2E2II

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dgtp
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2iI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2iI02
3HOVI 1RLYA 3S1MI 4A3EI 3LUSA 1I50I 4NBAA 2NVTI 4Y7NI 3S1RI 3PO2I 2R93I 1ZB9A 4XX2A 1Y1VS 2F4MA 2JS4A 4NBEA 1TWCI 3VB9A 2BJOA 3I4NI 2JNYA 1TFIA 3D6WA 3S1QI 1QYPA 1NUIA 1ZB8A 4Y52I 5IP9I 3CQZI 3RZDI 5FLMI 3M4OI 1TWGI 3VMIA 4NBGA 3GTMI 4NOZA 2NVYI 5C44I 5C3EI 1WCMI 2R92I 2DE6A 3H3VJ 2P3YA 1SFOI 4NB8A 3HOUI 4BBRI 2DE5A 4QTUA 2J6AA 3GTMS 4MH4A 3GTQI 2R7ZI 3GTGI 3GTJI 3VMHA 1N2FA 1L1OC 2DE7A 4A3JI 1VLAA 3I4MI 4A3CI 3GKQA 2E2II 2HF1A 1RO4A 1K83I 1DL6A 2K5RA 1Y1WI 4BBSI 2JR6A 3S2DI 3S1NI 4NB9A 3I07A 4A3KI 4A3DI 3K7AI 1I3QI 4QTTA 1X3WA 3HOXI 4NBFA 4NBDA 5C4XI 1R9TI 5C4JI 2RBLA 3GCFA 2F4OA 3HOYI 2KPIA 2NVQI 1TWFI 1TWHI 3ESWA 2JA6I 3S16I 1PFTA 2JA7I 2JA5I 3Q87A 3S17I 2B63I 4A3BI 1WW9A 3GTKI 4A3LI 3S2HI 4BY7I 4NBCA 3FKII 2PK7A 4BY1I 3PO3I 4A93I 1ML8A 3VMGA 3H0GI 1USPA 4A3II 3RZOI 5IP7I 3GTLI 4NBBA 3HOZI 4NBHA 3HOWI 3GTOI 3PO3S 1TWAI 2VUMI 2E2HI 3S14I 2NVXI 1USPB 2AKLA 3U50C 2JA8I 2YU9I 1X3ZA 1I6HI 5CM2M 1YUAA 4A3FI 1LQLA 2E2JI 3S15I 4BXXI 3EERA 3GTPI 1Y1VI 4A3MI 3M3YI 4A3GI 4X6AI
chains in the Genus database with same CATH superfamily
2QEX1 3S1MI 1W2BY 5IT9f 3CPWY 1JWHC 4XX2A 3NDIA 4MD7A 2PMZA 3IX0A 1TWCI 2RPRA 2BJOA 3I4NI 2LEXA 3D6WA 1QYPA 3IF8A 4NFRA 5IP9I 3CQZI 1TWGI 3GTMI 3J81f 1Z03A 5C3EI 5FLXb 2QREB 3H3VJ 1YI2Z 4NB8A 2J6AA 3GTMS 3JAMb 2O53A 2R7ZI 2OTLZ 2YADA 2W03A 1K83I 1Y1WI 3KIFA 1NJI2 2GTHA 1K731 1VQ91 1KD11 2JR6A 3CCRZ 1Q7Y2 1Q861 2VF1A 2GU2A 4MXUA 4RVGA 1K9M2 1QVFZ 4A3DI 1VQN1 3I56Z 2RIQA 2NAPA 1VQM1 3CC4Z 1YJN1 3HOYI 2K3RA 2VPWA 2JIRA 2QRDB 3CC21 2JA7I 3Q87A 2B63I 2IZ3A 3S2HI 4BY7I 4NBCA 3PO3I 3CXCZ 2JIMA 4RVHA 1VQ61 3CCJ1 3P5JB 3G4S1 1YJ91 3TDHB 3GTOI 3PO3S 2NVXI 1USPB 2AKLA 1YHQ1 2JA8I 3CCU1 3G71Z 1X0TA 4MONA 3GTPI 1K8A2 3CMA1 1Y1VI 2QRCB 4A3MI 3M3YI 4X6AI 3HKZA 4CL1A 3CCM1 4NBAA 2ZAEB 1YIJZ 1VQKZ 1YITZ 1VQOZ 4MRIA 1Y1VS 3OW2Z 2OOXB 2JS4A 3CD61 3CCS1 1RNIA 2V3VA 1TFIA 5T67A 3RZDI 5FLMI 1RO0A 4NBGA 1VQPZ 2JIPA 2VPZA 1KC81 4E33A 1WIIA 5C44I 1FDOA 5A2Qf 3BG1B 2RHBA 2DE6A 3CC71 2P3YA 