3I4MI

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 11
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4mI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4mI02
1WW9A 5C44I 3M4OI 2JNYA 4Y7NI 1X3WA 1USPB 3HOVI 3H0GI 1ZB9A 2F4MA 1Y1WI 4NBBA 3GTQI 2R7ZI 3K7AI 5IP7I 4BXXI 4X6AI 1RO4A 3GTGI 3I4MI 2NVTI 3S1QI 4A3LI 3S15I 1LQLA 4BY1I 3FKII 5C3EI 2F4OA 4MH4A 2K5RA 2R93I 3S2DI 3GKQA 1I3QI 3I07A 3HOXI 3S16I 4A3JI 1ML8A 3GCFA 1QYPA 2E2JI 3HOZI 3ESWA 4A3EI 3VMHA 3VMGA 5C4XI 2R92I 3U50C 1L1OC 1TWFI 3PO3S 2RBLA 2B63I 2P3YA 2BJOA 4NOZA 3M3YI 4NBAA 3PO2I 3S14I 3RZOI 1Y1VS 3GTMS 4XX2A 3GTKI 4A3BI 1NUIA 4Y52I 4NBGA 3RZDI 1PFTA 2NVXI 1WCMI 4A3GI 1RLYA 4A3II 1N2FA 4NBFA 2JA5I 2NVYI 3LUSA 3EERA 2KPIA 3GTJI 2JS4A 1I50I 1TWAI 3VMIA 4A3FI 3I4NI 4A3MI 3S1RI 2E2HI 4A93I 5CM2M 1TWGI 4BY7I 2DE7A 1ZB8A 3VB9A 5FLMI 3H3VJ 3HOUI 4A3DI 1I6HI 3D6WA 2YU9I 1USPA 1TFIA 1DL6A 3CQZI 1K83I 2AKLA 3PO3I 2JA8I 4NB9A 2NVQI 3GTOI 2HF1A 3HOYI 1VLAA 4BBSI 2J6AA 1TWHI 4NBCA 4QTTA 4BBRI 3GTPI 4A3KI 3S17I 1TWCI 1Y1VI 1R9TI 3HOWI 4QTUA 3GTMI 2PK7A 2JA6I 3GTLI 3S1MI 4A3CI 1YUAA 2VUMI 4NBHA 5C4JI 3S1NI 2JR6A 3S2HI 2JA7I 2DE6A 4NB8A 2E2II 4NBDA 4NBEA 2DE5A 1SFOI 3Q87A 1X3ZA 5IP9I
chains in the Genus database with same CATH superfamily
1WW9A 5C44I 3CCSZ 3CCVZ 2F4MA 3CCQ1 1Y1WI 2VPXA 1QF8A 5IP7I 1RQFA 4DK1A 1P9NA 3NH4A 3CPWZ 3I4MI 1M901 1X0TA 4A3LI 2QREB 2ZAEB 3S15I 3FKII 1KC82 2F4OA 2K5RA 3CC71 5IT9b 3GKQA 4HGZA 1KQSY 3CMAZ 1VQ81 3HOXI 3G6E1 1QYPA 5T64A 2VF1A 2R92I 2LFUA 3CMEZ 1TWFI 2VPWA 2RBLA 5A2Qb 4S1TA 4NOZA 4AYBA 2QLVB 4RVDA 3S14I 3I561 1Y1VS 1VQ7Z 2OTL1 1Z02A 1YIJ1 3J81f 4A3BI 1NUIA 2VUGA 1QVGY 4NBGA 3RZDI 3MZKB 4MONA 4EWCA 3D9XA 3CCLZ 3EERA 2JS4A 1TWAI 3CCQZ 1VQ51 3I4NI 1KD12 2E2HI 3NH5A 1TWGI 3VB9A 5FLMI 2AYDA 3HOUI 3VTNA 4RVFA 2OZKA 3D6WA 1KC81 1TFIA 4MD8A 3CQZI 3CC7Z 2AKLA 3PO3I 4NB9A 3T4NB 2HF1A 1FDOA 1VQ8Z 2O53A 3CCJZ 3G4SZ 3GTMI 2PK7A 1JJ2Y 4HH4A 2O4HA 2JR6A 1YI21 2YADA 1Q822 3P5JB 1VQP1 1X3ZA 3G711 2OTJ1 3NDIA 4MD7A 5D1OA 1USPB 2LEXA 2OTLZ 4E32A 1AA6A 3K7AI 1VQ6Z 3CCUZ 1RO4A 4MXUA 1VQMZ 3NH8A 1WZNA 1SIWA 2NVTI 3IFUA 3KIHA 3I55Z 2JIRA 1K8A2 4BY1I 2V45A 1Q7Y2 4MH4A 3TDHB 3EEDA 2R93I 