3I4MI

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
total genus 11
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4mI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4mI02
5C4XI 4A3CI 4NBBA 3GTMS 1X3WA 4MH4A 1VLAA 2E2JI 4NBEA 1WW9A 3FKII 3GTGI 2PK7A 4Y7NI 3GTMI 3S2HI 4QTTA 1ZB8A 4A3II 2BJOA 2K5RA 2VUMI 3S15I 1I6HI 3HOZI 1TWFI 4BBSI 3Q87A 3I4MI 3ESWA 4A3LI 2R93I 2B63I 4Y52I 1Y1WI 1N2FA 1X3ZA 4A3KI 3CQZI 3S1MI 4NBFA 2NVXI 2JS4A 3H0GI 4A3DI 4A3EI 2AKLA 5IP9I 1DL6A 3PO2I 2NVYI 5FLMI 1TWCI 1YUAA 2R92I 2E2HI 3M3YI 1RLYA 3GTKI 3D6WA 3RZOI 1USPA 1L1OC 3S1QI 3VMHA 3VB9A 2R7ZI 5CM2M 2JA6I 3HOVI 4NBDA 3HOYI 2DE7A 2F4OA 3U50C 4BBRI 4XX2A 4A93I 1RO4A 3VMIA 2YU9I 3S2DI 4NOZA 1TWHI 1I3QI 1LQLA 1R9TI 3S16I 2DE5A 4BXXI 2JNYA 4A3FI 1PFTA 1ML8A 1WCMI 1TWAI 2J6AA 3HOXI 4A3JI 3H3VJ 3PO3S 2JA7I 5C3EI 1I50I 1TFIA 3GTPI 2JA5I 3M4OI 2NVQI 2HF1A 4NB9A 3RZDI 3PO3I 3S1RI 3LUSA 4A3BI 2F4MA 2DE6A 4NBCA 2KPIA 5IP7I 3GKQA 2JA8I 3GTQI 5C44I 4NB8A 1ZB9A 3GTJI 4QTUA 1NUIA 2RBLA 1USPB 2JR6A 1TWGI 3EERA 4A3MI 2E2II 3GTOI 3K7AI 3I07A 3VMGA 4NBAA 4X6AI 3S1NI 5C4JI 3GCFA 1Y1VS 3HOUI 4NBGA 3GTLI 3I4NI 3S14I 1Y1VI 1QYPA 2P3YA 4BY1I 2NVTI 4BY7I 4A3GI 4NBHA 1K83I 3HOWI 3S17I 1SFOI
chains in the Genus database with same CATH superfamily
4RVGA 4MH4A 3G6E1 4E2ZA 1YJWZ 1VQ8Z 2VPZA 4NBEA 1KRLA 3GTMI 1JJ2Z 5T67A 1I6HI 1RNIA 2R93I 3CXCZ 4A3KI 3CCLZ 1W2BZ 1KC81 2OZKA 2IV2X 4A3DI 2AKLA 1TWCI 2R92I 3M3YI 5D1OB 2IZ3A 3GTKI 2QA4Z 1VQLZ 3D6WA 1K732 1USPA 3S1QI 3CC4Z 2JA6I 2LIYA 1M1K1 5T6BA 3S2DI 2QEX1 3CC71 3MONA 1LQLA 3CC21 3CCU1 1Q862 4A3FI 1NP6A 3CCRZ 3CCM1 3G4S1 1FDIA 3HOXI 2JA7I 1VQK1 1VQOZ 4MD8A 1VQNZ 1YJ91 2OOYB 3CCQ1 2Q51A 4RS4A 3NDIA 4NH1C 3GTJI 5AN9F 5LL6f 4A3MI 2QLVB 1S72Z 5C4JI 1N8R2 3IFUA 2GTIA 5IT9f 1QF8A 2W03A 2IZ4A 3CC2Z 