2KI7B

The solution structure of rpp29-rpp21 complex from pyrococcus furiosus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
97
structure length
97
Chain Sequence
EKKRIAKERIDILFSLAERVFPYSPELAKRYVELALLVQQKAKVKIPRKWKRRYCKKCHAFLVPGINARVRLRQKRMPHIVVKCLECGHIMRYPYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of an archaeal RNase P binary protein complex: formation of the 30-kDa complex between Pyrococcus furiosus RPP21 and RPP29 is accompanied by coupled protein folding and highlights critical features for protein-protein and protein-RNA interactions.
pubmed doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 1
total genus 23
structure length 97
sequence length 97
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2ki7B01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ki7B02
2KIKA 2UWJE 1OVUA 3ZDMA 2B87B 2KUBA 5C39A 4ZNCA 2QRXA 1LT1A 1EDIA 1JM0A 2LXCB 2KI7B 3FXDA 4GOFA 1EDKA 1S3JA 1H0TB 1ZW0A 1OVRA 4IOIH 2P58A 5K5GB 2KZIA 4HB1A 2KZJA 3MZWB 4MN4C 1MFTA 3RGUA 2KS1B 4ASVA 1OVVA 2Q1KA 4NPFX 4NPDA 2I8DA 2JWDA 2HR3A 4HKZH 1SS1A 3QWOC 2R44A 4HJGH 1BDDA 2M5AB 4BXLA 4GODA 3MHVA 3FXEA 1Y47A 4EYYQ 1EC5A 2B89A 2M0BA 2OTKE 2QVAA 3S1KA 2LXBA 2WMMA 1BDCA 4ASWA 4CPGA 4WWIA 4NPEA 1LP1A 1FC2C 5DJUB 2ZAEB 1U7MA 2M5AA 1ZXGA 1JMBA 5CBOA 1U7JA 4K3AA 1EDJA 1Q2NA 5DJTB 2B87A 2RKLA 4GOEA 2B88A 2K3RA 1DEEG 2LR2A 5CBNA 4JBZA 1X0TA 2SPZA 1LP1B 3PH0A 4KJMA 1H0TA 5EFWB 1EDLA 4ZMDA 4K35A 1NVOA
chains in the Genus database with same CATH superfamily
2KIKA 3CCRZ 2YKQA 4I6MC 2K1AA 3BRVB 5H2FH 4EOTA 4IL6X 2XDJA 2JP3A 1QVGO 4RVGA 1SQPD 2P1JA 3FXDA 4NB8A 1JJ2Y 1M7LA 1ZV8A 1VQ7P 1AA0A 3WUUA 2O1JA 4NBBA 1Q7Y1 4IL6H 4GKGA 3G3ZA 3L72G 1JWHC 4Y99C 1S4XA 1SQVJ 2K9YA 3U1CA 1PGQA 5AVUB 1FOSF 1AVYA 1MFTA 1OMIA 5CJ0A 1NTME 1SFOI 1L0LJ 2JS4A 2WPVB 4RVHA 2OYHB 3S16I 4H44D 3PO3S 3VMXA 3F3PC 1X3ZA 3CXHE 2E75C 2N1TD 1KYOE 1L0NG 4AYCA 4XX2A 1EC5A 2W6JH 1BSHA 1KRLA 1BGYJ 2LXBA 4BBRI 3V2PA 1K83I 4A93I 1YTZT 2FXOA 3CD61 4TLFA 3WMM0 2LKMA 5APUA 3CCSP 3JCUH 1DD4A 3H0GI 4YXWH 3NH5A 4MD8A 2QEXP 2GTIA 3FQMA 2XKMA 1YYCA 1QGKB 1ZRTE 1Y1WI 4U3FD 2R5DA 3CC7Z 3VOPA 1LTBC 1NTZK 3A0BH 4N6JA 1L0NK 2E2II 3H1IJ 3I561 2FYZA 3T97A 3I55Z 1SQVG 4RVFA 3MD0A 2H7HA 1GL2D 4PD4D 4K35A 1L0LK 1RLYA 4L76A 2OYOA 2LEXA 1VQ61 1VQ41 2JIPA 3S1QI 2B87B 3NMDA 1CSBA 1RO4A 2IBZE 2QRXA 5C4JI 1EQ7A 3U59A 3RK3C 1LT1A 3CMEP 3RL0C 1FJPA 1USPB 1ZB9A 5M1BA 3IR7A 2GTHA 2KK7A 3TE5B 1IK9A 2Y0DA 2YNYA 1S3JA 2YKOA 2QEXZ 1OVRA 1NTMG 5KLIB 5H2FE 1OIPA 2NVXI 3CCUZ 2O01H 2MJZA 5E79E 2OTLZ 2R6MA 2QIWA 3V2RA 1EXJA 2VF1A 1AQTA 2ZYGA 1E5WA 1SS1A 5KAIH 2GUVA 3CC7P 3NXSA 5IT9b 1Q812 2OGUA 1AVOA 3MP7B 4E32A 1JY3N 1LWUA 2OYIA 1JY2N 2MKVA 3L73G 1L0LG 2HPCA 2WSCJ 2PM9A 5AVTB 4DJGA 4TNUA 2E75B 3G4S1 2YU9I 2E9HA 3T97B 2ZT9C 3H1LD 5T64A 3MZLB 1USDA 2K88A 1ZH1A 4XE5B 2JIOA 3MTUE 1M1K1 3KXDA 3H1LG 1EZVE 2IBZD 1ZRTD 2H85A 2B9BA 5BVZA 5A2Qf 1PIXA 1QLED 5CBNA 3P8MC 4C7NA 1KB9E 2OTLP 1SQPK 1GL2C 1ZMEC 3CCMP 2A06D 2SPZA 1SLQA 3CCMZ 1FDMA 1GK6A 3HKZA 3CCSZ 1YITP 5CCHD 4PV1D 2P7JA 3CXCY 2JEEA 2DE7A 2JUBA 1JCDA 1FZBA 3IF8A 2V7QH 1RF0A 3HUSA 3CMEZ 1N8R1 2RT9A 1HBWA 3CL3D 3FQQA 3CCQZ 3CXHD 3KYQA 5CCGD 2WB1A 1M1KQ 1M1K2 1SQVK 2RHBA 2KI7B 2YXRB 2WT7A 4H44C 5T6BA 3ESWA 2KPIA 3GMAA 2L5GB 3A2AA 5BU8B 2P58A 1DEBA 1VQO1 2G2KA 2JIRA 2BCCE 1IFNA 2V8KA 3J81b 3G4SZ 2FYUG 3KDPB 4JYCA 2PMZA 1MFZA 2JWDA 1BE3G 1YUAA 2WAQA 1URQA 1BCCJ 1VQM1 4L74A 2A06G 3J81f 1KMIZ 3M0DA 4S1TA 1KQSZ 3NDJA 2GM4A 1T3JA 1Q821 2QE7H 2V3VA 1NTKE 3H1JG 1KN7A 4NFRA 3J80f 1FZCB 1S9KD 1N2FA 2WSEH 1BGYE 3O6QA 1SQBG 5KKZC 1SIWA 3HD7B 2C0XA 1SQPE 5APTA 3AE1C 4A3GI 1Q81Q 1GU4A 3EFGA 1JCCA 3HUSB 1KQSO 5KAFE 5IP9I 3A0BE 2E42A 3GTMI 3NDIA 4H0LC 2WWWA 1ZOYC 1L0LE 2JIMA 3CXHI 4M3LA 1OFCX 2Q6QA 1RF1C 1AQ5A 3BCCJ 1PP9D 1R8EA 1QVFZ 1NUIA 3AEBC 4DGLA 2L91A 2ZT9D 2BCCD 3S14I 4EIJA 3CWBE 4PV1C 1D7MA 1VQ9P 4L73A 3H1KJ 2VRSA 4Z1MH 4NBHA 4LLHA 1KD1Q 2IX7C 2F4OA 4U3FG 1FJKA 2ZYAA 3CC21 1EDKA 2CK3H 1NU1G 1HGZA 1TWFI 2D2CD 4IOIH 1NTZE 4DT0A 1HF9A 2FYNC 2ZVOB 3CCJP 3GTQI 4WY4A 3CC4P 3D6YA 2IBZI 1S72P 5IT9f 4B86A 5KAFH 4YTPC 1VLAA 2Q1KA 1IFMA 1QXFA 3L73D 1NOHA 2POHA 3TDKA 1VQNP 4NH1C 2AEMA 1Y47A 3CPWY 3D71A 2WMMA 1VF5C 1A02F 1YJ91 1YJWZ 2JKVA 4A3BI 3RK3B 3VMHA 2VPZA 2KSEA 2E76B 3G6EP 2VPXA 1GMJA 5D1PA 1JMBA 5CBOA 2KSJA 1W2EA 3CPWO 3EQ2A 1NKNA 2QKDA 4EI2A 4MH4A 2RKLA 4D6TG 1MZ9A 4RKUJ 1GDTA 3C1LA 3L37A 4GT1A 1M901 1PFIA 5APXA 2E2HI 1EXIA 1AFOA 1KILD 4IFMA 1NAYA 1VDFA 2RPRA 3B71A 1SQQG 4E33A 1OW6A 1FZFA 3GHGB 2NVQI 1XTGB 5APSA 2V8IA 3MIWA 2E76C 4HH4A 1VQ71 5APVA 1KB9I 1QX8A 1PGPA 1R5SA 2OARA 2FFDB 4UB8H 3M3YI 1SFCD 2WSSH 3RK2D 2PFXA 2KP8A 3CLQA 2Q7CA 1KQLA 1RE4A 4A7PA 2IZ3A 3GTGI 4LGDE 1PPJE 1NTKK 3EWKA 1J1EB 3RGUA 5KLVK 2WPSA 2KNCB 1I6HI 1LNQA 2ZFCA 2OTJP 1RE3A 1N73B 4LC1A 2OYHC 3GW6A 3HD7C 2R93I 1NTZG 1TWGI 4OGQB 3MHVA 3CD6P 1Y8CA 3CCS1 3OJAB 4E2WA 3S1KA 2JR8A 3QWUA 2Z5HA 