3I4MI

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 11
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4mI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4mI02
3H0GI 3PO3I 4A3CI 3HOUI 4A3FI 3I4MI 3GTQI 2DE5A 1YUAA 1RO4A 3GTMS 3K7AI 1X3ZA 3PO2I 4A3LI 2HF1A 3HOYI 3Q87A 5IP9I 1SFOI 3S14I 1USPB 3S16I 3I07A 2F4MA 1DL6A 1R9TI 3S2DI 5IP7I 3S17I 2F4OA 3M4OI 1Y1VS 3HOWI 2VUMI 2R7ZI 1ML8A 1N2FA 4A3EI 2YU9I 3GTPI 4MH4A 3GKQA 1L1OC 3HOXI 2RBLA 2B63I 1RLYA 2E2JI 2R92I 1TWFI 3HOZI 2JS4A 1TWHI 3LUSA 3GTKI 4Y7NI 3FKII 4X6AI 3VMHA 4NBBA 1QYPA 2NVYI 2BJOA 2E2HI 3VB9A 1TFIA 4NBFA 2JA5I 3RZOI 3S1RI 2E2II 3U50C 2JR6A 1TWGI 4NBGA 4A3MI 5C4XI 3VMIA 1X3WA 4NBHA 4A3II 1NUIA 2K5RA 1Y1WI 3D6WA 3H3VJ 3M3YI 3PO3S 2JA7I 4A3BI 1TWAI 1USPA 2P3YA 3VMGA 1WW9A 2KPIA 4NBEA 3GTMI 4A3GI 4Y52I 4QTUA 2NVTI 3HOVI 3S1QI 3CQZI 4NOZA 3GTLI 4NBCA 4A3DI 2R93I 1I6HI 3S2HI 1VLAA 2JA8I 1ZB9A 5C44I 5C4JI 4NB9A 1TWCI 1I50I 5C3EI 4BXXI 1Y1VI 3S1MI 1PFTA 5FLMI 4BBSI 2AKLA 2NVQI 2PK7A 4NB8A 4BY1I 4A93I 1K83I 2JNYA 2NVXI 3ESWA 2DE7A 4QTTA 4XX2A 3GTOI 3I4NI 1ZB8A 2JA6I 2DE6A 3GCFA 3GTGI 3EERA 1WCMI 3GTJI 3S1NI 4A3JI 2J6AA 1LQLA 4NBAA 4NBDA 3S15I 4BY7I 4A3KI 4BBRI 3RZDI 5CM2M 1I3QI
chains in the Genus database with same CATH superfamily
5D1PA 1YJW1 3H0GI 1YJNZ 4A3CI 3HOUI 1NJI1 3GTQI 1RO4A 1VQL1 3BG1B 2JUBA 3CCV1 1K731 1Q822 5IP9I 1RNIA 1Q812 1VQK1 1USPB 3CC21 2F4MA 3TE5B 3S2DI 5IP7I 3D9XA 3S17I 2VPZA 2V45A 1M1K1 3G711 4RS4A 1QVGY 3GTPI 3HOXI 4RV9A 2RBLA 2QR1B 2B63I 3I551 1RLYA 3NH4A 2PMZA 2R92I 3CCE1 3CMEZ 2RT9A 5A2Qf 2JS4A 2KI7B 3CMAZ 2QA41 3FKII 3VMHA 2M6NA 3G6EZ 4NBBA 1KC82 1S72Z 1YJ91 2BJOA 1X0TA 2JA5I 4S1TA 3F3PC 4E2WA 1AA6A 2JR6A 1TWGI 2GTIA 1N8R1 3VMIA 5LL6f 1X3WA 1Y1WI 2JA7I 4MD9A 4A3BI 4AYBA 4A3GI 1YIJ1 4QTUA 2Y0SA 3FQQA 3CQZI 2JIPA 4RVFA 1JWHC 2R93I 1N8R2 3CXCY 4RVHA 5IT9b 1M902 3S1MI 1KC81 3I561 3ESWA 2DE7A 5FLXb 2JIOA 1W2BZ 3GCFA 3EERA 1WCMI 3S1NI 2IV2X 3TDHB 1VQ5Z 1QVGZ 4E31A 4A3KI 3HKZA 4BBRI 1VQOZ 2OTJ1 1KQSZ 1I3QI 3CCMZ 4DQYB 2JIQA 3I4MI 2DE5A 3CCR1 2OTL1 3CCM1 1VQ7Z 1SFOI 3NH5A 2E9HA 3S14I 1ZH1A 1M901 3I07A 1DL6A 2OOYB 1R9TI 1K732 1VQ81 3G4S1 1SIWA 3MZLB 1Q16A 2HU9A 4NFRA 1K8A2 