3I4MI

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
116
structure length
116
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 11
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4mI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4mI02
5CM2M 3VMIA 3S1RI 1TWAI 3PO3S 1ML8A 1X3ZA 2BJOA 2F4MA 2JR6A 1I50I 1PFTA 4A3II 4X6AI 1SFOI 3S1QI 3H0GI 4A3LI 3GTKI 3M3YI 3GTJI 3HOXI 4BY7I 3S14I 4A3EI 3S1MI 4NBCA 3GTOI 4NBHA 3EERA 1Y1VI 2NVXI 4NBDA 4Y52I 1R9TI 4NBGA 3S15I 1WW9A 5C44I 2JS4A 3S1NI 1VLAA 5C4JI 5C3EI 1L1OC 4A93I 3GTLI 1WCMI 3FKII 2E2II 2JA5I 3PO3I 3RZDI 2JA6I 4BY1I 4A3FI 2K5RA 3I4NI 2JA7I 2HF1A 2DE7A 2JNYA 4BXXI 1USPB 4NBBA 3U50C 3S17I 3D6WA 3I07A 4NOZA 5IP7I 1QYPA 1TWFI 3HOUI 3I4MI 1X3WA 4A3KI 4A3GI 3GTQI 1Y1WI 1ZB9A 2F4OA 3HOYI 5C4XI 1USPA 1YUAA 2VUMI 3GTMS 3Q87A 1RO4A 2DE5A 4Y7NI 1TWHI 4NBFA 4A3CI 2RBLA 1I3QI 4NBAA 4BBRI 2B63I 3GTPI 1TWGI 2J6AA 2NVTI 2NVQI 4A3JI 5IP9I 1TFIA 1K83I 2E2JI 4BBSI 3LUSA 2KPIA 2R92I 2JA8I 1N2FA 3S16I 3H3VJ 3K7AI 4QTTA 2PK7A 4A3DI 4A3BI 3VMHA 4A3MI 1I6HI 1NUIA 1ZB8A 5FLMI 3PO2I 3HOZI 3VB9A 1RLYA 3GTGI 3S2DI 3HOVI 3S2HI 3GCFA 3GTMI 2YU9I 4XX2A 3VMGA 2P3YA 3RZOI 3HOWI 2R93I 4NB9A 4NBEA 1TWCI 2NVYI 3ESWA 3CQZI 3GKQA 2R7ZI 1Y1VS 2DE6A 1DL6A 2E2HI 2AKLA 4QTUA 1LQLA 3M4OI 4MH4A 4NB8A
chains in the Genus database with same CATH superfamily
3VMIA 3S1RI 3KIHA 1RO0A 3F3FC 2QA4Z 1K9M1 5T6BA 3OW2Y 4A3II 4X6AI 3T4NB 1SFOI 4RV9A 3M3YI 3CMA1 1QF8A 1VQLZ 4MRIA 2OTL1 3S14I 4HH4A 3S1MI 1Q822 1YJWZ 3GTOI 4NBHA 2VPYA 3EERA 2M6NA 1YJW1 1R9TI 1VQ6Z 1WZNA 5C44I 3D2LA 2O53A 4MD8A 3GTLI 1QVFY 5A2Qb 4DQYB 4MONA 2Y0SA 2OTJZ 4A3FI 2V3VA 2E7ZA 3MZLB 2K5RA 4E32A 3I55Z 5IT9b 5D1OB 1Q7Y1 3U50C 3D6WA 5IP7I 3I551 1QYPA 5LL6f 1KC81 4A3KI 2JIPA 4A3GI 1Y1WI 1KD12 4MD7A 1W2BY 5FLXf 2H85A 3G4SZ 2RIQA 1RO4A 1VQKZ 4E2YA 1TWHI 1KRLA 1Z01A 3D9XA 3J7A4 2J6AA 2E2JI 4BBSI 3LUSA 1VQ7Z 3H3VJ 3K7AI 4QTTA 1VQ71 4A3DI 2YADA 3CCQZ 3JAMb 3IFUA 1W2BZ 4RS4A 2OOYB 1VQ9Z 3S2DI 3HOVI 2VPWA 2E9HA 3S2HI 3GCFA 2P3YA 3RZOI 1K8A2 3HOWI 4NB9A 3IF8A 1YHQ1 3CCEZ 2IV2X 3BG0B 3CCRZ 2QEXZ 3CCR1 2E2HI 2QEX1 2QRCB 4QTUA 1YI21 1LQLA 4RVGA 2ZAEB 3CCSZ 2VUGA 3M4OI 3MONA 3EEDA 3PO3S 1VQ8Z 5T67A 