2QEX1 1Q7YQ 3CCEP 1SP4A 3TYYA 3CMAZ 1K73Q 1S5LX 2YMYA 3MUDA 4E2YA 2NRGA 5L8RJ 4A3MI 3LW5H 1JEKA 2IBZG 1M56D 4HH2A 3S2DI 3F89A 2P3YA 3CX5D 3CCVP 1SQXJ 1ZN5A 2LR2A 2LIYA 1CI6B 1VQ6P 1USPA 2M6NA 1NTMJ 3GCFA 4OGQC 4N78D 1IFIA 1VL2A 1FS0E 4I2LC 3OW2Y 3M06A 3CME1 1IFJA 3HOZI 1N7LA 3Q2YA 1P84E 5GTIE 2R32A 1YHQP 1SQBE 3HOWI 3RK2B 2W04A 2KNCA 2NZ2A 1MKMA 4XA4A 3GKQA 2NVTI 3H3VJ 3K7AI 4RS4A 1K05A 1FZCC 1ML8A 2HLOA 1S2EA 4HGYA 1CZQA 1Y1VI 3CX5E 4Y99B 2FFDC 4MD7A 1DH3A 3PJSK 3M9QA 5GTHE 3CCQP 3GTMS 3BRTB 2QRCB 2V8JA 4NPFX 2QREB 1I3QI 3FWNA 3M0AA 1RE3C 1KC82 3AEAC 3Q87A 3R4YA 3RK2C 2AYDA 1SQXG 4WY4B 1DD3A 5AW0B 5KLVD 3G4SP 2XNDH 2E76D 3NTNA 1YQ3C 1OXZA 3E1IA 1T3UA 3PLNA 1WRGA 4A3JI 5BU5A 5TISH 3AE3C 2JJLA 2H43A 2WZ7A 4U3FJ 3GTPI 3C9IA 3S1MI 1ZXGA 2O1KA 1HGVA 1N73C 1NKZB 2JMOA 3CCVZ 2OTL1 1YJW1 1SQBK 1ZP0C 3VP9A 3MUDC 3TNUA 3VYIA 3CCUP 2YO2A 3H1HE 3CCRP 1LP1B 1GL2B 3CQZI 1JUNA 5APQA 4YPCA 3RL0B 5FLXf 2BEZF 1LT9C 3K5BA 4MD9A 5CJ4A 1VQ6Z 1L0NE 3TGUG 1VQ51 2UWJE 1S72Z 1FBMA 4GDOA 2W90A 2H89C 3B4SA 3M0DC 3V4WA 4ZKPA 5B5EH 1OZHA 2JO1A 3B5NC 1VQOP 3ABVC 2FY8A 3RZDI 1P9NA 1URQB 3QH9A 3CCL1 5TJHA 1H0TB 1PFTA 3H25A 3GG2A 4E30A 2PP6A 3NFQA 4YXDC 3L74D 1RE4C 1WIIA 1VQMP 1K9MQ 3IFUA 2FFDA 2NPSC 2GA1A 3CX5H 3VMYA 5CHXA 3TF5A 3HD7A 5GTHH 3D6WA 3AE6C 1JY3P 2JIQA 5APWA 1YITZ 2E7ZA 2Q3EA 4E31A 1M57D 2M8RA 1VQ5Z 2IYOA 2E5TA 1PGJA 2O3JA 1RQFA 3PTZA 2V7QJ 1GL2A 3W68A 3V6IA 2HU9A 2E75D 2M5AA 1LTIC 2IZ1A 3VN0A 2J59M 1JTHA 1EDJA 1FDIA 3H32A 1OWAA 3I4NI 1W2BY 2AEFA 1NU1J 4EDFA 2Y9YA 2IZ0A 3TDHB 1LT9A 1H0TA 4ZMDA 2PAJA 1S1CX 3KQGA 1NTZJ 3L71G 3M91A 3VMGA 1QVFO 2QJKC 4I7ZB 1Z03A 3ZDMA 1HJ0A 1NAFA 3NH8A 4A3LI 4ZNCA 2C9NY 4IFDK 3G9RA 4E2XA 5AW4B 4C7NB 4L75A 4O9BA 1QVFY 3M4OI 1QVGY 4NBEA 4W80A 2QLVB 1EZVG 3D6ZA 4N3YB 2AKLA 4PJ0E 1M902 1DX7A 1W2BO 2ZVNB 3H1LJ 2FBWC 3HE4B 2CPBA 2QJKB 1VQLP 4NBDA 3G711 3PO2I 4PD4H 1BDDA 2M5AB 1NYHA 4R4MA 5AVYB 4AUWA 1NO4A 1U57A 1NTKD 1QF8A 3G6E1 2OOXB 1PPJG 3RL0g 3VMAA 4UB6H 2K5RA 1NTKJ 1RH5B 2RBLA 1U7MA 1A02J 1J1EC 3GHGA 1RO2A 2FYUD 1RF0C 3HUSC 1H89A 2Y0SA 3VP8A 2JWAA 3KPEA 4Y7NI 1QEXA 3GF3A 1UIIA 2RMZA 2FYUJ 4PD4E 2K9JB 5IP7I 3HTKA 4KJMA 2NPSB 1SFCC 2PK7A 3I56Z 1RF1B 1BE3D 4H44B 4TT3H 1I50I 3AECC 1BCCG 1M1JB 1AA6A 3CD6Z 2FYNB 1IC2A 5AVWB 1MV8A 4BRYB 5AVZB 1KYOI 2PRRA 3EFFK 1KFMA 1URQC 1X79B 1SQQJ 4HGZA 5K5GB 4W7YA 2AXTE 1N2DC 3BCCE 1DL6A 3JAMb 1YI21 1JY3O 4MN4C 5AVSB 2E43A 2XZRA 1VQP1 1YJN1 2FYUE 1Q822 3Q5RA 1KYOD 3MONA 2JA5I 3BVHA 1VQK1 2WSFJ 1K04A 4OWFA 3FKII 4HJGH 1VQ81 1R5LA 1LTGC 3HOUI 3L35A 2YKPA 3WUTA 1IK7A 5AVQB 2FYUK 2FXPA 3CXHH 1T6AA 3BATA 1NH4A 3A0HE 1JY2P 2QM7A 1N7SD 1QL1A 2IFMA 2A45I 2R5BA 2C9LY 1KILE 1FC2C 1BGYD 3HTKB 1FOSE 1T2KC 3H1KG 1RF1A 1L4AA 3L71E 5CM2M 3S15I 3CCV1 2WQYC 2RN0A 2D2CB 3V5BA 5D1OA 3H1KD 3H1JD 5T67A 4NBCA 2F4MA 4BRYA 5CCHA 5AW9B 4DK1A 1YHQ1 4PV1B 3CC71 2BEQD 4JPZB 2P10A 3P8CD 4IFFA 3CPWZ 1YIJZ 2QJYC 3GF7A 4DQYB 3IFMA 3W67A 2ZJSE 1ZR2A 3CX5I 1NJI1 2KLUA 1RNIA 1ZLLA 1KB9H 2WPQA 3HOXI 2WTYA 1LT9B 1ZW0A 3JC22 3L70G 4NOZA 3AE7C 3CCJZ 3V2QA 3MZWB 1X8YA 3S4RA 2A45G 2BASA 4OVNF 5CMZA 3S1NI 3U1AA 3CCM1 4HKZH 1RO0A 2RH0A 3D70A 3D2LA 3OW2Z 2A06E 3HOVI 2Z4EA 2NAPA 4QTTA 4DCKA 1L4AB 4I1LA 3H1IG 1KQGB 4R4LA 3VB9A 2Q5UA 1VQ4P 2J6AA 3Q3DA 2HFED 1HVVA 3S9OA 1KILB 2IFNA 4IL6E 4KHXA 1ZB8A 2R7ZI 3IAOA 2GUSA 2WVRA 1PP9E 3VMIA 2HG5D 1YJWP 1LP1A 1GU5A 3I55P 4UB6E 3A5TA 1K8A1 2QA4P 2QG4A 2QA4Z 1HH0A 3CCU1 3SFEC 1IFDA 3L75G 4K3AA 3CCR1 2ITAA 1JY2O 1QYPA 1X9VA 1VQPZ 1L4AC 5C3EI 3A3YB 2W83C 1DEEG 1VQ5P 3P8CE 1Q90D 1LGHB 4DZOA 1KYOH 3V2NA 3VTPC 3IX0A 1VF5B 3GTLI 1VQ4Z 3KIHA 1KORA 2NVYI 3AE4C 4E2ZA 1X3WA 1YTZI 3SFDC 3RBXA 3G71Z 4A3EI 2YXQB 1SQQK 3H1JE 2OQQA 1K8A2 3H1KE 3SWYA 1JM0A 1YBKA 5LL6f 2M3BA 3CWBJ 1LTTC 2YMKA 4AYBA 2NPSA 4GOFA 5A2Qb 2VPYA 1QL2A 3G6EZ 1G1IA 3I07A 3TGUJ 2IYPA 3H1HD 5AN9F 3I4MI 2KB7P 2KZIA 2KZJA 3BCCD 3SSUA 3L75D 3H1HJ 1WZNA 3M9HA 4ASVA 3R2PA 2J5UA 2R3SA 4CL1A 3L75J 2W03A 1RQVA 2Z5IA 3CCLZ 3L70J 4NBGA 2DW3A 2B89A 1SQPJ 4U3FE 2ZXEB 2E5YA 2QVAA 2IPPA 1FDOA 3B5ND 1LTJC 1W5CE 1N7SB 4WBAA 2K37A 1IFPA 1GTWA 1KB9D 3CC2P 3L4FA 2EGTA 2P2UA 3L72J 3MZKB 5AW1B 2IZ4A 3P5JB 1BCCE 5DJTB 1EZVD 4H0LB 3KIFA 1WCMI 1K8AQ 3FWLA 2Y0CA 2DE6A 3H1LE 1MUUA 4JBZA 4RVDA 2W27A 4C46A 1VQ9Z 3IN6A 1SQVE 1UIXA 2YIUC 2E2JI 2E74B 1JOCA 3JCUE 3RL0D 3JAMf 1L1OC 1NVOA 3TGUE 2O01N 3P7KA 5D1OB 4XFJA 1SVFA 1YHQZ 2N9YB 3TNUB 2P28A 3RZOI 3L70D 5AW5B 3H1JJ 4D6TD 1SQPG 1RY3A 1K732 1VQOZ 3UIAA 4DOJA 2Q51A 1NHLA 1KQFB 5AVXB 2XU6A 1VQL1 2QSIA 3KHUA 1R9TI 4U7JA 3LW5J 2E74C 2KS1B 2YIUB 1OVVA 3VTNA 2FKWB 1HTLC 4NPDA 2I8DA 3OAKA 5KJ7C 3IR9A 1N7SA 1Y1VS 1GW4A 1NJIQ 3CMAP 4RJTA 2AXTH 1DIPA 1G2CB 2JNYA 1BDCA 1YIJ1 1PP9J 4KT0J 3NH4A 3SWFA 4QMAA 2K9JA 1T8ZA 1YI2Z 3HD7D 2VUMI 3E7KA 4NBAA 1M1JA 1NU1D 2DE5A 1KILA 3D9XA 1Z02A 1Q2NA 2B87A 1NWQA 3A0HH 3EERA 4BY7I 2I1KA 3C8VA 1PPJD 3EEDA 1RHZB 3N4XA 3GHGC 1X0TA 4BY1I 3VMZA 2OTJ1 3FGAD 1LTSC 