4E32A 1K9M2 1ML8A 4DGLA 4A3EI 3G6E1 2GU2A 1VQ61 1L1OC 4HGZA 3CMA1 3QWUA 2OOXB 2QKDA 2JMOA 3OW2Z 2E2JI 2GTHA 1VQMZ 1VQ8Z 1QYPA 2OZKA 1YHQ1 2W03A 2E2HI 1VQ41 4NBFA 2H85A 3RZOI 1WJ2A 3IF8A 4A3MI 2K5RA 2O53A 2P28A 3CCL1 3H3VJ 2WAQA 1TWAI 1WW9A 2OTJZ 1QF8A 2QREB 3GTLI 5A2Qb 1WZNA 2V3VA 3NFZA 4E2XA 2Q51A 1VLAA 2JA8I 5C4JI 5C44I 3VTNA 1VQPZ 1FDOA 4NB9A 1KD11 1I50I 1Q811 4BXXI 1QXFA 3JAMf 3J81f 5T6BA 5FLMI 4NB8A 1K83I 3IFUA 5IT9f 3I56Z 3I4NI 1RQFA 5FLXf 2M48A 2JA6I 3CCQZ 2DE6A 4RVDA 1Y8CA 2AYDA 3FQMA 2J6AA 2YADA 1QVFZ 3S15I 3EEDA 2LIYA 4MXUA 2QEX1 5CM2M 3CCVZ 4MD7A 3PO3I 4A3FI 1KRLA 1YUAA 2IZ3A 3K7AI 3OW2Y 3GTMS 3KIHA 3G4SZ 3PO2I 2QEXZ 1VQLZ 3J80b 1VQ4Z 3CPWY 3S16I 1VQNZ 1VQ71 3JAMb 3J81b 1S721 2F4OA 1Y1VS 3HOWI 1VQM1 2VUMI 2R7ZI 1K8A1 5T64A 2RHBA 3CC7Z 3J7A4 2JIRA 1KD12 1WIIA 1JJ2Y 3CCQ1 3G71Z 3LUSA 3GTKI 2VUGA 4MD8A 4Y7NI 1RO0A 2O4HA 1KQSY 1YIT1 3CC2Z 2E7ZA 2NAPA 3S1RI 4EWCA 2E2II 3U50C 1VQKZ 4A3II 2OTLZ 1NUIA 3PO3S 3CCRZ 2K3RA 1YITZ 1USPA 4Y52I 2KPIA 1YJN1 2NVTI 3HOVI 3CC41 2RIQA 4NOZA 4NBCA 4RVGA 2LEXA 1VQ51 4A3DI 3D2LA 1Z01A 1TWCI 2IZ4A 1Q862 2VPWA 3CCJZ 3NDJA 1YJ9Z 3CC71 2V8IA 4BBSI 4E30A 2QLVB 2PK7A 4BY1I 3CCUZ 2QA4Z 2NVQI 2R6MA 5D1OA 2NVXI 2JNYA 3CD61 2PM9A 3CPWZ 2VPXA 4QTTA 1K9M1 4XX2A 3CD6Z 3CME1 3KIFA 4E33A 3GTJI 4A3JI 1LQLA 4NBAA 3CCS1 4NBDA 2V8KA 1VQN1 5AN9F 4BY7I 1VQ6Z 4MRIA 2WB1A 3RZDI 2RPRA 2EGTA 2QRCB 3CC4Z 1X3ZA 4A3LI 2HF1A 2G2KA 3Q87A 3NDIA 5D1OB 1NP6A 1YUKA 1Q861 3CCSZ 2VPYA 3M4OI 2VF1A 3NH8A 3IR7A 1RO2A 3MONA 4MONA 1M1K2 2ZAEB 1YJWZ 1N2FA 2YU9I 3CCU1 1VQO1 4MH4A 4E2ZA 3GKQA 2Q4ZA 1Z03A 1FDIA 3CCJ1 1Q821 1P9NA 1TWFI 3HOZI 1VQP1 2JIMA 3F3FC 1TWHI 1QVFY 2LFUA 1NJI2 4X6AI 4TNUA 3T4NB 3P5JB 2NVYI 2V8JA 3CCLZ 3VB9A 1TFIA 4NBGA 5C4XI 1YI2Z 2W04A 3BG0B 4NBHA 4E2YA 1W2BY 3M3YI 3D6WA 2P3YA 1YHQZ 5T67A 3VMGA 4NBEA 1YIJZ 3GTMI 3S1QI 1YI21 4DK1A 1I6HI 3S2HI 1ZB9A 1Q7Y1 1Q7Y2 3J80f 5C3EI 2QRDB 4HGYA 4NH1C 1S7MA 1Y1VI 1PFTA 2AKLA 1VQ91 4A93I 1VQ9Z 1JJ2Z 3GTOI 1ZB8A 3CCEZ 3IX0A 3GTGI 3I55Z 4CL1A 2I3CA 4HH4A 3MZKB 1Z02A 3HOYI 3CXCZ
chains in the Genus database with same CATH topology
