2E2II

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dgtp
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2iI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2iI02
3GTLI 2NVTI 3M4OI 3VMHA 4A3II 2F4OA 2E2JI 1YUAA 3EERA 2DE7A 3I07A 3CQZI 1I6HI 2R93I 2R7ZI 3U50C 5C4JI 3HOYI 3S1QI 4MH4A 2JA6I 2F4MA 1USPB 4A3LI 2BJOA 3HOUI 1RLYA 1LQLA 4A93I 1Y1WI 3S1MI 1ZB9A 3VB9A 3Q87A 3ESWA 1VLAA 1WW9A 3VMIA 1N2FA 4BBSI 2YU9I 3I4MI 4NBGA 2JS4A 5C4XI 3HOZI 1ML8A 3HOWI 3RZDI 3PO3I 5IP9I 3S2HI 3HOXI 2VUMI 2K5RA 4BY7I 4A3GI 1X3ZA 3PO3S 1TWCI 2JNYA 4A3EI 1SFOI 5C3EI 4NBFA 5C44I 2AKLA 3M3YI 3GKQA 1WCMI 1ZB8A 3LUSA 5CM2M 1I50I 4QTUA 4NB9A 4A3FI 3GTQI 4A3MI 1RO4A 1USPA 3S2DI 2JA5I 4NBBA 4BY1I 5IP7I 2R92I 3GTKI 1NUIA 2NVYI 4XX2A 1R9TI 3GTMI 3PO2I 3VMGA 4A3KI 4BXXI 1I3QI 1Y1VI 3S16I 1PFTA 1X3WA 3S14I 3RZOI 4X6AI 3D6WA 3GTMS 2J6AA 3S1RI 2JA8I 2PK7A 2B63I 1Y1VS 1L1OC 2E2II 3GCFA 1TWAI 4A3DI 4NB8A 2HF1A 4A3JI 4BBRI 1K83I 3S17I 4A3CI 1TWHI 2NVQI 2NVXI 3K7AI 1TFIA 3I4NI 4Y7NI 1QYPA 1DL6A 3GTOI 4QTTA 1TWGI 3S15I 4Y52I 2DE5A 3GTJI 4NBAA 4NBHA 5FLMI 4A3BI 3H3VJ 2JA7I 1TWFI 3FKII 3HOVI 2P3YA 2KPIA 3GTGI 3S1NI 3H0GI 2JR6A 4NBDA 2RBLA 2E2HI 4NBEA 3GTPI 4NOZA 4NBCA 2DE6A
chains in the Genus database with same CATH superfamily
3D2LA 3VMHA 2F4OA 1K732 2QEXZ 3G6E1 3I07A 3CCV1 3IR7A 3CCLZ 1VQ5Z 2R6MA 3BG0B 3U50C 2JIMA 1VQNZ 5IT9b 3I55Z 3HKZA 1M1K2 3CMEZ 1ZB9A 3ESWA 2QLVB 4MRIA 1JWHC 2YU9I 2RHBA 2JS4A 4NBGA 1ML8A 3HOWI 2OTLZ 2RT9A 3MZKB 2QKDA 1RNIA 2RPRA 1VQOZ 1VQ61 2K5RA 3CC4Z 2Y0SA 4A3GI 1YITZ 1KD12 3CCE1 1QVGY 3FQMA 3GKQA 1VQ4Z 1ZB8A 5CM2M 2JIQA 4A3FI 2Q51A 1Q811 1USPA 3S2DI 2JA5I 2VPXA 5D1PA 1VQ7Z 4RVDA 2W04A 2I3CA 2V8IA 3S16I 4RS4A 1PFTA 2VUGA 3G711 3RZOI 1VQMZ 4X6AI 3CC71 3S1RI 3OW2Y 2PK7A 4CL1A 3J81b 5FLXf 2E2II 3CCM1 2E7ZA 4BBRI 1K83I 3NH8A 3S17I 4A3CI 1TWHI 2NVQI 4MXUA 3G6EZ 5FLXb 1K9M2 3CCVZ 2ZAEB 1QYPA 4MONA 1Q822 3GTOI 4QTTA 3GTJI 4TNUA 4NBAA 2YADA 4NBHA 5FLMI 2E9HA 3TDHB 3H3VJ 2JA7I 3FKII 2P3YA 3GTGI 4RV9A 1K731 1NJI2 2JIPA 3H0GI 2JR6A 4AYBA 4NBDA 1VQ6Z 4NFRA 2JMOA 4NBEA 2EGTA 4NBCA 2DE6A 3CCEZ 4A3II 2V45A 2HU9A 5D1OB 3CPWZ 2GTHA 2VPWA 1YIJ1 2VF1A 1VQL1 3HOYI 2QR1B 3CCUZ 