3H6PA 1NTKG 3L74J 2G8YA 1NJI2 5EFWB 1M8OB 1PL5A 3H1ID 5TISE 1JTHB 1VPCA 3L73J 2N1TA 1OVUA 5CCHC 3FX0A 3H32B 4JF7A 3WUVA 1CW5A 3S1RI 4W7ZA 5KJ7D 4JQ0D 1YJ9P 1EDIA 1GK4A 3ITKA 4OH8B 3OW2O 3CCE1 1FZGA 2A45H 1GZLA 4BWNA 1VQ7Z 1YJNP 1S7MA 4RO0A 4X6AI 1NTMD 1L0NJ 4HB1A 5FLXb 3BASA 3KZIH 1VQKP 3L74E 2VPWA 2Y0EA 2GU2A 3N7NA 3LUSA 3RBZA 1T2KD 2HR3A 1PGOA 2IDBA 1N7SC 3MGNA 5KLIC 5KJ7A 3B5NA 3QWOC 1H88A 1LTJB 3GTJI 5C4XI 4BXLA 1KFNA 4GODA 3FXEA 3L71J 2W8ZA 3Q5PA 1GW3A 4MRIA 3HE4A 3L71D 3AEDC 4WWIA 3BG1B 2C0WA 1JJ2Z 4Y28J 4C7RA 1TWHI 2M3EA 1KC8Q 1FZEA 5DJUB 3CWBG 1OW8A 3LIEA 3A7OA 3S17I 1WW9A 2WPRA 3TK1A 1KILC 2J58A 2N1TB 4A3FI 3PHLA 4WB4A 1IO4A 1BE3J 1IJDB 4PJ0H 2D2CC 2V45A 3GTKI 1URQD 1BGYG 3OA7A 2KLVA 3SWKA 4GIFA 4JYBA 4RESB 1JNMA 2QR1B 1SQXD 4EWCA 1PZQA 4H13C 2WSCH 3RK3E 1VQNZ 1SQQE 1NU1K 1M90Q 4BBSI 3I56P 5KLVE 1S5LH 2AXCA 2KUBA 1VQKZ 1FU1A 1RQUA 1Q861 3L36A 1SQQD 1VF5D 5FLMI 2HYNA 2AEJA 1SQBJ 1AJYA 1JO5A 4A3II 3NFZA 4H13B 3J7A4 1WJ2A 1IZNB 2XNXA 1LTJA 5AW3B 1YQ4C 1L0LD 1USEA 3I5CA 3HOYI 2G3AA 1E79H 1Z01A 1BE3E 1FZCA 1FZAA 3TSIA 1Q7Y2 2BCCG 1P84I 2R44A 2Q4ZA 1HWTC 1Q862 3USSA 1Y8AA 3L72E 1S9KE 4EYYQ 1NTMK 3Q1MA 3I551 3F5HA 4WY4D 1VQLZ 4H0LD 1JB0J 2KS1A 2OTJZ 2QA41 3U50C 1LTAC 2KOGA 4N78E 2ZAEB 4OGQD 1TWCI 1L2PA 3CCLP 2P67A 1JMMA 4HYTB 1YUKA 3L70E 1U7JA 2N1TC 2JA7I 2W6AA 5KTBA 1KV4A 1SQBD 1LWUB 2OYIB 4GOEA 1G2CA 5B66H 3CCQ1 2B88A 3L72D 1P84D 2K3RA 2I1JA 3BG0B 5KAIE 1SQVD 3PH0A 3V4QA 3II6A 2B63I 1EDLA 2WSEJ 2HF1A 5AW7B 1W2BZ 1PV3A 3AEEC 4A3CI 2H88C 1YIT1 3CC4Z 1J2JB 2HODA 1HUCA 1YJNZ 1WMKA 2M48A 2QRDB 1PP9G 2OYHA 1Q811 1G1JA 1FE6A 1Y9BA 1H8AA 2N9BA 3IF4A 5KLVJ 4NB9A 1VQMZ 3CC2Z 2W6BA 4AQRD 2O53A 4D6TJ 2BJOA 2WITA 5AW6B 2XV5A 5B66E 2RIQA 4ZKUA 3GTOI 2E74D 5CCGC 2IV2X 5B5EE 2JA6I 3AEFC 1KQSY 1NU1E 1Q82Q 1SQXE 2QM8A 3PO3I 1Z56A 1N86A 3CXCZ 1LQLA 2WT7B 1AV1A 2QJPB 4WY4C 2OTKE 1XTCC 5APYA 1WT6A 1BSNA 4QTUA 1K731 3AE2C 3JSVC 1TU3F 1HJBA 1KD12 2FXMA 4NPEA 3B5NB 1QVGZ 1J1DB 1SQXK 5KKZB 1GD2E 1ZR4A 2Q9IA 2QJYB 2ZYDA 1TFIA 4MXUA 2HODB 4H13D 1NP6A 5AVRB 2O4HA 5AVVB 2CPSA 3P32A 3PP5A 3O6QB 3HE5A 1NGMB 2ZT9B 2NPSD 4D6TE 2WSFH 2KXPB 1LWUC 2OYIC 1KD11 3AEGC 2VUGA 3PRJA 2O01J 3B8EB 5C39A 3WU2H 1S5LE 3HRNA 1K9M2 1SFCB 3TGUD 2LXCB 3CCEZ 1N73A 2PGDA 2Y9ZA 1X22A 3L73E 2R3CA 1VQ91 1N8R2 1N8RQ 3GLMA 2JDIH 1TWAI 2OOYB 4I7ZC 4MONA 3BCCG 3AE9C 5E79H 3H1IE 5CCGA 3F3FC 1BCCD 3CMA1 1L0ND 3O8ZA 1YJ9Z 2KYVA 2HPCB 1P84H 1EZVI 1OX3A 5GTIH 3CCJ1 3CC41 1S721 3AE5C 5KLVG 2YO3A 1OW7A 1K9M1 1VQ8Z 1YIJP 1KZUB 4PD4I 3WU2E 2H8PD 3CI9A 2V4HA 1FAVA 4RV9A 2M0BA 5AW2B 2LFUA 2JA8I 2Q3IA 3L74G 3RK3D 3M9BA 4ASWA 2OZKA 3J80b 1VQN1 1KC81 1Q16A 4CPGA 1CI6A 4A3KI 1NTZD 4Y52I 3HE5B 1J1DC 3E1RA 3LIDA 1Q86Q 3AE8C 4BXXI 3T4NB 4A3DI 3Q5SA 2I3CA 2QJPC 3S2HI 3L75E 3CWBD 1YI2P 1L4AD 5AW8B 1KTMA 4NBFA 1VQPP 1LJ2A 3KZIE 3H1HG 1SFCA 1M1JC 5C44I 3G71P 2JR6A 2R92I 2BCCJ 1VQ8P 2ZXXA 4WVZA 4UB8E 2YADA
chains in the Genus database with same CATH topology
3CD6Z 2KIKA 3CCRZ 1OVUA 2NVQI 2V8IA 4HH4A 1VQ71 3S1RI 1EDIA 3M3YI 3CCE1 4RVGA 3FXDA 4NB8A 1JJ2Y 1VQ7Z 1S7MA 4X6AI 4NBBA 4HGZA 1Q7Y1 5K5GB 4HB1A 5FLXb 2IZ3A 1JWHC 3GTGI 1DL6A 3JAMb 1YI21 4MN4C 1MFTA 2GU2A 1VQP1 3RGUA 3LUSA 1YJN1 1SFOI 1Q822 1I6HI 2JS4A 3MONA 4RVHA 2JA5I 3S16I 2HR3A 1VQK1 3PO3S 3FKII 3QWOC 4HJGH 3F3PC 1VQ81 1X3ZA 2R93I 3GTJI 5C4XI 4BXLA 3HOUI 4GODA 1TWGI 3MHVA 3FXEA 4XX2A 1EC5A 1KRLA 3CCS1 4E2WA 3S1KA 2LXBA 4BBRI 1K83I 4MRIA 3QWUA 4A93I 3CD61 2QEX1 3BG1B 4WWIA 1JJ2Z 1TWHI 1FC2C 5DJUB 3CMAZ 3H0GI 3S17I 3NH5A 5CM2M 3S15I 1WW9A 4MD8A 3CCV1 4E2YA 2GTIA 3FQMA 4A3MI 5D1OA 4A3FI 5T67A 4NBCA 1Y1WI 2F4MA 3S2DI 2P3YA 3CC7Z 2LR2A 2LIYA 1USPA 2M6NA 3GCFA 2E2II 3GTKI 3I561 4DK1A 3I55Z 4RVFA 2QR1B 1YHQ1 4EWCA 3CC71 3OW2Y 4K35A 1RLYA 1VQ61 3CPWZ 3CME1 1YIJZ 1VQ41 1VQNZ 3HOZI 3S1QI 4DQYB 4BBSI 2B87B 2KUBA 1VQKZ 1RO4A 1Q861 2QRXA 5C4JI 3HOWI 2W04A 1NJI1 1RNIA 1LT1A 5FLMI 1USPB 1ZB9A 3GKQA 2GTHA 2NVTI 3H3VJ 4A3II 3NFZA 3K7AI 4RS4A 3TE5B 3HOXI 3J7A4 1ML8A 1S3JA 1ZW0A 2QEXZ 1OVRA 2NVXI 4HGYA 4NOZA 3CCUZ 3CCJZ 1Y1VI 2OTLZ 3MZWB 2R6MA 4MD7A 3HOYI 3GTMS 1Z01A 2VF1A 3S1NI 2QRCB 2V8JA 4NPFX 2QREB 1I3QI 3CCM1 4HKZH 1RO0A 1Q7Y2 1SS1A 3OW2Z 1KC82 3HOVI 2R44A 2Q4ZA 3Q87A 1Q862 4QTTA 5IT9b 3VB9A 2J6AA 1Q812 4EYYQ 2R7ZI 1ZB8A 4E32A 3I551 1VQLZ 2OTJZ 2QA41 4A3JI 2PM9A 3VMIA 3U50C 1LP1A 4TNUA 3G4S1 2YU9I 2E9HA 2ZAEB 1TWCI 3GTPI 5T64A 3MZLB 1K8A1 3S1MI 1ZXGA 1ZH1A 1YUKA 2QA4Z 3CCU1 1U7JA 2JMOA 3CCVZ 2OTL1 4K3AA 1YJW1 1M1K1 3CCR1 2JA7I 2H85A 5A2Qf 1QYPA 4GOEA 1VQPZ 3CCQ1 2B88A 5C3EI 2K3RA 1DEEG 5CBNA 3BG0B 2SPZA 3CCMZ 1LP1B 3CQZI 3HKZA 3PH0A 3CCSZ 5FLXf 4MD9A 3CXCY 3IX0A 2B63I 3GTLI 1VQ6Z 1EDLA 2DE7A 2JUBA 1VQ4Z 1VQ51 3KIHA 3IF8A 2HF1A 2NVYI 1W2BZ 4A3CI 2UWJE 3CMEZ 4E2ZA 1X3WA 1N8R1 1S72Z 1YIT1 3CC4Z 2RT9A 3G71Z 3FQQA 4A3EI 1YJNZ 3CCQZ 1K8A2 2M48A 2WB1A 1JM0A 2QRDB 5LL6f 1M1K2 2RHBA 1Q811 2KI7B 3RZDI 1P9NA 4AYBA 4GOFA 3ESWA 5T6BA 4NB9A 5A2Qb 