2E2II

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dgtp
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2iI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2e2iI02
3PO3S 4NBBA 4BBSI 4NBCA 2E2JI 3D6WA 5C3EI 2JA8I 1DL6A 2DE5A 3S17I 2NVYI 1PFTA 4A3MI 2K5RA 4NBEA 2F4OA 1TFIA 1X3WA 2J6AA 4A3EI 3HOWI 1I3QI 2JNYA 2NVTI 3GTKI 4A3GI 4XX2A 4NB8A 4NOZA 3VMGA 4NBFA 1N2FA 2DE7A 1NUIA 2DE6A 4X6AI 3HOZI 2KPIA 1TWAI 2JA6I 1K83I 4BXXI 3GTPI 2R93I 3PO2I 2PK7A 1WCMI 1TWGI 2JA7I 3EERA 2VUMI 2HF1A 3S1QI 4A3II 4BBRI 2B63I 1ZB9A 4QTTA 5C44I 1TWFI 2RBLA 4A3KI 1ZB8A 2NVXI 1USPA 1Y1WI 1VLAA 3Q87A 4NBHA 4BY1I 2JR6A 3I4MI 2AKLA 2E2II 1I50I 3H3VJ 4NBDA 1LQLA 1RLYA 2F4MA 2JS4A 1TWCI 1WW9A 3S1RI 3HOXI 3GCFA 4A3JI 4A3LI 1X3ZA 1QYPA 3I4NI 2R92I 3VB9A 4Y52I 3I07A 2E2HI 1Y1VI 5IP7I 1RO4A 3GTMI 3HOVI 1Y1VS 3GTMS 5FLMI 4A3CI 3HOUI 3VMIA 2BJOA 4Y7NI 4A3FI 2NVQI 1R9TI 3CQZI 3GTLI 3S15I 3M3YI 1TWHI 4A3DI 4NBAA 2R7ZI 1I6HI 5CM2M 5C4XI 3RZDI 3LUSA 3S16I 4BY7I 3U50C 5C4JI 1SFOI 3GKQA 1USPB 3H0GI 3HOYI 4NBGA 1YUAA 5IP9I 3GTGI 3ESWA 2JA5I 4A93I 3RZOI 3FKII 4NB9A 4QTUA 3GTJI 3S1NI 4A3BI 2YU9I 2P3YA 3S14I 1ML8A 3GTQI 3VMHA 4MH4A 3S1MI 3S2DI 1L1OC 3S2HI 3M4OI 3GTOI 3PO3I 3K7AI
chains in the Genus database with same CATH superfamily
5FLXf 2JA8I 1Z01A 1PFTA 5AN9F 4A3MI 2K5RA 4NBEA 3CCVZ 4A3EI 3HOWI 3G711 3GTKI 2IV2X 4NOZA 4E32A 1YHQ1 3VMGA 5T6BA 4NBFA 2DE7A 1NUIA 3CPWZ 4X6AI 1Q862 3TE5B 3CCUZ 1RNIA 3FQQA 1YJ9Z 4BXXI 3GTPI 2R93I 1YJW1 2Q51A 3CCRZ 1WCMI 2LIYA 3KIFA 2JA7I 2E9HA 4NFRA 2YADA 4AYBA 2GTIA 3G4S1 3S1QI 1KC81 5A2Qb 2JUBA 4HGYA 4QTTA 5C44I 2V8KA 1QVFZ 3IF8A 2PMZA 2W03A 2GTHA 2VPZA 1VLAA 1VQKZ 1Y8CA 2JR6A 2VF1A 2IZ4A 1JJ2Y 1I50I 2WB1A 3BG1B 4NBDA 2F4MA 3NH5A 1WW9A 3HOXI 3TDHB 3CCV1 3OW2Y 3GCFA 4MD9A 4TNUA 3NFZA 3I56Z 2M6NA 3I4NI 1M901 2R92I 1K9M1 2RT9A 3CXCY 4RVFA 1WZNA 3CCU1 5D1OB 2QLVB 4RVGA 1YJ91 1VQLZ 3VMIA 2BJOA 3CCR1 2NVQI 3CCSZ 1X0TA 1I6HI 3LUSA 2VPYA 4HGZA 1USPB 2G2KA 1SIWA 3ESWA 3GTGI 3J81b 4A93I 1VQK1 4QTUA 2EGTA 1VQNZ 2M48A 2QREB 1FDOA 3S1MI 3S2HI 4MXUA 1Z03A 3GTOI 3PO3S 3CCQ1 4BBSI 4NBCA 3D6WA 2JIMA 3I561 2NVYI 2F4OA 3T4NB 1YIJZ 1I3QI 1VQL1 4A3GI 4XX2A 2OTJZ 3CCS1 4DK1A 