3TDHB 1VQ81 3VTNA 4E2XA 4HGZA 1KD11 3CD6Z 1I50I 1PFTA 3H0GI 4A3LI 4TNUA 1JWHC 3HOXI 1RQFA 2O4HA 1VQP1 4NBCA 2NVXI 1VQ5Z 2QKDA 3J80f 3IX0A 1FDIA 3S1NI 1VLAA 5C4JI 2IZ4A 1L1OC 4A93I 1QVGZ 2JA5I 2KI7B 1P9NA 2JIQA 1YIJZ 1KQSZ 3CC4Z 3F3PC 3CMAZ 1YIJ1 3I4NI 3CC41 2JIOA 3G71Z 2OTLZ 1USPB 4BXXI 3NFZA 3G711 3HOUI 1TWFI 2I3CA 1K8A1 3HOYI 3GTMS 1X0TA 4RVDA 2DE5A 1M1K2 1VQNZ 2RBLA 1VQN1 2NVTI 3NH4A 2NVQI 3OW2Z 4HGYA 1WJ2A 1Z02A 2KPIA 3CME1 2JA8I 1N2FA 3S16I 2PK7A 2OOXB 4RVFA 3VMHA 2OZKA 4E31A 5T64A 1NUIA 2QLVB 3PO2I 3HOZI 3QWUA 1YIT1 3HKZA 1AA6A 3CC7Z 3CC71 2YU9I 1FDOA 4XX2A 3FQMA 1S7MA 1QVFZ 4NBEA 4CL1A 2NVYI 2NAPA 3CQZI 2DE6A 2JMOA 3NDJA 3CCU1 1VQ41 1Q16A 2QREB 2M48A 1M902 1YJ91 3TE5B 2IZ3A 1ML8A 1X3ZA 2R6MA 2BJOA 1Q821 2F4MA 1YHQZ 1N8R2 3J80b 3GTKI 3P5JB 5A2Qf 3IR7A 1M1K1 4A3EI 1YI2Z 1Y1VI 2GTIA 4Y52I 2RT9A 2W04A 1WW9A 5IT9f 5C3EI 2V8KA 2JIRA 2E2II 3CPWY 3I561 3G6E1 4AYBA 2DE7A 2JNYA 4NBBA 3S17I 3I07A 1VQPZ 4E2ZA 4E2WA 3I4MI 2VPXA 2V45A 1X3WA 4MD9A 3CCJZ 1ZB9A 5C4XI 1YUAA 3CCJ1 3MZKB 4DGLA 3NH8A 2VUMI 1RNIA 2V8IA 4Y7NI 1M901 2JIMA 4MXUA 4E33A 1I3QI 4NBAA 1TWGI 1VQO1 4A3JI 1TFIA 1K83I 5FLXb 1Z03A 1NJI2 1S72Z 1S721 2P28A 2V8JA 1VQM1 1N8R1 2Q4ZA 4A3BI 3NH5A 3CCLZ 1I6HI 5FLMI 3CCL1 3GTGI 1Q812 2QA41 3CCMZ 1K732 1WIIA 3CCM1 1TWCI 3ESWA 2R7ZI 3CMEZ 1VQL1 2LFUA 2GTHA 3FQQA 1NP6A 3KIFA 2Q51A 5CM2M 1VQ61 1TWAI 1YUKA 3J81f 1YITZ 2AYDA 1ZH1A 1YJNZ 4NFRA 2JR6A 1YJN1 3S1QI 2OTJ1 1Y8CA 2K3RA 2VPZA 2PM9A 2QR1B 2QRDB 3GTJI 3CCUZ 1VQ4Z 4BY7I 2W03A 1Q862 1SIWA 4NBDA 4NBGA 3S15I 4EWCA 1YJ9Z 2JS4A 2EGTA 1NJI1 3G4S1 1WCMI 3FKII 3PO3I 3RZDI 1VQK1 2JA6I 2LEXA 4BY1I 3NDIA 2JA7I 2HF1A 3CCVZ 3CCV1 1Q811 4NOZA 1K731 1K9M2 3GTQI 2F4OA 1USPA 3CCQ1 2PMZA 3Q87A 1VQ91 4DK1A 4NBFA 3CXCY 4A3CI 1JJ2Y 2GU2A 3I56Z 4BBRI 2B63I 2VF1A 3G6EZ 3GTPI 2RPRA 2G2KA 4S1TA 2RHBA 2WB1A 4E30A 5IP9I 3CCE1 4NH1C 2HU9A 5D1PA 2R92I 1QXFA 2WAQA 3CC2Z 3CCS1 1QVGY 3CC21 5D1OA 4A3MI 1ZB8A 1KQSY 3VB9A 4RVHA 1Q7Y2 1RLYA 1Q861 1RO2A 1KC82 3GTMI 5AN9F 3VMGA 3CD61 1VQOZ 2R93I 3JAMf 3CXCZ 1JJ2Z 3GKQA 1Y1VS 3CPWZ 3J81b 3BG1B 1DL6A 2JUBA 2LIYA 1VQMZ 2AKLA 1VQ51 4MH4A 4NB8A
chains in the Genus database with same CATH topology
