4BBSI

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
molecule tags Transcription
source organism Saccharomyces cerevisiae
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4bbsI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4bbsI02
1TWCI 5C4JI 1L1OC 3VMGA 4A3FI 3LUSA 5IP9I 3K7AI 4BBSI 4A93I 1ML8A 3GCFA 3S1MI 1LQLA 1VLAA 4NBCA 2DE5A 3GTKI 4A3CI 3HOUI 3VMIA 1TWFI 1YUAA 3S14I 2AKLA 3H0GI 1ZB8A 1I6HI 4QTUA 4BY1I 2P3YA 4NOZA 3H3VJ 3HOXI 3GTGI 3ESWA 3S17I 1Y1VI 3HOVI 3FKII 4X6AI 2BJOA 3I4MI 3M4OI 3GTJI 4A3BI 1PFTA 2R92I 4NBAA 2JA7I 4NB9A 2R93I 1I50I 1R9TI 4Y7NI 5CM2M 1TWAI 2NVYI 4BXXI 2VUMI 2DE7A 2JR6A 1NUIA 1TWHI 2HF1A 4NBBA 3PO3S 1SFOI 2DE6A 3VMHA 4A3II 4QTTA 2J6AA 3S1QI 4BY7I 1TWGI 1X3ZA 4NBGA 2JS4A 3PO2I 4A3GI 3GTQI 1TFIA 2RBLA 3GTMI 1WCMI 1Y1VS 2NVQI 2JA5I 5FLMI 4NBHA 3HOWI 3U50C 1USPB 3GTOI 2E2II 1I3QI 5C3EI 4NBEA 3RZDI 3S16I 2YU9I 3I07A 1K83I 5C44I 1RO4A 2KPIA 1USPA 3GTLI 3S1NI 4XX2A 3S15I 4NB8A 2K5RA 2PK7A 2JA8I 2R7ZI 3S1RI 3M3YI 3PO3I 4A3KI 4NBDA 4A3JI 3HOZI 3CQZI 2F4OA 4A3MI 5C4XI 3GTMS 1DL6A 5IP7I 3Q87A 1RLYA 2E2JI 4Y52I 3VB9A 3EERA 3RZOI 2JNYA 2E2HI 4A3LI 1QYPA 4A3EI 3S2HI 3D6WA 4BBRI 2F4MA 3S2DI 3GKQA 2NVXI 1WW9A 3HOYI 4MH4A 1ZB9A 1X3WA 1Y1WI 4NBFA 4A3DI 1N2FA 2B63I 2NVTI 3GTPI 3I4NI 2JA6I
chains in the Genus database with same CATH superfamily
3CC21 5C4JI 1YJ91 4E31A 2WB1A 2GU2A 3CCE1 2O53A 4BBSI 4A93I 3CCV1 1K8A2 2VPYA 4NBCA 2DE5A 2OOXB 3VMIA 3CC7Z 3FQQA 3G4S1 3CCJZ 2P3YA 4NOZA 4E2YA 2OTJ1 4X6AI 3FKII 3I4MI 3M4OI 4A3BI 1PFTA 1S721 1QXFA 2JA7I 2R93I 1KD11 1RO0A 2JR6A 1VQ6Z 2NAPA 1VQ91 1P9NA 2JIMA 2HF1A 2Y0SA 1VQO1 1YJNZ 2DE6A 4RVHA 3J80b 2ZAEB 4A3II 3FQMA 4QTTA 4BY7I 1Q862 3F3FC 4NBGA 1VQ41 3PO2I 1YIT1 1RQFA 1NP6A 3CCVZ 5A2Qb 4E2ZA 4NBHA 3CCL1 3NDJA 3GTOI 5C3EI 2QR1B 1NJI2 3S16I 2V8JA 1Z01A 5C44I 1RO4A 1M1K2 2QKDA 1VQ4Z 1USPA 3S15I 2QEX1 4NB8A 2K5RA 3JAMb 3D9XA 2R7ZI 3CC4Z 4NBDA 4A3JI 4EWCA 3CQZI 2OTLZ 2W03A 3CCS1 3S2DI 4BBRI 4MONA 1VQOZ 1WW9A 2OZKA 3CC41 1X3WA 2H85A 4NBFA 3CCMZ 4MD9A 3J7A4 2NVTI 1M1K1 3CME1 3NH8A 5IT9f 1YHQZ 1QVFY 2EGTA 1L1OC 3CCSZ 4HGYA 1Q821 5FLXf 3G6EZ 1N8R2 5T67A 3OW2Y 1ML8A 3EEDA 3NH5A 2W04A 4A3CI 3CCRZ 1TWFI 4DGLA 