3MONA 3CXCY 1I3QI 1Q861 2LIYA 3GCFA 2QA41 4A3EI 3OW2Y 1YJ91 1W2BY 3CCRZ 2JMOA 1L1OC 5LL6f 1K9M2 3CC4Z 3J80b 1Q811 4RV9A 2B63I 2PM9A 1K732 4NBAA 2Q51A 4RVHA 3RZOI 3KIFA 1FDIA 2JUBA 1Q821 2RPRA 2NVXI 4A3GI 2OTJZ 2H85A 2PMZA 2W03A 5FLXb 1KQSZ 1N2FA 4NBFA 3CPWY 2NVYI 3LUSA 3MZLB 2QEXZ 3GTJI 1VQ9Z 3IF8A 3TE5B 4A3FI 4A3MI 4RS4A 3S1RI 5CM2M 4HGYA 3IR7A 4BY7I 1YIT1 5AN9F 2GTHA 3HKZA 2IV2X 1Q7Y1 3CD61 1VQ41 1YJNZ 5T6BA 4RVGA 2J6AA 2GU2A 4CL1A 3JAMf 1KRLA 3HOWI 4QTUA 1VQN1 5D1PA 3S1NI 5C4JI 3CCM1 3S2HI 1K9M1 4E2XA 2E2II 2JIQA 2DE5A 1SFOI 1JWHC 3CCE1 1K731 3QWUA 3M4OI 2JNYA 1X3WA 1RO0A 3H0GI 1YHQ1 4DQYB 1N8R2 2NAPA 3GTQI 2R7ZI 4BXXI 4X6AI 3G6EZ 3IX0A 3GTGI 3CC21 2KI7B 2W04A 3CCS1 2Y0SA 3J81b 3S1QI 1LQLA 1S721 5C3EI 1QVFZ 2V8KA 3S2DI 5D1OB 3I56Z 2OOYB 1YIJZ 4MD9A 3VMGA 3CD6Z 4NH1C 1RNIA 4NFRA 3PO3S 2P3YA 2WAQA 1Z03A 1VQK1 4E33A 3CMA1 1Y8CA 3PO2I 1YJW1 2I3CA 2JIMA 3GTMS 4DGLA 4XX2A 1VQ5Z 1KD11 3GTKI 4Y52I 4E2WA 3NDJA 3CME1 4A3II 5IT9f 1N8R1 2JA5I 1WIIA 2KPIA 1VQ71 1NP6A 3VMIA 4A93I 1ZB8A 5A2Qf 2QKDA 1RO2A 1YI2Z 2YU9I 1M1K2 3CCL1 1S72Z 1VQPZ 3F3PC 3G71Z 2E9HA 4TNUA 1VLAA 2WB1A 2RIQA 3S17I 1TWHI 4NBCA 3GTPI 4A3KI 1NJI2 1Y1VI 1R9TI 2VUMI 2RHBA 4NBHA 3F3FC 2OOXB 2JA7I 2DE6A 4NBEA 2QRCB 1VQL1 5IP9I 1VQKZ 4Y7NI 2G2KA 1K8A1 3HOVI 1YJWZ 3CCJ1 1ZB9A 2IZ4A 3G4S1 2HU9A 2RT9A 4NBBA 1QVGZ 2JIPA 2V8IA 4E2YA 2V8JA 1Q16A 1QXFA 2QA4Z 1YJ9Z 2VPZA 3J7A4 2QR1B 2V3VA 1VQ61 3I07A 3CCU1 5T67A 3S16I 2P28A 4A3JI 1ML8A 1VQM1 2E2JI 3NFZA 4E30A 1M1K1 3HOZI 3ESWA 1WJ2A 3VMHA 3BG1B 5C4XI 3I551 2K3RA 3U50C 4MRIA 1YUKA 1VQO1 1NJI1 2BJOA 2EGTA 3M3YI 3CCV1 1JJ2Z 1Q862 3BG0B 1YITZ 1PFTA 1VQLZ 3CCR1 1WCMI 1RLYA 3CC41 3JAMb 3D2LA 2E7ZA 1Q812 2IZ3A 1M902 2M6NA 1VQ4Z 1I50I 1QVFY 2GTIA 2VPYA 1Z01A 3FQQA 2DE7A 3J80f 3H3VJ 1VQNZ 2M48A 4A3DI 1I6HI 3CCMZ 1USPA 1DL6A 4E31A 2QEX1 1K83I 1VQ91 2JA8I 3CCEZ 2NVQI 1S7MA 3FQMA 3GTOI 4E2ZA 3CXCZ 3HOYI 4BBSI 4QTTA 4BBRI 1YHQZ 1TWCI 5FLXf 2JA6I 3GTLI 2R6MA 3S1MI 3OW2Z 1YUAA 4A3CI 2Q4ZA 1W2BZ 2JIOA 2QRDB 4NB8A 4NBDA 3Q87A 1YJN1 1ZH1A 1VQOZ 3CC2Z
chains in the Genus database with same CATH topology