1SFOI 2PM9A 3CME1 4E2XA 4QTUA 2VPYA 4NH1C 3CCL1 4E32A 3I4MI 1VLAA 1M1K2 2E2II 2M6NA 3J80b 2K5RA 2AYDA 4BBSI 3I551 2LFUA 1KQSZ 3S1NI 4NB9A 3I07A 3TE5B 1Q16A 4A3KI 4HGZA 3CCQ1 4NBFA 2JUBA 5C4XI 1R9TI 2QA41 3VTNA 1S721 1VQ71 2NVQI 1M901 1QXFA 3ESWA 2H85A 3FQQA 1Q812 3FKII 3G6E1 5D1OB 3F3PC 1NP6A 4A93I 1RO2A 1VQ81 5AN9F 2OTJ1 3VMGA 2Y0SA 1N8R1 1VQL1 3H0GI 1USPA 5IT9b 1YJW1 3GTLI 4NBBA 4NBHA 4HH4A 2V45A 4RV9A 3S14I 1X3ZA 3CCEZ 2V8JA 4RVFA 5CM2M 1Q822 4DQYB 1YUAA 1LQLA 3NH8A 2E2JI 3J7A4 4DK1A 3S15I 1QVFY 2Q4ZA 1VQ4Z 4A3GI 2QEXZ 3HOVI 3J81b 4A3EI 3LUSA 1I50I 2NVTI 3IFUA 3PO2I 1ZB9A 3KIHA 2F4MA 5D1PA 4NBEA 3FQMA 4MD9A 3MZLB 2GTIA 3VB9A 3NDJA 3D2LA 3S1QI 2HU9A 4Y52I 3CXCY 2KI7B 2NVYI 2G2KA 1WCMI 2R92I 1YI21 1JJ2Z 1QF8A 3HOUI 3F3FC 4BBRI 2DE5A 4MH4A 3GTGI 2OTL1 3VMHA 1N2FA 2DE7A 1QVGZ 1WJ2A 4E2YA 3QWUA 1SIWA 1FDIA 1K732 1KD12 2JIOA 2OOYB 1Q862 1VQ9Z 3CCR1 1NJI1 5FLXf 3S2DI 3OW2Y 1Q7Y1 3K7AI 4QTTA 1K9M1 1VQNZ 3HOXI 3I561 2Q51A 3JAMf 1QVGY 3BG0B 1VQMZ 3CC41 2RBLA 2WAQA 1YJNZ 2F4OA 1W2BZ 3CPWZ 1Y8CA 2I3CA 1TWFI 5D1OA 3CC2Z 2VUGA 2JA6I 3IR7A 4MD8A 1PFTA 2JA5I 3S17I 2E9HA 1WW9A 3GTKI 3NH5A 2O4HA 4BY1I 2QR1B 1ML8A 1VQ6Z 3CCJZ 4A3II 2P28A 5IP7I 1Z02A 3HOWI 3G4SZ 1YJ9Z 2E7ZA 4DGLA 4S1TA 2R6MA 1YHQZ 4TNUA 1KQSY 5LL6f 3CCUZ 3G711 1AA6A 1ZH1A 4BXXI 3CMAZ 1S7MA 2RT9A 1K8A1 1RLYA 3CCMZ 5A2Qb 4Y7NI 1YIJ1 3S1RI 4E2WA 2R93I 1VQK1 1YIT1 1VQO1 1VQ51 5T6BA 3CCV1 3EEDA 3CD6Z 3CCSZ 1KRLA 3MONA 2JNYA 1NUIA 1ZB8A 3MZKB 4EWCA 3M4OI 1WZNA 1KC82 3VMIA 1VQP1 4NOZA 2QLVB 2V8IA 3CC7Z 3NFZA 3CMEZ 2VPXA 2JIQA 3GTQI 2OZKA 4E31A 3GTJI 2QKDA 3CCLZ 1L1OC 4A3JI 4A3CI 4HGYA 3GKQA 2HF1A 1RO4A 1M1K1 1DL6A 3I55Z 4E30A 5T64A 3CCQZ 1I3QI 1X3WA 1P9NA 4NBDA 2QA4Z 2LIYA 5C4JI 1RQFA 3GCFA 2M48A 2W04A 1S72Z 2KPIA 4AYBA 1VQ7Z 1M902 3J80f 1TWHI 3S16I 4A3BI 2JMOA 1JJ2Y 4A3LI 1Q811 4RS4A 2PK7A 3G6EZ 1N8R2 1VQ8Z 2OTJZ 1Z01A 1VQLZ 2EGTA 3T4NB 1VQ5Z 3RZOI 2V8KA 3CCVZ 1YJWZ 3HOZI 3D9XA 3NH4A 2IZ4A 1TWAI 2VUMI 2E2HI 4RVDA 3U50C 4E2ZA 2YU9I 1YUKA 3CCE1 1I6HI 4A3FI 2WB1A 2IV2X 1Q821 3EERA 1VQ41
chains in the Genus database with same CATH topology