1VQ7Z 2DE6A 2V8IA 3HOZI 2JA6I 1K83I 3MONA 2PK7A 4RS4A 4E2YA 2OTLZ 3JAMb 2HF1A 2B63I 4E30A 4RVDA 2R6MA 1JWHC 2RBLA 2K3RA 3Q87A 2JIRA 1Q822 2NAPA 1KC82 1N8R1 1VQOZ 1JJ2Z 3CCMZ 2JS4A 1M1K1 3OW2Z 1YIJ1 1VQ6Z 4A3JI 4A3LI 1X3ZA 4E33A 3EEDA 2OTJ1 3I07A 2ZAEB 2E2HI 1S72Z 1VQ71 1Y1VI 3GTMI 4A3CI 3VTNA 4RV9A 4Y7NI 1NP6A 4A3FI 3GTLI 3M3YI 1TWHI 3D2LA 4NBAA 3MZLB 4S1TA 3CC7Z 5IT9f 2OTL1 5CM2M 1M902 2JIQA 1VQPZ 5FLXb 2O53A 3F3PC 2OOXB 3H0GI 1K731 5T64A 3J80f 4NBGA 3NH4A 2QKDA 3RZOI 1VQ5Z 3NH8A 3S1NI 1P9NA 2YU9I 2P3YA 1ML8A 3HKZA 1VQO1 3CPWY 2LEXA 1Q811 1KQSY 3CD6Z 3M4OI 3CCM1 3K7AI 4NBBA 3MZKB 2Y0SA 2E2JI 1VQ61 4NH1C 3I55Z 1RO2A 2DE5A 3S17I 2W04A 2J6AA 2QA4Z 2JNYA 3CC2Z 1QVFY 3CCEZ 4E2ZA 3F3FC 1VQP1 5IT9b 1VQMZ 1QF8A 1VQ4Z 1TWGI 1ZH1A 2VPXA 3CC4Z 2KI7B 2VUMI 3CMEZ 2E7ZA 3D9XA 2JIPA 4BBRI 1Z02A 1ZB9A 1VQ51 2QRCB 1QXFA 5LL6f 1W2BY 1ZB8A 1Q7Y1 4NBHA 4BY1I 2OOYB 3NDIA 3I4MI 3I551 2JMOA 1K8A1 3FQMA 3H3VJ 1LQLA 1RLYA 1TWCI 3CCJZ 2QEXZ 2QA41 2RIQA 5A2Qf 3CC21 1RO0A 1QVGY 3VB9A 1VQN1 1YJNZ 1N8R2 3G6EZ 3HOVI 4E2XA 4E2WA 1VQ41 1R9TI 3S15I 3CC41 2R7ZI 3CME1 2JIOA 5C4XI 2V8JA 2RHBA 2Q4ZA 2WAQA 1VQ8Z 4BY7I 3U50C 1KD11 3QWUA 1NJI1 2JA5I 4E31A 3FKII 4DQYB 2LFUA 4NB9A 3IR7A 3IX0A 3CXCZ 4A3BI 3GTQI 3VMHA 4MH4A 1VQ9Z 3S2DI 1L1OC 2OZKA 2RPRA 1K732 1KQSZ 2IZ3A 3CCLZ 4MD8A 3PO3I 3CCJ1 2QEX1 1WIIA 5C3EI 1K9M2 1Q821 1DL6A 1Q861 1YJN1 3G6E1 3CMAZ 1TFIA 1X3WA 1Q812 3J81f 1YI2Z 2NVTI 4NB8A 1N2FA 3NDJA 2H85A 2O4HA 4MD7A 1WJ2A 2V3VA 2KPIA 1TWAI 1VQ81 4RVHA 2P28A 3PO2I 2V45A 3EERA 5D1OA 3CCQZ 5T67A 4A3II 1S721 1FDIA 4HH4A 1W2BZ 1TWFI 2VUGA 3IFUA 4A3KI 1VQ91 2NVXI 1USPA 4EWCA 1Y1WI 2I3CA 1KRLA 1YITZ 3CCL1 2VPWA 3CC71 4DGLA 2AKLA 2E2II 2AYDA 3P5JB 4MRIA 3JAMf 3S1RI 1Q7Y2 3CMA1 1S7MA 3J80b 1QVGZ 1YI21 2QRDB 1QYPA 4Y52I 2PM9A 5IP7I 1RO4A 1K8A2 1Y1VS 3G71Z 5D1PA 5FLMI 3GTMS 3HOUI 1RQFA 1YHQZ 3CD61 3CQZI 4CL1A 4A3DI 3RZDI 3S16I 5C4JI 1YJWZ 1SFOI 3GKQA 3HOYI 2QR1B 1YUKA 3BG0B 1AA6A 3G4SZ 1YUAA 5IP9I 3CCE1 1YIT1 3GTJI 4MONA 3S14I 3KIHA 1VQM1 2GU2A 1KD12 1M1K2 2HU9A 3J7A4 1NJI2 1Q16A
chains in the Genus database with same CATH topology