4RVGA 3S1MI 3VB9A 3Q87A 3G71Z 1VLAA 3EEDA 3CC7Z 1KD11 3CXCY 3I4MI 2WAQA 2QA4Z 1JJ2Z 2Q4ZA 2VPYA 3CD6Z 3JAMb 5IP9I 3S2HI 2VUMI 4BY7I 3CCJ1 1X3ZA 1QF8A 5IT9f 2JNYA 1SFOI 3M3YI 3CXCZ 1Z03A 2V8JA 2OOYB 3I561 1YI21 2M6NA 2JIRA 1QVFY 2NVYI 2IV2X 3KIFA 1X3WA 3S14I 3F3FC 1VQK1 3D6WA 4NH1C 1YJWZ 1Q821 2B63I 1S721 2QRDB 1P9NA 1L1OC 4A3DI 2HF1A 1S7MA 1QVFZ 4HGZA 3CCRZ 2NVXI 3K7AI 1TFIA 2KI7B 4Y7NI 1DL6A 3CCS1 4Y52I 3CCQZ 3J7A4 2G2KA 3J81f 1QVGZ 4DQYB 1KC81 1TWFI 2M48A 1Q861 2KPIA 3T4NB 1NP6A 1YUKA 3NDIA 3MZLB 1K8A2 4NOZA 3MONA 3G4S1 1W2BY 3M4OI 1Y8CA 4E2ZA 3NH5A 3OW2Z 3D9XA 2DE7A 4E32A 2R93I 1X0TA 1YI2Z 1VQP1 2P28A 1ZH1A 5C4JI 2JIOA 4MD8A 4MH4A 4A3LI 2BJOA 3HOUI 1VQ91 4A93I 1Y1WI 2GTIA 1VQKZ 1N2FA 4BBSI 1Q7Y2 5C4XI 1VQN1 4S1TA 1M1K1 3CMA1 1TWCI 4A3EI 5C3EI 2AKLA 2OTL1 5D1OA 5T67A 1WCMI 1VQO1 1I50I 4NB9A 2V8KA 4A3MI 1RO4A 1M902 2QRCB 2O53A 4DK1A 3JAMf 4NBBA 4BY1I 1NUIA 4XX2A 3CCMZ 4RVHA 3PO2I 3VMGA 4BXXI 1I3QI 2JUBA 4HH4A 1YHQ1 1N8R2 4E33A 5A2Qf 3G4SZ 3GCFA 3NFZA 4NB8A 1QXFA 4A3JI 4E2WA 4MD7A 2AYDA 5A2Qb 3I4NI 1VQPZ 1FDIA 1TWGI 1Z02A 2WB1A 3S15I 1RO0A 2DE5A 1VQ9Z 1RQFA 1K9M1 3CC21 1K8A1 4E2XA 2OTJ1 2W03A 5T6BA 2K3RA 2PMZA 2LIYA 2NAPA 1YJ91 2IZ3A 3CMAZ 3FQQA 1AA6A 3GTPI 2IZ4A 1RO2A 1YIJZ 1YJN1 1WJ2A 1Z01A 1VQLZ 2NVTI 3GTLI 3IX0A 3TE5B 4E2YA 1Q16A 2E2JI 1NJI1 1YUAA 3EERA 3CQZI 1I6HI 3NH4A 3NDJA 1Q7Y1 2R7ZI 3S1QI 2JA6I 2F4MA 1USPB 2QREB 3IF8A 1VQ81 1RLYA 1LQLA 1SIWA 3VMIA 1WW9A 2H85A 3CCJZ 3P5JB 1YHQZ 3HOZI 3CCU1 4E31A 3RZDI 2GU2A 3PO3I 3HOXI 4MD9A 2RIQA 1M901 2QA41 3PO3S 3I56Z 4NBFA 3CD61 5C44I 3LUSA 3QWUA 2QEX1 2OZKA 3KIHA 4QTUA 5T64A 1W2BZ 3GTQI 3CCL1 3CC2Z 1VQ51 1N8R1 5IP7I 2R92I 1S72Z 2OTJZ 3GTKI 4HGYA 1R9TI 3I551 1KRLA 3GTMI 2LFUA 4A3KI 1Y1VI 3CME1 4RVFA 1YJ9Z 1Q812 2J6AA 2O4HA 2JA8I 3GTMS 1Y1VS 3CCSZ 1YJNZ 1TWAI 3CPWY 1WIIA 2OOXB 3CC41 1WZNA 3IFUA 3J80f 5LL6f 1KC82 1FDOA 1YJW1 1YIT1 1Q862 2PM9A 4E30A 3J80b 2LEXA 1VQ41 2VPZA 4EWCA 5AN9F 1VQ8Z 3CCR1 1KQSY 4A3BI 1JJ2Y 3F3PC 1VQ71 3VTNA 3HOVI 3CCQ1 3S1NI 1VQM1 4DGLA 2V3VA 2RBLA 2E2HI 3BG1B 1KQSZ
chains in the Genus database with same CATH topology