2QEX1 3S1MI 1W2BY 5IT9f 3CPWY 1JWHC 4XX2A 3NDIA 4MD7A 2PMZA 3IX0A 1TWCI 2RPRA 2BJOA 3I4NI 3D6WA 1QYPA 3IF8A 4NFRA 5IP9I 3CQZI 1TWGI 3GTMI 3J81f 1Z03A 5C3EI 5FLXb 2QREB 3H3VJ 1YI2Z 4NB8A 2J6AA 3GTMS 3JAMb 2O53A 2R7ZI 2OTLZ 2YADA 2W03A 1K83I 1Y1WI 3KIFA 1NJI2 2GTHA 1K731 1VQ91 1KD11 2JR6A 3CCRZ 1Q7Y2 1Q861 2VF1A 2GU2A 4MXUA 4RVGA 1K9M2 1QVFZ 4A3DI 1VQN1 3I56Z 2RIQA 1VQM1 3CC4Z 1YJN1 3HOYI 2K3RA 2QRDB 3CC21 2JA7I 3Q87A 2B63I 2IZ3A 3S2HI 4BY7I 4NBCA 3PO3I 3CXCZ 4RVHA 1VQ61 3CCJ1 3P5JB 3G4S1 1YJ91 3TDHB 3GTOI 3PO3S 2NVXI 1USPB 2AKLA 1YHQ1 2JA8I 3CCU1 3G71Z 1X0TA 4MONA 3GTPI 1K8A2 3CMA1 1Y1VI 2QRCB 4A3MI 3M3YI 4X6AI 3HKZA 4CL1A 3CCM1 4NBAA 2ZAEB 1YIJZ 1VQKZ 1YITZ 1VQOZ 4MRIA 1Y1VS 3OW2Z 2OOXB 2JS4A 3CD61 3CCS1 1RNIA 1TFIA 5T67A 3RZDI 5FLMI 1RO0A 4NBGA 1VQPZ 1KC81 4E33A 1WIIA 5C44I 5A2Qf 3BG1B 2RHBA 2DE6A 3CC71 2P3YA 1SFOI 2PM9A 3CME1 4E2XA 4QTUA 4NH1C 3CCL1 4E32A 3I4MI 1VLAA 1M1K2 2E2II 2M6NA 3J80b 2K5RA 4BBSI 3I551 2LFUA 1KQSZ 3S1NI 4NB9A 3I07A 3TE5B 4A3KI 4HGZA 3CCQ1 4NBFA 2JUBA 5C4XI 1R9TI 2QA41 3VTNA 1S721 1VQ71 2NVQI 1M901 3ESWA 2H85A 3FQQA 1Q812 3FKII 3G6E1 5D1OB 3F3PC 1NP6A 4A93I 1RO2A 1VQ81 5AN9F 2OTJ1 3VMGA 2Y0SA 1N8R1 1VQL1 3H0GI 1USPA 5IT9b 1YJW1 3GTLI 4NBBA 4NBHA 4HH4A 4RV9A 3S14I 1X3ZA 3CCEZ 2V8JA 4RVFA 5CM2M 1Q822 4DQYB 1YUAA 1LQLA 3NH8A 2E2JI 3J7A4 4DK1A 3S15I 1QVFY 2Q4ZA 1VQ4Z 4A3GI 2QEXZ 3HOVI 3J81b 4A3EI 3LUSA 1I50I 2NVTI 3IFUA 3PO2I 1ZB9A 3KIHA 2F4MA 5D1PA 4NBEA 3FQMA 4MD9A 3MZLB 2GTIA 3VB9A 3NDJA 3S1QI 2HU9A 4Y52I 3CXCY 2KI7B 2NVYI 2G2KA 1WCMI 2R92I 1YI21 1JJ2Z 1QF8A 3HOUI 3F3FC 4BBRI 2DE5A 4MH4A 3GTGI 2OTL1 3VMHA 1N2FA 2DE7A 1QVGZ 4E2YA 3QWUA 1K732 1KD12 2OOYB 1Q862 1VQ9Z 3CCR1 1NJI1 5FLXf 3S2DI 3OW2Y 1Q7Y1 3K7AI 4QTTA 1K9M1 1VQNZ 3HOXI 3I561 2Q51A 3JAMf 1QVGY 3BG0B 1VQMZ 3CC41 2RBLA 2WAQA 1YJNZ 2F4OA 1W2BZ 3CPWZ 2I3CA 1TWFI 5D1OA 3CC2Z 2VUGA 2JA6I 4MD8A 1PFTA 2JA5I 3S17I 2E9HA 1WW9A 3GTKI 3NH5A 2O4HA 4BY1I 2QR1B 1ML8A 1VQ6Z 3CCJZ 4A3II 2P28A 5IP7I 1Z02A 3HOWI 3G4SZ 1YJ9Z 4DGLA 4S1TA 2R6MA 1YHQZ 4TNUA 1KQSY 5LL6f 3CCUZ 3G711 1ZH1A 4BXXI 3CMAZ 1S7MA 2RT9A 1K8A1 1RLYA 3CCMZ 5A2Qb 4Y7NI 1YIJ1 3S1RI 4E2WA 2R93I 1VQK1 1YIT1 1VQO1 1VQ51 5T6BA 3CCV1 3EEDA 3CD6Z 3CCSZ 1KRLA 3MONA 2JNYA 1NUIA 1ZB8A 3MZKB 4EWCA 3M4OI 1KC82 3VMIA 