2W04A 3CCUZ 1Q822 2WAQA 1VQ4Z 3CCMZ 3G4SZ 4NBHA 1K83I 4DQYB 2M6NA 2Q4ZA 5IT9b 4A3CI 3CME1 3OW2Z 3QWUA 3CD61 1X3WA 3CCE1 1JJ2Y 3FKII 3MZLB 3GTGI 1K9M1 3D9XA 2BJOA 3HOZI 1Q861 4BBSI 3CXCY 1VQP1 2V8IA 4Y52I 2JUBA 1W2BY 2GU2A 1KD12 2JIQA 3S1MI 2QR1B 3CQZI 4NFRA 2NVXI 3H0GI 2GTHA 4MD7A 5IP9I 1YI21 1VQ5Z 2V8JA 3T4NB 1YJNZ 1NJI2 1RLYA 3RZOI 1L1OC 4S1TA 4MRIA 3VB9A 3CCJZ 2R7ZI 5CM2M 3HOVI 1VQ91 3HOYI 2E7ZA 2DE7A 4BBRI 3P5JB 1M902 2HU9A 2RHBA 1I3QI 2QREB 3IF8A 1R9TI 1Y8CA 3FQQA 4RVHA 1PFTA 2JIRA 1YIJ1 3CMA1 1VQPZ 1I50I 3KIHA 1Q7Y2 1TFIA 2AYDA 3M4OI 2HF1A 4CL1A 3LUSA 2PMZA 2OTJZ 1KQSZ 2F4MA 4E2WA 2LEXA 3VTNA 4NBCA 2JA8I 4MD9A 1RO0A 3G6EZ 2JR6A 1Q16A 2VF1A 4E2XA 3NH5A 1KD11 3FQMA 5D1OA 1JWHC 4E31A 4NBGA 3S14I 3IX0A 2VPXA 1YIT1 4MXUA 1FDOA 3S17I 3OW2Y 3HKZA 2WB1A 2E2HI 4NBBA 1VQ61 1X0TA 1VLAA 1WW9A 3J80f 3CCS1 2QRCB 5FLXf 4TNUA 2QRDB 1VQ71 1WIIA 2PK7A 2OTL1 4Y7NI 2QEXZ 3J81f 3CC7Z 1YHQ1 1ZB8A 3S2HI 4DK1A 1YUKA 2K5RA 2VUMI 3S15I 2E9HA 1K8A2 3Q87A 3I4MI 3ESWA 2B63I 1N2FA 1Z03A 1X3ZA 4RV9A 2JMOA 1P9NA 1K731 2JS4A 3CCV1 1Q7Y1 3J80b 3KIFA 1Z01A 5FLXb 1RO2A 3PO2I 1S7MA 1VQKZ 5T64A 2ZAEB 2JIMA 3VMHA 1YJ9Z 3MZKB 3NH4A 3CCQZ 4NBDA 4DGLA 4XX2A 3BG1B 4HGYA 1YITZ 3JAMf 1TWHI 2OOXB 4E2YA 2DE5A 3D2LA 4RVFA 3CCSZ 1RQFA 2JNYA 1ML8A 1WCMI 3EEDA 2RIQA 1TWAI 3JAMb 1Z02A 4A3JI 3H3VJ 3PO3S 5C3EI 3I551 2QA41 2JA5I 1WJ2A 1VQL1 3NDJA 4NB9A 3CC41 1KQSY 2PM9A 3CCVZ 3BG0B 3I561 1QVFZ 2KPIA 3GKQA 3CMEZ 3GTQI 1ZB9A 2QKDA 1Q812 1QVGZ 3CCEZ 4QTUA 1VQM1 1N8R1 3CD6Z 1NUIA 2V45A 2RBLA 1USPB 2VUGA 1K8A1 1TWGI 2RPRA 3EERA 4HH4A 3CPWY 3I07A 3VMGA 4NBAA 3S1NI 2JIPA 1Q821 3CCR1 4RVDA 1Y1VS 2VPYA 3G711 3GTLI 3J7A4 3I4NI 1QYPA 1YI2Z 1VQO1 2P3YA 1AA6A 1VQN1 4BY1I 4A3GI 2K3RA 2O4HA 2O53A 1SFOI 5C4XI 2VPWA 3TDHB 2KI7B 3I55Z 3GTMS 1VQ9Z 2I3CA 2E2JI 