2RPRA 3KIHA 3H0GI 2VUGA 4QTUA 3CMAZ 3HOXI 3G6E1 2I3CA 3J81f 2IZ3A 1SIWA 5T64A 3KIFA 1R9TI 2E9HA 4BXXI 2VUMI 3NDIA 1NUIA 4RS4A 3J80f 2O4HA 3PO3S 1SFOI 1YIJZ 5D1OB 3VMHA 2PMZA 1Q7Y1 1WZNA 2J6AA 1FDOA 1TWGI 2QRCB 3IF8A 1WCMI 3QWUA 2LFUA 4RVDA 3I551 3NH4A 3G4SZ 3HOWI 4RV9A 1I3QI 1YIJ1 4NBEA 2AYDA 2YU9I 1VQ51 3I07A 3CD6Z 3VTNA 2IZ4A 2PM9A 5AN9F 4E32A 4XX2A 1VQN1 1S72Z 2JA8I 5D1PA 3CXCZ 3HOZI 4NFRA 1QF8A 2IV2X 5IP7I 2E2JI 1RLYA 1YJN1 3G711 3EERA 3RZOI 2JNYA 1VQMZ 1Q16A 1QYPA 3S2HI 1Q811 3GKQA 2NVXI 3HOYI 3BG0B 2V8IA 2VPZA 1ZB9A 3JAMf 1Y1WI 1K731 4A3DI 1JWHC 2B63I 4MXUA 1TWCI 4MD7A 3VMGA 1W2BY 3LUSA 3P5JB 5IP9I 3CMEZ 3K7AI 1NJI1 3GCFA 1LQLA 5A2Qf 3GTKI 2R6MA 1Y8CA 3HOUI 1Q7Y2 3T4NB 2K3RA 2AKLA 2JMOA 1ZB8A 2JIOA 3CCJ1 1I6HI 4BY1I 3CXCY 3ESWA 1VQL1 3MZLB 3MONA 3GTJI 1VQM1 1WIIA 2R92I 1RO2A 3I55Z 4NBAA 4TNUA 1JJ2Y 1Z02A 1I50I 4E2XA 2NVYI 1YHQ1 2DE7A 4HGZA 4NBBA 1VQKZ 2V8KA 1YJWZ 2M6NA 4MD8A 1S7MA 1X3ZA 1K9M2 1YITZ 2Q4ZA 4E2WA 1TFIA 2Q51A 1Y1VS 3IX0A 2NVQI 2JA5I 3CPWY 1VQ71 1KC82 3U50C 5FLXb 2E2II 5LL6f 2GTHA 4NH1C 4CL1A 2KPIA 1M902 3S1NI 2JIPA 2LEXA 2YADA 3IR7A 3PO3I 3NFZA 3MZKB 4A3KI 4E30A 1WJ2A 4HH4A 2QREB 1YI21 3TE5B 2F4OA 2QLVB 3GTMS 5D1OA 4Y52I 2E2HI 1KQSY 4A3EI 3D6WA 1JJ2Z 4MH4A 2VF1A 3CCQZ 4E33A 2G2KA 2VPXA 3I4NI 3CCEZ 3CCU1 1FDIA 1VQLZ 4A3FI 2QA41 1RNIA 2GTIA 3S1MI 1VQ81 1KC81 1VLAA 1YUKA 1K8A1 4DK1A 1YUAA 2P28A 3S14I 3J81b 3CCLZ 1W2BZ 1K9M1 4RVGA 1VQK1 5IT9b 3H3VJ 1Q812 3G71Z 2E7ZA 3GTGI 1QVGZ 1KD12 1YJ9Z 1Y1VI 1ZH1A 3HOVI 3S17I 2BJOA 2VPWA 1VQ7Z 3TDHB 4NB9A 3CCQ1 1VQ61 1Z03A 5CM2M 4Y7NI 1TWAI 3CC71 4AYBA 4MRIA 2RHBA 3CPWZ 1TWHI 4S1TA 3I56Z 5T6BA 4DQYB 2OTJZ 1KRLA 2OTL1 3D2LA 2WAQA 2QA4Z 3S1QI 2QRDB 2JS4A 4A3GI 3GTQI 2RBLA 1YI2Z 3GTMI 1VQ8Z 3CC2Z 5FLMI 3CCM1 1KQSZ 1Q861 1Q822 1USPB 1AA6A 3IFUA 3RZDI 1N8R1 1VQ9Z 3HKZA 4RVFA 2OOYB 1K83I 2V3VA 2RT9A 1VQ5Z 3CD61 3F3PC 3BG1B 3GTLI 1K732 1VQNZ 2PK7A 2JIRA 3S1RI 1QVFZ 2M48A 3M3YI 2HU9A 2JUBA 3CCR1 2V45A 3CCUZ 1VQPZ 4A3MI 3OW2Z 5C4XI 1DL6A 2LIYA 3Q87A 2RIQA 3VB9A 1YJW1 3CMA1 4A3LI 3I561 2F4MA 1X0TA 2QEXZ 2JIQA 1M901 1QVGY 1N2FA 3GTPI 1VQP1 2KI7B 2JA6I
chains in the Genus database with same CATH topology