1VQP1 4NOZA 2QLVB 2V8IA 3CC7Z 3NFZA 3CMEZ 3GTQI 2OZKA 4E31A 3GTJI 2QKDA 3CCLZ 1L1OC 4A3JI 4A3CI 4HGYA 3GKQA 2HF1A 1RO4A 1M1K1 1DL6A 3I55Z 4E30A 5T64A 3CCQZ 1I3QI 1X3WA 1P9NA 4NBDA 2QA4Z 2LIYA 5C4JI 1RQFA 3GCFA 2M48A 2W04A 1S72Z 2KPIA 4AYBA 1VQ7Z 1M902 3J80f 1TWHI 3S16I 4A3BI 2JMOA 1JJ2Y 4A3LI 1Q811 4RS4A 2PK7A 3G6EZ 1N8R2 1VQ8Z 2OTJZ 1Z01A 1VQLZ 2EGTA 3T4NB 1VQ5Z 3RZOI 2V8KA 3CCVZ 1YJWZ 3HOZI 3D9XA 3NH4A 2IZ4A 1TWAI 2VUMI 2E2HI 4RVDA 3U50C 4E2ZA 2YU9I 1YUKA 3CCE1 1I6HI 4A3FI 2WB1A 1Q821 3EERA 1VQ41
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOV I;  1RLY A;  3S1M I;  4A3E I;  3LUS A;  1I50 I;  4NBA A;  2NVT I;  4Y7N I;  3S1R I;  3PO2 I;  2R93 I;  1ZB9 A;  4XX2 A;  1Y1V S;  2F4M A;  2JS4 A;  4NBE A;  1TWC I;  3VB9 A;  2BJO A;  3I4N I;  2JNY A;  1TFI A;  3D6W A;  3S1Q I;  1QYP A;  1NUI A;  1ZB8 A;  4Y52 I;  5IP9 I;  3CQZ I;  3RZD I;  5FLM I;  3M4O I;  1TWG I;  3VMI A;  4NBG A;  3GTM I;  4NOZ A;  2NVY I;  5C44 I;  5C3E I;  1WCM I;  2R92 I;  2DE6 A;  3H3V J;  2P3Y A;  1SFO I;  4NB8 A;  3HOU I;  4BBR I;  2DE5 A;  4QTU A;  2J6A A;  3GTM S;  4MH4 A;  3GTQ I;  2R7Z I;  3GTG I;  3GTJ I;  3VMH A;  1N2F A;  1L1O C;  2DE7 A;  4A3J I;  1VLA A;  3I4M I;  4A3C I;  3GKQ A;  2E2I I;  2HF1 A;  1RO4 A;  1K83 I;  1DL6 A;  2K5R A;  1Y1W I;  4BBS I;  2JR6 A;  3S2D I;  3S1N I;  4NB9 A;  3I07 A;  4A3K I;  4A3D I;  3K7A I;  1I3Q I;  4QTT A;  1X3W A;  3HOX I;  4NBF A;  4NBD A;  5C4X I;  1R9T I;  5C4J I;  2RBL A;  3GCF A;  2F4O A;  3HOY I;  2KPI A;  2NVQ I;  1TWF I;  1TWH I;  3ESW A;  2JA6 I;  3S16 I;  1PFT A;  2JA7 I;  2JA5 I;  3Q87 A;  3S17 I;  2B63 I;  4A3B I;  1WW9 A;  3GTK I;  4A3L I;  3S2H I;  4BY7 I;  4NBC A;  3FKI I;  2PK7 A;  4BY1 I;  3PO3 I;  4A93 I;  1ML8 A;  3VMG A;  3H0G I;  1USP A;  4A3I I;  3RZO I;  5IP7 I;  3GTL I;  4NBB A;  3HOZ I;  4NBH A;  3HOW I;  3GTO I;  3PO3 S;  1TWA I;  2VUM I;  2E2H I;  3S14 I;  2NVX I;  1USP B;  2AKL A;  3U50 C;  2JA8 I;  2YU9 I;  1X3Z A;  1I6H I;  5CM2 M;  1YUA A;  4A3F I;  1LQL A;  2E2J I;  3S15 I;  4BXX I;  3EER A;  3GTP I;  1Y1V I;  4A3M I;  3M3Y I;  4A3G I;  4X6A I; 
#chains in the Genus database with same CATH topology