3G6EZ 3CCL1 1VQMZ 1H0TB 1PFTA 2KPIA 3I07A 3CC2Z 4E30A 2P58A 5AN9F 3I4MI 1VQO1 2G2KA 2KZIA 2O53A 2BJOA 2KZJA 2RIQA 2V8KA 3J81b 3G4SZ 3GTOI 1WIIA 2JA6I 2PMZA 1KQSY 3IFUA 4ASVA 3PO3I 2JWDA 1YUAA 4CL1A 3CXCZ 2WAQA 1LQLA 2W03A 3D6WA 3CCLZ 1VQM1 3J81f 4S1TA 4NBGA 1KQSZ 3NDJA 2B89A 1Q821 2OTKE 1YITZ 2QVAA 4QTUA 1K731 4NFRA 3J80f 4E31A 1VQ5Z 1N2FA 1KD12 1RQFA 4NPEA 2HU9A 1QVGZ 2EGTA 2M5AA 4A3GI 3MZKB 2IZ4A 3P5JB 1EDJA 5DJTB 1TFIA 5IP9I 4MXUA 3KIFA 1WCMI 3I4NI 3GTMI 3NDIA 1W2BY 1NP6A 2O4HA 2DE6A 4JBZA 4RVDA 3TDHB 1VQ9Z 1H0TA 2E2JI 1QVFZ 1NUIA 3JAMf 4ZMDA 1L1OC 1NVOA 3VMGA 4DGLA 1KD11 5D1OB 2VUGA 1Z03A 3ZDMA 3NH8A 3S14I 4A3LI 5C39A 4ZNCA 1YHQZ 1K9M2 2P28A 3RZOI 4E2XA 2LXCB 1QVFY 3CCEZ 3M4OI 4NBHA 1QVGY 4NBEA 2F4OA 2QLVB 3CC21 1EDKA 1K732 1VQ91 2AKLA 1VQOZ 1N8R2 1TWFI 4IOIH 1M902 2Q51A 1TWAI 2OOYB 3GTQI 4MONA 1VQL1 5IT9f 1R9TI 1VLAA 3F3FC 3CMA1 2KS1B 1OVVA 2Q1KA 3VTNA 4NPDA 1YJ9Z 2I8DA 3CCJ1 1Y1VS 3CC41 4NBDA 1S721 3G711 3PO2I 1K9M1 1BDDA 2M5AB 1VQ8Z 4NH1C 1Y47A 4RV9A 2M0BA 2LFUA 2JA8I 3CPWY 1QF8A 2JNYA 2WMMA 1BDCA 4ASWA 2OZKA 3J80b 3G6E1 1YIJ1 1VQN1 2OOXB 1KC81 4CPGA 1YJ91 4A3KI 3NH4A 1YJWZ 2K5RA 4Y52I 4A3BI 1YI2Z 2RBLA 3VMHA 2VUMI 1U7MA 4BXXI 5D1PA 3T4NB 4A3DI 1JMBA 5CBOA 4NBAA 1RO2A 2I3CA 2DE5A 3D9XA 1Z02A 1Q2NA 3S2HI 2Y0SA 2B87A 2QKDA 4MH4A 2RKLA 4Y7NI 4NBFA 3EERA 4BY7I 3EEDA 1M901 1X0TA 4BY1I 2OTJ1 2E2HI 5IP7I 5C44I 2JR6A 2R92I 1NJI2 4KJMA 3I56Z 2PK7A 2RPRA 5EFWB 4E33A 2YADA 1I50I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIK A;  2UWJ E;  1OVU A;  3ZDM A;  2B87 B;  2KUB A;  5C39 A;  4ZNC A;  2QRX A;  1LT1 A;  1EDI A;  1JM0 A;  2LXC B;  2KI7 B;  3FXD A;  4GOF A;  1EDK A;  1S3J A;  1H0T B;  1ZW0 A;  1OVR A;  4IOI H;  2P58 A;  5K5G B;  2KZI A;  4HB1 A;  2KZJ A;  3MZW B;  4MN4 C;  1MFT A;  3RGU A;  2KS1 B;  4ASV A;  1OVV A;  2Q1K A;  4NPF X;  4NPD A;  2I8D A;  2JWD A;  2HR3 A;  4HKZ H;  1SS1 A;  3QWO C;  2R44 A;  4HJG H;  1BDD A;  2M5A B;  4BXL A;  4GOD A;  3MHV A;  3FXE A;  1Y47 A;  4EYY Q;  1EC5 A;  2B89 A;  2M0B A;  2OTK E;  2QVA A;  3S1K A;  2LXB A;  2WMM A;  1BDC A;  4ASW A;  4CPG A;  4WWI A;  4NPE A;  1LP1 A;  1FC2 C;  5DJU B;  2ZAE B;  1U7M A;  2M5A A;  1ZXG A;  1JMB A;  5CBO A;  1U7J A;  4K3A A;  1EDJ A;  1Q2N A;  5DJT B;  2B87 A;  2RKL A;  4GOE A;  2B88 A;  2K3R A;  1DEE G;  2LR2 A;  5CBN A;  4JBZ A;  1X0T A;  2SPZ A;  1LP1 B;  3PH0 A;  4KJM A;  1H0T A;  5EFW B;  1EDL A;  4ZMD A;  4K35 A;  1NVO A; 
#chains in the Genus database with same CATH topology
 2KIK A;  3CCR Z;  2YKQ A;  4I6M C;  2K1A A;  3BRV B;  5H2F H;  4EOT A;  4IL6 X;  2XDJ A;  2JP3 A;  1QVG O;  4RVG A;  1SQP D;  2P1J A;  3FXD A;  4NB8 A;  1JJ2 Y;  1M7L A;  1ZV8 A;  1VQ7 P;  1AA0 A;  3WUU A;  2O1J A;  4NBB A;  1Q7Y 1;  4IL6 H;  4GKG A;  3G3Z A;  3L72 G;  1JWH C;  4Y99 C;  1S4X A;  1SQV J;  2K9Y A;  3U1C A;  1PGQ A;  5AVU B;  1FOS F;  1AVY A;  1MFT A;  1OMI A;  5CJ0 A;  1NTM E;  1SFO I;  1L0L J;  2JS4 A;  2WPV B;  4RVH A;  2OYH B;  3S16 I;  4H44 D;  3PO3 S;  3VMX A;  3F3P C;  1X3Z A;  3CXH E;  2E75 C;  2N1T D;  1KYO E;  1L0N G;  4AYC A;  4XX2 A;  1EC5 A;  2W6J H;  1BSH A;  1KRL A;  1BGY J;  2LXB A;  4BBR I;  3V2P A;  1K83 I;  4A93 I;  1YTZ T;  2FXO A;  3CD6 1;  4TLF A;  3WMM 0;  2LKM A;  5APU A;  3CCS P;  3JCU H;  1DD4 A;  3H0G I;  4YXW H;  3NH5 A;  4MD8 A;  2QEX P;  2GTI A;  3FQM A;  2XKM A;  1YYC A;  1QGK B;  1ZRT E;  1Y1W I;  4U3F D;  2R5D A;  3CC7 Z;  3VOP A;  1LTB C;  1NTZ K;  3A0B H;  4N6J A;  1L0N K;  2E2I I;  3H1I J;  3I56 1;  2FYZ A;  3T97 A;  3I55 Z;  1SQV G;  4RVF A;  3MD0 A;  2H7H A;  1GL2 D;  4PD4 D;  4K35 A;  1L0L K;  1RLY A;  4L76 A;  2OYO A;  2LEX A;  1VQ6 1;  1VQ4 1;  2JIP A;  3S1Q I;  2B87 B;  3NMD A;  1CSB A;  1RO4 A;  2IBZ E;  2QRX A;  5C4J I;  1EQ7 A;  3U59 A;  3RK3 C;  1LT1 A;  3CME P;  3RL0 C;  1FJP A;  1USP B;  1ZB9 A;  5M1B A;  3IR7 A;  2GTH A;  2KK7 A;  3TE5 B;  1IK9 A;  2Y0D A;  2YNY A;  1S3J A;  2YKO A;  2QEX Z;  1OVR A;  1NTM G;  5KLI B;  5H2F E;  1OIP A;  2NVX I;  3CCU Z;  2O01 H;  2MJZ A;  5E79 E;  2OTL Z;  2R6M A;  2QIW A;  3V2R A;  1EXJ A;  2VF1 A;  1AQT A;  2ZYG A;  1E5W A;  1SS1 A;  5KAI H;  2GUV A;  3CC7 P;  3NXS A;  5IT9 b;  1Q81 2;  2OGU A;  1AVO A;  3MP7 B;  4E32 A;  1JY3 N;  1LWU A;  2OYI A;  1JY2 N;  2MKV A;  3L73 G;  1L0L G;  2HPC A;  2WSC J;  2PM9 A;  5AVT B;  4DJG A;  4TNU A;  2E75 B;  3G4S 1;  2YU9 I;  2E9H A;  3T97 B;  2ZT9 C;  3H1L D;  5T64 A;  3MZL B;  1USD A;  2K88 A;  1ZH1 A;  4XE5 B;  2JIO A;  3MTU E;  1M1K 1;  3KXD A;  3H1L G;  1EZV E;  2IBZ D;  1ZRT D;  2H85 A;  2B9B A;  5BVZ A;  5A2Q f;  1PIX A;  1QLE D;  5CBN A;  3P8M C;  4C7N A;  1KB9 E;  2OTL P;  1SQP K;  1GL2 C;  1ZME C;  3CCM P;  2A06 D;  2SPZ A;  1SLQ A;  3CCM Z;  1FDM A;  1GK6 A;  3HKZ A;  3CCS Z;  1YIT P;  5CCH D;  4PV1 D;  2P7J A;  3CXC Y;  2JEE A;  2DE7 A;  2JUB A;  1JCD A;  1FZB A;  3IF8 A;  2V7Q H;  1RF0 A;  