3TE5B 3CPWZ 4QTTA 3I56Z 4A3II 1S721 1TWFI 2V8KA 4A3LI 1VQMZ 4E30A 1Y1WI 1NJI1 1K9M2 4NBFA 2RT9A 2EGTA 3F3PC 4E33A 4A3EI 1YIJZ 3CMAZ 1DL6A 2NVYI 5FLMI 1VQ41 1YUAA 2H85A 3NH8A 4AYBA 1M901 3G71Z 1ZH1A 3F3FC 1Q811 5D1PA 2F4OA 4MONA 3U50C 4A93I 3IR7A 4E32A 1RO4A 3NFZA 5A2Qf 3VMIA 2YU9I 4NOZA 2G2KA 3S16I 1WZNA 4BXXI 2JIOA 4HGZA 1SIWA 3J81b 2J6AA 1VQ51 5A2Qb 1YJN1 1KC82 3GTPI 2NVQI 1YJW1 1VQ81 3RZDI 3PO3I 1QVFY 3S1RI 3CCJ1 4A3BI 2R6MA 2DE6A 1QVGY 5IP7I 2NAPA 2M48A 5C44I 1VQ6Z 4NB8A 2Y0SA 1M1K2 2V3VA 3GTOI 2E2II 3CCL1 1VQ7Z 3K7AI 2OTLZ 4X6AI 4EWCA 1YHQZ 3GCFA 3HOUI 1Y1VI 2P28A 2NVTI 4BY7I 3HOWI 1QXFA 2OTJ1 2YADA 2LFUA
chains in the Genus database with same CATH topology
4RVGA 4MH4A 3G6E1 4E2ZA 1YJWZ 1VQ8Z 4NBEA 1KRLA 3GTMI 1JJ2Z 5T67A 1I6HI 1RNIA 2R93I 3CXCZ 4A3KI 3CCLZ 1W2BZ 1KC81 2OZKA 4A3DI 2AKLA 1TWCI 2R92I 3M3YI 5D1OB 2IZ3A 3GTKI 2QA4Z 1VQLZ 3D6WA 1K732 1USPA 3S1QI 3CC4Z 2JA6I 2LIYA 1M1K1 5T6BA 3S2DI 2QEX1 3CC71 3MONA 1LQLA 3CC21 3CCU1 1Q862 4A3FI 1NP6A 3CCRZ 3CCM1 3G4S1 3HOXI 2JA7I 1VQK1 1VQOZ 4MD8A 1VQNZ 1YJ91 2OOYB 3CCQ1 2Q51A 4RS4A 3NDIA 4NH1C 3GTJI 5AN9F 5LL6f 4A3MI 2QLVB 1S72Z 5C4JI 1N8R2 3IFUA 2GTIA 5IT9f 1QF8A 2W03A 2IZ4A 3CC2Z 2W04A 3CCUZ 1Q822 2WAQA 1VQ4Z 3CCMZ 3G4SZ 4NBHA 1K83I 4DQYB 2M6NA 2Q4ZA 5IT9b 4A3CI 3CME1 3OW2Z 3QWUA 3CD61 1X3WA 3CCE1 1JJ2Y 3FKII 3MZLB 3GTGI 1K9M1 3D9XA 2BJOA 3HOZI 1Q861 4BBSI 3CXCY 1VQP1 2V8IA 4Y52I 2JUBA 1W2BY 2GU2A 1KD12 3S1MI 2QR1B 3CQZI 4NFRA 2NVXI 3H0GI 2GTHA 4MD7A 5IP9I 1YI21 1VQ5Z 2V8JA 3T4NB 1YJNZ 1NJI2 1RLYA 3RZOI 1L1OC 4S1TA 4MRIA 3VB9A 3CCJZ 2R7ZI 5CM2M 3HOVI 1VQ91 3HOYI 2DE7A 4BBRI 3P5JB 1M902 2HU9A 2RHBA 1I3QI 2QREB 3IF8A 1R9TI 3FQQA 4RVHA 1PFTA 1YIJ1 3CMA1 1VQPZ 1I50I 3KIHA 1Q7Y2 1TFIA 3M4OI 2HF1A 4CL1A 3LUSA 2PMZA 2OTJZ 1KQSZ 2F4MA 4E2WA 3VTNA 4NBCA 