5FLXf 2JA8I 1Z01A 1PFTA 5AN9F 4A3MI 2K5RA 4NBEA 3CCVZ 4A3EI 3HOWI 3G711 3GTKI 4NOZA 4E32A 1YHQ1 3VMGA 5T6BA 4NBFA 2DE7A 1NUIA 3CPWZ 4X6AI 1Q862 3TE5B 3CCUZ 1RNIA 3FQQA 1YJ9Z 4BXXI 3GTPI 2R93I 1YJW1 2Q51A 3CCRZ 1WCMI 2LIYA 3KIFA 2JA7I 2E9HA 4NFRA 2YADA 4AYBA 2GTIA 3G4S1 3S1QI 1KC81 5A2Qb 2JUBA 4HGYA 4QTTA 5C44I 2V8KA 1QVFZ 3IF8A 2PMZA 2W03A 2GTHA 1VLAA 1VQKZ 2JR6A 2VF1A 2IZ4A 1JJ2Y 1I50I 2WB1A 3BG1B 4NBDA 2F4MA 3NH5A 1WW9A 3HOXI 3TDHB 3CCV1 3OW2Y 3GCFA 4MD9A 4TNUA 3NFZA 3I56Z 2M6NA 3I4NI 1M901 2R92I 1K9M1 2RT9A 3CXCY 4RVFA 5D1OB 3CCU1 1VQLZ 2QLVB 4RVGA 1YJ91 3VMIA 2BJOA 3CCR1 2NVQI 3CCSZ 1X0TA 1I6HI 3LUSA 4HGZA 1USPB 2G2KA 3GTGI 3ESWA 3J81b 4A93I 1VQK1 4QTUA 2EGTA 1VQNZ 2M48A 2QREB 3S1MI 3S2HI 4MXUA 1Z03A 3GTOI 3PO3S 3CCQ1 4BBSI 4NBCA 3D6WA 3I561 2NVYI 2F4OA 3T4NB 1YIJZ 1I3QI 1VQL1 4A3GI 4XX2A 2OTJZ 3CCS1 4DK1A 1VQ7Z 2DE6A 2V8IA 3HOZI 2JA6I 1K83I 3MONA 2PK7A 4RS4A 4E2YA 2OTLZ 3JAMb 2HF1A 2B63I 4E30A 4RVDA 2R6MA 1JWHC 2RBLA 2K3RA 3Q87A 1Q822 1KC82 1N8R1 1VQOZ 1JJ2Z 3CCMZ 2JS4A 1M1K1 3OW2Z 1YIJ1 1VQ6Z 4A3JI 4A3LI 1X3ZA 4E33A 3EEDA 2OTJ1 3I07A 2ZAEB 2E2HI 1S72Z 1VQ71 1Y1VI 3GTMI 4A3CI 3VTNA 4RV9A 4Y7NI 1NP6A 4A3FI 3GTLI 3M3YI 1TWHI 4NBAA 3MZLB 4S1TA 3CC7Z 5IT9f 2OTL1 5CM2M 1M902 1VQPZ 5FLXb 2O53A 3F3PC 2OOXB 3H0GI 1K731 5T64A 3J80f 4NBGA 3NH4A 2QKDA 3RZOI 1VQ5Z 3NH8A 3S1NI 1P9NA 2YU9I 2P3YA 1ML8A 3HKZA 1VQO1 3CPWY 1Q811 3M4OI 1KQSY 3CD6Z 3CCM1 3K7AI 4NBBA 3MZKB 2Y0SA 2E2JI 1VQ61 4NH1C 3I55Z 1RO2A 2DE5A 3S17I 2W04A 2J6AA 2QA4Z 2JNYA 3CC2Z 1QVFY 3CCEZ 4E2ZA 3F3FC 1VQP1 5IT9b 1VQMZ 1QF8A 1VQ4Z 1TWGI 1ZH1A 3CC4Z 2KI7B 2VUMI 3CMEZ 3D9XA 4BBRI 1Z02A 1ZB9A 1VQ51 2QRCB 5LL6f 1W2BY 1ZB8A 1Q7Y1 4NBHA 4BY1I 2OOYB 3NDIA 3I4MI 3I551 2JMOA 1K8A1 3FQMA 3H3VJ 1LQLA 1RLYA 1TWCI 3CCJZ 2QEXZ 2QA41 2RIQA 5A2Qf 3CC21 1RO0A 1QVGY 3VB9A 1VQN1 1YJNZ 1N8R2 3G6EZ 3HOVI 4E2XA 4E2WA 1VQ41 1R9TI 3S15I 3CC41 2R7ZI 3CME1 5C4XI 2V8JA 2RHBA 2Q4ZA 2WAQA 1VQ8Z 4BY7I 3U50C 1KD11 3QWUA 1NJI1 2JA5I 4E31A 3FKII 4DQYB 2LFUA 4NB9A 3IX0A 3CXCZ 4A3BI 3GTQI 3VMHA 4MH4A 1VQ9Z 3S2DI 1L1OC 2OZKA 2RPRA 1K732 1KQSZ 2IZ3A 3CCLZ 4MD8A 3PO3I 3CCJ1 2QEX1 1WIIA 5C3EI 1K9M2 1Q821 1DL6A 1Q861 1YJN1 3G6E1 3CMAZ 1TFIA 1X3WA 1Q812 3J81f 1YI2Z 2NVTI 4NB8A 1N2FA 3NDJA 2H85A 2O4HA 4MD7A 2KPIA 