3VMHA 2F4OA 1K732 2QEXZ 3G6E1 3I07A 3CCV1 3CCLZ 1VQ5Z 2R6MA 3BG0B 3U50C 1VQNZ 5IT9b 3I55Z 3HKZA 1M1K2 3CMEZ 1ZB9A 3ESWA 2QLVB 4MRIA 1JWHC 2YU9I 2RHBA 2JS4A 4NBGA 1ML8A 3HOWI 2OTLZ 2RT9A 3MZKB 2QKDA 1RNIA 2RPRA 1VQOZ 1VQ61 2K5RA 3CC4Z 2Y0SA 4A3GI 1YITZ 1KD12 3CCE1 1QVGY 3FQMA 3GKQA 1VQ4Z 1ZB8A 5CM2M 4A3FI 2Q51A 1Q811 1USPA 3S2DI 2JA5I 5D1PA 1VQ7Z 4RVDA 2W04A 2I3CA 2V8IA 3S16I 4RS4A 1PFTA 2VUGA 3G711 3RZOI 1VQMZ 4X6AI 3CC71 3S1RI 3OW2Y 2PK7A 4CL1A 3J81b 5FLXf 2E2II 3CCM1 4BBRI 1K83I 3NH8A 3S17I 4A3CI 1TWHI 2NVQI 4MXUA 3G6EZ 5FLXb 1K9M2 3CCVZ 2ZAEB 1QYPA 4MONA 1Q822 3GTOI 4QTTA 3GTJI 4TNUA 4NBAA 2YADA 4NBHA 5FLMI 2E9HA 3TDHB 3H3VJ 2JA7I 3FKII 2P3YA 3GTGI 4RV9A 1K731 1NJI2 3H0GI 2JR6A 4AYBA 4NBDA 1VQ6Z 4NFRA 2JMOA 4NBEA 2EGTA 4NBCA 2DE6A 3CCEZ 4A3II 2HU9A 5D1OB 3CPWZ 2GTHA 1YIJ1 2VF1A 1VQL1 3HOYI 2QR1B 3CCUZ 4RVGA 3S1MI 3VB9A 3Q87A 3G71Z 1VLAA 3EEDA 3CC7Z 1KD11 3CXCY 3I4MI 2WAQA 2QA4Z 1JJ2Z 2Q4ZA 3CD6Z 3JAMb 5IP9I 3S2HI 2VUMI 4BY7I 3CCJ1 1X3ZA 1QF8A 5IT9f 2JNYA 1SFOI 3M3YI 3CXCZ 1Z03A 2V8JA 2OOYB 3I561 1YI21 2M6NA 1QVFY 2NVYI 3KIFA 1X3WA 3S14I 3F3FC 1VQK1 3D6WA 4NH1C 1YJWZ 1Q821 2B63I 1S721 2QRDB 1P9NA 1L1OC 4A3DI 2HF1A 1S7MA 1QVFZ 4HGZA 3CCRZ 2NVXI 3K7AI 1TFIA 2KI7B 4Y7NI 1DL6A 3CCS1 4Y52I 3CCQZ 3J7A4 2G2KA 3J81f 1QVGZ 4DQYB 1KC81 1TWFI 2M48A 1Q861 2KPIA 3T4NB 1NP6A 1YUKA 3NDIA 3MZLB 1K8A2 4NOZA 3MONA 3G4S1 1W2BY 3M4OI 4E2ZA 3NH5A 3OW2Z 3D9XA 2DE7A 4E32A 2R93I 1X0TA 1YI2Z 1VQP1 2P28A 1ZH1A 5C4JI 4MD8A 4MH4A 4A3LI 2BJOA 3HOUI 1VQ91 4A93I 1Y1WI 2GTIA 1VQKZ 1N2FA 4BBSI 1Q7Y2 5C4XI 1VQN1 4S1TA 1M1K1 3CMA1 1TWCI 4A3EI 5C3EI 2AKLA 2OTL1 5D1OA 5T67A 1WCMI 1VQO1 1I50I 4NB9A 2V8KA 4A3MI 1RO4A 1M902 2QRCB 2O53A 4DK1A 3JAMf 4NBBA 4BY1I 1NUIA 4XX2A 3CCMZ 4RVHA 3PO2I 3VMGA 4BXXI 1I3QI 2JUBA 4HH4A 1YHQ1 1N8R2 4E33A 5A2Qf 3G4SZ 3GCFA 3NFZA 4NB8A 4A3JI 4E2WA 4MD7A 5A2Qb 3I4NI 1VQPZ 1TWGI 1Z02A 2WB1A 3S15I 1RO0A 2DE5A 1VQ9Z 1RQFA 1K9M1 3CC21 1K8A1 4E2XA 2OTJ1 2W03A 5T6BA 2K3RA 2PMZA 2LIYA 1YJ91 2IZ3A 3CMAZ 3FQQA 3GTPI 2IZ4A 1RO2A 1YIJZ 1YJN1 1Z01A 1VQLZ 2NVTI 3GTLI 3IX0A 3TE5B 4E2YA 2E2JI 1NJI1 1YUAA 3EERA 3CQZI 1I6HI 3NH4A 3NDJA 1Q7Y1 2R7ZI 3S1QI 2JA6I 2F4MA 1USPB 2QREB 3IF8A 1VQ81 1RLYA 1LQLA 3VMIA 1WW9A 2H85A 3CCJZ 3P5JB 1YHQZ 3HOZI 3CCU1 4E31A 