 2QEX 1;  3S1M I;  1W2B Y;  5IT9 f;  3CPW Y;  1JWH C;  4XX2 A;  3NDI A;  4MD7 A;  2PMZ A;  3IX0 A;  1TWC I;  2RPR A;  2BJO A;  3I4N I;  2LEX A;  3D6W A;  1QYP A;  3IF8 A;  4NFR A;  5IP9 I;  3CQZ I;  1TWG I;  3GTM I;  3J81 f;  1Z03 A;  5C3E I;  5FLX b;  2QRE B;  3H3V J;  1YI2 Z;  4NB8 A;  2J6A A;  3GTM S;  3JAM b;  2O53 A;  2R7Z I;  2OTL Z;  2YAD A;  2W03 A;  1K83 I;  1Y1W I;  3KIF A;  1NJI 2;  2GTH A;  1K73 1;  1VQ9 1;  1KD1 1;  2JR6 A;  3CCR Z;  1Q7Y 2;  1Q86 1;  2VF1 A;  2GU2 A;  4MXU A;  4RVG A;  1K9M 2;  1QVF Z;  4A3D I;  1VQN 1;  3I56 Z;  2RIQ A;  2NAP A;  1VQM 1;  3CC4 Z;  1YJN 1;  3HOY I;  2K3R A;  2VPW A;  2JIR A;  2QRD B;  3CC2 1;  2JA7 I;  3Q87 A;  2B63 I;  2IZ3 A;  3S2H I;  4BY7 I;  4NBC A;  3PO3 I;  3CXC Z;  2JIM A;  4RVH A;  1VQ6 1;  3CCJ 1;  3P5J B;  3G4S 1;  1YJ9 1;  3TDH B;  3GTO I;  3PO3 S;  2NVX I;  1USP B;  2AKL A;  1YHQ 1;  2JA8 I;  3CCU 1;  3G71 Z;  1X0T A;  4MON A;  3GTP I;  1K8A 2;  3CMA 1;  1Y1V I;  2QRC B;  4A3M I;  3M3Y I;  4X6A I;  3HKZ A;  4CL1 A;  3CCM 1;  4NBA A;  2ZAE B;  1YIJ Z;  1VQK Z;  1YIT Z;  1VQO Z;  4MRI A;  1Y1V S;  3OW2 Z;  2OOX B;  2JS4 A;  3CD6 1;  3CCS 1;  1RNI A;  2V3V A;  1TFI A;  5T67 A;  3RZD I;  5FLM I;  1RO0 A;  4NBG A;  1VQP Z;  2JIP A;  2VPZ A;  1KC8 1;  4E33 A;  1WII A;  5C44 I;  1FDO A;  5A2Q f;  3BG1 B;  2RHB A;  2DE6 A;  3CC7 1;  2P3Y A;  1SFO I;  2PM9 A;  3CME 1;  4E2X A;  4QTU A;  2VPY A;  4NH1 C;  3CCL 1;  4E32 A;  3I4M I;  1VLA A;  1M1K 2;  2E2I I;  2M6N A;  3J80 b;  2K5R A;  2AYD A;  4BBS I;  3I55 1;  2LFU A;  1KQS Z;  3S1N I;  4NB9 A;  3I07 A;  3TE5 B;  1Q16 A;  4A3K I;  4HGZ A;  3CCQ 1;  4NBF A;  2JUB A;  5C4X I;  1R9T I;  2QA4 1;  3VTN A;  1S72 1;  1VQ7 1;  2NVQ I;  1M90 1;  1QXF A;  3ESW A;  2H85 A;  3FQQ A;  1Q81 2;  3FKI I;  3G6E 1;  5D1O B;  3F3P C;  1NP6 A;  4A93 I;  1RO2 A;  1VQ8 1;  5AN9 F;  2OTJ 1;  3VMG A;  2Y0S A;  1N8R 1;  1VQL 1;  3H0G I;  1USP A;  5IT9 b;  1YJW 1;  3GTL I;  4NBB A;  4NBH A;  4HH4 A;  2V45 A;  4RV9 A;  3S14 I;  1X3Z A;  3CCE Z;  2V8J A;  4RVF A;  5CM2 M;  1Q82 2;  4DQY B;  1YUA A;  1LQL A;  3NH8 A;  2E2J I;  3J7A 4;  4DK1 A;  3S15 I;  1QVF Y;  2Q4Z A;  1VQ4 Z;  4A3G I;  