1WW9A 5C44I 3CCSZ 3CCVZ 2F4MA 3CCQ1 1Y1WI 1QF8A 5IP7I 1RQFA 4DK1A 1P9NA 3NH4A 3CPWZ 3I4MI 1M901 1X0TA 4A3LI 2QREB 2ZAEB 3S15I 3FKII 1KC82 2F4OA 2K5RA 3CC71 5IT9b 3GKQA 4HGZA 1KQSY 3CMAZ 1VQ81 3HOXI 3G6E1 1QYPA 5T64A 2VF1A 2R92I 2LFUA 3CMEZ 1TWFI 2RBLA 5A2Qb 4S1TA 4NOZA 4AYBA 2QLVB 4RVDA 3S14I 3I561 1Y1VS 1VQ7Z 2OTL1 1Z02A 1YIJ1 3J81f 4A3BI 1NUIA 2VUGA 1QVGY 4NBGA 3RZDI 3MZKB 4MONA 4EWCA 3D9XA 3CCLZ 3EERA 2JS4A 1TWAI 3CCQZ 1VQ51 3I4NI 1KD12 2E2HI 3NH5A 1TWGI 3VB9A 5FLMI 3HOUI 3VTNA 4RVFA 2OZKA 3D6WA 1KC81 1TFIA 4MD8A 3CQZI 3CC7Z 2AKLA 3PO3I 4NB9A 3T4NB 2HF1A 1VQ8Z 2O53A 3CCJZ 3G4SZ 3GTMI 2PK7A 1JJ2Y 4HH4A 2O4HA 2JR6A 1YI21 2YADA 1Q822 3P5JB 1VQP1 1X3ZA 3G711 2OTJ1 3NDIA 4MD7A 5D1OA 1USPB 2OTLZ 4E32A 3K7AI 1VQ6Z 3CCUZ 1RO4A 4MXUA 1VQMZ 3NH8A 2NVTI 3IFUA 3KIHA 3I55Z 1K8A2 4BY1I 1Q7Y2 4MH4A 3TDHB 3EEDA 2R93I 3MONA 3CXCY 1I3QI 1Q861 2LIYA 3GCFA 2QA41 4A3EI 3OW2Y 1YJ91 1W2BY 3CCRZ 2JMOA 1L1OC 5LL6f 1K9M2 3CC4Z 3J80b 1Q811 4RV9A 2B63I 2PM9A 1K732 4NBAA 2Q51A 4RVHA 3RZOI 3KIFA 2JUBA 1Q821 2RPRA 2NVXI 4A3GI 2OTJZ 2H85A 2PMZA 2W03A 5FLXb 1KQSZ 1N2FA 4NBFA 3CPWY 2NVYI 3LUSA 3MZLB 2QEXZ 3GTJI 1VQ9Z 3IF8A 3TE5B 4A3FI 4A3MI 4RS4A 3S1RI 5CM2M 4HGYA 4BY7I 1YIT1 5AN9F 2GTHA 3HKZA 1Q7Y1 3CD61 1VQ41 1YJNZ 5T6BA 4RVGA 2J6AA 2GU2A 4CL1A 3JAMf 1KRLA 3HOWI 4QTUA 1VQN1 5D1PA 3S1NI 5C4JI 3CCM1 3S2HI 1K9M1 4E2XA 2E2II 2DE5A 1SFOI 1JWHC 3CCE1 1K731 3QWUA 3M4OI 2JNYA 1X3WA 1RO0A 3H0GI 1YHQ1 4DQYB 1N8R2 3GTQI 2R7ZI 4BXXI 4X6AI 3G6EZ 3IX0A 3GTGI 3CC21 2KI7B 2W04A 3CCS1 2Y0SA 3J81b 3S1QI 1LQLA 1S721 5C3EI 1QVFZ 2V8KA 3S2DI 5D1OB 3I56Z 2OOYB 1YIJZ 4MD9A 3VMGA 3CD6Z 4NH1C 1RNIA 4NFRA 3PO3S 2P3YA 2WAQA 1Z03A 1VQK1 4E33A 3CMA1 3PO2I 1YJW1 2I3CA 3GTMS 4DGLA 4XX2A 1VQ5Z 1KD11 3GTKI 4Y52I 4E2WA 3NDJA 3CME1 4A3II 5IT9f 1N8R1 2JA5I 1WIIA 2KPIA 1VQ71 1NP6A 3VMIA 4A93I 1ZB8A 5A2Qf 2QKDA 1RO2A 1YI2Z 2YU9I 1M1K2 3CCL1 1S72Z 1VQPZ 3F3PC 3G71Z 2E9HA 4TNUA 1VLAA 2WB1A 2RIQA 3S17I 1TWHI 4NBCA 3GTPI 4A3KI 1NJI2 1Y1VI 1R9TI 2VUMI 2RHBA 4NBHA 3F3FC 2OOXB 2JA7I 2DE6A 4NBEA 2QRCB 1VQL1 5IP9I 1VQKZ 4Y7NI 2G2KA 1K8A1 3HOVI 1YJWZ 3CCJ1 1ZB9A 2IZ4A 3G4S1 2HU9A 2RT9A 4NBBA 1QVGZ 2V8IA 4E2YA 2V8JA 2QA4Z 1YJ9Z 3J7A4 2QR1B 1VQ61 3I07A 3CCU1 5T67A 3S16I 2P28A 4A3JI 1ML8A 1VQM1 2E2JI 3NFZA 4E30A 