3RZDI 2GU2A 3PO3I 3HOXI 4MD9A 2RIQA 1M901 2QA41 3PO3S 3I56Z 4NBFA 3CD61 5C44I 3LUSA 3QWUA 2QEX1 2OZKA 3KIHA 4QTUA 5T64A 1W2BZ 3GTQI 3CCL1 3CC2Z 1VQ51 1N8R1 5IP7I 2R92I 1S72Z 2OTJZ 3GTKI 4HGYA 1R9TI 3I551 1KRLA 3GTMI 2LFUA 4A3KI 1Y1VI 3CME1 4RVFA 1YJ9Z 1Q812 2J6AA 2O4HA 2JA8I 3GTMS 1Y1VS 3CCSZ 1YJNZ 1TWAI 3CPWY 1WIIA 2OOXB 3IFUA 3J80f 3CC41 1KC82 5LL6f 1YJW1 1YIT1 1Q862 2PM9A 4E30A 3J80b 1VQ41 4EWCA 5AN9F 1VQ8Z 3CCR1 1KQSY 4A3BI 1JJ2Y 3F3PC 1VQ71 3VTNA 3HOVI 3CCQ1 3S1NI 1VQM1 4DGLA 2RBLA 2E2HI 3BG1B 1KQSZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL I;  2NVT I;  3M4O I;  3VMH A;  4A3I I;  2F4O A;  2E2J I;  1YUA A;  3EER A;  2DE7 A;  3I07 A;  3CQZ I;  1I6H I;  2R93 I;  2R7Z I;  3U50 C;  5C4J I;  3HOY I;  3S1Q I;  4MH4 A;  2JA6 I;  2F4M A;  1USP B;  4A3L I;  2BJO A;  3HOU I;  1RLY A;  1LQL A;  4A93 I;  1Y1W I;  3S1M I;  1ZB9 A;  3VB9 A;  3Q87 A;  3ESW A;  1VLA A;  1WW9 A;  3VMI A;  1N2F A;  4BBS I;  2YU9 I;  3I4M I;  4NBG A;  2JS4 A;  5C4X I;  3HOZ I;  1ML8 A;  3HOW I;  3RZD I;  3PO3 I;  5IP9 I;  3S2H I;  3HOX I;  2VUM I;  2K5R A;  4BY7 I;  4A3G I;  1X3Z A;  3PO3 S;  1TWC I;  2JNY A;  4A3E I;  1SFO I;  5C3E I;  4NBF A;  5C44 I;  2AKL A;  3M3Y I;  3GKQ A;  1WCM I;  1ZB8 A;  3LUS A;  5CM2 M;  1I50 I;  4QTU A;  4NB9 A;  4A3F I;  3GTQ I;  4A3M I;  1RO4 A;  1USP A;  3S2D I;  2JA5 I;  4NBB A;  4BY1 I;  5IP7 I;  2R92 I;  3GTK I;  1NUI A;  2NVY I;  4XX2 A;  1R9T I;  3GTM I;  3PO2 I;  3VMG A;  4A3K I;  4BXX I;  1I3Q I;  1Y1V I;  3S16 I;  1PFT A;  1X3W A;  3S14 I;  3RZO I;  4X6A I;  3D6W A;  3GTM S;  2J6A A;  3S1R I;  2JA8 I;  2PK7 A;  2B63 I;  1Y1V S;  1L1O C;  2E2I I;  3GCF A;  1TWA I;  4A3D I;  4NB8 A;  2HF1 A;  4A3J I;  4BBR I;  1K83 I;  3S17 I;  4A3C I;  1TWH I;  2NVQ I;  2NVX I;  3K7A I;  1TFI A;  3I4N I;  4Y7N I;  1QYP A;  1DL6 A;  3GTO I;  4QTT A;  1TWG I;  3S15 I;  4Y52 I;  2DE5 A;  3GTJ I;  4NBA A;  4NBH A;  5FLM I;  4A3B I;  3H3V J;  2JA7 I;  1TWF I;  3FKI I;  3HOV I;  2P3Y A;  2KPI A;  3GTG I;  3S1N I;  3H0G I;  2JR6 A;  4NBD A;  2RBL A;  2E2H I;  4NBE A;  3GTP I;  4NOZ A;  4NBC A;  2DE6 A; 
#chains in the Genus database with same CATH topology