5D1PA 1YJW1 3H0GI 1YJNZ 4A3CI 3HOUI 1NJI1 3GTQI 1RO4A 1VQL1 3BG1B 2JUBA 3CCV1 1K731 1Q822 5IP9I 1RNIA 1Q812 1VQK1 1USPB 3CC21 2F4MA 3TE5B 3S2DI 5IP7I 3D9XA 3S17I 1M1K1 3G711 4RS4A 1QVGY 3GTPI 3HOXI 4RV9A 2RBLA 2QR1B 2B63I 3I551 1RLYA 3NH4A 2PMZA 2R92I 3CCE1 3CMEZ 2RT9A 5A2Qf 2JS4A 2KI7B 3CMAZ 2QA41 3FKII 3VMHA 2M6NA 3G6EZ 4NBBA 1KC82 1S72Z 1YJ91 2BJOA 1X0TA 2JA5I 4S1TA 3F3PC 4E2WA 2JR6A 1TWGI 2GTIA 1N8R1 3VMIA 5LL6f 1X3WA 1Y1WI 2JA7I 4MD9A 4A3BI 4AYBA 4A3GI 1YIJ1 4QTUA 2Y0SA 3FQQA 3CQZI 4RVFA 1JWHC 2R93I 1N8R2 3CXCY 4RVHA 5IT9b 1M902 3S1MI 1KC81 3I561 3ESWA 2DE7A 5FLXb 1W2BZ 3GCFA 3EERA 1WCMI 3S1NI 3TDHB 1VQ5Z 1QVGZ 4E31A 4A3KI 3HKZA 4BBRI 1VQOZ 2OTJ1 1KQSZ 1I3QI 3CCMZ 4DQYB 3I4MI 2DE5A 3CCR1 2OTL1 3CCM1 1VQ7Z 1SFOI 3NH5A 2E9HA 3S14I 1ZH1A 1M901 3I07A 1DL6A 2OOYB 1R9TI 1K732 1VQ81 3G4S1 3MZLB 4NFRA 2HU9A 1K8A2 4E32A 1K9M2 1ML8A 4DGLA 4A3EI 3G6E1 2GU2A 1VQ61 1L1OC 4HGZA 3CMA1 3QWUA 2OOXB 2QKDA 2JMOA 3OW2Z 2E2JI 2GTHA 1VQMZ 1VQ8Z 1QYPA 2OZKA 1YHQ1 2W03A 2E2HI 1VQ41 4NBFA 2H85A 3RZOI 3IF8A 4A3MI 2K5RA 2O53A 2P28A 3CCL1 3H3VJ 2WAQA 1TWAI 1WW9A 2OTJZ 1QF8A 2QREB 3GTLI 5A2Qb 3NFZA 4E2XA 2Q51A 1VLAA 2JA8I 5C4JI 5C44I 3VTNA 1VQPZ 4NB9A 1KD11 1I50I 1Q811 4BXXI 3JAMf 3J81f 5T6BA 5FLMI 4NB8A 1K83I 3IFUA 5IT9f 3I56Z 3I4NI 1RQFA 5FLXf 2M48A 2JA6I 3CCQZ 2DE6A 4RVDA 3FQMA 2J6AA 2YADA 1QVFZ 3S15I 3EEDA 2LIYA 4MXUA 2QEX1 5CM2M 3CCVZ 4MD7A 3PO3I 4A3FI 1KRLA 1YUAA 2IZ3A 3K7AI 3OW2Y 3GTMS 3KIHA 3G4SZ 3PO2I 2QEXZ 1VQLZ 3J80b 1VQ4Z 3CPWY 3S16I 1VQNZ 1VQ71 3JAMb 3J81b 1S721 2F4OA 1Y1VS 3HOWI 1VQM1 2VUMI 2R7ZI 1K8A1 5T64A 2RHBA 3CC7Z 3J7A4 1KD12 1WIIA 1JJ2Y 3CCQ1 3G71Z 3LUSA 3GTKI 2VUGA 4MD8A 4Y7NI 1RO0A 2O4HA 1KQSY 1YIT1 3CC2Z 3S1RI 4EWCA 2E2II 3U50C 1VQKZ 4A3II 2OTLZ 1NUIA 3PO3S 3CCRZ 2K3RA 1YITZ 1USPA 4Y52I 2KPIA 1YJN1 2NVTI 3HOVI 3CC41 2RIQA 4NOZA 4NBCA 4RVGA 4A3DI 1VQ51 1Q862 1Z01A 1TWCI 2IZ4A 3CCJZ 3NDJA 1YJ9Z 3CC71 2V8IA 4BBSI 4E30A 2QLVB 2PK7A 4BY1I 3CCUZ 2QA4Z 2NVQI 2R6MA 5D1OA 2NVXI 2JNYA 3CD61 2PM9A 3CPWZ 4QTTA 1K9M1 4XX2A 3CD6Z 3CME1 3KIFA 4E33A 3GTJI 4A3JI 1LQLA 4NBAA 3CCS1 4NBDA 2V8KA 1VQN1 5AN9F 4BY7I 1VQ6Z 4MRIA 2WB1A 3RZDI 2RPRA 2EGTA 2QRCB 3CC4Z 1X3ZA 4A3LI 2HF1A 2G2KA 3Q87A 3NDIA 5D1OB 1NP6A 1YUKA 1Q861 3CCSZ 3M4OI 2VF1A 3NH8A 1RO2A 