2JA8I 4MD9A 1RO0A 3G6EZ 2JR6A 2VF1A 4E2XA 3NH5A 1KD11 3FQMA 5D1OA 1JWHC 4E31A 4NBGA 3S14I 3IX0A 1YIT1 4MXUA 3S17I 3OW2Y 3HKZA 2WB1A 2E2HI 4NBBA 1VQ61 1X0TA 1VLAA 1WW9A 3J80f 3CCS1 2QRCB 5FLXf 4TNUA 2QRDB 1VQ71 1WIIA 2PK7A 2OTL1 4Y7NI 2QEXZ 3J81f 1YHQ1 3CC7Z 1ZB8A 3S2HI 4DK1A 1YUKA 2K5RA 2VUMI 3S15I 2E9HA 1K8A2 3Q87A 3I4MI 3ESWA 2B63I 1N2FA 1Z03A 1X3ZA 4RV9A 2JMOA 1P9NA 1K731 2JS4A 3CCV1 1Q7Y1 3J80b 3KIFA 1Z01A 5FLXb 1RO2A 3PO2I 1S7MA 1VQKZ 5T64A 2ZAEB 3VMHA 1YJ9Z 3MZKB 3NH4A 3CCQZ 4NBDA 4DGLA 4XX2A 3BG1B 4HGYA 1YITZ 3JAMf 1TWHI 2OOXB 4E2YA 2DE5A 4RVFA 3CCSZ 2JNYA 1RQFA 1ML8A 1WCMI 3EEDA 2RIQA 1TWAI 3JAMb 1Z02A 4A3JI 3H3VJ 3PO3S 5C3EI 3I551 2QA41 2JA5I 1VQL1 3NDJA 4NB9A 3CC41 1KQSY 2PM9A 3CCVZ 3BG0B 3I561 1QVFZ 2KPIA 3GKQA 3CMEZ 3GTQI 1ZB9A 2QKDA 1Q812 1QVGZ 3CCEZ 4QTUA 1VQM1 1N8R1 3CD6Z 1NUIA 2RBLA 1USPB 2VUGA 1K8A1 1TWGI 2RPRA 3EERA 4HH4A 3CPWY 3I07A 3VMGA 4NBAA 3S1NI 1Q821 3CCR1 4RVDA 1Y1VS 3G711 3GTLI 3J7A4 3I4NI 1QYPA 1YI2Z 1VQO1 2P3YA 1VQN1 4BY1I 4A3GI 2K3RA 2O4HA 2O53A 1SFOI 5C4XI 3TDHB 2KI7B 3I55Z 3GTMS 1VQ9Z 2I3CA 2E2JI 3TE5B 3CPWZ 4QTTA 3I56Z 4A3II 1S721 1TWFI 2V8KA 4A3LI 1VQMZ 4E30A 1Y1WI 1NJI1 1K9M2 4NBFA 2RT9A 2EGTA 3F3PC 4E33A 4A3EI 1YIJZ 3CMAZ 1DL6A 2NVYI 5FLMI 1VQ41 1YUAA 2H85A 3NH8A 4AYBA 1M901 3G71Z 1ZH1A 3F3FC 1Q811 5D1PA 2F4OA 4MONA 3U50C 4A93I 4E32A 1RO4A 3NFZA 5A2Qf 3VMIA 2YU9I 4NOZA 2G2KA 3S16I 4BXXI 4HGZA 3J81b 2J6AA 1VQ51 5A2Qb 1YJN1 1KC82 3GTPI 2NVQI 1YJW1 1VQ81 3RZDI 3PO3I 1QVFY 3S1RI 3CCJ1 4A3BI 2R6MA 2DE6A 1QVGY 5IP7I 2M48A 5C44I 1VQ6Z 4NB8A 2Y0SA 1M1K2 3GTOI 2E2II 3CCL1 1VQ7Z 3K7AI 2OTLZ 4X6AI 4EWCA 1YHQZ 3GCFA 3HOUI 1Y1VI 2P28A 2NVTI 4BY7I 3HOWI 2OTJ1 2YADA 2LFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4X I;  4A3C I;  4NBB A;  3GTM S;  1X3W A;  4MH4 A;  1VLA A;  