1TWAI 1VQ81 4RVHA 2P28A 3PO2I 3EERA 5D1OA 3CCQZ 5T67A 4A3II 1S721 4HH4A 1W2BZ 1TWFI 2VUGA 3IFUA 4A3KI 1VQ91 2NVXI 1USPA 4EWCA 1Y1WI 2I3CA 1KRLA 1YITZ 3CCL1 3CC71 4DGLA 2AKLA 2E2II 3P5JB 4MRIA 3JAMf 3S1RI 1Q7Y2 3CMA1 1S7MA 3J80b 1QVGZ 1YI21 2QRDB 1QYPA 4Y52I 2PM9A 5IP7I 1RO4A 1K8A2 1Y1VS 5D1PA 5FLMI 3G71Z 3GTMS 3HOUI 1RQFA 1YHQZ 3CD61 3CQZI 4CL1A 4A3DI 3RZDI 3S16I 5C4JI 1YJWZ 1SFOI 3GKQA 3HOYI 2QR1B 1YUKA 3BG0B 3G4SZ 1YUAA 5IP9I 3CCE1 1YIT1 3GTJI 4MONA 3S14I 3KIHA 1VQM1 2GU2A 1KD12 1M1K2 2HU9A 3J7A4 1NJI2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO3 S;  4NBB A;  4BBS I;  4NBC A;  2E2J I;  3D6W A;  5C3E I;  2JA8 I;  1DL6 A;  2DE5 A;  3S17 I;  2NVY I;  1PFT A;  4A3M I;  2K5R A;  4NBE A;  2F4O A;  1TFI A;  1X3W A;  2J6A A;  4A3E I;  3HOW I;  1I3Q I;  2JNY A;  2NVT I;  3GTK I;  4A3G I;  4XX2 A;  4NB8 A;  4NOZ A;  3VMG A;  4NBF A;  1N2F A;  2DE7 A;  1NUI A;  2DE6 A;  4X6A I;  3HOZ I;  2KPI A;  1TWA I;  2JA6 I;  1K83 I;  4BXX I;  3GTP I;  2R93 I;  3PO2 I;  2PK7 A;  1WCM I;  1TWG I;  2JA7 I;  3EER A;  2VUM I;  2HF1 A;  3S1Q I;  4A3I I;  4BBR I;  2B63 I;  1ZB9 A;  4QTT A;  5C44 I;  1TWF I;  2RBL A;  4A3K I;  1ZB8 A;  2NVX I;  1USP A;  1Y1W I;  1VLA A;  3Q87 A;  4NBH A;  4BY1 I;  2JR6 A;  3I4M I;  2AKL A;  2E2I I;  1I50 I;  3H3V J;  4NBD A;  1LQL A;  1RLY A;  2F4M A;  2JS4 A;  1TWC I;  1WW9 A;  3S1R I;  3HOX I;  3GCF A;  4A3J I;  4A3L I;  1X3Z A;  1QYP A;  3I4N I;  2R92 I;  3VB9 A;  4Y52 I;  3I07 A;  2E2H I;  1Y1V I;  5IP7 I;  1RO4 A;  3GTM I;  3HOV I;  1Y1V S;  3GTM S;  5FLM I;  4A3C I;  3HOU I;  3VMI A;  2BJO A;  4Y7N I;  4A3F I;  2NVQ I;  1R9T I;  3CQZ I;  3GTL I;  3S15 I;  3M3Y I;  1TWH I;  4A3D I;  4NBA A;  2R7Z I;  1I6H I;  5CM2 M;  5C4X I;  3RZD I;  3LUS A;  3S16 I;  4BY7 I;  3U50 C;  5C4J I;  1SFO I;  3GKQ A;  1USP B;  3H0G I;  3HOY I;  4NBG A;  1YUA A;  5IP9 I;  3GTG I;  3ESW A;  2JA5 I;  4A93 I;  3RZO I;  3FKI I;  4NB9 A;  4QTU A;  3GTJ I;  3S1N I;  4A3B I;  2YU9 I;  2P3Y A;  3S14 I;  1ML8 A;  3GTQ I;  3VMH A;  4MH4 A;  3S1M I;  3S2D I;  1L1O C;  3S2H I;  3M4O I;  3GTO I;  3PO3 I;  3K7A I; 
#chains in the Genus database with same CATH topology