3MONA 4MONA 1M1K2 2ZAEB 1YJWZ 1N2FA 2YU9I 3CCU1 1VQO1 4MH4A 4E2ZA 3GKQA 2Q4ZA 1Z03A 3CCJ1 1Q821 1P9NA 1TWFI 3HOZI 1VQP1 3F3FC 1TWHI 1QVFY 2LFUA 1NJI2 4X6AI 4TNUA 3T4NB 3P5JB 2NVYI 2V8JA 3CCLZ 3VB9A 1TFIA 4NBGA 5C4XI 1YI2Z 2W04A 3BG0B 4NBHA 4E2YA 1W2BY 3M3YI 3D6WA 2P3YA 1YHQZ 5T67A 3VMGA 4NBEA 1YIJZ 3GTMI 3S1QI 1YI21 4DK1A 1I6HI 3S2HI 1ZB9A 1Q7Y1 1Q7Y2 3J80f 5C3EI 2QRDB 4HGYA 4NH1C 1S7MA 1Y1VI 1PFTA 2AKLA 1VQ91 4A93I 1VQ9Z 1JJ2Z 3GTOI 1ZB8A 3CCEZ 3IX0A 3GTGI 3I55Z 4CL1A 2I3CA 4HH4A 3MZKB 1Z02A 3HOYI 3CXCZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0G I;  3PO3 I;  4A3C I;  3HOU I;  4A3F I;  3I4M I;  3GTQ I;  2DE5 A;  1YUA A;  1RO4 A;  3GTM S;  3K7A I;  1X3Z A;  3PO2 I;  4A3L I;  2HF1 A;  3HOY I;  3Q87 A;  5IP9 I;  1SFO I;  3S14 I;  1USP B;  3S16 I;  3I07 A;  2F4M A;  1DL6 A;  1R9T I;  3S2D I;  5IP7 I;  3S17 I;  2F4O A;  3M4O I;  1Y1V S;  3HOW I;  2VUM I;  2R7Z I;  1ML8 A;  1N2F A;  4A3E I;  2YU9 I;  3GTP I;  4MH4 A;  3GKQ A;  1L1O C;  3HOX I;  2RBL A;  2B63 I;  1RLY A;  2E2J I;  2R92 I;  1TWF I;  3HOZ I;  2JS4 A;  1TWH I;  3LUS A;  3GTK I;  4Y7N I;  3FKI I;  4X6A I;  3VMH A;  4NBB A;  1QYP A;  2NVY I;  2BJO A;  2E2H I;  3VB9 A;  1TFI A;  4NBF A;  2JA5 I;  3RZO I;  3S1R I;  2E2I I;  3U50 C;  2JR6 A;  1TWG I;  4NBG A;  4A3M I;  5C4X I;  3VMI A;  1X3W A;  4NBH A;  4A3I I;  1NUI A;  2K5R A;  1Y1W I;  3D6W A;  3H3V J;  3M3Y I;  3PO3 S;  2JA7 I;  4A3B I;  1TWA I;  1USP A;  2P3Y A;  3VMG A;  1WW9 A;  2KPI A;  4NBE A;  3GTM I;  4A3G I;  4Y52 I;  4QTU A;  2NVT I;  3HOV I;  3S1Q I;  3CQZ I;  4NOZ A;  3GTL I;  4NBC A;  4A3D I;  2R93 I;  1I6H I;  3S2H I;  1VLA A;  2JA8 I;  1ZB9 A;  5C44 I;  5C4J I;  4NB9 A;  1TWC I;  1I50 I;  5C3E I;  4BXX I;  1Y1V I;  3S1M I;  1PFT A;  5FLM I;  4BBS I;  2AKL A;  2NVQ I;  2PK7 A;  4NB8 A;  4BY1 I;  4A93 I;  1K83 I;  2JNY A;  2NVX I;  3ESW A;  2DE7 A;  4QTT A;  4XX2 A;  3GTO I;  3I4N I;  1ZB8 A;  2JA6 I;  2DE6 A;  3GCF A;  3GTG I;  3EER A;  1WCM I;  3GTJ I;  3S1N I;  4A3J I;  2J6A A;  1LQL A;  4NBA A;  4NBD A;  3S15 I;  4BY7 I;  4A3K I;  4BBR I;  3RZD I;  5CM2 M;  1I3Q I; 
#chains in the Genus database with same CATH topology