3HUS A;  3CME Z;  1N8R 1;  2RT9 A;  1HBW A;  3CL3 D;  3FQQ A;  3CCQ Z;  3CXH D;  3KYQ A;  5CCG D;  2WB1 A;  1M1K Q;  1M1K 2;  1SQV K;  2RHB A;  2KI7 B;  2YXR B;  2WT7 A;  4H44 C;  5T6B A;  3ESW A;  2KPI A;  3GMA A;  2L5G B;  3A2A A;  5BU8 B;  2P58 A;  1DEB A;  1VQO 1;  2G2K A;  2JIR A;  2BCC E;  1IFN A;  2V8K A;  3J81 b;  3G4S Z;  2FYU G;  3KDP B;  4JYC A;  2PMZ A;  1MFZ A;  2JWD A;  1BE3 G;  1YUA A;  2WAQ A;  1URQ A;  1BCC J;  1VQM 1;  4L74 A;  2A06 G;  3J81 f;  1KMI Z;  3M0D A;  4S1T A;  1KQS Z;  3NDJ A;  2GM4 A;  1T3J A;  1Q82 1;  2QE7 H;  2V3V A;  1NTK E;  3H1J G;  1KN7 A;  4NFR A;  3J80 f;  1FZC B;  1S9K D;  1N2F A;  2WSE H;  1BGY E;  3O6Q A;  1SQB G;  5KKZ C;  1SIW A;  3HD7 B;  2C0X A;  1SQP E;  5APT A;  3AE1 C;  4A3G I;  1Q81 Q;  1GU4 A;  3EFG A;  1JCC A;  3HUS B;  1KQS O;  5KAF E;  5IP9 I;  3A0B E;  2E42 A;  3GTM I;  3NDI A;  4H0L C;  2WWW A;  1ZOY C;  1L0L E;  2JIM A;  3CXH I;  4M3L A;  1OFC X;  2Q6Q A;  1RF1 C;  1AQ5 A;  3BCC J;  1PP9 D;  1R8E A;  1QVF Z;  1NUI A;  3AEB C;  4DGL A;  2L91 A;  2ZT9 D;  2BCC D;  3S14 I;  4EIJ A;  3CWB E;  4PV1 C;  1D7M A;  1VQ9 P;  4L73 A;  3H1K J;  2VRS A;  4Z1M H;  4NBH A;  4LLH A;  1KD1 Q;  2IX7 C;  2F4O A;  4U3F G;  1FJK A;  2ZYA A;  3CC2 1;  1EDK A;  2CK3 H;  1NU1 G;  1HGZ A;  1TWF I;  2D2C D;  4IOI H;  1NTZ E;  4DT0 A;  1HF9 A;  2FYN C;  2ZVO B;  3CCJ P;  3GTQ I;  4WY4 A;  3CC4 P;  3D6Y A;  2IBZ I;  1S72 P;  5IT9 f;  4B86 A;  5KAF H;  4YTP C;  1VLA A;  2Q1K A;  1IFM A;  1QXF A;  3L73 D;  1NOH A;  2POH A;  3TDK A;  1VQN P;  4NH1 C;  2AEM A;  1Y47 A;  3CPW Y;  3D71 A;  2WMM A;  1VF5 C;  1A02 F;  1YJ9 1;  1YJW Z;  2JKV A;  4A3B I;  3RK3 B;  3VMH A;  2VPZ A;  2KSE A;  2E76 B;  3G6E P;  2VPX A;  1GMJ A;  5D1P A;  1JMB A;  5CBO A;  2KSJ A;  1W2E A;  3CPW O;  3EQ2 A;  1NKN A;  2QKD A;  4EI2 A;  4MH4 A;  2RKL A;  4D6T G;  1MZ9 A;  4RKU J;  1GDT A;  3C1L A;  3L37 A;  4GT1 A;  1M90 1;  1PFI A;  5APX A;  2E2H I;  1EXI A;  1AFO A;  1KIL D;  4IFM A;  1NAY A;  1VDF A;  2RPR A;  3B71 A;  1SQQ G;  4E33 A;  1OW6 A;  1FZF A;  3GHG B;  2NVQ I;  1XTG B;  5APS A;  2V8I A;  3MIW A;  2E76 C;  4HH4 A;  1VQ7 1;  5APV A;  1KB9 I;  1QX8 A;  1PGP A;  1R5S A;  2OAR A;  2FFD B;  4UB8 H;  3M3Y I;  1SFC D;  2WSS H;  3RK2 D;  2PFX A;  2KP8 A;  3CLQ A;  2Q7C A;  1KQL A;  1RE4 A;  4A7P A;  2IZ3 A;  3GTG I;  4LGD E;  1PPJ E;  1NTK K;  3EWK A;  1J1E B;  3RGU A;  5KLV K;  2WPS A;  2KNC B;  1I6H I;  1LNQ A;  2ZFC A;  2OTJ P;  1RE3 A;  1N73 B;  4LC1 A;  2OYH C;  3GW6 A;  3HD7 C;  2R93 I;  1NTZ G;  1TWG I;  4OGQ B;  3MHV A;  3CD6 P;  1Y8C A;  3CCS 1;  3OJA B;  4E2W A;  3S1K A;  2JR8 A;  3QWU A;  2Z5H A;  2QEX 1;  1Q7Y Q;  3CCE P;  1SP4 A;  3TYY A;  3CMA Z;  1K73 Q;  1S5L X;  2YMY A;  3MUD A;  4E2Y A;  2NRG A;  5L8R J;  4A3M I;  3LW5 H;  1JEK A;  2IBZ G;  1M56 D;  4HH2 A;  3S2D I;  3F89 A;  2P3Y A;  3CX5 D;  3CCV P;  1SQX J;  1ZN5 A;  2LR2 A;  2LIY A;  1CI6 B;  1VQ6 P;  1USP A;  2M6N A;  1NTM J;  3GCF A;  4OGQ C;  4N78 D;  1IFI A;  1VL2 A;  1FS0 E;  4I2L C;  3OW2 Y;  3M06 A;  3CME 1;  1IFJ A;  3HOZ I;  1N7L A;  3Q2Y A;  1P84 E;  5GTI E;  2R32 A;  1YHQ P;  1SQB E;  3HOW I;  3RK2 B;  2W04 A;  2KNC A;  2NZ2 A;  1MKM A;  4XA4 A;  3GKQ A;  2NVT I;  3H3V J;  3K7A I;  4RS4 A;  1K05 A;  1FZC C;  1ML8 A;  2HLO A;  1S2E A;  4HGY A;  1CZQ A;  1Y1V I;  3CX5 E;  4Y99 B;  2FFD C;  4MD7 A;  1DH3 A;  3PJS K;  3M9Q A;  5GTH E;  3CCQ P;  3GTM S;  3BRT B;  2QRC B;  2V8J A;  4NPF X;  2QRE B;  1I3Q I;  3FWN A;  3M0A A;  1RE3 C;  1KC8 2;  3AEA C;  3Q87 A;  3R4Y A;  3RK2 C;  2AYD A;  1SQX G;  4WY4 B;  1DD3 A;  5AW0 B;  5KLV D;  3G4S P;  2XND H;  2E76 D;  3NTN A;  1YQ3 C;  1OXZ A;  3E1I A;  1T3U A;  3PLN A;  1WRG A;  4A3J I;  5BU5 A;  5TIS H;  3AE3 C;  2JJL A;  2H43 A;  2WZ7 A;  4U3F J;  3GTP I;  3C9I A;  3S1M I;  1ZXG A;  2O1K A;  1HGV A;  1N73 C;  1NKZ B;  2JMO A;  3CCV Z;  2OTL 1;  1YJW 1;  1SQB K;  1ZP0 C;  3VP9 A;  3MUD C;  3TNU A;  3VYI A;  3CCU P;  2YO2 A;  3H1H E;  3CCR P;  1LP1 B;  1GL2 B;  3CQZ I;  1JUN A;  5APQ A;  4YPC A;  3RL0 B;  5FLX f;  2BEZ F;  1LT9 C;  3K5B A;  4MD9 A;  5CJ4 A;  1VQ6 Z;  1L0N E;  3TGU G;  1VQ5 1;  2UWJ E;  1S72 Z;  1FBM A;  4GDO A;  2W90 A;  2H89 C;  3B4S A;  3M0D C;  3V4W A;  4ZKP A;  5B5E H;  1OZH A;  2JO1 A;  3B5N C;  1VQO P;  3ABV C;  2FY8 A;  3RZD I;  1P9N A;  1URQ B;  3QH9 A;  3CCL 1;  5TJH A;  1H0T B;  1PFT A;  3H25 A;  3GG2 A;  4E30 A;  2PP6 A;  3NFQ A;  4YXD C;  3L74 D;  1RE4 C;  1WII A;  1VQM P;  1K9M Q;  3IFU A;  2FFD A;  2NPS C;  2GA1 A;  3CX5 H;  3VMY A;  5CHX A;  3TF5 A;  3HD7 A;  5GTH H;  3D6W A;  3AE6 C;  1JY3 P;  2JIQ A;  5APW A;  1YIT Z;  2E7Z A;  2Q3E A;  4E31 A;  1M57 D;  2M8R A;  1VQ5 Z;  2IYO A;  2E5T A;  1PGJ A;  2O3J A;  1RQF A;  3PTZ A;  2V7Q J;  1GL2 A;  3W68 A;  3V6I A;  2HU9 A;  2E75 D;  2M5A A;  1LTI C;  2IZ1 A;  3VN0 A;  2J59 M;  1JTH A;  1EDJ A;  