 5FLX f;  2JA8 I;  1Z01 A;  1PFT A;  5AN9 F;  4A3M I;  2K5R A;  4NBE A;  3CCV Z;  4A3E I;  3HOW I;  3G71 1;  3GTK I;  2IV2 X;  4NOZ A;  4E32 A;  1YHQ 1;  3VMG A;  5T6B A;  4NBF A;  2DE7 A;  1NUI A;  3CPW Z;  4X6A I;  1Q86 2;  3TE5 B;  3CCU Z;  1RNI A;  3FQQ A;  1YJ9 Z;  4BXX I;  3GTP I;  2R93 I;  1YJW 1;  2Q51 A;  3CCR Z;  1WCM I;  2LIY A;  3KIF A;  2JA7 I;  2E9H A;  4NFR A;  2YAD A;  4AYB A;  2GTI A;  3G4S 1;  3S1Q I;  1KC8 1;  5A2Q b;  2JUB A;  4HGY A;  4QTT A;  5C44 I;  2V8K A;  1QVF Z;  3IF8 A;  2PMZ A;  2W03 A;  2GTH A;  2VPZ A;  1VLA A;  1VQK Z;  1Y8C A;  2JR6 A;  2VF1 A;  2IZ4 A;  1JJ2 Y;  1I50 I;  2WB1 A;  3BG1 B;  4NBD A;  2F4M A;  3NH5 A;  1WW9 A;  3HOX I;  3TDH B;  3CCV 1;  3OW2 Y;  3GCF A;  4MD9 A;  4TNU A;  3NFZ A;  3I56 Z;  2M6N A;  3I4N I;  1M90 1;  2R92 I;  1K9M 1;  2RT9 A;  3CXC Y;  4RVF A;  1WZN A;  3CCU 1;  5D1O B;  2QLV B;  4RVG A;  1YJ9 1;  1VQL Z;  3VMI A;  2BJO A;  3CCR 1;  2NVQ I;  3CCS Z;  1X0T A;  1I6H I;  3LUS A;  2VPY A;  4HGZ A;  1USP B;  2G2K A;  1SIW A;  3ESW A;  3GTG I;  3J81 b;  4A93 I;  1VQK 1;  4QTU A;  2EGT A;  1VQN Z;  2M48 A;  2QRE B;  1FDO A;  3S1M I;  3S2H I;  4MXU A;  1Z03 A;  3GTO I;  3PO3 S;  3CCQ 1;  4BBS I;  4NBC A;  3D6W A;  2JIM A;  3I56 1;  2NVY I;  2F4O A;  3T4N B;  1YIJ Z;  1I3Q I;  1VQL 1;  4A3G I;  4XX2 A;  2OTJ Z;  3CCS 1;  4DK1 A;  1VQ7 Z;  2DE6 A;  2V8I A;  3HOZ I;  2JA6 I;  1K83 I;  3MON A;  2PK7 A;  4RS4 A;  4E2Y A;  2OTL Z;  3JAM b;  2HF1 A;  2B63 I;  4E30 A;  4RVD A;  2R6M A;  1JWH C;  2RBL A;  2K3R A;  3Q87 A;  2JIR A;  1Q82 2;  2NAP A;  1KC8 2;  1N8R 1;  1VQO Z;  1JJ2 Z;  3CCM Z;  2JS4 A;  1M1K 1;  3OW2 Z;  1YIJ 1;  1VQ6 Z;  4A3J I;  4A3L I;  1X3Z A;  4E33 A;  3EED A;  2OTJ 1;  3I07 A;  2ZAE B;  2E2H I;  1S72 Z;  1VQ7 1;  1Y1V I;  3GTM I;  4A3C I;  3VTN A;  4RV9 A;  4Y7N I;  1NP6 A;  4A3F I;  3GTL I;  3M3Y I;  1TWH I;  3D2L A;  4NBA A;  3MZL B;  4S1T A;  3CC7 Z;  5IT9 f;  2OTL 1;  5CM2 M;  1M90 2;  2JIQ A;  1VQP Z;  5FLX b;  2O53 A;  3F3P C;  2OOX B;  3H0G I;  1K73 1;  5T64 A;  3J80 f;  4NBG A;  3NH4 A;  2QKD A;  3RZO I;  1VQ5 Z;  3NH8 A;  3S1N I;  1P9N A;  2YU9 I;  2P3Y A;  1ML8 A;  3HKZ A;  1VQO 1;  