 5D1P A;  1YJW 1;  3H0G I;  1YJN Z;  4A3C I;  3HOU I;  1NJI 1;  3GTQ I;  1RO4 A;  1VQL 1;  3BG1 B;  2JUB A;  3CCV 1;  1K73 1;  1Q82 2;  5IP9 I;  1RNI A;  1Q81 2;  1VQK 1;  1USP B;  3CC2 1;  2F4M A;  3TE5 B;  3S2D I;  5IP7 I;  3D9X A;  3S17 I;  2VPZ A;  2V45 A;  1M1K 1;  3G71 1;  4RS4 A;  1QVG Y;  3GTP I;  3HOX I;  4RV9 A;  2RBL A;  2QR1 B;  2B63 I;  3I55 1;  1RLY A;  3NH4 A;  2PMZ A;  2R92 I;  3CCE 1;  3CME Z;  2RT9 A;  5A2Q f;  2JS4 A;  2KI7 B;  3CMA Z;  2QA4 1;  3FKI I;  3VMH A;  2M6N A;  3G6E Z;  4NBB A;  1KC8 2;  1S72 Z;  1YJ9 1;  2BJO A;  1X0T A;  2JA5 I;  4S1T A;  3F3P C;  4E2W A;  1AA6 A;  2JR6 A;  1TWG I;  2GTI A;  1N8R 1;  3VMI A;  5LL6 f;  1X3W A;  1Y1W I;  2JA7 I;  4MD9 A;  4A3B I;  4AYB A;  4A3G I;  1YIJ 1;  4QTU A;  2Y0S A;  3FQQ A;  3CQZ I;  2JIP A;  4RVF A;  1JWH C;  2R93 I;  1N8R 2;  3CXC Y;  4RVH A;  5IT9 b;  1M90 2;  3S1M I;  1KC8 1;  3I56 1;  3ESW A;  2DE7 A;  5FLX b;  2JIO A;  1W2B Z;  3GCF A;  3EER A;  1WCM I;  3S1N I;  2IV2 X;  3TDH B;  1VQ5 Z;  1QVG Z;  4E31 A;  4A3K I;  3HKZ A;  4BBR I;  1VQO Z;  2OTJ 1;  1KQS Z;  1I3Q I;  3CCM Z;  4DQY B;  2JIQ A;  3I4M I;  2DE5 A;  3CCR 1;  2OTL 1;  3CCM 1;  1VQ7 Z;  1SFO I;  3NH5 A;  2E9H A;  3S14 I;  1ZH1 A;  1M90 1;  3I07 A;  1DL6 A;  2OOY B;  1R9T I;  1K73 2;  1VQ8 1;  3G4S 1;  1SIW A;  3MZL B;  1Q16 A;  2HU9 A;  4NFR A;  1K8A 2;  4E32 A;  1K9M 2;  1ML8 A;  4DGL A;  4A3E I;  3G6E 1;  2GU2 A;  1VQ6 1;  1L1O C;  4HGZ A;  3CMA 1;  3QWU A;  2OOX B;  2QKD A;  2JMO A;  3OW2 Z;  2E2J I;  2GTH A;  1VQM Z;  1VQ8 Z;  1QYP A;  2OZK A;  1YHQ 1;  2W03 A;  2E2H I;  1VQ4 1;  4NBF A;  2H85 A;  3RZO I;  1WJ2 A;  3IF8 A;  4A3M I;  2K5R A;  2O53 A;  2P28 A;  3CCL 1;  3H3V J;  2WAQ A;  1TWA I;  1WW9 A;  2OTJ Z;  1QF8 A;  2QRE B;  3GTL I;  5A2Q b;  1WZN A;  2V3V A;  3NFZ A;  4E2X A;  2Q51 A;  1VLA A;  2JA8 I;  5C4J I;  5C44 I;  3VTN A;  1VQP Z;  1FDO A;  4NB9 A;  1KD1 1;  1I50 I;  1Q81 1;  4BXX I;  1QXF A;  3JAM f;  3J81 f;  5T6B A;  5FLM I;  4NB8 A;  1K83 I;  3IFU A;  5IT9 f;  3I56 Z;  3I4N I;  1RQF A;  5FLX f;  2M48 A;  2JA6 I;  3CCQ Z;  2DE6 A;  4RVD A;  1Y8C A;  2AYD A;  3FQM A;  2J6A A;  2YAD A;  1QVF Z;  3S15 I;  