2QEX Z;  3HOV I;  3J81 b;  4A3E I;  3LUS A;  1I50 I;  2NVT I;  3IFU A;  3PO2 I;  1ZB9 A;  3KIH A;  2F4M A;  5D1P A;  4NBE A;  3FQM A;  4MD9 A;  3MZL B;  2GTI A;  3VB9 A;  3NDJ A;  3D2L A;  3S1Q I;  2HU9 A;  4Y52 I;  3CXC Y;  2KI7 B;  2NVY I;  2G2K A;  1WCM I;  2R92 I;  1YI2 1;  1JJ2 Z;  1QF8 A;  3HOU I;  3F3F C;  4BBR I;  2DE5 A;  4MH4 A;  3GTG I;  2OTL 1;  3VMH A;  1N2F A;  2DE7 A;  1QVG Z;  1WJ2 A;  4E2Y A;  3QWU A;  1SIW A;  1FDI A;  1K73 2;  1KD1 2;  2JIO A;  2OOY B;  1Q86 2;  1VQ9 Z;  3CCR 1;  1NJI 1;  5FLX f;  3S2D I;  3OW2 Y;  1Q7Y 1;  3K7A I;  4QTT A;  1K9M 1;  1VQN Z;  3HOX I;  3I56 1;  2Q51 A;  3JAM f;  1QVG Y;  3BG0 B;  1VQM Z;  3CC4 1;  2RBL A;  2WAQ A;  1YJN Z;  2F4O A;  1W2B Z;  3CPW Z;  1Y8C A;  2I3C A;  1TWF I;  5D1O A;  3CC2 Z;  2VUG A;  2JA6 I;  3IR7 A;  4MD8 A;  1PFT A;  2JA5 I;  3S17 I;  2E9H A;  1WW9 A;  3GTK I;  3NH5 A;  2O4H A;  4BY1 I;  2QR1 B;  1ML8 A;  1VQ6 Z;  3CCJ Z;  4A3I I;  2P28 A;  5IP7 I;  1Z02 A;  3HOW I;  3G4S Z;  1YJ9 Z;  2E7Z A;  4DGL A;  4S1T A;  2R6M A;  1YHQ Z;  4TNU A;  1KQS Y;  5LL6 f;  3CCU Z;  3G71 1;  1AA6 A;  1ZH1 A;  4BXX I;  3CMA Z;  1S7M A;  2RT9 A;  1K8A 1;  1RLY A;  3CCM Z;  5A2Q b;  4Y7N I;  1YIJ 1;  3S1R I;  4E2W A;  2R93 I;  1VQK 1;  1YIT 1;  1VQO 1;  1VQ5 1;  5T6B A;  3CCV 1;  3EED A;  3CD6 Z;  3CCS Z;  1KRL A;  3MON A;  2JNY A;  1NUI A;  1ZB8 A;  3MZK B;  4EWC A;  3M4O I;  1WZN A;  1KC8 2;  3VMI A;  1VQP 1;  4NOZ A;  2QLV B;  2V8I A;  3CC7 Z;  3NFZ A;  3CME Z;  2VPX A;  2JIQ A;  3GTQ I;  2OZK A;  4E31 A;  3GTJ I;  2QKD A;  3CCL Z;  1L1O C;  4A3J I;  4A3C I;  4HGY A;  3GKQ A;  2HF1 A;  1RO4 A;  1M1K 1;  1DL6 A;  3I55 Z;  4E30 A;  5T64 A;  3CCQ Z;  1I3Q I;  1X3W A;  1P9N A;  4NBD A;  2QA4 Z;  2LIY A;  5C4J I;  1RQF A;  3GCF A;  2M48 A;  2W04 A;  1S72 Z;  2KPI A;  4AYB A;  1VQ7 Z;  1M90 2;  3J80 f;  1TWH I;  3S16 I;  4A3B I;  2JMO A;  1JJ2 Y;  4A3L I;  1Q81 1;  4RS4 A;  2PK7 A;  3G6E Z;  1N8R 2;  1VQ8 Z;  2OTJ Z;  1Z01 A;  1VQL Z;  2EGT A;  3T4N B;  1VQ5 Z;  3RZO I;  2V8K A;  3CCV Z;  1YJW Z;  3HOZ I;  3D9X A;  3NH4 A;  2IZ4 A;  1TWA I;  2VUM I;  2E2H I;  4RVD A;  3U50 C;  4E2Z A;  2YU9 I;  1YUK A;  3CCE 1;  1I6H I;  4A3F I;  2WB1 A;  2IV2 X;  1Q82 1;  3EER A;  1VQ4 1; 