1FDI A;  3H32 A;  1OWA A;  3I4N I;  1W2B Y;  2AEF A;  1NU1 J;  4EDF A;  2Y9Y A;  2IZ0 A;  3TDH B;  1LT9 A;  1H0T A;  4ZMD A;  2PAJ A;  1S1C X;  3KQG A;  1NTZ J;  3L71 G;  3M91 A;  3VMG A;  1QVF O;  2QJK C;  4I7Z B;  1Z03 A;  3ZDM A;  1HJ0 A;  1NAF A;  3NH8 A;  4A3L I;  4ZNC A;  2C9N Y;  4IFD K;  3G9R A;  4E2X A;  5AW4 B;  4C7N B;  4L75 A;  4O9B A;  1QVF Y;  3M4O I;  1QVG Y;  4NBE A;  4W80 A;  2QLV B;  1EZV G;  3D6Z A;  4N3Y B;  2AKL A;  4PJ0 E;  1M90 2;  1DX7 A;  1W2B O;  2ZVN B;  3H1L J;  2FBW C;  3HE4 B;  2CPB A;  2QJK B;  1VQL P;  4NBD A;  3G71 1;  3PO2 I;  4PD4 H;  1BDD A;  2M5A B;  1NYH A;  4R4M A;  5AVY B;  4AUW A;  1NO4 A;  1U57 A;  1NTK D;  1QF8 A;  3G6E 1;  2OOX B;  1PPJ G;  3RL0 g;  3VMA A;  4UB6 H;  2K5R A;  1NTK J;  1RH5 B;  2RBL A;  1U7M A;  1A02 J;  1J1E C;  3GHG A;  1RO2 A;  2FYU D;  1RF0 C;  3HUS C;  1H89 A;  2Y0S A;  3VP8 A;  2JWA A;  3KPE A;  4Y7N I;  1QEX A;  3GF3 A;  1UII A;  2RMZ A;  2FYU J;  4PD4 E;  2K9J B;  5IP7 I;  3HTK A;  4KJM A;  2NPS B;  1SFC C;  2PK7 A;  3I56 Z;  1RF1 B;  1BE3 D;  4H44 B;  4TT3 H;  1I50 I;  3AEC C;  1BCC G;  1M1J B;  1AA6 A;  3CD6 Z;  2FYN B;  1IC2 A;  5AVW B;  1MV8 A;  4BRY B;  5AVZ B;  1KYO I;  2PRR A;  3EFF K;  1KFM A;  1URQ C;  1X79 B;  1SQQ J;  4HGZ A;  5K5G B;  4W7Y A;  2AXT E;  1N2D C;  3BCC E;  1DL6 A;  3JAM b;  1YI2 1;  1JY3 O;  4MN4 C;  5AVS B;  2E43 A;  2XZR A;  1VQP 1;  1YJN 1;  2FYU E;  1Q82 2;  3Q5R A;  1KYO D;  3MON A;  2JA5 I;  3BVH A;  1VQK 1;  2WSF J;  1K04 A;  4OWF A;  3FKI I;  4HJG H;  1VQ8 1;  1R5L A;  1LTG C;  3HOU I;  3L35 A;  2YKP A;  3WUT A;  1IK7 A;  5AVQ B;  2FYU K;  2FXP A;  3CXH H;  1T6A A;  3BAT A;  1NH4 A;  3A0H E;  1JY2 P;  2QM7 A;  1N7S D;  1QL1 A;  2IFM A;  2A45 I;  2R5B A;  2C9L Y;  1KIL E;  1FC2 C;  1BGY D;  3HTK B;  1FOS E;  1T2K C;  3H1K G;  1RF1 A;  1L4A A;  3L71 E;  5CM2 M;  3S15 I;  3CCV 1;  2WQY C;  2RN0 A;  2D2C B;  3V5B A;  5D1O A;  3H1K D;  3H1J D;  5T67 A;  4NBC A;  2F4M A;  4BRY A;  5CCH A;  5AW9 B;  4DK1 A;  1YHQ 1;  4PV1 B;  3CC7 1;  2BEQ D;  4JPZ B;  2P10 A;  3P8C D;  4IFF A;  3CPW Z;  1YIJ Z;  2QJY C;  3GF7 A;  4DQY B;  3IFM A;  3W67 A;  2ZJS E;  1ZR2 A;  3CX5 I;  1NJI 1;  2KLU A;  1RNI A;  1ZLL A;  1KB9 H;  2WPQ A;  3HOX I;  2WTY A;  1LT9 B;  1ZW0 A;  3JC2 2;  3L70 G;  4NOZ A;  3AE7 C;  3CCJ Z;  3V2Q A;  3MZW B;  1X8Y A;  3S4R A;  2A45 G;  2BAS A;  4OVN F;  5CMZ A;  3S1N I;  3U1A A;  3CCM 1;  4HKZ H;  1RO0 A;  2RH0 A;  3D70 A;  3D2L A;  3OW2 Z;  2A06 E;  3HOV I;  2Z4E A;  2NAP A;  4QTT A;  4DCK A;  1L4A B;  4I1L A;  3H1I G;  1KQG B;  4R4L A;  3VB9 A;  2Q5U A;  1VQ4 P;  2J6A A;  3Q3D A;  2HFE D;  1HVV A;  3S9O A;  1KIL B;  2IFN A;  4IL6 E;  4KHX A;  1ZB8 A;  2R7Z I;  3IAO A;  2GUS A;  2WVR A;  1PP9 E;  3VMI A;  2HG5 D;  1YJW P;  1LP1 A;  1GU5 A;  3I55 P;  4UB6 E;  3A5T A;  1K8A 1;  2QA4 P;  2QG4 A;  2QA4 Z;  1HH0 A;  3CCU 1;  3SFE C;  1IFD A;  3L75 G;  4K3A A;  3CCR 1;  2ITA A;  1JY2 O;  1QYP A;  1X9V A;  1VQP Z;  1L4A C;  5C3E I;  3A3Y B;  2W83 C;  1DEE G;  1VQ5 P;  3P8C E;  1Q90 D;  1LGH B;  4DZO A;  1KYO H;  3V2N A;  3VTP C;  3IX0 A;  1VF5 B;  3GTL I;  1VQ4 Z;  3KIH A;  1KOR A;  2NVY I;  3AE4 C;  4E2Z A;  1X3W A;  1YTZ I;  3SFD C;  3RBX A;  3G71 Z;  4A3E I;  2YXQ B;  1SQQ K;  3H1J E;  2OQQ A;  1K8A 2;  3H1K E;  3SWY A;  1JM0 A;  1YBK A;  5LL6 f;  2M3B A;  3CWB J;  1LTT C;  2YMK A;  4AYB A;  2NPS A;  4GOF A;  5A2Q b;  2VPY A;  1QL2 A;  3G6E Z;  1G1I A;  3I07 A;  3TGU J;  2IYP A;  3H1H D;  5AN9 F;  3I4M I;  2KB7 P;  2KZI A;  2KZJ A;  3BCC D;  3SSU A;  3L75 D;  3H1H J;  1WZN A;  3M9H A;  4ASV A;  3R2P A;  2J5U A;  2R3S A;  4CL1 A;  3L75 J;  2W03 A;  1RQV A;  2Z5I A;  3CCL Z;  3L70 J;  4NBG A;  2DW3 A;  2B89 A;  1SQP J;  4U3F E;  2ZXE B;  2E5Y A;  2QVA A;  2IPP A;  1FDO A;  3B5N D;  1LTJ C;  1W5C E;  1N7S B;  4WBA A;  2K37 A;  1IFP A;  1GTW A;  1KB9 D;  3CC2 P;  3L4F A;  2EGT A;  2P2U A;  3L72 J;  3MZK B;  5AW1 B;  2IZ4 A;  3P5J B;  1BCC E;  5DJT B;  1EZV D;  4H0L B;  3KIF A;  1WCM I;  1K8A Q;  3FWL A;  2Y0C A;  2DE6 A;  3H1L E;  1MUU A;  4JBZ A;  4RVD A;  2W27 A;  4C46 A;  1VQ9 Z;  3IN6 A;  1SQV E;  1UIX A;  2YIU C;  2E2J I;  2E74 B;  1JOC A;  3JCU E;  3RL0 D;  3JAM f;  1L1O C;  1NVO A;  3TGU E;  2O01 N;  3P7K A;  5D1O B;  4XFJ A;  1SVF A;  1YHQ Z;  2N9Y B;  3TNU B;  2P28 A;  3RZO I;  3L70 D;  5AW5 B;  3H1J J;  4D6T D;  1SQP G;  1RY3 A;  1K73 2;  1VQO Z;  3UIA A;  4DOJ A;  2Q51 A;  1NHL A;  1KQF B;  5AVX B;  2XU6 A;  1VQL 1;  2QSI A;  3KHU A;  1R9T I;  4U7J A;  3LW5 J;  2E74 C;  2KS1 B;  2YIU B;  1OVV A;  3VTN A;  2FKW B;  1HTL C;  4NPD A;  2I8D A;  3OAK A;  5KJ7 C;  3IR9 A;  1N7S A;  1Y1V S;  1GW4 A;  1NJI Q;  3CMA P;  4RJT A;  2AXT H;  1DIP A;  1G2C B;  2JNY A;  1BDC A;  1YIJ 1;  1PP9 J;  4KT0 J;  3NH4 A;  3SWF A;  4QMA A;  2K9J A;  1T8Z A;  1YI2 Z;  3HD7 D;  2VUM I;  3E7K A;  4NBA A;  1M1J A;  1NU1 