1M1K1 3HOZI 3ESWA 3VMHA 3BG1B 5C4XI 3I551 2K3RA 3U50C 4MRIA 1YUKA 1VQO1 1NJI1 2BJOA 2EGTA 3M3YI 3CCV1 1JJ2Z 1Q862 3BG0B 1YITZ 1PFTA 1VQLZ 3CCR1 1WCMI 1RLYA 3CC41 3JAMb 1Q812 2IZ3A 1M902 2M6NA 1VQ4Z 1I50I 1QVFY 2GTIA 1Z01A 3FQQA 2DE7A 3J80f 3H3VJ 1VQNZ 2M48A 4A3DI 1I6HI 3CCMZ 1USPA 1DL6A 4E31A 2QEX1 1K83I 1VQ91 2JA8I 3CCEZ 2NVQI 1S7MA 3FQMA 3GTOI 4E2ZA 3CXCZ 3HOYI 4BBSI 4QTTA 4BBRI 1YHQZ 1TWCI 5FLXf 2JA6I 3GTLI 2R6MA 3S1MI 3OW2Z 1YUAA 4A3CI 2Q4ZA 1W2BZ 2QRDB 4NB8A 4NBDA 3Q87A 1YJN1 1ZH1A 1VQOZ 3CC2Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WW9 A;  5C44 I;  3M4O I;  2JNY A;  4Y7N I;  1X3W A;  1USP B;  3HOV I;  3H0G I;  1ZB9 A;  2F4M A;  1Y1W I;  4NBB A;  3GTQ I;  2R7Z I;  3K7A I;  5IP7 I;  4BXX I;  4X6A I;  1RO4 A;  3GTG I;  3I4M I;  2NVT I;  3S1Q I;  4A3L I;  3S15 I;  1LQL A;  4BY1 I;  3FKI I;  5C3E I;  2F4O A;  4MH4 A;  2K5R A;  2R93 I;  3S2D I;  3GKQ A;  1I3Q I;  3I07 A;  3HOX I;  3S16 I;  4A3J I;  1ML8 A;  3GCF A;  1QYP A;  2E2J I;  3HOZ I;  3ESW A;  4A3E I;  3VMH A;  3VMG A;  5C4X I;  2R92 I;  3U50 C;  1L1O C;  1TWF I;  3PO3 S;  2RBL A;  2B63 I;  2P3Y A;  2BJO A;  4NOZ A;  3M3Y I;  4NBA A;  3PO2 I;  3S14 I;  3RZO I;  1Y1V S;  3GTM S;  4XX2 A;  3GTK I;  4A3B I;  1NUI A;  4Y52 I;  4NBG A;  3RZD I;  1PFT A;  2NVX I;  1WCM I;  4A3G I;  1RLY A;  4A3I I;  1N2F A;  4NBF A;  2JA5 I;  2NVY I;  3LUS A;  3EER A;  2KPI A;  3GTJ I;  2JS4 A;  1I50 I;  1TWA I;  3VMI A;  4A3F I;  3I4N I;  4A3M I;  3S1R I;  2E2H I;  4A93 I;  5CM2 M;  1TWG I;  4BY7 I;  2DE7 A;  1ZB8 A;  3VB9 A;  5FLM I;  3H3V J;  3HOU I;  4A3D I;  1I6H I;  3D6W A;  2YU9 I;  1USP A;  1TFI A;  1DL6 A;  3CQZ I;  1K83 I;  2AKL A;  3PO3 I;  2JA8 I;  4NB9 A;  2NVQ I;  3GTO I;  2HF1 A;  3HOY I;  1VLA A;  4BBS I;  2J6A A;  1TWH I;  4NBC A;  4QTT A;  4BBR I;  3GTP I;  4A3K I;  3S17 I;  1TWC I;  1Y1V I;  1R9T I;  3HOW I;  4QTU A;  3GTM I;  2PK7 A;  2JA6 I;  3GTL I;  3S1M I;  4A3C I;  1YUA A;  2VUM I;  4NBH A;  5C4J I;  3S1N I;  2JR6 A;  3S2H I;  2JA7 I;  2DE6 A;  4NB8 A;  2E2I I;  4NBD A;  4NBE A;  2DE5 A;  1SFO I;  3Q87 A;  1X3Z A;  5IP9 I; 
#chains in the Genus database with same CATH topology