3CC21 5C4JI 1YJ91 4E31A 2WB1A 2GU2A 3CCE1 2O53A 4BBSI 4A93I 3CCV1 1K8A2 4NBCA 2DE5A 2OOXB 3VMIA 3CC7Z 3FQQA 3G4S1 3CCJZ 2P3YA 4NOZA 4E2YA 2OTJ1 4X6AI 3FKII 3I4MI 3M4OI 4A3BI 1PFTA 1S721 2JA7I 2R93I 1KD11 1RO0A 2JR6A 1VQ6Z 1VQ91 1P9NA 2HF1A 2Y0SA 1VQO1 1YJNZ 2DE6A 4RVHA 3J80b 2ZAEB 4A3II 3FQMA 4QTTA 4BY7I 1Q862 3F3FC 4NBGA 1VQ41 3PO2I 1YIT1 1RQFA 1NP6A 3CCVZ 5A2Qb 4E2ZA 4NBHA 3CCL1 3NDJA 3GTOI 5C3EI 2QR1B 1NJI2 3S16I 2V8JA 1Z01A 5C44I 1RO4A 1M1K2 2QKDA 1VQ4Z 1USPA 3S15I 2QEX1 4NB8A 2K5RA 3JAMb 3D9XA 2R7ZI 3CC4Z 4NBDA 4A3JI 4EWCA 3CQZI 2OTLZ 2W03A 3CCS1 3S2DI 4BBRI 4MONA 1VQOZ 1WW9A 2OZKA 3CC41 1X3WA 2H85A 4NBFA 3CCMZ 4MD9A 3J7A4 2NVTI 1M1K1 3CME1 3NH8A 5IT9f 1YHQZ 1QVFY 2EGTA 1L1OC 3CCSZ 4HGYA 1Q821 5FLXf 3G6EZ 1N8R2 5T67A 3OW2Y 1ML8A 3EEDA 3NH5A 2W04A 4A3CI 3CCRZ 1TWFI 4DGLA 2RPRA 3KIHA 3H0GI 2VUGA 4QTUA 3CMAZ 3HOXI 3G6E1 2I3CA 3J81f 2IZ3A 5T64A 3KIFA 1R9TI 2E9HA 4BXXI 2VUMI 3NDIA 1NUIA 4RS4A 3J80f 2O4HA 3PO3S 1SFOI 1YIJZ 5D1OB 3VMHA 2PMZA 1Q7Y1 2J6AA 1TWGI 2QRCB 3IF8A 1WCMI 3QWUA 2LFUA 4RVDA 3I551 3NH4A 3G4SZ 3HOWI 4RV9A 1I3QI 1YIJ1 4NBEA 2YU9I 3I07A 1VQ51 3CD6Z 3VTNA 2IZ4A 2PM9A 5AN9F 4E32A 4XX2A 1VQN1 1S72Z 2JA8I 5D1PA 3CXCZ 3HOZI 4NFRA 1QF8A 5IP7I 2E2JI 1RLYA 1YJN1 3G711 3EERA 3RZOI 2JNYA 1VQMZ 1QYPA 3S2HI 1Q811 3GKQA 2NVXI 3HOYI 3BG0B 2V8IA 1ZB9A 3JAMf 1Y1WI 1K731 4A3DI 1JWHC 2B63I 4MXUA 1TWCI 4MD7A 3VMGA 1W2BY 3LUSA 3P5JB 5IP9I 3CMEZ 3K7AI 1NJI1 3GCFA 1LQLA 5A2Qf 3GTKI 2R6MA 3HOUI 1Q7Y2 3T4NB 2K3RA 2AKLA 2JMOA 1ZB8A 3CCJ1 1I6HI 4BY1I 3CXCY 3ESWA 1VQL1 3MZLB 3MONA 3GTJI 1VQM1 1WIIA 2R92I 1RO2A 3I55Z 4NBAA 4TNUA 1JJ2Y 1Z02A 1I50I 4E2XA 2NVYI 1YHQ1 2DE7A 4HGZA 4NBBA 1VQKZ 2V8KA 1YJWZ 2M6NA 4MD8A 1S7MA 1X3ZA 1K9M2 1YITZ 2Q4ZA 4E2WA 1TFIA 2Q51A 1Y1VS 3IX0A 2NVQI 2JA5I 3CPWY 1VQ71 1KC82 3U50C 5FLXb 2E2II 5LL6f 2GTHA 4NH1C 4CL1A 2KPIA 1M902 3S1NI 2YADA 3PO3I 3NFZA 3MZKB 4A3KI 4E30A 4HH4A 2QREB 1YI21 3TE5B 2F4OA 2QLVB 3GTMS 5D1OA 4Y52I 2E2HI 1KQSY 4A3EI 3D6WA 1JJ2Z 4MH4A 2VF1A 3CCQZ 4E33A 2G2KA 3I4NI 3CCEZ 3CCU1 1VQLZ 4A3FI 2QA41 1RNIA 2GTIA 3S1MI 1VQ81 1KC81 1VLAA 1YUKA 1K8A1 4DK1A 1YUAA 2P28A 3S14I 3J81b 3CCLZ 1W2BZ 1K9M1 4RVGA 1VQK1 5IT9b 3H3VJ 1Q812 3G71Z 3GTGI 1QVGZ 1KD12 1YJ9Z 1Y1VI 