3VMIA 3S1RI 3KIHA 1RO0A 3F3FC 2QA4Z 1K9M1 5T6BA 3OW2Y 4A3II 4X6AI 3T4NB 1SFOI 4RV9A 3M3YI 3CMA1 1QF8A 1VQLZ 4MRIA 2OTL1 3S14I 4HH4A 3S1MI 1Q822 1YJWZ 3GTOI 4NBHA 3EERA 2M6NA 1YJW1 1R9TI 1VQ6Z 5C44I 2O53A 4MD8A 3GTLI 1QVFY 5A2Qb 4DQYB 4MONA 2Y0SA 2OTJZ 4A3FI 3MZLB 4E32A 2K5RA 3I55Z 5IT9b 5D1OB 1Q7Y1 3U50C 3D6WA 5IP7I 3I551 1QYPA 5LL6f 1KC81 4A3KI 4A3GI 1Y1WI 1KD12 4MD7A 1W2BY 5FLXf 2H85A 3G4SZ 2RIQA 1RO4A 1VQKZ 4E2YA 1TWHI 1KRLA 1Z01A 3D9XA 3J7A4 2J6AA 2E2JI 4BBSI 3LUSA 1VQ7Z 3H3VJ 3K7AI 4QTTA 1VQ71 4A3DI 2YADA 3CCQZ 3JAMb 3IFUA 1W2BZ 4RS4A 2OOYB 1VQ9Z 3S2DI 3HOVI 2E9HA 3S2HI 3GCFA 2P3YA 3RZOI 1K8A2 3HOWI 4NB9A 3IF8A 1YHQ1 3CCEZ 3BG0B 3CCRZ 2QEXZ 3CCR1 2E2HI 2QEX1 2QRCB 4QTUA 1YI21 1LQLA 4RVGA 2ZAEB 3CCSZ 2VUGA 3M4OI 3MONA 3EEDA 3PO3S 1VQ8Z 5T67A 3TDHB 1VQ81 3VTNA 4E2XA 4HGZA 1KD11 3CD6Z 1I50I 1PFTA 3H0GI 4A3LI 4TNUA 1JWHC 3HOXI 1RQFA 2O4HA 1VQP1 4NBCA 2NVXI 1VQ5Z 2QKDA 3J80f 3IX0A 3S1NI 1VLAA 5C4JI 2IZ4A 1L1OC 4A93I 1QVGZ 2JA5I 2KI7B 1P9NA 1YIJZ 1KQSZ 3CC4Z 3F3PC 3CMAZ 1YIJ1 3I4NI 3CC41 3G71Z 2OTLZ 1USPB 4BXXI 3NFZA 3G711 3HOUI 1TWFI 2I3CA 1K8A1 3HOYI 3GTMS 1X0TA 4RVDA 2DE5A 1M1K2 1VQNZ 2RBLA 1VQN1 2NVTI 3NH4A 2NVQI 3OW2Z 4HGYA 1Z02A 2KPIA 3CME1 2JA8I 1N2FA 3S16I 2PK7A 2OOXB 4RVFA 3VMHA 2OZKA 4E31A 5T64A 1NUIA 2QLVB 3PO2I 3HOZI 3QWUA 1YIT1 3HKZA 3CC7Z 3CC71 2YU9I 4XX2A 3FQMA 1S7MA 1QVFZ 4NBEA 4CL1A 2NVYI 3CQZI 2DE6A 2JMOA 3NDJA 3CCU1 1VQ41 2QREB 2M48A 1M902 1YJ91 3TE5B 2IZ3A 1ML8A 1X3ZA 2R6MA 2BJOA 1Q821 2F4MA 1YHQZ 1N8R2 3J80b 3GTKI 3P5JB 5A2Qf 1M1K1 4A3EI 1YI2Z 1Y1VI 2GTIA 4Y52I 2RT9A 2W04A 1WW9A 5IT9f 5C3EI 2V8KA 2E2II 3CPWY 3I561 3G6E1 4AYBA 2DE7A 2JNYA 4NBBA 3S17I 3I07A 1VQPZ 4E2ZA 4E2WA 3I4MI 1X3WA 4MD9A 3CCJZ 1ZB9A 5C4XI 1YUAA 3CCJ1 3MZKB 4DGLA 3NH8A 2VUMI 1RNIA 2V8IA 4Y7NI 1M901 4MXUA 4E33A 1I3QI 4NBAA 1TWGI 1VQO1 4A3JI 1TFIA 1K83I 5FLXb 1Z03A 1NJI2 1S72Z 1S721 2P28A 2V8JA 1VQM1 1N8R1 2Q4ZA 4A3BI 3NH5A 3CCLZ 1I6HI 5FLMI 3CCL1 3GTGI 1Q812 2QA41 3CCMZ 1K732 1WIIA 3CCM1 1TWCI 3ESWA 2R7ZI 3CMEZ 1VQL1 2LFUA 2GTHA 3FQQA 1NP6A 3KIFA 2Q51A 5CM2M 1VQ61 1TWAI 1YUKA 3J81f 1YITZ 1ZH1A 1YJNZ 4NFRA 2JR6A 1YJN1 3S1QI 2OTJ1 2K3RA 2PM9A 2QR1B 2QRDB 3GTJI 3CCUZ 1VQ4Z 4BY7I 2W03A 1Q862 4NBDA 