 1WW9 A;  5C44 I;  3CCS Z;  3CCV Z;  2F4M A;  3CCQ 1;  1Y1W I;  2VPX A;  1QF8 A;  5IP7 I;  1RQF A;  4DK1 A;  1P9N A;  3NH4 A;  3CPW Z;  3I4M I;  1M90 1;  1X0T A;  4A3L I;  2QRE B;  2ZAE B;  3S15 I;  3FKI I;  1KC8 2;  2F4O A;  2K5R A;  3CC7 1;  5IT9 b;  3GKQ A;  4HGZ A;  1KQS Y;  3CMA Z;  1VQ8 1;  3HOX I;  3G6E 1;  1QYP A;  5T64 A;  2VF1 A;  2R92 I;  2LFU A;  3CME Z;  1TWF I;  2VPW A;  2RBL A;  5A2Q b;  4S1T A;  4NOZ A;  4AYB A;  2QLV B;  4RVD A;  3S14 I;  3I56 1;  1Y1V S;  1VQ7 Z;  2OTL 1;  1Z02 A;  1YIJ 1;  3J81 f;  4A3B I;  1NUI A;  2VUG A;  1QVG Y;  4NBG A;  3RZD I;  3MZK B;  4MON A;  4EWC A;  3D9X A;  3CCL Z;  3EER A;  2JS4 A;  1TWA I;  3CCQ Z;  1VQ5 1;  3I4N I;  1KD1 2;  2E2H I;  3NH5 A;  1TWG I;  3VB9 A;  5FLM I;  2AYD A;  3HOU I;  3VTN A;  4RVF A;  2OZK A;  3D6W A;  1KC8 1;  1TFI A;  4MD8 A;  3CQZ I;  3CC7 Z;  2AKL A;  3PO3 I;  4NB9 A;  3T4N B;  2HF1 A;  1FDO A;  1VQ8 Z;  2O53 A;  3CCJ Z;  3G4S Z;  3GTM I;  2PK7 A;  1JJ2 Y;  4HH4 A;  2O4H A;  2JR6 A;  1YI2 1;  2YAD A;  1Q82 2;  3P5J B;  1VQP 1;  1X3Z A;  3G71 1;  2OTJ 1;  3NDI A;  4MD7 A;  5D1O A;  1USP B;  2LEX A;  2OTL Z;  4E32 A;  1AA6 A;  3K7A I;  1VQ6 Z;  3CCU Z;  1RO4 A;  4MXU A;  1VQM Z;  3NH8 A;  1WZN A;  1SIW A;  2NVT I;  3IFU A;  3KIH A;  3I55 Z;  2JIR A;  1K8A 2;  4BY1 I;  2V45 A;  1Q7Y 2;  4MH4 A;  3TDH B;  3EED A;  2R93 I;  3MON A;  3CXC Y;  1I3Q I;  1Q86 1;  2LIY A;  3GCF A;  2QA4 1;  4A3E I;  3OW2 Y;  1YJ9 1;  1W2B Y;  3CCR Z;  2JMO A;  1L1O C;  5LL6 f;  1K9M 2;  3CC4 Z;  3J80 b;  1Q81 1;  4RV9 A;  2B63 I;  2PM9 A;  1K73 2;  4NBA A;  2Q51 A;  4RVH A;  3RZO I;  3KIF A;  1FDI A;  2JUB A;  1Q82 1;  2RPR A;  2NVX I;  4A3G I;  2OTJ Z;  2H85 A;  2PMZ A;  2W03 A;  5FLX b;  1KQS Z;  1N2F A;  4NBF A;  3CPW Y;  2NVY I;  3LUS A;  3MZL B;  2QEX Z;  3GTJ I;  1VQ9 Z;  3IF8 A;  3TE5 B;  4A3F I;  4A3M I;  4RS4 A;  3S1R I;  5CM2 M;  4HGY A;  3IR7 A;  4BY7 I;  1YIT 1;  5AN9 F;  2GTH A;  3HKZ A;  2IV2 X;  1Q7Y 1;  3CD6 1;  1VQ4 1;  1YJN Z;  5T6B A;  4RVG A;  2J6A A;  2GU2 A;  4CL1 A;  3JAM f;  1KRL A;  3HOW I;  4QTU A;  1VQN 1;  5D1P A;  3S1N I;  5C4J I;  3CCM 1;  3S2H I;  1K9M 1;  4E2X A;  2E2I I;  2JIQ A;  