D;  2DE5 A;  1KIL A;  3D9X A;  1Z02 A;  1Q2N A;  2B87 A;  1NWQ A;  3A0H H;  3EER A;  4BY7 I;  2I1K A;  3C8V A;  1PPJ D;  3EED A;  1RHZ B;  3N4X A;  3GHG C;  1X0T A;  4BY1 I;  3VMZ A;  2OTJ 1;  3FGA D;  1LTS C;  3H6P A;  1NTK G;  3L74 J;  2G8Y A;  1NJI 2;  5EFW B;  1M8O B;  1PL5 A;  3H1I D;  5TIS E;  1JTH B;  1VPC A;  3L73 J;  2N1T A;  1OVU A;  5CCH C;  3FX0 A;  3H32 B;  4JF7 A;  3WUV A;  1CW5 A;  3S1R I;  4W7Z A;  5KJ7 D;  4JQ0 D;  1YJ9 P;  1EDI A;  1GK4 A;  3ITK A;  4OH8 B;  3OW2 O;  3CCE 1;  1FZG A;  2A45 H;  1GZL A;  4BWN A;  1VQ7 Z;  1YJN P;  1S7M A;  4RO0 A;  4X6A I;  1NTM D;  1L0N J;  4HB1 A;  5FLX b;  3BAS A;  3KZI H;  1VQK P;  3L74 E;  2VPW A;  2Y0E A;  2GU2 A;  3N7N A;  3LUS A;  3RBZ A;  1T2K D;  2HR3 A;  1PGO A;  2IDB A;  1N7S C;  3MGN A;  5KLI C;  5KJ7 A;  3B5N A;  3QWO C;  1H88 A;  1LTJ B;  3GTJ I;  5C4X I;  4BXL A;  1KFN A;  4GOD A;  3FXE A;  3L71 J;  2W8Z A;  3Q5P A;  1GW3 A;  4MRI A;  3HE4 A;  3L71 D;  3AED C;  4WWI A;  3BG1 B;  2C0W A;  1JJ2 Z;  4Y28 J;  4C7R A;  1TWH I;  2M3E A;  1KC8 Q;  1FZE A;  5DJU B;  3CWB G;  1OW8 A;  3LIE A;  3A7O A;  3S17 I;  1WW9 A;  2WPR A;  3TK1 A;  1KIL C;  2J58 A;  2N1T B;  4A3F I;  3PHL A;  4WB4 A;  1IO4 A;  1BE3 J;  1IJD B;  4PJ0 H;  2D2C C;  2V45 A;  3GTK I;  1URQ D;  1BGY G;  3OA7 A;  2KLV A;  3SWK A;  4GIF A;  4JYB A;  4RES B;  1JNM A;  2QR1 B;  1SQX D;  4EWC A;  1PZQ A;  4H13 C;  2WSC H;  3RK3 E;  1VQN Z;  1SQQ E;  1NU1 K;  1M90 Q;  4BBS I;  3I56 P;  5KLV E;  1S5L H;  2AXC A;  2KUB A;  1VQK Z;  1FU1 A;  1RQU A;  1Q86 1;  3L36 A;  1SQQ D;  1VF5 D;  5FLM I;  2HYN A;  2AEJ A;  1SQB J;  1AJY A;  1JO5 A;  4A3I I;  3NFZ A;  4H13 B;  3J7A 4;  1WJ2 A;  1IZN B;  2XNX A;  1LTJ A;  5AW3 B;  1YQ4 C;  1L0L D;  1USE A;  3I5C A;  3HOY I;  2G3A A;  1E79 H;  1Z01 A;  1BE3 E;  1FZC A;  1FZA A;  3TSI A;  1Q7Y 2;  2BCC G;  1P84 I;  2R44 A;  2Q4Z A;  1HWT C;  1Q86 2;  3USS A;  1Y8A A;  3L72 E;  1S9K E;  4EYY Q;  1NTM K;  3Q1M A;  3I55 1;  3F5H A;  4WY4 D;  1VQL Z;  4H0L D;  1JB0 J;  2KS1 A;  2OTJ Z;  2QA4 1;  3U50 C;  1LTA C;  2KOG A;  4N78 E;  2ZAE B;  4OGQ D;  1TWC I;  1L2P A;  3CCL P;  2P67 A;  1JMM A;  4HYT B;  1YUK A;  3L70 E;  1U7J A;  2N1T C;  2JA7 I;  2W6A A;  5KTB A;  1KV4 A;  1SQB D;  1LWU B;  2OYI B;  4GOE A;  1G2C A;  5B66 H;  3CCQ 1;  2B88 A;  3L72 D;  1P84 D;  2K3R A;  2I1J A;  3BG0 B;  5KAI E;  1SQV D;  3PH0 A;  3V4Q A;  3II6 A;  2B63 I;  1EDL A;  2WSE J;  2HF1 A;  5AW7 B;  1W2B Z;  1PV3 A;  3AEE C;  4A3C I;  2H88 C;  1YIT 1;  3CC4 Z;  1J2J B;  2HOD A;  1HUC A;  1YJN Z;  1WMK A;  2M48 A;  2QRD B;  1PP9 G;  2OYH A;  1Q81 1;  1G1J A;  1FE6 A;  1Y9B A;  1H8A A;  2N9B A;  3IF4 A;  5KLV J;  4NB9 A;  1VQM Z;  3CC2 Z;  2W6B A;  4AQR D;  2O53 A;  4D6T J;  2BJO A;  2WIT A;  5AW6 B;  2XV5 A;  5B66 E;  2RIQ A;  4ZKU A;  3GTO I;  2E74 D;  5CCG C;  2IV2 X;  5B5E E;  2JA6 I;  3AEF C;  1KQS Y;  1NU1 E;  1Q82 Q;  1SQX E;  2QM8 A;  3PO3 I;  1Z56 A;  1N86 A;  3CXC Z;  1LQL A;  2WT7 B;  1AV1 A;  2QJP B;  4WY4 C;  2OTK E;  1XTC C;  5APY A;  1WT6 A;  1BSN A;  4QTU A;  1K73 1;  3AE2 C;  3JSV C;  1TU3 F;  1HJB A;  1KD1 2;  2FXM A;  4NPE A;  3B5N B;  1QVG Z;  1J1D B;  1SQX K;  5KKZ B;  1GD2 E;  1ZR4 A;  2Q9I A;  2QJY B;  2ZYD A;  1TFI A;  4MXU A;  2HOD B;  4H13 D;  1NP6 A;  5AVR B;  2O4H A;  5AVV B;  2CPS A;  3P32 A;  3PP5 A;  3O6Q B;  3HE5 A;  1NGM B;  2ZT9 B;  2NPS D;  4D6T E;  2WSF H;  2KXP B;  1LWU C;  2OYI C;  1KD1 1;  3AEG C;  2VUG A;  3PRJ A;  2O01 J;  3B8E B;  5C39 A;  3WU2 H;  1S5L E;  3HRN A;  1K9M 2;  1SFC B;  3TGU D;  2LXC B;  3CCE Z;  1N73 A;  2PGD A;  2Y9Z A;  1X22 A;  3L73 E;  2R3C A;  1VQ9 1;  1N8R 2;  1N8R Q;  3GLM A;  2JDI H;  1TWA I;  2OOY B;  4I7Z C;  4MON A;  3BCC G;  3AE9 C;  5E79 H;  3H1I E;  5CCG A;  3F3F C;  1BCC D;  3CMA 1;  1L0N D;  3O8Z A;  1YJ9 Z;  2KYV A;  2HPC B;  1P84 H;  1EZV I;  1OX3 A;  5GTI H;  3CCJ 1;  3CC4 1;  1S72 1;  3AE5 C;  5KLV G;  2YO3 A;  1OW7 A;  1K9M 1;  1VQ8 Z;  1YIJ P;  1KZU B;  4PD4 I;  3WU2 E;  2H8P D;  3CI9 A;  2V4H A;  1FAV A;  4RV9 A;  2M0B A;  5AW2 B;  2LFU A;  2JA8 I;  2Q3I A;  3L74 G;  3RK3 D;  3M9B A;  4ASW A;  2OZK A;  3J80 b;  1VQN 1;  1KC8 1;  1Q16 A;  4CPG A;  1CI6 A;  4A3K I;  1NTZ D;  4Y52 I;  3HE5 B;  1J1D C;  3E1R A;  3LID A;  1Q86 Q;  3AE8 C;  4BXX I;  3T4N B;  4A3D I;  3Q5S A;  2I3C A;  2QJP C;  3S2H I;  3L75 E;  3CWB D;  1YI2 P;  1L4A D;  5AW8 B;  1KTM A;  4NBF A;  1VQP P;  1LJ2 A;  3KZI E;  3H1H G;  1SFC A;  1M1J C;  5C44 I;  3G71 P;  2JR6 A;  2R92 I;  2BCC J;  1VQ8 P;  2ZXX A;  4WVZ A;  4UB8 E;  2YAD A; 
#chains in the Genus database with same CATH homology