1ZH1A 3HOVI 3S17I 2BJOA 1VQ7Z 3TDHB 4NB9A 3CCQ1 1VQ61 1Z03A 5CM2M 4Y7NI 1TWAI 3CC71 4AYBA 4MRIA 2RHBA 3CPWZ 1TWHI 4S1TA 3I56Z 5T6BA 4DQYB 2OTJZ 1KRLA 2OTL1 2WAQA 2QA4Z 3S1QI 2QRDB 2JS4A 4A3GI 3GTQI 2RBLA 1YI2Z 3GTMI 1VQ8Z 3CC2Z 5FLMI 3CCM1 1KQSZ 1Q861 1Q822 1USPB 3IFUA 3RZDI 1N8R1 1VQ9Z 3HKZA 4RVFA 2OOYB 1K83I 2RT9A 1VQ5Z 3CD61 3F3PC 3BG1B 3GTLI 1K732 1VQNZ 2PK7A 3S1RI 1QVFZ 2M48A 3M3YI 2HU9A 2JUBA 3CCR1 3CCUZ 1VQPZ 4A3MI 3OW2Z 5C4XI 1DL6A 2LIYA 3Q87A 2RIQA 3VB9A 1YJW1 3CMA1 4A3LI 3I561 2F4MA 1X0TA 2QEXZ 1M901 1QVGY 1N2FA 3GTPI 1VQP1 2KI7B 2JA6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWC I;  5C4J I;  1L1O C;  3VMG A;  4A3F I;  3LUS A;  5IP9 I;  3K7A I;  4BBS I;  4A93 I;  1ML8 A;  3GCF A;  3S1M I;  1LQL A;  1VLA A;  4NBC A;  2DE5 A;  3GTK I;  4A3C I;  3HOU I;  3VMI A;  1TWF I;  1YUA A;  3S14 I;  2AKL A;  3H0G I;  1ZB8 A;  1I6H I;  4QTU A;  4BY1 I;  2P3Y A;  4NOZ A;  3H3V J;  3HOX I;  3GTG I;  3ESW A;  3S17 I;  1Y1V I;  3HOV I;  3FKI I;  4X6A I;  2BJO A;  3I4M I;  3M4O I;  3GTJ I;  4A3B I;  1PFT A;  2R92 I;  4NBA A;  2JA7 I;  4NB9 A;  2R93 I;  1I50 I;  1R9T I;  4Y7N I;  5CM2 M;  1TWA I;  2NVY I;  4BXX I;  2VUM I;  2DE7 A;  2JR6 A;  1NUI A;  1TWH I;  2HF1 A;  4NBB A;  3PO3 S;  1SFO I;  2DE6 A;  3VMH A;  4A3I I;  4QTT A;  2J6A A;  3S1Q I;  4BY7 I;  1TWG I;  1X3Z A;  4NBG A;  2JS4 A;  3PO2 I;  4A3G I;  3GTQ I;  1TFI A;  2RBL A;  3GTM I;  1WCM I;  1Y1V S;  2NVQ I;  2JA5 I;  5FLM I;  4NBH A;  3HOW I;  3U50 C;  1USP B;  3GTO I;  2E2I I;  1I3Q I;  5C3E I;  4NBE A;  3RZD I;  3S16 I;  2YU9 I;  3I07 A;  1K83 I;  5C44 I;  1RO4 A;  2KPI A;  1USP A;  3GTL I;  3S1N I;  4XX2 A;  3S15 I;  4NB8 A;  2K5R A;  2PK7 A;  2JA8 I;  2R7Z I;  3S1R I;  3M3Y I;  3PO3 I;  4A3K I;  4NBD A;  4A3J I;  3HOZ I;  3CQZ I;  2F4O A;  4A3M I;  5C4X I;  3GTM S;  1DL6 A;  5IP7 I;  3Q87 A;  1RLY A;  2E2J I;  4Y52 I;  3VB9 A;  3EER A;  3RZO I;  2JNY A;  2E2H I;  4A3L I;  1QYP A;  4A3E I;  3S2H I;  3D6W A;  4BBR I;  2F4M A;  3S2D I;  3GKQ A;  2NVX I;  1WW9 A;  3HOY I;  4MH4 A;  1ZB9 A;  1X3W A;  1Y1W I;  4NBF A;  4A3D I;  1N2F A;  2B63 I;  2NVT I;  3GTP I;  3I4N I;  2JA6 I; 