 3D2L A;  3VMH A;  2F4O A;  1K73 2;  2QEX Z;  3G6E 1;  3I07 A;  3CCV 1;  3IR7 A;  3CCL Z;  1VQ5 Z;  2R6M A;  3BG0 B;  3U50 C;  2JIM A;  1VQN Z;  5IT9 b;  3I55 Z;  3HKZ A;  1M1K 2;  3CME Z;  1ZB9 A;  3ESW A;  2QLV B;  4MRI A;  1JWH C;  2YU9 I;  2RHB A;  2JS4 A;  4NBG A;  1ML8 A;  3HOW I;  2OTL Z;  2RT9 A;  3MZK B;  2QKD A;  1RNI A;  2RPR A;  1VQO Z;  1VQ6 1;  2K5R A;  3CC4 Z;  2Y0S A;  4A3G I;  1YIT Z;  1KD1 2;  3CCE 1;  1QVG Y;  3FQM A;  3GKQ A;  1VQ4 Z;  1ZB8 A;  5CM2 M;  2JIQ A;  4A3F I;  2Q51 A;  1Q81 1;  1USP A;  3S2D I;  2JA5 I;  2VPX A;  5D1P A;  1VQ7 Z;  4RVD A;  2W04 A;  2I3C A;  2V8I A;  3S16 I;  4RS4 A;  1PFT A;  2VUG A;  3G71 1;  3RZO I;  1VQM Z;  4X6A I;  3CC7 1;  3S1R I;  3OW2 Y;  2PK7 A;  4CL1 A;  3J81 b;  5FLX f;  2E2I I;  3CCM 1;  2E7Z A;  4BBR I;  1K83 I;  3NH8 A;  3S17 I;  4A3C I;  1TWH I;  2NVQ I;  4MXU A;  3G6E Z;  5FLX b;  1K9M 2;  3CCV Z;  2ZAE B;  1QYP A;  4MON A;  1Q82 2;  3GTO I;  4QTT A;  3GTJ I;  4TNU A;  4NBA A;  2YAD A;  4NBH A;  5FLM I;  2E9H A;  3TDH B;  3H3V J;  2JA7 I;  3FKI I;  2P3Y A;  3GTG I;  4RV9 A;  1K73 1;  1NJI 2;  2JIP A;  3H0G I;  2JR6 A;  4AYB A;  4NBD A;  1VQ6 Z;  4NFR A;  2JMO A;  4NBE A;  2EGT A;  4NBC A;  2DE6 A;  3CCE Z;  4A3I I;  2V45 A;  2HU9 A;  5D1O B;  3CPW Z;  2GTH A;  2VPW A;  1YIJ 1;  2VF1 A;  1VQL 1;  3HOY I;  2QR1 B;  3CCU Z;  4RVG A;  3S1M I;  3VB9 A;  3Q87 A;  3G71 Z;  1VLA A;  3EED A;  3CC7 Z;  1KD1 1;  3CXC Y;  3I4M I;  2WAQ A;  2QA4 Z;  1JJ2 Z;  2Q4Z A;  2VPY A;  3CD6 Z;  3JAM b;  5IP9 I;  3S2H I;  2VUM I;  4BY7 I;  3CCJ 1;  1X3Z A;  1QF8 A;  5IT9 f;  2JNY A;  1SFO I;  3M3Y I;  3CXC Z;  1Z03 A;  2V8J A;  2OOY B;  3I56 1;  1YI2 1;  2M6N A;  2JIR A;  1QVF Y;  2NVY I;  2IV2 X;  3KIF A;  1X3W A;  3S14 I;  3F3F C;  1VQK 1;  3D6W A;  4NH1 C;  1YJW Z;  1Q82 1;  2B63 I;  1S72 1;  2QRD B;  1P9N A;  1L1O C;  4A3D I;  2HF1 A;  1S7M A;  1QVF Z;  4HGZ A;  3CCR Z;  2NVX I;  3K7A I;  1TFI A;  2KI7 B;  4Y7N I;  1DL6 A;  3CCS 1;  4Y52 I;  3CCQ Z;  3J7A 4;  2G2K A;  3J81 f;  1QVG Z;  4DQY B;  1KC8 1;  1TWF I;  2M48 A;  1Q86 1;  2KPI A;  3T4N B;  1NP6 A;  1YUK A;  3NDI A;  3MZL B;  1K8A 2;  4NOZ A;  3MON A;  3G4S 1;  