4NBGA 3S15I 4EWCA 1YJ9Z 2JS4A 2EGTA 1NJI1 3G4S1 1WCMI 3FKII 3PO3I 3RZDI 1VQK1 2JA6I 4BY1I 3NDIA 2JA7I 2HF1A 3CCVZ 3CCV1 1Q811 4NOZA 1K731 1K9M2 3GTQI 2F4OA 1USPA 3CCQ1 2PMZA 3Q87A 1VQ91 4DK1A 4NBFA 3CXCY 4A3CI 1JJ2Y 2GU2A 3I56Z 4BBRI 2B63I 2VF1A 3G6EZ 3GTPI 2RPRA 2G2KA 4S1TA 2RHBA 2WB1A 4E30A 5IP9I 3CCE1 4NH1C 2HU9A 5D1PA 2R92I 2WAQA 3CC2Z 3CCS1 1QVGY 3CC21 5D1OA 4A3MI 1ZB8A 1KQSY 3VB9A 4RVHA 1Q7Y2 1RLYA 1Q861 1RO2A 1KC82 3GTMI 5AN9F 3VMGA 3CD61 1VQOZ 2R93I 3JAMf 3CXCZ 1JJ2Z 3GKQA 1Y1VS 3CPWZ 3J81b 3BG1B 1DL6A 2JUBA 2LIYA 1VQMZ 2AKLA 1VQ51 4MH4A 4NB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CM2 M;  3VMI A;  3S1R I;  1TWA I;  3PO3 S;  1ML8 A;  1X3Z A;  2BJO A;  2F4M A;  2JR6 A;  1I50 I;  1PFT A;  4A3I I;  4X6A I;  1SFO I;  3S1Q I;  3H0G I;  4A3L I;  3GTK I;  3M3Y I;  3GTJ I;  3HOX I;  4BY7 I;  3S14 I;  4A3E I;  3S1M I;  4NBC A;  3GTO I;  4NBH A;  3EER A;  1Y1V I;  2NVX I;  4NBD A;  4Y52 I;  1R9T I;  4NBG A;  3S15 I;  1WW9 A;  5C44 I;  2JS4 A;  3S1N I;  1VLA A;  5C4J I;  5C3E I;  1L1O C;  4A93 I;  3GTL I;  1WCM I;  3FKI I;  2E2I I;  2JA5 I;  3PO3 I;  3RZD I;  2JA6 I;  4BY1 I;  4A3F I;  2K5R A;  3I4N I;  2JA7 I;  2HF1 A;  2DE7 A;  2JNY A;  4BXX I;  1USP B;  4NBB A;  3U50 C;  3S17 I;  3D6W A;  3I07 A;  4NOZ A;  5IP7 I;  1QYP A;  1TWF I;  3HOU I;  3I4M I;  1X3W A;  4A3K I;  4A3G I;  3GTQ I;  1Y1W I;  1ZB9 A;  2F4O A;  3HOY I;  5C4X I;  1USP A;  1YUA A;  2VUM I;  3GTM S;  3Q87 A;  1RO4 A;  2DE5 A;  4Y7N I;  1TWH I;  4NBF A;  4A3C I;  2RBL A;  1I3Q I;  4NBA A;  4BBR I;  2B63 I;  3GTP I;  1TWG I;  2J6A A;  2NVT I;  2NVQ I;  4A3J I;  5IP9 I;  1TFI A;  1K83 I;  2E2J I;  4BBS I;  3LUS A;  2KPI A;  2R92 I;  2JA8 I;  1N2F A;  3S16 I;  3H3V J;  3K7A I;  4QTT A;  2PK7 A;  4A3D I;  4A3B I;  3VMH A;  4A3M I;  1I6H I;  1NUI A;  1ZB8 A;  5FLM I;  3PO2 I;  3HOZ I;  3VB9 A;  1RLY A;  3GTG I;  3S2D I;  3HOV I;  3S2H I;  3GCF A;  3GTM I;  2YU9 I;  4XX2 A;  3VMG A;  2P3Y A;  3RZO I;  3HOW I;  2R93 I;  4NB9 A;  4NBE A;  1TWC I;  2NVY I;  3ESW A;  3CQZ I;  3GKQ A;  2R7Z I;  1Y1V S;  2DE6 A;  1DL6 A;  2E2H I;  2AKL A;  4QTU A;  1LQL A;  3M4O I;  4MH4 A;  4NB8 A; 