#chains in the Genus database with same CATH topology
 3CC2 1;  5C4J I;  1YJ9 1;  4E31 A;  2WB1 A;  2GU2 A;  3CCE 1;  2O53 A;  4BBS I;  4A93 I;  3CCV 1;  1K8A 2;  2VPY A;  4NBC A;  2DE5 A;  2OOX B;  3VMI A;  3CC7 Z;  3FQQ A;  3G4S 1;  3CCJ Z;  2P3Y A;  4NOZ A;  4E2Y A;  2OTJ 1;  4X6A I;  3FKI I;  3I4M I;  3M4O I;  4A3B I;  1PFT A;  1S72 1;  1QXF A;  2JA7 I;  2R93 I;  1KD1 1;  1RO0 A;  2JR6 A;  1VQ6 Z;  2NAP A;  1VQ9 1;  1P9N A;  2JIM A;  2HF1 A;  2Y0S A;  1VQO 1;  1YJN Z;  2DE6 A;  4RVH A;  3J80 b;  2ZAE B;  4A3I I;  3FQM A;  4QTT A;  4BY7 I;  1Q86 2;  3F3F C;  4NBG A;  1VQ4 1;  3PO2 I;  1YIT 1;  1RQF A;  1NP6 A;  3CCV Z;  5A2Q b;  4E2Z A;  4NBH A;  3CCL 1;  3NDJ A;  3GTO I;  5C3E I;  2QR1 B;  1NJI 2;  3S16 I;  2V8J A;  1Z01 A;  5C44 I;  1RO4 A;  1M1K 2;  2QKD A;  1VQ4 Z;  1USP A;  3S15 I;  2QEX 1;  4NB8 A;  2K5R A;  3JAM b;  3D9X A;  2R7Z I;  3CC4 Z;  4NBD A;  4A3J I;  4EWC A;  3CQZ I;  2OTL Z;  2W03 A;  3CCS 1;  3S2D I;  4BBR I;  4MON A;  1VQO Z;  1WW9 A;  2OZK A;  3CC4 1;  1X3W A;  2H85 A;  4NBF A;  3CCM Z;  4MD9 A;  3J7A 4;  2NVT I;  1M1K 1;  3CME 1;  3NH8 A;  5IT9 f;  1YHQ Z;  1QVF Y;  2EGT A;  1L1O C;  3CCS Z;  4HGY A;  1Q82 1;  5FLX f;  3G6E Z;  1N8R 2;  5T67 A;  3OW2 Y;  1ML8 A;  3EED A;  3NH5 A;  2W04 A;  4A3C I;  3CCR Z;  1TWF I;  4DGL A;  2RPR A;  3KIH A;  3H0G I;  2VUG A;  4QTU A;  3CMA Z;  3HOX I;  3G6E 1;  2I3C A;  3J81 f;  2IZ3 A;  1SIW A;  5T64 A;  3KIF A;  1R9T I;  2E9H A;  4BXX I;  2VUM I;  3NDI A;  1NUI A;  4RS4 A;  3J80 f;  2O4H A;  3PO3 S;  1SFO I;  1YIJ Z;  5D1O B;  3VMH A;  2PMZ A;  1Q7Y 1;  1WZN A;  2J6A A;  1FDO A;  1TWG I;  2QRC B;  3IF8 A;  1WCM I;  3QWU A;  2LFU A;  4RVD A;  3I55 1;  3NH4 A;  3G4S Z;  3HOW I;  4RV9 A;  1I3Q I;  1YIJ 1;  4NBE A;  2AYD A;  2YU9 I;  1VQ5 1;  3I07 A;  3CD6 Z;  3VTN A;  2IZ4 A;  2PM9 A;  5AN9 F;  4E32 A;  4XX2 A;  1VQN 1;  1S72 Z;  2JA8 I;  5D1P A;  3CXC Z;  3HOZ I;  4NFR A;  1QF8 A;  2IV2 X;  5IP7 I;  2E2J I;  1RLY A;  1YJN 1;  3G71 1;  3EER A;  3RZO I;  2JNY A;  1VQM Z;  1Q16 A;  1QYP A;  3S2H I;  1Q81 1;  3GKQ A;  2NVX I;  3HOY I;  3BG0 B;  2V8I A;  2VPZ A;  1ZB9 A;  3JAM f;  1Y1W I;  1K73 1;  4A3D I;  1JWH C;  2B63 I;  4MXU A;  