1W2B Y;  3M4O I;  1Y8C A;  4E2Z A;  3NH5 A;  3OW2 Z;  3D9X A;  2DE7 A;  4E32 A;  2R93 I;  1X0T A;  1YI2 Z;  1VQP 1;  2P28 A;  1ZH1 A;  5C4J I;  2JIO A;  4MD8 A;  4MH4 A;  4A3L I;  2BJO A;  3HOU I;  1VQ9 1;  4A93 I;  1Y1W I;  2GTI A;  1VQK Z;  1N2F A;  4BBS I;  1Q7Y 2;  5C4X I;  1VQN 1;  4S1T A;  1M1K 1;  3CMA 1;  1TWC I;  4A3E I;  5C3E I;  2AKL A;  2OTL 1;  5D1O A;  5T67 A;  1WCM I;  1VQO 1;  1I50 I;  4NB9 A;  2V8K A;  4A3M I;  1RO4 A;  1M90 2;  2QRC B;  2O53 A;  4DK1 A;  3JAM f;  4NBB A;  4BY1 I;  1NUI A;  4XX2 A;  3CCM Z;  4RVH A;  3PO2 I;  3VMG A;  4BXX I;  1I3Q I;  2JUB A;  4HH4 A;  1YHQ 1;  1N8R 2;  4E33 A;  5A2Q f;  3G4S Z;  3GCF A;  3NFZ A;  4NB8 A;  1QXF A;  4A3J I;  4E2W A;  4MD7 A;  2AYD A;  5A2Q b;  3I4N I;  1VQP Z;  1FDI A;  1TWG I;  1Z02 A;  2WB1 A;  3S15 I;  1RO0 A;  2DE5 A;  1VQ9 Z;  1RQF A;  1K9M 1;  3CC2 1;  1K8A 1;  4E2X A;  2OTJ 1;  2W03 A;  5T6B A;  2K3R A;  2PMZ A;  2LIY A;  2NAP A;  1YJ9 1;  2IZ3 A;  3CMA Z;  3FQQ A;  1AA6 A;  3GTP I;  2IZ4 A;  1RO2 A;  1YIJ Z;  1YJN 1;  1WJ2 A;  1Z01 A;  1VQL Z;  2NVT I;  3GTL I;  3IX0 A;  3TE5 B;  4E2Y A;  1Q16 A;  2E2J I;  1NJI 1;  1YUA A;  3EER A;  3CQZ I;  1I6H I;  3NH4 A;  3NDJ A;  1Q7Y 1;  2R7Z I;  3S1Q I;  2JA6 I;  2F4M A;  1USP B;  2QRE B;  3IF8 A;  1VQ8 1;  1RLY A;  1LQL A;  1SIW A;  3VMI A;  1WW9 A;  2H85 A;  3CCJ Z;  3P5J B;  1YHQ Z;  3HOZ I;  3CCU 1;  4E31 A;  3RZD I;  2GU2 A;  3PO3 I;  3HOX I;  4MD9 A;  2RIQ A;  1M90 1;  2QA4 1;  3PO3 S;  3I56 Z;  4NBF A;  3CD6 1;  5C44 I;  3LUS A;  3QWU A;  2QEX 1;  2OZK A;  3KIH A;  4QTU A;  5T64 A;  1W2B Z;  3GTQ I;  3CCL 1;  3CC2 Z;  1VQ5 1;  1N8R 1;  5IP7 I;  2R92 I;  1S72 Z;  2OTJ Z;  3GTK I;  4HGY A;  1R9T I;  3I55 1;  1KRL A;  3GTM I;  2LFU A;  4A3K I;  1Y1V I;  3CME 1;  4RVF A;  1YJ9 Z;  1Q81 2;  2J6A A;  2O4H A;  2JA8 I;  3GTM S;  1Y1V S;  3CCS Z;  1YJN Z;  1TWA I;  3CPW Y;  1WII A;  2OOX B;  3CC4 1;  1WZN A;  3IFU A;  3J80 f;  5LL6 f;  1KC8 2;  1FDO A;  1YJW 1;  1YIT 1;  1Q86 2;  2PM9 A;  4E30 A;  3J80 b;  2LEX A;  1VQ4 1;  2VPZ A;  4EWC A;  5AN9 F;  1VQ8 Z;  3CCR 1;  1KQS Y;  4A3B I;  1JJ2 Y;  3F3P C;  1VQ7 1;  3VTN A;  3HOV I;  3CCQ 1;  3S1N I;  1VQM 1;  4DGL A;  2V3V A;  2RBL A;  2E2H I;  3BG1 B;  1KQS Z; 