2E2J I;  4NBE A;  1WW9 A;  3FKI I;  3GTG I;  2PK7 A;  4Y7N I;  3GTM I;  3S2H I;  4QTT A;  1ZB8 A;  4A3I I;  2BJO A;  2K5R A;  2VUM I;  3S15 I;  1I6H I;  3HOZ I;  1TWF I;  4BBS I;  3Q87 A;  3I4M I;  3ESW A;  4A3L I;  2R93 I;  2B63 I;  4Y52 I;  1Y1W I;  1N2F A;  1X3Z A;  4A3K I;  3CQZ I;  3S1M I;  4NBF A;  2NVX I;  2JS4 A;  3H0G I;  4A3D I;  4A3E I;  2AKL A;  5IP9 I;  1DL6 A;  3PO2 I;  2NVY I;  5FLM I;  1TWC I;  1YUA A;  2R92 I;  2E2H I;  3M3Y I;  1RLY A;  3GTK I;  3D6W A;  3RZO I;  1USP A;  1L1O C;  3S1Q I;  3VMH A;  3VB9 A;  2R7Z I;  5CM2 M;  2JA6 I;  3HOV I;  4NBD A;  3HOY I;  2DE7 A;  2F4O A;  3U50 C;  4BBR I;  4XX2 A;  4A93 I;  1RO4 A;  3VMI A;  2YU9 I;  3S2D I;  4NOZ A;  1TWH I;  1I3Q I;  1LQL A;  1R9T I;  3S16 I;  2DE5 A;  4BXX I;  2JNY A;  4A3F I;  1PFT A;  1ML8 A;  1WCM I;  1TWA I;  2J6A A;  3HOX I;  4A3J I;  3H3V J;  3PO3 S;  2JA7 I;  5C3E I;  1I50 I;  1TFI A;  3GTP I;  2JA5 I;  3M4O I;  2NVQ I;  2HF1 A;  4NB9 A;  3RZD I;  3PO3 I;  3S1R I;  3LUS A;  4A3B I;  2F4M A;  2DE6 A;  4NBC A;  2KPI A;  5IP7 I;  3GKQ A;  2JA8 I;  3GTQ I;  5C44 I;  4NB8 A;  1ZB9 A;  3GTJ I;  4QTU A;  1NUI A;  2RBL A;  1USP B;  2JR6 A;  1TWG I;  3EER A;  4A3M I;  2E2I I;  3GTO I;  3K7A I;  3I07 A;  3VMG A;  4NBA A;  4X6A I;  3S1N I;  5C4J I;  3GCF A;  1Y1V S;  3HOU I;  4NBG A;  3GTL I;  3I4N I;  3S14 I;  1Y1V I;  1QYP A;  2P3Y A;  4BY1 I;  2NVT I;  4BY7 I;  4A3G I;  4NBH A;  1K83 I;  3HOW I;  3S17 I;  1SFO I; 
#chains in the Genus database with same CATH topology