1TWC I;  4MD7 A;  3VMG A;  1W2B Y;  3LUS A;  3P5J B;  5IP9 I;  3CME Z;  3K7A I;  1NJI 1;  3GCF A;  1LQL A;  5A2Q f;  3GTK I;  2R6M A;  1Y8C A;  3HOU I;  1Q7Y 2;  3T4N B;  2K3R A;  2AKL A;  2JMO A;  1ZB8 A;  2JIO A;  3CCJ 1;  1I6H I;  4BY1 I;  3CXC Y;  3ESW A;  1VQL 1;  3MZL B;  3MON A;  3GTJ I;  1VQM 1;  1WII A;  2R92 I;  1RO2 A;  3I55 Z;  4NBA A;  4TNU A;  1JJ2 Y;  1Z02 A;  1I50 I;  4E2X A;  2NVY I;  1YHQ 1;  2DE7 A;  4HGZ A;  4NBB A;  1VQK Z;  2V8K A;  1YJW Z;  2M6N A;  4MD8 A;  1S7M A;  1X3Z A;  1K9M 2;  1YIT Z;  2Q4Z A;  4E2W A;  1TFI A;  2Q51 A;  1Y1V S;  3IX0 A;  2NVQ I;  2JA5 I;  3CPW Y;  1VQ7 1;  1KC8 2;  3U50 C;  5FLX b;  2E2I I;  5LL6 f;  2GTH A;  4NH1 C;  4CL1 A;  2KPI A;  1M90 2;  3S1N I;  2JIP A;  2LEX A;  2YAD A;  3IR7 A;  3PO3 I;  3NFZ A;  3MZK B;  4A3K I;  4E30 A;  1WJ2 A;  4HH4 A;  2QRE B;  1YI2 1;  3TE5 B;  2F4O A;  2QLV B;  3GTM S;  5D1O A;  4Y52 I;  2E2H I;  1KQS Y;  4A3E I;  3D6W A;  1JJ2 Z;  4MH4 A;  2VF1 A;  3CCQ Z;  4E33 A;  2G2K A;  2VPX A;  3I4N I;  3CCE Z;  3CCU 1;  1FDI A;  1VQL Z;  4A3F I;  2QA4 1;  1RNI A;  2GTI A;  3S1M I;  1VQ8 1;  1KC8 1;  1VLA A;  1YUK A;  1K8A 1;  4DK1 A;  1YUA A;  2P28 A;  3S14 I;  3J81 b;  3CCL Z;  1W2B Z;  1K9M 1;  4RVG A;  1VQK 1;  5IT9 b;  3H3V J;  1Q81 2;  3G71 Z;  2E7Z A;  3GTG I;  1QVG Z;  1KD1 2;  1YJ9 Z;  1Y1V I;  1ZH1 A;  3HOV I;  3S17 I;  2BJO A;  2VPW A;  1VQ7 Z;  3TDH B;  4NB9 A;  3CCQ 1;  1VQ6 1;  1Z03 A;  5CM2 M;  4Y7N I;  1TWA I;  3CC7 1;  4AYB A;  4MRI A;  2RHB A;  3CPW Z;  1TWH I;  4S1T A;  3I56 Z;  5T6B A;  4DQY B;  2OTJ Z;  1KRL A;  2OTL 1;  3D2L A;  2WAQ A;  2QA4 Z;  3S1Q I;  2QRD B;  2JS4 A;  4A3G I;  3GTQ I;  2RBL A;  1YI2 Z;  3GTM I;  1VQ8 Z;  3CC2 Z;  5FLM I;  3CCM 1;  1KQS Z;  1Q86 1;  1Q82 2;  1USP B;  1AA6 A;  3IFU A;  3RZD I;  1N8R 1;  1VQ9 Z;  3HKZ A;  4RVF A;  2OOY B;  1K83 I;  2V3V A;  2RT9 A;  1VQ5 Z;  3CD6 1;  3F3P C;  3BG1 B;  3GTL I;  1K73 2;  1VQN Z;  2PK7 A;  2JIR A;  3S1R I;  1QVF Z;  2M48 A;  3M3Y I;  2HU9 A;  2JUB A;  3CCR 1;  2V45 A;  3CCU Z;  1VQP Z;  4A3M I;  3OW2 Z;  5C4X I;  1DL6 A;  2LIY A;  3Q87 A;  2RIQ A;  3VB9 A;  1YJW 1;  3CMA 1;  4A3L I;  3I56 1;  2F4M A;  1X0T A;  2QEX Z;  2JIQ A;  1M90 1;  1QVG Y;  1N2F A;  3GTP I;  1VQP 1;  2KI7 B;  2JA6 I; 