#chains in the Genus database with same CATH homology
 3VMH A;  2F4O A;  1K73 2;  2QEX Z;  3G6E 1;  3I07 A;  3CCV 1;  3CCL Z;  1VQ5 Z;  2R6M A;  3BG0 B;  3U50 C;  1VQN Z;  5IT9 b;  3I55 Z;  3HKZ A;  1M1K 2;  3CME Z;  1ZB9 A;  3ESW A;  2QLV B;  4MRI A;  1JWH C;  2YU9 I;  2RHB A;  2JS4 A;  4NBG A;  1ML8 A;  3HOW I;  2OTL Z;  2RT9 A;  3MZK B;  2QKD A;  1RNI A;  2RPR A;  1VQO Z;  1VQ6 1;  2K5R A;  3CC4 Z;  2Y0S A;  4A3G I;  1YIT Z;  1KD1 2;  3CCE 1;  1QVG Y;  3FQM A;  3GKQ A;  1VQ4 Z;  1ZB8 A;  5CM2 M;  4A3F I;  2Q51 A;  1Q81 1;  1USP A;  3S2D I;  2JA5 I;  5D1P A;  1VQ7 Z;  4RVD A;  2W04 A;  2I3C A;  2V8I A;  3S16 I;  4RS4 A;  1PFT A;  2VUG A;  3G71 1;  3RZO I;  1VQM Z;  4X6A I;  3CC7 1;  3S1R I;  3OW2 Y;  2PK7 A;  4CL1 A;  3J81 b;  5FLX f;  2E2I I;  3CCM 1;  4BBR I;  1K83 I;  3NH8 A;  3S17 I;  4A3C I;  1TWH I;  2NVQ I;  4MXU A;  3G6E Z;  5FLX b;  1K9M 2;  3CCV Z;  2ZAE B;  1QYP A;  4MON A;  1Q82 2;  3GTO I;  4QTT A;  3GTJ I;  4TNU A;  4NBA A;  2YAD A;  4NBH A;  5FLM I;  2E9H A;  3TDH B;  3H3V J;  2JA7 I;  3FKI I;  2P3Y A;  3GTG I;  4RV9 A;  1K73 1;  1NJI 2;  3H0G I;  2JR6 A;  4AYB A;  4NBD A;  1VQ6 Z;  4NFR A;  2JMO A;  4NBE A;  2EGT A;  4NBC A;  2DE6 A;  3CCE Z;  4A3I I;  2HU9 A;  5D1O B;  3CPW Z;  2GTH A;  1YIJ 1;  2VF1 A;  1VQL 1;  3HOY I;  2QR1 B;  3CCU Z;  4RVG A;  3S1M I;  3VB9 A;  3Q87 A;  3G71 Z;  1VLA A;  3EED A;  3CC7 Z;  1KD1 1;  3CXC Y;  3I4M I;  2WAQ A;  2QA4 Z;  1JJ2 Z;  2Q4Z A;  3CD6 Z;  3JAM b;  5IP9 I;  3S2H I;  2VUM I;  4BY7 I;  3CCJ 1;  1X3Z A;  1QF8 A;  5IT9 f;  2JNY A;  1SFO I;  3M3Y I;  3CXC Z;  1Z03 A;  2V8J A;  2OOY B;  3I56 1;  1YI2 1;  2M6N A;  1QVF Y;  2NVY I;  3KIF A;  1X3W A;  3S14 I;  3F3F C;  1VQK 1;  3D6W A;  4NH1 C;  1YJW Z;  1Q82 1;  2B63 I;  1S72 1;  2QRD B;  1P9N A;  1L1O C;  4A3D I;  2HF1 A;  1S7M A;  1QVF Z;  4HGZ A;  3CCR Z;  2NVX I;  3K7A I;  1TFI A;  2KI7 B;  4Y7N I;  1DL6 A;  3CCS 1;  4Y52 I;  3CCQ Z;  3J7A 4;  2G2K A;  3J81 f;  1QVG Z;  4DQY B;  1KC8 1;  1TWF I;  2M48 A;  1Q86 1;  2KPI A;  3T4N B;  1NP6 A;  1YUK A;  3NDI A;  3MZL B;  1K8A 2;  4NOZ A;  