2DE5 A;  1SFO I;  1JWH C;  3CCE 1;  1K73 1;  3QWU A;  3M4O I;  2JNY A;  1X3W A;  1RO0 A;  3H0G I;  1YHQ 1;  4DQY B;  1N8R 2;  2NAP A;  3GTQ I;  2R7Z I;  4BXX I;  4X6A I;  3G6E Z;  3IX0 A;  3GTG I;  3CC2 1;  2KI7 B;  2W04 A;  3CCS 1;  2Y0S A;  3J81 b;  3S1Q I;  1LQL A;  1S72 1;  5C3E I;  1QVF Z;  2V8K A;  3S2D I;  5D1O B;  3I56 Z;  2OOY B;  1YIJ Z;  4MD9 A;  3VMG A;  3CD6 Z;  4NH1 C;  1RNI A;  4NFR A;  3PO3 S;  2P3Y A;  2WAQ A;  1Z03 A;  1VQK 1;  4E33 A;  3CMA 1;  1Y8C A;  3PO2 I;  1YJW 1;  2I3C A;  2JIM A;  3GTM S;  4DGL A;  4XX2 A;  1VQ5 Z;  1KD1 1;  3GTK I;  4Y52 I;  4E2W A;  3NDJ A;  3CME 1;  4A3I I;  5IT9 f;  1N8R 1;  2JA5 I;  1WII A;  2KPI A;  1VQ7 1;  1NP6 A;  3VMI A;  4A93 I;  1ZB8 A;  5A2Q f;  2QKD A;  1RO2 A;  1YI2 Z;  2YU9 I;  1M1K 2;  3CCL 1;  1S72 Z;  1VQP Z;  3F3P C;  3G71 Z;  2E9H A;  4TNU A;  1VLA A;  2WB1 A;  2RIQ A;  3S17 I;  1TWH I;  4NBC A;  3GTP I;  4A3K I;  1NJI 2;  1Y1V I;  1R9T I;  2VUM I;  2RHB A;  4NBH A;  3F3F C;  2OOX B;  2JA7 I;  2DE6 A;  4NBE A;  2QRC B;  1VQL 1;  5IP9 I;  1VQK Z;  4Y7N I;  2G2K A;  1K8A 1;  3HOV I;  1YJW Z;  3CCJ 1;  1ZB9 A;  2IZ4 A;  3G4S 1;  2HU9 A;  2RT9 A;  4NBB A;  1QVG Z;  2JIP A;  2V8I A;  4E2Y A;  2V8J A;  1Q16 A;  1QXF A;  2QA4 Z;  1YJ9 Z;  2VPZ A;  3J7A 4;  2QR1 B;  2V3V A;  1VQ6 1;  3I07 A;  3CCU 1;  5T67 A;  3S16 I;  2P28 A;  4A3J I;  1ML8 A;  1VQM 1;  2E2J I;  3NFZ A;  4E30 A;  1M1K 1;  3HOZ I;  3ESW A;  1WJ2 A;  3VMH A;  3BG1 B;  5C4X I;  3I55 1;  2K3R A;  3U50 C;  4MRI A;  1YUK A;  1VQO 1;  1NJI 1;  2BJO A;  2EGT A;  3M3Y I;  3CCV 1;  1JJ2 Z;  1Q86 2;  3BG0 B;  1YIT Z;  1PFT A;  1VQL Z;  3CCR 1;  1WCM I;  1RLY A;  3CC4 1;  3JAM b;  3D2L A;  2E7Z A;  1Q81 2;  2IZ3 A;  1M90 2;  2M6N A;  1VQ4 Z;  1I50 I;  1QVF Y;  2GTI A;  2VPY A;  1Z01 A;  3FQQ A;  2DE7 A;  3J80 f;  3H3V J;  1VQN Z;  2M48 A;  4A3D I;  1I6H I;  3CCM Z;  1USP A;  1DL6 A;  4E31 A;  2QEX 1;  1K83 I;  1VQ9 1;  2JA8 I;  3CCE Z;  2NVQ I;  1S7M A;  3FQM A;  3GTO I;  4E2Z A;  3CXC Z;  3HOY I;  4BBS I;  4QTT A;  4BBR I;  1YHQ Z;  1TWC I;  5FLX f;  2JA6 I;  3GTL I;  2R6M A;  3S1M I;  3OW2 Z;  1YUA A;  4A3C I;  2Q4Z A;  1W2B Z;  2JIO A;  2QRD B;  4NB8 A;  4NBD A;  3Q87 A;  1YJN 1;  1ZH1 A;  1VQO Z;  3CC2 Z; 