#chains in the Genus database with same CATH homology
 3CC2 1;  5C4J I;  1YJ9 1;  4E31 A;  2WB1 A;  2GU2 A;  3CCE 1;  2O53 A;  4BBS I;  4A93 I;  3CCV 1;  1K8A 2;  4NBC A;  2DE5 A;  2OOX B;  3VMI A;  3CC7 Z;  3FQQ A;  3G4S 1;  3CCJ Z;  2P3Y A;  4NOZ A;  4E2Y A;  2OTJ 1;  4X6A I;  3FKI I;  3I4M I;  3M4O I;  4A3B I;  1PFT A;  1S72 1;  2JA7 I;  2R93 I;  1KD1 1;  1RO0 A;  2JR6 A;  1VQ6 Z;  1VQ9 1;  1P9N A;  2HF1 A;  2Y0S A;  1VQO 1;  1YJN Z;  2DE6 A;  4RVH A;  3J80 b;  2ZAE B;  4A3I I;  3FQM A;  4QTT A;  4BY7 I;  1Q86 2;  3F3F C;  4NBG A;  1VQ4 1;  3PO2 I;  1YIT 1;  1RQF A;  1NP6 A;  3CCV Z;  5A2Q b;  4E2Z A;  4NBH A;  3CCL 1;  3NDJ A;  3GTO I;  5C3E I;  2QR1 B;  1NJI 2;  3S16 I;  2V8J A;  1Z01 A;  5C44 I;  1RO4 A;  1M1K 2;  2QKD A;  1VQ4 Z;  1USP A;  3S15 I;  2QEX 1;  4NB8 A;  2K5R A;  3JAM b;  3D9X A;  2R7Z I;  3CC4 Z;  4NBD A;  4A3J I;  4EWC A;  3CQZ I;  2OTL Z;  2W03 A;  3CCS 1;  3S2D I;  4BBR I;  4MON A;  1VQO Z;  1WW9 A;  2OZK A;  3CC4 1;  1X3W A;  2H85 A;  4NBF A;  3CCM Z;  4MD9 A;  3J7A 4;  2NVT I;  1M1K 1;  3CME 1;  3NH8 A;  5IT9 f;  1YHQ Z;  1QVF Y;  2EGT A;  1L1O C;  3CCS Z;  4HGY A;  1Q82 1;  5FLX f;  3G6E Z;  1N8R 2;  5T67 A;  3OW2 Y;  1ML8 A;  3EED A;  3NH5 A;  2W04 A;  4A3C I;  3CCR Z;  1TWF I;  4DGL A;  2RPR A;  3KIH A;  3H0G I;  2VUG A;  4QTU A;  3CMA Z;  3HOX I;  3G6E 1;  2I3C A;  3J81 f;  2IZ3 A;  5T64 A;  3KIF A;  1R9T I;  2E9H A;  4BXX I;  2VUM I;  3NDI A;  1NUI A;  4RS4 A;  3J80 f;  2O4H A;  3PO3 S;  1SFO I;  1YIJ Z;  5D1O B;  3VMH A;  2PMZ A;  1Q7Y 1;  2J6A A;  1TWG I;  2QRC B;  3IF8 A;  1WCM I;  3QWU A;  2LFU A;  4RVD A;  3I55 1;  3NH4 A;  3G4S Z;  3HOW I;  4RV9 A;  1I3Q I;  1YIJ 1;  4NBE A;  2YU9 I;  3I07 A;  1VQ5 1;  3CD6 Z;  3VTN A;  2IZ4 A;  2PM9 A;  5AN9 F;  4E32 A;  4XX2 A;  1VQN 1;  1S72 Z;  2JA8 I;  5D1P A;  3CXC Z;  3HOZ I;  4NFR A;  1QF8 A;  5IP7 I;  2E2J I;  1RLY A;  1YJN 1;  3G71 1;  3EER A;  3RZO I;  2JNY A;  1VQM Z;  1QYP A;  3S2H I;  1Q81 1;  3GKQ A;  2NVX I;  3HOY I;  3BG0 B;  2V8I A;  1ZB9 A;  3JAM f;  1Y1W I;  1K73 1;  4A3D I;  1JWH C;  2B63 I;  