#chains in the Genus database with same CATH homology
 2QEX 1;  3S1M I;  1W2B Y;  5IT9 f;  3CPW Y;  1JWH C;  4XX2 A;  3NDI A;  4MD7 A;  2PMZ A;  3IX0 A;  1TWC I;  2RPR A;  2BJO A;  3I4N I;  3D6W A;  1QYP A;  3IF8 A;  4NFR A;  5IP9 I;  3CQZ I;  1TWG I;  3GTM I;  3J81 f;  1Z03 A;  5C3E I;  5FLX b;  2QRE B;  3H3V J;  1YI2 Z;  4NB8 A;  2J6A A;  3GTM S;  3JAM b;  2O53 A;  2R7Z I;  2OTL Z;  2YAD A;  2W03 A;  1K83 I;  1Y1W I;  3KIF A;  1NJI 2;  2GTH A;  1K73 1;  1VQ9 1;  1KD1 1;  2JR6 A;  3CCR Z;  1Q7Y 2;  1Q86 1;  2VF1 A;  2GU2 A;  4MXU A;  4RVG A;  1K9M 2;  1QVF Z;  4A3D I;  1VQN 1;  3I56 Z;  2RIQ A;  1VQM 1;  3CC4 Z;  1YJN 1;  3HOY I;  2K3R A;  2QRD B;  3CC2 1;  2JA7 I;  3Q87 A;  2B63 I;  2IZ3 A;  3S2H I;  4BY7 I;  4NBC A;  3PO3 I;  3CXC Z;  4RVH A;  1VQ6 1;  3CCJ 1;  3P5J B;  3G4S 1;  1YJ9 1;  3TDH B;  3GTO I;  3PO3 S;  2NVX I;  1USP B;  2AKL A;  1YHQ 1;  2JA8 I;  3CCU 1;  3G71 Z;  1X0T A;  4MON A;  3GTP I;  1K8A 2;  3CMA 1;  1Y1V I;  2QRC B;  4A3M I;  3M3Y I;  4X6A I;  3HKZ A;  4CL1 A;  3CCM 1;  4NBA A;  2ZAE B;  1YIJ Z;  1VQK Z;  1YIT Z;  1VQO Z;  4MRI A;  1Y1V S;  3OW2 Z;  2OOX B;  2JS4 A;  3CD6 1;  3CCS 1;  1RNI A;  1TFI A;  5T67 A;  3RZD I;  5FLM I;  1RO0 A;  4NBG A;  1VQP Z;  1KC8 1;  4E33 A;  1WII A;  5C44 I;  5A2Q f;  3BG1 B;  2RHB A;  2DE6 A;  3CC7 1;  2P3Y A;  1SFO I;  2PM9 A;  3CME 1;  4E2X A;  4QTU A;  4NH1 C;  3CCL 1;  4E32 A;  3I4M I;  1VLA A;  1M1K 2;  2E2I I;  2M6N A;  3J80 b;  2K5R A;  4BBS I;  3I55 1;  2LFU A;  1KQS Z;  3S1N I;  4NB9 A;  3I07 A;  3TE5 B;  4A3K I;  4HGZ A;  3CCQ 1;  4NBF A;  2JUB A;  5C4X I;  1R9T I;  2QA4 1;  3VTN A;  1S72 1;  1VQ7 1;  2NVQ I;  1M90 1;  3ESW A;  2H85 A;  3FQQ A;  1Q81 2;  3FKI I;  3G6E 1;  5D1O B;  3F3P C;  1NP6 A;  4A93 I;  1RO2 A;  1VQ8 1;  5AN9 F;  2OTJ 1;  3VMG A;  2Y0S A;  1N8R 1;  1VQL 1;  3H0G I;  1USP A;  5IT9 b;  1YJW 1;  3GTL I;  4NBB A;  4NBH A;  4HH4 A;  4RV9 A;  3S14 I;  1X3Z A;  3CCE Z;  2V8J A;  4RVF A;  5CM2 M;  1Q82 2;  4DQY B;  1YUA A;  1LQL A;  3NH8 A;  2E2J I;  3J7A 4;  4DK1 A;  3S15 I;  1QVF Y;  2Q4Z A;  1VQ4 Z;  4A3G I;  