#chains in the Genus database with same CATH topology
 3VMI A;  3S1R I;  3KIH A;  1RO0 A;  3F3F C;  2QA4 Z;  1K9M 1;  5T6B A;  3OW2 Y;  4A3I I;  4X6A I;  3T4N B;  1SFO I;  4RV9 A;  3M3Y I;  3CMA 1;  1QF8 A;  1VQL Z;  4MRI A;  2OTL 1;  3S14 I;  4HH4 A;  3S1M I;  1Q82 2;  1YJW Z;  3GTO I;  4NBH A;  2VPY A;  3EER A;  2M6N A;  1YJW 1;  1R9T I;  1VQ6 Z;  1WZN A;  5C44 I;  3D2L A;  2O53 A;  4MD8 A;  3GTL I;  1QVF Y;  5A2Q b;  4DQY B;  4MON A;  2Y0S A;  2OTJ Z;  4A3F I;  2V3V A;  2E7Z A;  3MZL B;  2K5R A;  4E32 A;  3I55 Z;  5IT9 b;  5D1O B;  1Q7Y 1;  3U50 C;  3D6W A;  5IP7 I;  3I55 1;  1QYP A;  5LL6 f;  1KC8 1;  4A3K I;  2JIP A;  4A3G I;  1Y1W I;  1KD1 2;  4MD7 A;  1W2B Y;  5FLX f;  2H85 A;  3G4S Z;  2RIQ A;  1RO4 A;  1VQK Z;  4E2Y A;  1TWH I;  1KRL A;  1Z01 A;  3D9X A;  3J7A 4;  2J6A A;  2E2J I;  4BBS I;  3LUS A;  1VQ7 Z;  3H3V J;  3K7A I;  4QTT A;  1VQ7 1;  4A3D I;  2YAD A;  3CCQ Z;  3JAM b;  3IFU A;  1W2B Z;  4RS4 A;  2OOY B;  1VQ9 Z;  3S2D I;  3HOV I;  2VPW A;  2E9H A;  3S2H I;  3GCF A;  2P3Y A;  3RZO I;  1K8A 2;  3HOW I;  4NB9 A;  3IF8 A;  1YHQ 1;  3CCE Z;  2IV2 X;  3BG0 B;  3CCR Z;  2QEX Z;  3CCR 1;  2E2H I;  2QEX 1;  2QRC B;  4QTU A;  1YI2 1;  1LQL A;  4RVG A;  2ZAE B;  3CCS Z;  2VUG A;  3M4O I;  3MON A;  3EED A;  3PO3 S;  1VQ8 Z;  5T67 A;  3TDH B;  1VQ8 1;  3VTN A;  4E2X A;  4HGZ A;  1KD1 1;  3CD6 Z;  1I50 I;  1PFT A;  3H0G I;  4A3L I;  4TNU A;  1JWH C;  3HOX I;  1RQF A;  2O4H A;  1VQP 1;  4NBC A;  2NVX I;  1VQ5 Z;  2QKD A;  3J80 f;  3IX0 A;  1FDI A;  3S1N I;  1VLA A;  5C4J I;  2IZ4 A;  1L1O C;  4A93 I;  1QVG Z;  2JA5 I;  2KI7 B;  1P9N A;  2JIQ A;  1YIJ Z;  1KQS Z;  3CC4 Z;  3F3P C;  3CMA Z;  1YIJ 1;  3I4N I;  3CC4 1;  2JIO A;  3G71 Z;  2OTL Z;  1USP B;  4BXX I;  3NFZ A;  3G71 1;  3HOU I;  1TWF I;  2I3C A;  1K8A 1;  3HOY I;  3GTM S;  1X0T A;  4RVD A;  2DE5 A;  1M1K 2;  1VQN Z;  2RBL A;  1VQN 1;  2NVT I;  3NH4 A;  2NVQ I;  3OW2 Z;  4HGY A;  1WJ2 A;  1Z02 A;  2KPI A;  3CME 1;  2JA8 I;  1N2F A;  3S16 I;  2PK7 A;  2OOX B;  4RVF A;  3VMH A;  2OZK A;  4E31 A;  5T64 A;  1NUI A;  2QLV B;  3PO2 I;  3HOZ I;  3QWU A;  1YIT 1;  3HKZ A;  1AA6 A;  3CC7 Z;  3CC7 1;  2YU9 I;  1FDO A;  4XX2 A;  3FQM A;  