#chains in the Genus database with same CATH homology
 1WW9 A;  5C44 I;  3CCS Z;  3CCV Z;  2F4M A;  3CCQ 1;  1Y1W I;  1QF8 A;  5IP7 I;  1RQF A;  4DK1 A;  1P9N A;  3NH4 A;  3CPW Z;  3I4M I;  1M90 1;  1X0T A;  4A3L I;  2QRE B;  2ZAE B;  3S15 I;  3FKI I;  1KC8 2;  2F4O A;  2K5R A;  3CC7 1;  5IT9 b;  3GKQ A;  4HGZ A;  1KQS Y;  3CMA Z;  1VQ8 1;  3HOX I;  3G6E 1;  1QYP A;  5T64 A;  2VF1 A;  2R92 I;  2LFU A;  3CME Z;  1TWF I;  2RBL A;  5A2Q b;  4S1T A;  4NOZ A;  4AYB A;  2QLV B;  4RVD A;  3S14 I;  3I56 1;  1Y1V S;  1VQ7 Z;  2OTL 1;  1Z02 A;  1YIJ 1;  3J81 f;  4A3B I;  1NUI A;  2VUG A;  1QVG Y;  4NBG A;  3RZD I;  3MZK B;  4MON A;  4EWC A;  3D9X A;  3CCL Z;  3EER A;  2JS4 A;  1TWA I;  3CCQ Z;  1VQ5 1;  3I4N I;  1KD1 2;  2E2H I;  3NH5 A;  1TWG I;  3VB9 A;  5FLM I;  3HOU I;  3VTN A;  4RVF A;  2OZK A;  3D6W A;  1KC8 1;  1TFI A;  4MD8 A;  3CQZ I;  3CC7 Z;  2AKL A;  3PO3 I;  4NB9 A;  3T4N B;  2HF1 A;  1VQ8 Z;  2O53 A;  3CCJ Z;  3G4S Z;  3GTM I;  2PK7 A;  1JJ2 Y;  4HH4 A;  2O4H A;  2JR6 A;  1YI2 1;  2YAD A;  1Q82 2;  3P5J B;  1VQP 1;  1X3Z A;  3G71 1;  2OTJ 1;  3NDI A;  4MD7 A;  5D1O A;  1USP B;  2OTL Z;  4E32 A;  3K7A I;  1VQ6 Z;  3CCU Z;  1RO4 A;  4MXU A;  1VQM Z;  3NH8 A;  2NVT I;  3IFU A;  3KIH A;  3I55 Z;  1K8A 2;  4BY1 I;  1Q7Y 2;  4MH4 A;  3TDH B;  3EED A;  2R93 I;  3MON A;  3CXC Y;  1I3Q I;  1Q86 1;  2LIY A;  3GCF A;  2QA4 1;  4A3E I;  3OW2 Y;  1YJ9 1;  1W2B Y;  3CCR Z;  2JMO A;  1L1O C;  5LL6 f;  1K9M 2;  3CC4 Z;  3J80 b;  1Q81 1;  4RV9 A;  2B63 I;  2PM9 A;  1K73 2;  4NBA A;  2Q51 A;  4RVH A;  3RZO I;  3KIF A;  2JUB A;  1Q82 1;  2RPR A;  2NVX I;  4A3G I;  2OTJ Z;  2H85 A;  2PMZ A;  2W03 A;  5FLX b;  1KQS Z;  1N2F A;  4NBF A;  3CPW Y;  2NVY I;  3LUS A;  3MZL B;  2QEX Z;  3GTJ I;  1VQ9 Z;  3IF8 A;  3TE5 B;  4A3F I;  4A3M I;  4RS4 A;  3S1R I;  5CM2 M;  4HGY A;  4BY7 I;  1YIT 1;  5AN9 F;  2GTH A;  3HKZ A;  1Q7Y 1;  3CD6 1;  1VQ4 1;  1YJN Z;  5T6B A;  4RVG A;  2J6A A;  2GU2 A;  4CL1 A;  3JAM f;  1KRL A;  3HOW I;  4QTU A;  1VQN 1;  5D1P A;  3S1N I;  5C4J I;  3CCM 1;  3S2H I;  1K9M 1;  4E2X A;  2E2I I;  