2QEX Z;  3HOV I;  3J81 b;  4A3E I;  3LUS A;  1I50 I;  2NVT I;  3IFU A;  3PO2 I;  1ZB9 A;  3KIH A;  2F4M A;  5D1P A;  4NBE A;  3FQM A;  4MD9 A;  3MZL B;  2GTI A;  3VB9 A;  3NDJ A;  3S1Q I;  2HU9 A;  4Y52 I;  3CXC Y;  2KI7 B;  2NVY I;  2G2K A;  1WCM I;  2R92 I;  1YI2 1;  1JJ2 Z;  1QF8 A;  3HOU I;  3F3F C;  4BBR I;  2DE5 A;  4MH4 A;  3GTG I;  2OTL 1;  3VMH A;  1N2F A;  2DE7 A;  1QVG Z;  4E2Y A;  3QWU A;  1K73 2;  1KD1 2;  2OOY B;  1Q86 2;  1VQ9 Z;  3CCR 1;  1NJI 1;  5FLX f;  3S2D I;  3OW2 Y;  1Q7Y 1;  3K7A I;  4QTT A;  1K9M 1;  1VQN Z;  3HOX I;  3I56 1;  2Q51 A;  3JAM f;  1QVG Y;  3BG0 B;  1VQM Z;  3CC4 1;  2RBL A;  2WAQ A;  1YJN Z;  2F4O A;  1W2B Z;  3CPW Z;  2I3C A;  1TWF I;  5D1O A;  3CC2 Z;  2VUG A;  2JA6 I;  4MD8 A;  1PFT A;  2JA5 I;  3S17 I;  2E9H A;  1WW9 A;  3GTK I;  3NH5 A;  2O4H A;  4BY1 I;  2QR1 B;  1ML8 A;  1VQ6 Z;  3CCJ Z;  4A3I I;  2P28 A;  5IP7 I;  1Z02 A;  3HOW I;  3G4S Z;  1YJ9 Z;  4DGL A;  4S1T A;  2R6M A;  1YHQ Z;  4TNU A;  1KQS Y;  5LL6 f;  3CCU Z;  3G71 1;  1ZH1 A;  4BXX I;  3CMA Z;  1S7M A;  2RT9 A;  1K8A 1;  1RLY A;  3CCM Z;  5A2Q b;  4Y7N I;  1YIJ 1;  3S1R I;  4E2W A;  2R93 I;  1VQK 1;  1YIT 1;  1VQO 1;  1VQ5 1;  5T6B A;  3CCV 1;  3EED A;  3CD6 Z;  3CCS Z;  1KRL A;  3MON A;  2JNY A;  1NUI A;  1ZB8 A;  3MZK B;  4EWC A;  3M4O I;  1KC8 2;  3VMI A;  1VQP 1;  4NOZ A;  2QLV B;  2V8I A;  3CC7 Z;  3NFZ A;  3CME Z;  3GTQ I;  2OZK A;  4E31 A;  3GTJ I;  2QKD A;  3CCL Z;  1L1O C;  4A3J I;  4A3C I;  4HGY A;  3GKQ A;  2HF1 A;  1RO4 A;  1M1K 1;  1DL6 A;  3I55 Z;  4E30 A;  5T64 A;  3CCQ Z;  1I3Q I;  1X3W A;  1P9N A;  4NBD A;  2QA4 Z;  2LIY A;  5C4J I;  1RQF A;  3GCF A;  2M48 A;  2W04 A;  1S72 Z;  2KPI A;  4AYB A;  1VQ7 Z;  1M90 2;  3J80 f;  1TWH I;  3S16 I;  4A3B I;  2JMO A;  1JJ2 Y;  4A3L I;  1Q81 1;  4RS4 A;  2PK7 A;  3G6E Z;  1N8R 2;  1VQ8 Z;  2OTJ Z;  1Z01 A;  1VQL Z;  2EGT A;  3T4N B;  1VQ5 Z;  3RZO I;  2V8K A;  3CCV Z;  1YJW Z;  3HOZ I;  3D9X A;  3NH4 A;  2IZ4 A;  1TWA I;  2VUM I;  2E2H I;  4RVD A;  3U50 C;  4E2Z A;  2YU9 I;  1YUK A;  3CCE 1;  1I6H I;  4A3F I;  2WB1 A;  1Q82 1;  3EER A;  1VQ4 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...