 3CD6 Z;  2KIK A;  3CCR Z;  1OVU A;  2NVQ I;  2V8I A;  4HH4 A;  1VQ7 1;  3S1R I;  1EDI A;  3M3Y I;  3CCE 1;  4RVG A;  3FXD A;  4NB8 A;  1JJ2 Y;  1VQ7 Z;  1S7M A;  4X6A I;  4NBB A;  4HGZ A;  1Q7Y 1;  5K5G B;  4HB1 A;  5FLX b;  2IZ3 A;  1JWH C;  3GTG I;  1DL6 A;  3JAM b;  1YI2 1;  4MN4 C;  1MFT A;  2GU2 A;  1VQP 1;  3RGU A;  3LUS A;  1YJN 1;  1SFO I;  1Q82 2;  1I6H I;  2JS4 A;  3MON A;  4RVH A;  2JA5 I;  3S16 I;  2HR3 A;  1VQK 1;  3PO3 S;  3FKI I;  3QWO C;  4HJG H;  3F3P C;  1VQ8 1;  1X3Z A;  2R93 I;  3GTJ I;  5C4X I;  4BXL A;  3HOU I;  4GOD A;  1TWG I;  3MHV A;  3FXE A;  4XX2 A;  1EC5 A;  1KRL A;  3CCS 1;  4E2W A;  3S1K A;  2LXB A;  4BBR I;  1K83 I;  4MRI A;  3QWU A;  4A93 I;  3CD6 1;  2QEX 1;  3BG1 B;  4WWI A;  1JJ2 Z;  1TWH I;  1FC2 C;  5DJU B;  3CMA Z;  3H0G I;  3S17 I;  3NH5 A;  5CM2 M;  3S15 I;  1WW9 A;  4MD8 A;  3CCV 1;  4E2Y A;  2GTI A;  3FQM A;  4A3M I;  5D1O A;  4A3F I;  5T67 A;  4NBC A;  1Y1W I;  2F4M A;  3S2D I;  2P3Y A;  3CC7 Z;  2LR2 A;  2LIY A;  1USP A;  2M6N A;  3GCF A;  2E2I I;  3GTK I;  3I56 1;  4DK1 A;  3I55 Z;  4RVF A;  2QR1 B;  1YHQ 1;  4EWC A;  3CC7 1;  3OW2 Y;  4K35 A;  1RLY A;  1VQ6 1;  3CPW Z;  3CME 1;  1YIJ Z;  1VQ4 1;  1VQN Z;  3HOZ I;  3S1Q I;  4DQY B;  4BBS I;  2B87 B;  2KUB A;  1VQK Z;  1RO4 A;  1Q86 1;  2QRX A;  5C4J I;  3HOW I;  2W04 A;  1NJI 1;  1RNI A;  1LT1 A;  5FLM I;  1USP B;  1ZB9 A;  3GKQ A;  2GTH A;  2NVT I;  3H3V J;  4A3I I;  3NFZ A;  3K7A I;  4RS4 A;  3TE5 B;  3HOX I;  3J7A 4;  1ML8 A;  1S3J A;  1ZW0 A;  2QEX Z;  1OVR A;  2NVX I;  4HGY A;  4NOZ A;  3CCU Z;  3CCJ Z;  1Y1V I;  2OTL Z;  3MZW B;  2R6M A;  4MD7 A;  3HOY I;  3GTM S;  1Z01 A;  2VF1 A;  3S1N I;  2QRC B;  2V8J A;  4NPF X;  2QRE B;  1I3Q I;  3CCM 1;  4HKZ H;  1RO0 A;  1Q7Y 2;  1SS1 A;  3OW2 Z;  1KC8 2;  3HOV I;  2R44 A;  2Q4Z A;  3Q87 A;  1Q86 2;  4QTT A;  5IT9 b;  3VB9 A;  2J6A A;  1Q81 2;  4EYY Q;  2R7Z I;  1ZB8 A;  4E32 A;  3I55 1;  1VQL Z;  2OTJ Z;  2QA4 1;  4A3J I;  2PM9 A;  3VMI A;  3U50 C;  1LP1 A;  4TNU A;  3G4S 1;  2YU9 I;  2E9H A;  2ZAE B;  1TWC I;  3GTP I;  5T64 A;  3MZL B;  1K8A 1;  3S1M I;  1ZXG A;  1ZH1 A;  1YUK A;  2QA4 Z;  3CCU 1;  1U7J A;  2JMO A;  3CCV Z;  2OTL 1;  4K3A A;  1YJW 1;  1M1K 1;  3CCR 1;  2JA7 I;  2H85 A;  5A2Q f;  1QYP A;  4GOE A;  1VQP Z;  3CCQ 1;  2B88 A;  5C3E I;  2K3R A;  1DEE G;  5CBN A;  3BG0 B;  2SPZ A;  3CCM Z;  1LP1 B;  3CQZ I;  3HKZ A;  3PH0 A;  3CCS Z;  5FLX f;  4MD9 A;  3CXC Y;  3IX0 A;  2B63 I;  3GTL I;  1VQ6 Z;  1EDL A;  2DE7 A;  2JUB A;  1VQ4 Z;  1VQ5 1;  3KIH A;  3IF8 A;  2HF1 A;  2NVY I;  1W2B Z;  4A3C I;  2UWJ E;  3CME Z;  4E2Z A;  1X3W A;  1N8R 1;  1S72 Z;  1YIT 1;  3CC4 Z;  2RT9 A;  3G71 Z;  3FQQ A;  4A3E I;  1YJN Z;  3CCQ Z;  1K8A 2;  2M48 A;  2WB1 A;  1JM0 A;  2QRD B;  5LL6 f;  1M1K 2;  2RHB A;  1Q81 1;  2KI7 B;  3RZD I;  1P9N A;  4AYB A;  4GOF A;  3ESW A;  5T6B A;  4NB9 A;  5A2Q b;  3G6E Z;  3CCL 1;  1VQM Z;  1H0T B;  1PFT A;  2KPI A;  3I07 A;  3CC2 Z;  4E30 A;  2P58 A;  5AN9 F;  3I4M I;  1VQO 1;  2G2K A;  2KZI A;  2O53 A;  2BJO A;  2KZJ A;  2RIQ A;  2V8K A;  3J81 b;  3G4S Z;  3GTO I;  1WII A;  2JA6 I;  2PMZ A;  1KQS Y;  3IFU A;  4ASV A;  3PO3 I;  2JWD A;  1YUA A;  4CL1 A;  3CXC Z;  2WAQ A;  1LQL A;  2W03 A;  3D6W A;  3CCL Z;  1VQM 1;  3J81 f;  4S1T A;  4NBG A;  1KQS Z;  3NDJ A;  2B89 A;  1Q82 1;  2OTK E;  1YIT Z;  2QVA A;  4QTU A;  1K73 1;  4NFR A;  3J80 f;  4E31 A;  1VQ5 Z;  1N2F A;  1KD1 2;  1RQF A;  4NPE A;  2HU9 A;  1QVG Z;  2EGT A;  2M5A A;  4A3G I;  3MZK B;  2IZ4 A;  3P5J B;  1EDJ A;  5DJT B;  1TFI A;  5IP9 I;  4MXU A;  3KIF A;  1WCM I;  3I4N I;  3GTM I;  3NDI A;  1W2B Y;  1NP6 A;  2O4H A;  2DE6 A;  4JBZ A;  4RVD A;  3TDH B;  1VQ9 Z;  1H0T A;  2E2J I;  1QVF Z;  1NUI A;  3JAM f;  4ZMD A;  1L1O C;  1NVO A;  3VMG A;  4DGL A;  1KD1 1;  5D1O B;  2VUG A;  1Z03 A;  3ZDM A;  3NH8 A;  3S14 I;  4A3L I;  5C39 A;  4ZNC A;  1YHQ Z;  1K9M 2;  2P28 A;  3RZO I;  4E2X A;  2LXC B;  1QVF Y;  3CCE Z;  3M4O I;  4NBH A;  1QVG Y;  4NBE A;  2F4O A;  2QLV B;  3CC2 1;  1EDK A;  1K73 2;  1VQ9 1;  2AKL A;  1VQO Z;  1N8R 2;  1TWF I;  4IOI H;  1M90 2;  2Q51 A;  1TWA I;  2OOY B;  3GTQ I;  4MON A;  1VQL 1;  5IT9 f;  1R9T I;  1VLA A;  3F3F C;  3CMA 1;  2KS1 B;  1OVV A;  2Q1K A;  3VTN A;  4NPD A;  1YJ9 Z;  2I8D A;  3CCJ 1;  1Y1V S;  3CC4 1;  4NBD A;  1S72 1;  3G71 1;  3PO2 I;  1K9M 1;  1BDD A;  2M5A B;  1VQ8 Z;  4NH1 C;  1Y47 A;  4RV9 A;  2M0B A;  2LFU A;  2JA8 I;  3CPW Y;  1QF8 A;  2JNY A;  2WMM A;  1BDC A;  4ASW A;  2OZK A;  3J80 b;  3G6E 1;  1YIJ 1;  1VQN 1;  2OOX B;  1KC8 1;  4CPG A;  1YJ9 1;  4A3K I;  3NH4 A;  1YJW Z;  2K5R A;  4Y52 I;  4A3B I;  1YI2 Z;  2RBL A;  3VMH A;  2VUM I;  1U7M A;  4BXX I;  5D1P A;  3T4N B;  4A3D I;  1JMB A;  5CBO A;  4NBA A;  1RO2 A;  2I3C A;  2DE5 A;  3D9X A;  1Z02 A;  1Q2N A;  3S2H I;  2Y0S A;  2B87 A;  2QKD A;  4MH4 A;  2RKL A;  4Y7N I;  4NBF A;  3EER A;  4BY7 I;  3EED A;  1M90 1;  1X0T A;  4BY1 I;  2OTJ 1;  2E2H I;  5IP7 I;  5C44 I;  2JR6 A;  2R92 I;  1NJI 2;  4KJM A;  3I56 Z;  2PK7 A;  2RPR A;  5EFW B;  4E33 A;  2YAD A;  1I50 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...