1S7M A;  1QVF Z;  4NBE A;  4CL1 A;  2NVY I;  2NAP A;  3CQZ I;  2DE6 A;  2JMO A;  3NDJ A;  3CCU 1;  1VQ4 1;  1Q16 A;  2QRE B;  2M48 A;  1M90 2;  1YJ9 1;  3TE5 B;  2IZ3 A;  1ML8 A;  1X3Z A;  2R6M A;  2BJO A;  1Q82 1;  2F4M A;  1YHQ Z;  1N8R 2;  3J80 b;  3GTK I;  3P5J B;  5A2Q f;  3IR7 A;  1M1K 1;  4A3E I;  1YI2 Z;  1Y1V I;  2GTI A;  4Y52 I;  2RT9 A;  2W04 A;  1WW9 A;  5IT9 f;  5C3E I;  2V8K A;  2JIR A;  2E2I I;  3CPW Y;  3I56 1;  3G6E 1;  4AYB A;  2DE7 A;  2JNY A;  4NBB A;  3S17 I;  3I07 A;  1VQP Z;  4E2Z A;  4E2W A;  3I4M I;  2VPX A;  2V45 A;  1X3W A;  4MD9 A;  3CCJ Z;  1ZB9 A;  5C4X I;  1YUA A;  3CCJ 1;  3MZK B;  4DGL A;  3NH8 A;  2VUM I;  1RNI A;  2V8I A;  4Y7N I;  1M90 1;  2JIM A;  4MXU A;  4E33 A;  1I3Q I;  4NBA A;  1TWG I;  1VQO 1;  4A3J I;  1TFI A;  1K83 I;  5FLX b;  1Z03 A;  1NJI 2;  1S72 Z;  1S72 1;  2P28 A;  2V8J A;  1VQM 1;  1N8R 1;  2Q4Z A;  4A3B I;  3NH5 A;  3CCL Z;  1I6H I;  5FLM I;  3CCL 1;  3GTG I;  1Q81 2;  2QA4 1;  3CCM Z;  1K73 2;  1WII A;  3CCM 1;  1TWC I;  3ESW A;  2R7Z I;  3CME Z;  1VQL 1;  2LFU A;  2GTH A;  3FQQ A;  1NP6 A;  3KIF A;  2Q51 A;  5CM2 M;  1VQ6 1;  1TWA I;  1YUK A;  3J81 f;  1YIT Z;  2AYD A;  1ZH1 A;  1YJN Z;  4NFR A;  2JR6 A;  1YJN 1;  3S1Q I;  2OTJ 1;  1Y8C A;  2K3R A;  2VPZ A;  2PM9 A;  2QR1 B;  2QRD B;  3GTJ I;  3CCU Z;  1VQ4 Z;  4BY7 I;  2W03 A;  1Q86 2;  1SIW A;  4NBD A;  4NBG A;  3S15 I;  4EWC A;  1YJ9 Z;  2JS4 A;  2EGT A;  1NJI 1;  3G4S 1;  1WCM I;  3FKI I;  3PO3 I;  3RZD I;  1VQK 1;  2JA6 I;  2LEX A;  4BY1 I;  3NDI A;  2JA7 I;  2HF1 A;  3CCV Z;  3CCV 1;  1Q81 1;  4NOZ A;  1K73 1;  1K9M 2;  3GTQ I;  2F4O A;  1USP A;  3CCQ 1;  2PMZ A;  3Q87 A;  1VQ9 1;  4DK1 A;  4NBF A;  3CXC Y;  4A3C I;  1JJ2 Y;  2GU2 A;  3I56 Z;  4BBR I;  2B63 I;  2VF1 A;  3G6E Z;  3GTP I;  2RPR A;  2G2K A;  4S1T A;  2RHB A;  2WB1 A;  4E30 A;  5IP9 I;  3CCE 1;  4NH1 C;  2HU9 A;  5D1P A;  2R92 I;  1QXF A;  2WAQ A;  3CC2 Z;  3CCS 1;  1QVG Y;  3CC2 1;  5D1O A;  4A3M I;  1ZB8 A;  1KQS Y;  3VB9 A;  4RVH A;  1Q7Y 2;  1RLY A;  1Q86 1;  1RO2 A;  1KC8 2;  3GTM I;  5AN9 F;  3VMG A;  3CD6 1;  1VQO Z;  2R93 I;  3JAM f;  3CXC Z;  1JJ2 Z;  3GKQ A;  1Y1V S;  3CPW Z;  3J81 b;  3BG1 B;  1DL6 A;  2JUB A;  2LIY A;  1VQM Z;  2AKL A;  1VQ5 1;  4MH4 A;  4NB8 A; 