3EED A;  2LIY A;  4MXU A;  2QEX 1;  5CM2 M;  3CCV Z;  4MD7 A;  3PO3 I;  4A3F I;  1KRL A;  1YUA A;  2IZ3 A;  3K7A I;  3OW2 Y;  3GTM S;  3KIH A;  3G4S Z;  3PO2 I;  2QEX Z;  1VQL Z;  3J80 b;  1VQ4 Z;  3CPW Y;  3S16 I;  1VQN Z;  1VQ7 1;  3JAM b;  3J81 b;  1S72 1;  2F4O A;  1Y1V S;  3HOW I;  1VQM 1;  2VUM I;  2R7Z I;  1K8A 1;  5T64 A;  2RHB A;  3CC7 Z;  3J7A 4;  2JIR A;  1KD1 2;  1WII A;  1JJ2 Y;  3CCQ 1;  3G71 Z;  3LUS A;  3GTK I;  2VUG A;  4MD8 A;  4Y7N I;  1RO0 A;  2O4H A;  1KQS Y;  1YIT 1;  3CC2 Z;  2E7Z A;  2NAP A;  3S1R I;  4EWC A;  2E2I I;  3U50 C;  1VQK Z;  4A3I I;  2OTL Z;  1NUI A;  3PO3 S;  3CCR Z;  2K3R A;  1YIT Z;  1USP A;  4Y52 I;  2KPI A;  1YJN 1;  2NVT I;  3HOV I;  3CC4 1;  2RIQ A;  4NOZ A;  4NBC A;  4RVG A;  2LEX A;  1VQ5 1;  4A3D I;  3D2L A;  1Z01 A;  1TWC I;  2IZ4 A;  1Q86 2;  2VPW A;  3CCJ Z;  3NDJ A;  1YJ9 Z;  3CC7 1;  2V8I A;  4BBS I;  4E30 A;  2QLV B;  2PK7 A;  4BY1 I;  3CCU Z;  2QA4 Z;  2NVQ I;  2R6M A;  5D1O A;  2NVX I;  2JNY A;  3CD6 1;  2PM9 A;  3CPW Z;  2VPX A;  4QTT A;  1K9M 1;  4XX2 A;  3CD6 Z;  3CME 1;  3KIF A;  4E33 A;  3GTJ I;  4A3J I;  1LQL A;  4NBA A;  3CCS 1;  4NBD A;  2V8K A;  1VQN 1;  5AN9 F;  4BY7 I;  1VQ6 Z;  4MRI A;  2WB1 A;  3RZD I;  2RPR A;  2EGT A;  2QRC B;  3CC4 Z;  1X3Z A;  4A3L I;  2HF1 A;  2G2K A;  3Q87 A;  3NDI A;  5D1O B;  1NP6 A;  1YUK A;  1Q86 1;  3CCS Z;  2VPY A;  3M4O I;  2VF1 A;  3NH8 A;  3IR7 A;  1RO2 A;  3MON A;  4MON A;  1M1K 2;  2ZAE B;  1YJW Z;  1N2F A;  2YU9 I;  3CCU 1;  1VQO 1;  4MH4 A;  4E2Z A;  3GKQ A;  2Q4Z A;  1Z03 A;  1FDI A;  3CCJ 1;  1Q82 1;  1P9N A;  1TWF I;  3HOZ I;  1VQP 1;  2JIM A;  3F3F C;  1TWH I;  1QVF Y;  2LFU A;  1NJI 2;  4X6A I;  4TNU A;  3T4N B;  3P5J B;  2NVY I;  2V8J A;  3CCL Z;  3VB9 A;  1TFI A;  4NBG A;  5C4X I;  1YI2 Z;  2W04 A;  3BG0 B;  4NBH A;  4E2Y A;  1W2B Y;  3M3Y I;  3D6W A;  2P3Y A;  1YHQ Z;  5T67 A;  3VMG A;  4NBE A;  1YIJ Z;  3GTM I;  3S1Q I;  1YI2 1;  4DK1 A;  1I6H I;  3S2H I;  1ZB9 A;  1Q7Y 1;  1Q7Y 2;  3J80 f;  5C3E I;  2QRD B;  4HGY A;  4NH1 C;  1S7M A;  1Y1V I;  1PFT A;  2AKL A;  1VQ9 1;  4A93 I;  1VQ9 Z;  1JJ2 Z;  3GTO I;  1ZB8 A;  3CCE Z;  3IX0 A;  3GTG I;  3I55 Z;  4CL1 A;  2I3C A;  4HH4 A;  3MZK B;  1Z02 A;  3HOY I;  3CXC Z; 