3CPW Y;  2LEX A;  1Q81 1;  1KQS Y;  3CD6 Z;  3M4O I;  3CCM 1;  3K7A I;  4NBB A;  3MZK B;  2Y0S A;  2E2J I;  1VQ6 1;  4NH1 C;  3I55 Z;  1RO2 A;  2DE5 A;  3S17 I;  2W04 A;  2J6A A;  2QA4 Z;  2JNY A;  3CC2 Z;  1QVF Y;  3CCE Z;  4E2Z A;  3F3F C;  1VQP 1;  5IT9 b;  1VQM Z;  1QF8 A;  1VQ4 Z;  1TWG I;  1ZH1 A;  2VPX A;  3CC4 Z;  2KI7 B;  2VUM I;  3CME Z;  2E7Z A;  3D9X A;  2JIP A;  4BBR I;  1Z02 A;  1ZB9 A;  1VQ5 1;  2QRC B;  1QXF A;  5LL6 f;  1W2B Y;  1ZB8 A;  1Q7Y 1;  4NBH A;  4BY1 I;  2OOY B;  3NDI A;  3I4M I;  3I55 1;  2JMO A;  1K8A 1;  3FQM A;  3H3V J;  1LQL A;  1RLY A;  1TWC I;  3CCJ Z;  2QEX Z;  2QA4 1;  2RIQ A;  5A2Q f;  3CC2 1;  1RO0 A;  1QVG Y;  3VB9 A;  1VQN 1;  1YJN Z;  1N8R 2;  3G6E Z;  3HOV I;  4E2X A;  4E2W A;  1VQ4 1;  1R9T I;  3S15 I;  3CC4 1;  2R7Z I;  3CME 1;  2JIO A;  5C4X I;  2V8J A;  2RHB A;  2Q4Z A;  2WAQ A;  1VQ8 Z;  4BY7 I;  3U50 C;  1KD1 1;  3QWU A;  1NJI 1;  2JA5 I;  4E31 A;  3FKI I;  4DQY B;  2LFU A;  4NB9 A;  3IR7 A;  3IX0 A;  3CXC Z;  4A3B I;  3GTQ I;  3VMH A;  4MH4 A;  1VQ9 Z;  3S2D I;  1L1O C;  2OZK A;  2RPR A;  1K73 2;  1KQS Z;  2IZ3 A;  3CCL Z;  4MD8 A;  3PO3 I;  3CCJ 1;  2QEX 1;  1WII A;  5C3E I;  1K9M 2;  1Q82 1;  1DL6 A;  1Q86 1;  1YJN 1;  3G6E 1;  3CMA Z;  1TFI A;  1X3W A;  1Q81 2;  3J81 f;  1YI2 Z;  2NVT I;  4NB8 A;  1N2F A;  3NDJ A;  2H85 A;  2O4H A;  4MD7 A;  1WJ2 A;  2V3V A;  2KPI A;  1TWA I;  1VQ8 1;  4RVH A;  2P28 A;  3PO2 I;  2V45 A;  3EER A;  5D1O A;  3CCQ Z;  5T67 A;  4A3I I;  1S72 1;  1FDI A;  4HH4 A;  1W2B Z;  1TWF I;  2VUG A;  3IFU A;  4A3K I;  1VQ9 1;  2NVX I;  1USP A;  4EWC A;  1Y1W I;  2I3C A;  1KRL A;  1YIT Z;  3CCL 1;  2VPW A;  3CC7 1;  4DGL A;  2AKL A;  2E2I I;  2AYD A;  3P5J B;  4MRI A;  3JAM f;  3S1R I;  1Q7Y 2;  3CMA 1;  1S7M A;  3J80 b;  1QVG Z;  1YI2 1;  2QRD B;  1QYP A;  4Y52 I;  2PM9 A;  5IP7 I;  1RO4 A;  1K8A 2;  1Y1V S;  3G71 Z;  5D1P A;  5FLM I;  3GTM S;  3HOU I;  1RQF A;  1YHQ Z;  3CD6 1;  3CQZ I;  4CL1 A;  4A3D I;  3RZD I;  3S16 I;  5C4J I;  1YJW Z;  1SFO I;  3GKQ A;  3HOY I;  2QR1 B;  1YUK A;  3BG0 B;  1AA6 A;  3G4S Z;  1YUA A;  5IP9 I;  3CCE 1;  1YIT 1;  3GTJ I;  4MON A;  3S14 I;  3KIH A;  1VQM 1;  2GU2 A;  1KD1 2;  1M1K 2;  2HU9 A;  3J7A 4;  1NJI 2;  1Q16 A; 