#chains in the Genus database with same CATH homology
 3VMI A;  3S1R I;  3KIH A;  1RO0 A;  3F3F C;  2QA4 Z;  1K9M 1;  5T6B A;  3OW2 Y;  4A3I I;  4X6A I;  3T4N B;  1SFO I;  4RV9 A;  3M3Y I;  3CMA 1;  1QF8 A;  1VQL Z;  4MRI A;  2OTL 1;  3S14 I;  4HH4 A;  3S1M I;  1Q82 2;  1YJW Z;  3GTO I;  4NBH A;  3EER A;  2M6N A;  1YJW 1;  1R9T I;  1VQ6 Z;  5C44 I;  2O53 A;  4MD8 A;  3GTL I;  1QVF Y;  5A2Q b;  4DQY B;  4MON A;  2Y0S A;  2OTJ Z;  4A3F I;  3MZL B;  4E32 A;  2K5R A;  3I55 Z;  5IT9 b;  5D1O B;  1Q7Y 1;  3U50 C;  3D6W A;  5IP7 I;  3I55 1;  1QYP A;  5LL6 f;  1KC8 1;  4A3K I;  4A3G I;  1Y1W I;  1KD1 2;  4MD7 A;  1W2B Y;  5FLX f;  2H85 A;  3G4S Z;  2RIQ A;  1RO4 A;  1VQK Z;  4E2Y A;  1TWH I;  1KRL A;  1Z01 A;  3D9X A;  3J7A 4;  2J6A A;  2E2J I;  4BBS I;  3LUS A;  1VQ7 Z;  3H3V J;  3K7A I;  4QTT A;  1VQ7 1;  4A3D I;  2YAD A;  3CCQ Z;  3JAM b;  3IFU A;  1W2B Z;  4RS4 A;  2OOY B;  1VQ9 Z;  3S2D I;  3HOV I;  2E9H A;  3S2H I;  3GCF A;  2P3Y A;  3RZO I;  1K8A 2;  3HOW I;  4NB9 A;  3IF8 A;  1YHQ 1;  3CCE Z;  3BG0 B;  3CCR Z;  2QEX Z;  3CCR 1;  2E2H I;  2QEX 1;  2QRC B;  4QTU A;  1YI2 1;  1LQL A;  4RVG A;  2ZAE B;  3CCS Z;  2VUG A;  3M4O I;  3MON A;  3EED A;  3PO3 S;  1VQ8 Z;  5T67 A;  3TDH B;  1VQ8 1;  3VTN A;  4E2X A;  4HGZ A;  1KD1 1;  3CD6 Z;  1I50 I;  1PFT A;  3H0G I;  4A3L I;  4TNU A;  1JWH C;  3HOX I;  1RQF A;  2O4H A;  1VQP 1;  4NBC A;  2NVX I;  1VQ5 Z;  2QKD A;  3J80 f;  3IX0 A;  3S1N I;  1VLA A;  5C4J I;  2IZ4 A;  1L1O C;  4A93 I;  1QVG Z;  2JA5 I;  2KI7 B;  1P9N A;  1YIJ Z;  1KQS Z;  3CC4 Z;  3F3P C;  3CMA Z;  1YIJ 1;  3I4N I;  3CC4 1;  3G71 Z;  2OTL Z;  1USP B;  4BXX I;  3NFZ A;  3G71 1;  3HOU I;  1TWF I;  2I3C A;  1K8A 1;  3HOY I;  3GTM S;  1X0T A;  4RVD A;  2DE5 A;  1M1K 2;  1VQN Z;  2RBL A;  1VQN 1;  2NVT I;  3NH4 A;  2NVQ I;  3OW2 Z;  4HGY A;  1Z02 A;  2KPI A;  3CME 1;  2JA8 I;  1N2F A;  3S16 I;  2PK7 A;  2OOX B;  4RVF A;  3VMH A;  2OZK A;  4E31 A;  5T64 A;  1NUI A;  2QLV B;  3PO2 I;  3HOZ I;  3QWU A;  1YIT 1;  3HKZ A;  3CC7 Z;  3CC7 1;  2YU9 I;  4XX2 A;  3FQM A;  1S7M A;  1QVF Z;  