#chains in the Genus database with same CATH homology
 5D1P A;  1YJW 1;  3H0G I;  1YJN Z;  4A3C I;  3HOU I;  1NJI 1;  3GTQ I;  1RO4 A;  1VQL 1;  3BG1 B;  2JUB A;  3CCV 1;  1K73 1;  1Q82 2;  5IP9 I;  1RNI A;  1Q81 2;  1VQK 1;  1USP B;  3CC2 1;  2F4M A;  3TE5 B;  3S2D I;  5IP7 I;  3D9X A;  3S17 I;  1M1K 1;  3G71 1;  4RS4 A;  1QVG Y;  3GTP I;  3HOX I;  4RV9 A;  2RBL A;  2QR1 B;  2B63 I;  3I55 1;  1RLY A;  3NH4 A;  2PMZ A;  2R92 I;  3CCE 1;  3CME Z;  2RT9 A;  5A2Q f;  2JS4 A;  2KI7 B;  3CMA Z;  2QA4 1;  3FKI I;  3VMH A;  2M6N A;  3G6E Z;  4NBB A;  1KC8 2;  1S72 Z;  1YJ9 1;  2BJO A;  1X0T A;  2JA5 I;  4S1T A;  3F3P C;  4E2W A;  2JR6 A;  1TWG I;  2GTI A;  1N8R 1;  3VMI A;  5LL6 f;  1X3W A;  1Y1W I;  2JA7 I;  4MD9 A;  4A3B I;  4AYB A;  4A3G I;  1YIJ 1;  4QTU A;  2Y0S A;  3FQQ A;  3CQZ I;  4RVF A;  1JWH C;  2R93 I;  1N8R 2;  3CXC Y;  4RVH A;  5IT9 b;  1M90 2;  3S1M I;  1KC8 1;  3I56 1;  3ESW A;  2DE7 A;  5FLX b;  1W2B Z;  3GCF A;  3EER A;  1WCM I;  3S1N I;  3TDH B;  1VQ5 Z;  1QVG Z;  4E31 A;  4A3K I;  3HKZ A;  4BBR I;  1VQO Z;  2OTJ 1;  1KQS Z;  1I3Q I;  3CCM Z;  4DQY B;  3I4M I;  2DE5 A;  3CCR 1;  2OTL 1;  3CCM 1;  1VQ7 Z;  1SFO I;  3NH5 A;  2E9H A;  3S14 I;  1ZH1 A;  1M90 1;  3I07 A;  1DL6 A;  2OOY B;  1R9T I;  1K73 2;  1VQ8 1;  3G4S 1;  3MZL B;  4NFR A;  2HU9 A;  1K8A 2;  4E32 A;  1K9M 2;  1ML8 A;  4DGL A;  4A3E I;  3G6E 1;  2GU2 A;  1VQ6 1;  1L1O C;  4HGZ A;  3CMA 1;  3QWU A;  2OOX B;  2QKD A;  2JMO A;  3OW2 Z;  2E2J I;  2GTH A;  1VQM Z;  1VQ8 Z;  1QYP A;  2OZK A;  1YHQ 1;  2W03 A;  2E2H I;  1VQ4 1;  4NBF A;  2H85 A;  3RZO I;  3IF8 A;  4A3M I;  2K5R A;  2O53 A;  2P28 A;  3CCL 1;  3H3V J;  2WAQ A;  1TWA I;  1WW9 A;  2OTJ Z;  1QF8 A;  2QRE B;  3GTL I;  5A2Q b;  3NFZ A;  4E2X A;  2Q51 A;  1VLA A;  2JA8 I;  5C4J I;  5C44 I;  3VTN A;  1VQP Z;  4NB9 A;  1KD1 1;  1I50 I;  1Q81 1;  4BXX I;  3JAM f;  3J81 f;  5T6B A;  5FLM I;  4NB8 A;  1K83 I;  3IFU A;  5IT9 f;  3I56 Z;  3I4N I;  1RQF A;  5FLX f;  2M48 A;  2JA6 I;  3CCQ Z;  2DE6 A;  4RVD A;  3FQM A;  2J6A A;  2YAD A;  1QVF Z;  3S15 I;  3EED A;  2LIY A;  