#chains in the Genus database with same CATH homology
 5FLX f;  2JA8 I;  1Z01 A;  1PFT A;  5AN9 F;  4A3M I;  2K5R A;  4NBE A;  3CCV Z;  4A3E I;  3HOW I;  3G71 1;  3GTK I;  4NOZ A;  4E32 A;  1YHQ 1;  3VMG A;  5T6B A;  4NBF A;  2DE7 A;  1NUI A;  3CPW Z;  4X6A I;  1Q86 2;  3TE5 B;  3CCU Z;  1RNI A;  3FQQ A;  1YJ9 Z;  4BXX I;  3GTP I;  2R93 I;  1YJW 1;  2Q51 A;  3CCR Z;  1WCM I;  2LIY A;  3KIF A;  2JA7 I;  2E9H A;  4NFR A;  2YAD A;  4AYB A;  2GTI A;  3G4S 1;  3S1Q I;  1KC8 1;  5A2Q b;  2JUB A;  4HGY A;  4QTT A;  5C44 I;  2V8K A;  1QVF Z;  3IF8 A;  2PMZ A;  2W03 A;  2GTH A;  1VLA A;  1VQK Z;  2JR6 A;  2VF1 A;  2IZ4 A;  1JJ2 Y;  1I50 I;  2WB1 A;  3BG1 B;  4NBD A;  2F4M A;  3NH5 A;  1WW9 A;  3HOX I;  3TDH B;  3CCV 1;  3OW2 Y;  3GCF A;  4MD9 A;  4TNU A;  3NFZ A;  3I56 Z;  2M6N A;  3I4N I;  1M90 1;  2R92 I;  1K9M 1;  2RT9 A;  3CXC Y;  4RVF A;  5D1O B;  3CCU 1;  1VQL Z;  2QLV B;  4RVG A;  1YJ9 1;  3VMI A;  2BJO A;  3CCR 1;  2NVQ I;  3CCS Z;  1X0T A;  1I6H I;  3LUS A;  4HGZ A;  1USP B;  2G2K A;  3GTG I;  3ESW A;  3J81 b;  4A93 I;  1VQK 1;  4QTU A;  2EGT A;  1VQN Z;  2M48 A;  2QRE B;  3S1M I;  3S2H I;  4MXU A;  1Z03 A;  3GTO I;  3PO3 S;  3CCQ 1;  4BBS I;  4NBC A;  3D6W A;  3I56 1;  2NVY I;  2F4O A;  3T4N B;  1YIJ Z;  1I3Q I;  1VQL 1;  4A3G I;  4XX2 A;  2OTJ Z;  3CCS 1;  4DK1 A;  1VQ7 Z;  2DE6 A;  2V8I A;  3HOZ I;  2JA6 I;  1K83 I;  3MON A;  2PK7 A;  4RS4 A;  4E2Y A;  2OTL Z;  3JAM b;  2HF1 A;  2B63 I;  4E30 A;  4RVD A;  2R6M A;  1JWH C;  2RBL A;  2K3R A;  3Q87 A;  1Q82 2;  1KC8 2;  1N8R 1;  1VQO Z;  1JJ2 Z;  3CCM Z;  2JS4 A;  1M1K 1;  3OW2 Z;  1YIJ 1;  1VQ6 Z;  4A3J I;  4A3L I;  1X3Z A;  4E33 A;  3EED A;  2OTJ 1;  3I07 A;  2ZAE B;  2E2H I;  1S72 Z;  1VQ7 1;  1Y1V I;  3GTM I;  4A3C I;  3VTN A;  4RV9 A;  4Y7N I;  1NP6 A;  4A3F I;  3GTL I;  3M3Y I;  1TWH I;  4NBA A;  3MZL B;  4S1T A;  3CC7 Z;  5IT9 f;  2OTL 1;  5CM2 M;  1M90 2;  1VQP Z;  5FLX b;  2O53 A;  3F3P C;  2OOX B;  3H0G I;  1K73 1;  5T64 A;  3J80 f;  4NBG A;  3NH4 A;  2QKD A;  3RZO I;  1VQ5 Z;  3NH8 A;  3S1N I;  1P9N A;  2YU9 I;  2P3Y A;  1ML8 A;  