4MXU A;  1TWC I;  4MD7 A;  3VMG A;  1W2B Y;  3LUS A;  3P5J B;  5IP9 I;  3CME Z;  3K7A I;  1NJI 1;  3GCF A;  1LQL A;  5A2Q f;  3GTK I;  2R6M A;  3HOU I;  1Q7Y 2;  3T4N B;  2K3R A;  2AKL A;  2JMO A;  1ZB8 A;  3CCJ 1;  1I6H I;  4BY1 I;  3CXC Y;  3ESW A;  1VQL 1;  3MZL B;  3MON A;  3GTJ I;  1VQM 1;  1WII A;  2R92 I;  1RO2 A;  3I55 Z;  4NBA A;  4TNU A;  1JJ2 Y;  1Z02 A;  1I50 I;  4E2X A;  2NVY I;  1YHQ 1;  2DE7 A;  4HGZ A;  4NBB A;  1VQK Z;  2V8K A;  1YJW Z;  2M6N A;  4MD8 A;  1S7M A;  1X3Z A;  1K9M 2;  1YIT Z;  2Q4Z A;  4E2W A;  1TFI A;  2Q51 A;  1Y1V S;  3IX0 A;  2NVQ I;  2JA5 I;  3CPW Y;  1VQ7 1;  1KC8 2;  3U50 C;  5FLX b;  2E2I I;  5LL6 f;  2GTH A;  4NH1 C;  4CL1 A;  2KPI A;  1M90 2;  3S1N I;  2YAD A;  3PO3 I;  3NFZ A;  3MZK B;  4A3K I;  4E30 A;  4HH4 A;  2QRE B;  1YI2 1;  3TE5 B;  2F4O A;  2QLV B;  3GTM S;  5D1O A;  4Y52 I;  2E2H I;  1KQS Y;  4A3E I;  3D6W A;  1JJ2 Z;  4MH4 A;  2VF1 A;  3CCQ Z;  4E33 A;  2G2K A;  3I4N I;  3CCE Z;  3CCU 1;  1VQL Z;  4A3F I;  2QA4 1;  1RNI A;  2GTI A;  3S1M I;  1VQ8 1;  1KC8 1;  1VLA A;  1YUK A;  1K8A 1;  4DK1 A;  1YUA A;  2P28 A;  3S14 I;  3J81 b;  3CCL Z;  1W2B Z;  1K9M 1;  4RVG A;  1VQK 1;  5IT9 b;  3H3V J;  1Q81 2;  3G71 Z;  3GTG I;  1QVG Z;  1KD1 2;  1YJ9 Z;  1Y1V I;  1ZH1 A;  3HOV I;  3S17 I;  2BJO A;  1VQ7 Z;  3TDH B;  4NB9 A;  3CCQ 1;  1VQ6 1;  1Z03 A;  5CM2 M;  4Y7N I;  1TWA I;  3CC7 1;  4AYB A;  4MRI A;  2RHB A;  3CPW Z;  1TWH I;  4S1T A;  3I56 Z;  5T6B A;  4DQY B;  2OTJ Z;  1KRL A;  2OTL 1;  2WAQ A;  2QA4 Z;  3S1Q I;  2QRD B;  2JS4 A;  4A3G I;  3GTQ I;  2RBL A;  1YI2 Z;  3GTM I;  1VQ8 Z;  3CC2 Z;  5FLM I;  3CCM 1;  1KQS Z;  1Q86 1;  1Q82 2;  1USP B;  3IFU A;  3RZD I;  1N8R 1;  1VQ9 Z;  3HKZ A;  4RVF A;  2OOY B;  1K83 I;  2RT9 A;  1VQ5 Z;  3CD6 1;  3F3P C;  3BG1 B;  3GTL I;  1K73 2;  1VQN Z;  2PK7 A;  3S1R I;  1QVF Z;  2M48 A;  3M3Y I;  2HU9 A;  2JUB A;  3CCR 1;  3CCU Z;  1VQP Z;  4A3M I;  3OW2 Z;  5C4X I;  1DL6 A;  2LIY A;  3Q87 A;  2RIQ A;  3VB9 A;  1YJW 1;  3CMA 1;  4A3L I;  3I56 1;  2F4M A;  1X0T A;  2QEX Z;  1M90 1;  1QVG Y;  1N2F A;  3GTP I;  1VQP 1;  2KI7 B;  2JA6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...