 4RVG A;  4MH4 A;  3G6E 1;  4E2Z A;  1YJW Z;  1VQ8 Z;  2VPZ A;  4NBE A;  1KRL A;  3GTM I;  1JJ2 Z;  5T67 A;  1I6H I;  1RNI A;  2R93 I;  3CXC Z;  4A3K I;  3CCL Z;  1W2B Z;  1KC8 1;  2OZK A;  2IV2 X;  4A3D I;  2AKL A;  1TWC I;  2R92 I;  3M3Y I;  5D1O B;  2IZ3 A;  3GTK I;  2QA4 Z;  1VQL Z;  3D6W A;  1K73 2;  1USP A;  3S1Q I;  3CC4 Z;  2JA6 I;  2LIY A;  1M1K 1;  5T6B A;  3S2D I;  2QEX 1;  3CC7 1;  3MON A;  1LQL A;  3CC2 1;  3CCU 1;  1Q86 2;  4A3F I;  1NP6 A;  3CCR Z;  3CCM 1;  3G4S 1;  1FDI A;  3HOX I;  2JA7 I;  1VQK 1;  1VQO Z;  4MD8 A;  1VQN Z;  1YJ9 1;  2OOY B;  3CCQ 1;  2Q51 A;  4RS4 A;  3NDI A;  4NH1 C;  3GTJ I;  5AN9 F;  5LL6 f;  4A3M I;  2QLV B;  1S72 Z;  5C4J I;  1N8R 2;  3IFU A;  2GTI A;  5IT9 f;  1QF8 A;  2W03 A;  2IZ4 A;  3CC2 Z;  2W04 A;  3CCU Z;  1Q82 2;  2WAQ A;  1VQ4 Z;  3CCM Z;  3G4S Z;  4NBH A;  1K83 I;  4DQY B;  2M6N A;  2Q4Z A;  5IT9 b;  4A3C I;  3CME 1;  3OW2 Z;  3QWU A;  3CD6 1;  1X3W A;  3CCE 1;  1JJ2 Y;  3FKI I;  3MZL B;  3GTG I;  1K9M 1;  3D9X A;  2BJO A;  3HOZ I;  1Q86 1;  4BBS I;  3CXC Y;  1VQP 1;  2V8I A;  4Y52 I;  2JUB A;  1W2B Y;  2GU2 A;  1KD1 2;  2JIQ A;  3S1M I;  2QR1 B;  3CQZ I;  4NFR A;  2NVX I;  3H0G I;  2GTH A;  4MD7 A;  5IP9 I;  1YI2 1;  1VQ5 Z;  2V8J A;  3T4N B;  1YJN Z;  1NJI 2;  1RLY A;  3RZO I;  1L1O C;  4S1T A;  4MRI A;  3VB9 A;  3CCJ Z;  2R7Z I;  5CM2 M;  3HOV I;  1VQ9 1;  3HOY I;  2E7Z A;  2DE7 A;  4BBR I;  3P5J B;  1M90 2;  2HU9 A;  2RHB A;  1I3Q I;  2QRE B;  3IF8 A;  1R9T I;  1Y8C A;  3FQQ A;  4RVH A;  1PFT A;  2JIR A;  1YIJ 1;  3CMA 1;  1VQP Z;  1I50 I;  3KIH A;  1Q7Y 2;  1TFI A;  2AYD A;  3M4O I;  2HF1 A;  4CL1 A;  3LUS A;  2PMZ A;  2OTJ Z;  1KQS Z;  2F4M A;  4E2W A;  2LEX A;  3VTN A;  4NBC A;  2JA8 I;  4MD9 A;  1RO0 A;  3G6E Z;  2JR6 A;  1Q16 A;  2VF1 A;  4E2X A;  3NH5 A;  1KD1 1;  3FQM A;  5D1O A;  1JWH C;  4E31 A;  4NBG A;  3S14 I;  3IX0 A;  2VPX A;  1YIT 1;  4MXU A;  1FDO A;  3S17 I;  3OW2 Y;  3HKZ A;  2WB1 A;  2E2H I;  4NBB A;  1VQ6 1;  1X0T A;  1VLA A;  1WW9 A;  3J80 f;  3CCS 1;  2QRC B;  5FLX f;  4TNU