B;  1TWF I;  2V8I A;  3RZO I;  2QEX Z;  4A3K I;  5IT9 b;  3D6W A;  3HOW I;  1RO4 A;  3HOZ I;  1VQ5 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...