4MXU A;  2QEX 1;  5CM2 M;  3CCV Z;  4MD7 A;  3PO3 I;  4A3F I;  1KRL A;  1YUA A;  2IZ3 A;  3K7A I;  3OW2 Y;  3GTM S;  3KIH A;  3G4S Z;  3PO2 I;  2QEX Z;  1VQL Z;  3J80 b;  1VQ4 Z;  3CPW Y;  3S16 I;  1VQN Z;  1VQ7 1;  3JAM b;  3J81 b;  1S72 1;  2F4O A;  1Y1V S;  3HOW I;  1VQM 1;  2VUM I;  2R7Z I;  1K8A 1;  5T64 A;  2RHB A;  3CC7 Z;  3J7A 4;  1KD1 2;  1WII A;  1JJ2 Y;  3CCQ 1;  3G71 Z;  3LUS A;  3GTK I;  2VUG A;  4MD8 A;  4Y7N I;  1RO0 A;  2O4H A;  1KQS Y;  1YIT 1;  3CC2 Z;  3S1R I;  4EWC A;  2E2I I;  3U50 C;  1VQK Z;  4A3I I;  2OTL Z;  1NUI A;  3PO3 S;  3CCR Z;  2K3R A;  1YIT Z;  1USP A;  4Y52 I;  2KPI A;  1YJN 1;  2NVT I;  3HOV I;  3CC4 1;  2RIQ A;  4NOZ A;  4NBC A;  4RVG A;  4A3D I;  1VQ5 1;  1Q86 2;  1Z01 A;  1TWC I;  2IZ4 A;  3CCJ Z;  3NDJ A;  1YJ9 Z;  3CC7 1;  2V8I A;  4BBS I;  4E30 A;  2QLV B;  2PK7 A;  4BY1 I;  3CCU Z;  2QA4 Z;  2NVQ I;  2R6M A;  5D1O A;  2NVX I;  2JNY A;  3CD6 1;  2PM9 A;  3CPW Z;  4QTT A;  1K9M 1;  4XX2 A;  3CD6 Z;  3CME 1;  3KIF A;  4E33 A;  3GTJ I;  4A3J I;  1LQL A;  4NBA A;  3CCS 1;  4NBD A;  2V8K A;  1VQN 1;  5AN9 F;  4BY7 I;  1VQ6 Z;  4MRI A;  2WB1 A;  3RZD I;  2RPR A;  2EGT A;  2QRC B;  3CC4 Z;  1X3Z A;  4A3L I;  2HF1 A;  2G2K A;  3Q87 A;  3NDI A;  5D1O B;  1NP6 A;  1YUK A;  1Q86 1;  3CCS Z;  3M4O I;  2VF1 A;  3NH8 A;  1RO2 A;  3MON A;  4MON A;  1M1K 2;  2ZAE B;  1YJW Z;  1N2F A;  2YU9 I;  3CCU 1;  1VQO 1;  4MH4 A;  4E2Z A;  3GKQ A;  2Q4Z A;  1Z03 A;  3CCJ 1;  1Q82 1;  1P9N A;  1TWF I;  3HOZ I;  1VQP 1;  3F3F C;  1TWH I;  1QVF Y;  2LFU A;  1NJI 2;  4X6A I;  4TNU A;  3T4N B;  3P5J B;  2NVY I;  2V8J A;  3CCL Z;  3VB9 A;  1TFI A;  4NBG A;  5C4X I;  1YI2 Z;  2W04 A;  3BG0 B;  4NBH A;  4E2Y A;  1W2B Y;  3M3Y I;  3D6W A;  2P3Y A;  1YHQ Z;  5T67 A;  3VMG A;  4NBE A;  1YIJ Z;  3GTM I;  3S1Q I;  1YI2 1;  4DK1 A;  1I6H I;  3S2H I;  1ZB9 A;  1Q7Y 1;  1Q7Y 2;  3J80 f;  5C3E I;  2QRD B;  4HGY A;  4NH1 C;  1S7M A;  1Y1V I;  1PFT A;  2AKL A;  1VQ9 1;  4A93 I;  1VQ9 Z;  1JJ2 Z;  3GTO I;  1ZB8 A;  3CCE Z;  3IX0 A;  3GTG I;  3I55 Z;  4CL1 A;  2I3C A;  4HH4 A;  3MZK B;  1Z02 A;  3HOY I;  3CXC Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...