3HKZ A;  1VQO 1;  3CPW Y;  1Q81 1;  3M4O I;  1KQS Y;  3CD6 Z;  3CCM 1;  3K7A I;  4NBB A;  3MZK B;  2Y0S A;  2E2J I;  1VQ6 1;  4NH1 C;  3I55 Z;  1RO2 A;  2DE5 A;  3S17 I;  2W04 A;  2J6A A;  2QA4 Z;  2JNY A;  3CC2 Z;  1QVF Y;  3CCE Z;  4E2Z A;  3F3F C;  1VQP 1;  5IT9 b;  1VQM Z;  1QF8 A;  1VQ4 Z;  1TWG I;  1ZH1 A;  3CC4 Z;  2KI7 B;  2VUM I;  3CME Z;  3D9X A;  4BBR I;  1Z02 A;  1ZB9 A;  1VQ5 1;  2QRC B;  5LL6 f;  1W2B Y;  1ZB8 A;  1Q7Y 1;  4NBH A;  4BY1 I;  2OOY B;  3NDI A;  3I4M I;  3I55 1;  2JMO A;  1K8A 1;  3FQM A;  3H3V J;  1LQL A;  1RLY A;  1TWC I;  3CCJ Z;  2QEX Z;  2QA4 1;  2RIQ A;  5A2Q f;  3CC2 1;  1RO0 A;  1QVG Y;  3VB9 A;  1VQN 1;  1YJN Z;  1N8R 2;  3G6E Z;  3HOV I;  4E2X A;  4E2W A;  1VQ4 1;  1R9T I;  3S15 I;  3CC4 1;  2R7Z I;  3CME 1;  5C4X I;  2V8J A;  2RHB A;  2Q4Z A;  2WAQ A;  1VQ8 Z;  4BY7 I;  3U50 C;  1KD1 1;  3QWU A;  1NJI 1;  2JA5 I;  4E31 A;  3FKI I;  4DQY B;  2LFU A;  4NB9 A;  3IX0 A;  3CXC Z;  4A3B I;  3GTQ I;  3VMH A;  4MH4 A;  1VQ9 Z;  3S2D I;  1L1O C;  2OZK A;  2RPR A;  1K73 2;  1KQS Z;  2IZ3 A;  3CCL Z;  4MD8 A;  3PO3 I;  3CCJ 1;  2QEX 1;  1WII A;  5C3E I;  1K9M 2;  1Q82 1;  1DL6 A;  1Q86 1;  1YJN 1;  3G6E 1;  3CMA Z;  1TFI A;  1X3W A;  1Q81 2;  3J81 f;  1YI2 Z;  2NVT I;  4NB8 A;  1N2F A;  3NDJ A;  2H85 A;  2O4H A;  4MD7 A;  2KPI A;  1TWA I;  1VQ8 1;  4RVH A;  2P28 A;  3PO2 I;  3EER A;  5D1O A;  3CCQ Z;  5T67 A;  4A3I I;  1S72 1;  4HH4 A;  1W2B Z;  1TWF I;  2VUG A;  3IFU A;  4A3K I;  1VQ9 1;  2NVX I;  1USP A;  4EWC A;  1Y1W I;  2I3C A;  1KRL A;  1YIT Z;  3CCL 1;  3CC7 1;  4DGL A;  2AKL A;  2E2I I;  3P5J B;  4MRI A;  3JAM f;  3S1R I;  1Q7Y 2;  3CMA 1;  1S7M A;  3J80 b;  1QVG Z;  1YI2 1;  2QRD B;  1QYP A;  4Y52 I;  2PM9 A;  5IP7 I;  1RO4 A;  1K8A 2;  1Y1V S;  5D1P A;  5FLM I;  3G71 Z;  3GTM S;  3HOU I;  1RQF A;  1YHQ Z;  3CD6 1;  3CQZ I;  4CL1 A;  4A3D I;  3RZD I;  3S16 I;  5C4J I;  1YJW Z;  1SFO I;  3GKQ A;  3HOY I;  2QR1 B;  1YUK A;  3BG0 B;  3G4S Z;  1YUA A;  5IP9 I;  3CCE 1;  1YIT 1;  3GTJ I;  4MON A;  3S14 I;  3KIH A;  1VQM 1;  2GU2 A;  1KD1 2;  1M1K 2;  2HU9 A;  3J7A 4;  1NJI 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...