4NBE A;  4CL1 A;  2NVY I;  3CQZ I;  2DE6 A;  2JMO A;  3NDJ A;  3CCU 1;  1VQ4 1;  2QRE B;  2M48 A;  1M90 2;  1YJ9 1;  3TE5 B;  2IZ3 A;  1ML8 A;  1X3Z A;  2R6M A;  2BJO A;  1Q82 1;  2F4M A;  1YHQ Z;  1N8R 2;  3J80 b;  3GTK I;  3P5J B;  5A2Q f;  1M1K 1;  4A3E I;  1YI2 Z;  1Y1V I;  2GTI A;  4Y52 I;  2RT9 A;  2W04 A;  1WW9 A;  5IT9 f;  5C3E I;  2V8K A;  2E2I I;  3CPW Y;  3I56 1;  3G6E 1;  4AYB A;  2DE7 A;  2JNY A;  4NBB A;  3S17 I;  3I07 A;  1VQP Z;  4E2Z A;  4E2W A;  3I4M I;  1X3W A;  4MD9 A;  3CCJ Z;  1ZB9 A;  5C4X I;  1YUA A;  3CCJ 1;  3MZK B;  4DGL A;  3NH8 A;  2VUM I;  1RNI A;  2V8I A;  4Y7N I;  1M90 1;  4MXU A;  4E33 A;  1I3Q I;  4NBA A;  1TWG I;  1VQO 1;  4A3J I;  1TFI A;  1K83 I;  5FLX b;  1Z03 A;  1NJI 2;  1S72 Z;  1S72 1;  2P28 A;  2V8J A;  1VQM 1;  1N8R 1;  2Q4Z A;  4A3B I;  3NH5 A;  3CCL Z;  1I6H I;  5FLM I;  3CCL 1;  3GTG I;  1Q81 2;  2QA4 1;  3CCM Z;  1K73 2;  1WII A;  3CCM 1;  1TWC I;  3ESW A;  2R7Z I;  3CME Z;  1VQL 1;  2LFU A;  2GTH A;  3FQQ A;  1NP6 A;  3KIF A;  2Q51 A;  5CM2 M;  1VQ6 1;  1TWA I;  1YUK A;  3J81 f;  1YIT Z;  1ZH1 A;  1YJN Z;  4NFR A;  2JR6 A;  1YJN 1;  3S1Q I;  2OTJ 1;  2K3R A;  2PM9 A;  2QR1 B;  2QRD B;  3GTJ I;  3CCU Z;  1VQ4 Z;  4BY7 I;  2W03 A;  1Q86 2;  4NBD A;  4NBG A;  3S15 I;  4EWC A;  1YJ9 Z;  2JS4 A;  2EGT A;  1NJI 1;  3G4S 1;  1WCM I;  3FKI I;  3PO3 I;  3RZD I;  1VQK 1;  2JA6 I;  4BY1 I;  3NDI A;  2JA7 I;  2HF1 A;  3CCV Z;  3CCV 1;  1Q81 1;  4NOZ A;  1K73 1;  1K9M 2;  3GTQ I;  2F4O A;  1USP A;  3CCQ 1;  2PMZ A;  3Q87 A;  1VQ9 1;  4DK1 A;  4NBF A;  3CXC Y;  4A3C I;  1JJ2 Y;  2GU2 A;  3I56 Z;  4BBR I;  2B63 I;  2VF1 A;  3G6E Z;  3GTP I;  2RPR A;  2G2K A;  4S1T A;  2RHB A;  2WB1 A;  4E30 A;  5IP9 I;  3CCE 1;  4NH1 C;  2HU9 A;  5D1P A;  2R92 I;  2WAQ A;  3CC2 Z;  3CCS 1;  1QVG Y;  3CC2 1;  5D1O A;  4A3M I;  1ZB8 A;  1KQS Y;  3VB9 A;  4RVH A;  1Q7Y 2;  1RLY A;  1Q86 1;  1RO2 A;  1KC8 2;  3GTM I;  5AN9 F;  3VMG A;  3CD6 1;  1VQO Z;  2R93 I;  3JAM f;  3CXC Z;  1JJ2 Z;  3GKQ A;  1Y1V S;  3CPW Z;  3J81 b;  3BG1 B;  1DL6 A;  2JUB A;  2LIY A;  1VQM Z;  2AKL A;  1VQ5 1;  4MH4 A;  4NB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...