2DE5 A;  1SFO I;  1JWH C;  3CCE 1;  1K73 1;  3QWU A;  3M4O I;  2JNY A;  1X3W A;  1RO0 A;  3H0G I;  1YHQ 1;  4DQY B;  1N8R 2;  3GTQ I;  2R7Z I;  4BXX I;  4X6A I;  3G6E Z;  3IX0 A;  3GTG I;  3CC2 1;  2KI7 B;  2W04 A;  3CCS 1;  2Y0S A;  3J81 b;  3S1Q I;  1LQL A;  1S72 1;  5C3E I;  1QVF Z;  2V8K A;  3S2D I;  5D1O B;  3I56 Z;  2OOY B;  1YIJ Z;  4MD9 A;  3VMG A;  3CD6 Z;  4NH1 C;  1RNI A;  4NFR A;  3PO3 S;  2P3Y A;  2WAQ A;  1Z03 A;  1VQK 1;  4E33 A;  3CMA 1;  3PO2 I;  1YJW 1;  2I3C A;  3GTM S;  4DGL A;  4XX2 A;  1VQ5 Z;  1KD1 1;  3GTK I;  4Y52 I;  4E2W A;  3NDJ A;  3CME 1;  4A3I I;  5IT9 f;  1N8R 1;  2JA5 I;  1WII A;  2KPI A;  1VQ7 1;  1NP6 A;  3VMI A;  4A93 I;  1ZB8 A;  5A2Q f;  2QKD A;  1RO2 A;  1YI2 Z;  2YU9 I;  1M1K 2;  3CCL 1;  1S72 Z;  1VQP Z;  3F3P C;  3G71 Z;  2E9H A;  4TNU A;  1VLA A;  2WB1 A;  2RIQ A;  3S17 I;  1TWH I;  4NBC A;  3GTP I;  4A3K I;  1NJI 2;  1Y1V I;  1R9T I;  2VUM I;  2RHB A;  4NBH A;  3F3F C;  2OOX B;  2JA7 I;  2DE6 A;  4NBE A;  2QRC B;  1VQL 1;  5IP9 I;  1VQK Z;  4Y7N I;  2G2K A;  1K8A 1;  3HOV I;  1YJW Z;  3CCJ 1;  1ZB9 A;  2IZ4 A;  3G4S 1;  2HU9 A;  2RT9 A;  4NBB A;  1QVG Z;  2V8I A;  4E2Y A;  2V8J A;  2QA4 Z;  1YJ9 Z;  3J7A 4;  2QR1 B;  1VQ6 1;  3I07 A;  3CCU 1;  5T67 A;  3S16 I;  2P28 A;  4A3J I;  1ML8 A;  1VQM 1;  2E2J I;  3NFZ A;  4E30 A;  1M1K 1;  3HOZ I;  3ESW A;  3VMH A;  3BG1 B;  5C4X I;  3I55 1;  2K3R A;  3U50 C;  4MRI A;  1YUK A;  1VQO 1;  1NJI 1;  2BJO A;  2EGT A;  3M3Y I;  3CCV 1;  1JJ2 Z;  1Q86 2;  3BG0 B;  1YIT Z;  1PFT A;  1VQL Z;  3CCR 1;  1WCM I;  1RLY A;  3CC4 1;  3JAM b;  1Q81 2;  2IZ3 A;  1M90 2;  2M6N A;  1VQ4 Z;  1I50 I;  1QVF Y;  2GTI A;  1Z01 A;  3FQQ A;  2DE7 A;  3J80 f;  3H3V J;  1VQN Z;  2M48 A;  4A3D I;  1I6H I;  3CCM Z;  1USP A;  1DL6 A;  4E31 A;  2QEX 1;  1K83 I;  1VQ9 1;  2JA8 I;  3CCE Z;  2NVQ I;  1S7M A;  3FQM A;  3GTO I;  4E2Z A;  3CXC Z;  3HOY I;  4BBS I;  4QTT A;  4BBR I;  1YHQ Z;  1TWC I;  5FLX f;  2JA6 I;  3GTL I;  2R6M A;  3S1M I;  3OW2 Z;  1YUA A;  4A3C I;  2Q4Z A;  1W2B Z;  2QRD B;  4NB8 A;  4NBD A;  3Q87 A;  1YJN 1;  1ZH1 A;  1VQO Z;  3CC2 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...