3MON A;  3G4S 1;  1W2B Y;  3M4O I;  4E2Z A;  3NH5 A;  3OW2 Z;  3D9X A;  2DE7 A;  4E32 A;  2R93 I;  1X0T A;  1YI2 Z;  1VQP 1;  2P28 A;  1ZH1 A;  5C4J I;  4MD8 A;  4MH4 A;  4A3L I;  2BJO A;  3HOU I;  1VQ9 1;  4A93 I;  1Y1W I;  2GTI A;  1VQK Z;  1N2F A;  4BBS I;  1Q7Y 2;  5C4X I;  1VQN 1;  4S1T A;  1M1K 1;  3CMA 1;  1TWC I;  4A3E I;  5C3E I;  2AKL A;  2OTL 1;  5D1O A;  5T67 A;  1WCM I;  1VQO 1;  1I50 I;  4NB9 A;  2V8K A;  4A3M I;  1RO4 A;  1M90 2;  2QRC B;  2O53 A;  4DK1 A;  3JAM f;  4NBB A;  4BY1 I;  1NUI A;  4XX2 A;  3CCM Z;  4RVH A;  3PO2 I;  3VMG A;  4BXX I;  1I3Q I;  2JUB A;  4HH4 A;  1YHQ 1;  1N8R 2;  4E33 A;  5A2Q f;  3G4S Z;  3GCF A;  3NFZ A;  4NB8 A;  4A3J I;  4E2W A;  4MD7 A;  5A2Q b;  3I4N I;  1VQP Z;  1TWG I;  1Z02 A;  2WB1 A;  3S15 I;  1RO0 A;  2DE5 A;  1VQ9 Z;  1RQF A;  1K9M 1;  3CC2 1;  1K8A 1;  4E2X A;  2OTJ 1;  2W03 A;  5T6B A;  2K3R A;  2PMZ A;  2LIY A;  1YJ9 1;  2IZ3 A;  3CMA Z;  3FQQ A;  3GTP I;  2IZ4 A;  1RO2 A;  1YIJ Z;  1YJN 1;  1Z01 A;  1VQL Z;  2NVT I;  3GTL I;  3IX0 A;  3TE5 B;  4E2Y A;  2E2J I;  1NJI 1;  1YUA A;  3EER A;  3CQZ I;  1I6H I;  3NH4 A;  3NDJ A;  1Q7Y 1;  2R7Z I;  3S1Q I;  2JA6 I;  2F4M A;  1USP B;  2QRE B;  3IF8 A;  1VQ8 1;  1RLY A;  1LQL A;  3VMI A;  1WW9 A;  2H85 A;  3CCJ Z;  3P5J B;  1YHQ Z;  3HOZ I;  3CCU 1;  4E31 A;  3RZD I;  2GU2 A;  3PO3 I;  3HOX I;  4MD9 A;  2RIQ A;  1M90 1;  2QA4 1;  3PO3 S;  3I56 Z;  4NBF A;  3CD6 1;  5C44 I;  3LUS A;  3QWU A;  2QEX 1;  2OZK A;  3KIH A;  4QTU A;  5T64 A;  1W2B Z;  3GTQ I;  3CCL 1;  3CC2 Z;  1VQ5 1;  1N8R 1;  5IP7 I;  2R92 I;  1S72 Z;  2OTJ Z;  3GTK I;  4HGY A;  1R9T I;  3I55 1;  1KRL A;  3GTM I;  2LFU A;  4A3K I;  1Y1V I;  3CME 1;  4RVF A;  1YJ9 Z;  1Q81 2;  2J6A A;  2O4H A;  2JA8 I;  3GTM S;  1Y1V S;  3CCS Z;  1YJN Z;  1TWA I;  3CPW Y;  1WII A;  2OOX B;  3IFU A;  3J80 f;  3CC4 1;  1KC8 2;  5LL6 f;  1YJW 1;  1YIT 1;  1Q86 2;  2PM9 A;  4E30 A;  3J80 b;  1VQ4 1;  4EWC A;  5AN9 F;  1VQ8 Z;  3CCR 1;  1KQS Y;  4A3B I;  1JJ2 Y;  3F3P C;  1VQ7 1;  3VTN A;  3HOV I;  3CCQ 1;  3S1N I;  1VQM 1;  4DGL A;  2RBL A;  2E2H I;  3BG1 B;  1KQS Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...