A;  2QRD B;  1VQ7 1;  1WII A;  2PK7 A;  2OTL 1;  4Y7N I;  2QEX Z;  3J81 f;  3CC7 Z;  1YHQ 1;  1ZB8 A;  3S2H I;  4DK1 A;  1YUK A;  2K5R A;  2VUM I;  3S15 I;  2E9H A;  1K8A 2;  3Q87 A;  3I4M I;  3ESW A;  2B63 I;  1N2F A;  1Z03 A;  1X3Z A;  4RV9 A;  2JMO A;  1P9N A;  1K73 1;  2JS4 A;  3CCV 1;  1Q7Y 1;  3J80 b;  3KIF A;  1Z01 A;  5FLX b;  1RO2 A;  3PO2 I;  1S7M A;  1VQK Z;  5T64 A;  2ZAE B;  2JIM A;  3VMH A;  1YJ9 Z;  3MZK B;  3NH4 A;  3CCQ Z;  4NBD A;  4DGL A;  4XX2 A;  3BG1 B;  4HGY A;  1YIT Z;  3JAM f;  1TWH I;  2OOX B;  4E2Y A;  2DE5 A;  3D2L A;  4RVF A;  3CCS Z;  1RQF A;  2JNY A;  1ML8 A;  1WCM I;  3EED A;  2RIQ A;  1TWA I;  3JAM b;  1Z02 A;  4A3J I;  3H3V J;  3PO3 S;  5C3E I;  3I55 1;  2QA4 1;  2JA5 I;  1WJ2 A;  1VQL 1;  3NDJ A;  4NB9 A;  3CC4 1;  1KQS Y;  2PM9 A;  3CCV Z;  3BG0 B;  3I56 1;  1QVF Z;  2KPI A;  3GKQ A;  3CME Z;  3GTQ I;  1ZB9 A;  2QKD A;  1Q81 2;  1QVG Z;  3CCE Z;  4QTU A;  1VQM 1;  1N8R 1;  3CD6 Z;  1NUI A;  2V45 A;  2RBL A;  1USP B;  2VUG A;  1K8A 1;  1TWG I;  2RPR A;  3EER A;  4HH4 A;  3CPW Y;  3I07 A;  3VMG A;  4NBA A;  3S1N I;  2JIP A;  1Q82 1;  3CCR 1;  4RVD A;  1Y1V S;  2VPY A;  3G71 1;  3GTL I;  3J7A 4;  3I4N I;  1QYP A;  1YI2 Z;  1VQO 1;  2P3Y A;  1AA6 A;  1VQN 1;  4BY1 I;  4A3G I;  2K3R A;  2O4H A;  2O53 A;  1SFO I;  5C4X I;  2VPW A;  3TDH B;  2KI7 B;  3I55 Z;  3GTM S;  1VQ9 Z;  2I3C A;  2E2J I;  3TE5 B;  3CPW Z;  4QTT A;  3I56 Z;  4A3I I;  1S72 1;  1TWF I;  2V8K A;  4A3L I;  1VQM Z;  4E30 A;  1Y1W I;  1NJI 1;  1K9M 2;  4NBF A;  2RT9 A;  2EGT A;  3F3P C;  4E33 A;  4A3E I;  1YIJ Z;  3CMA Z;  1DL6 A;  2NVY I;  5FLM I;  1VQ4 1;  1YUA A;  2H85 A;  3NH8 A;  4AYB A;  1M90 1;  3G71 Z;  1ZH1 A;  3F3F C;  1Q81 1;  5D1P A;  2F4O A;  4MON A;  3U50 C;  4A93 I;  3IR7 A;  4E32 A;  1RO4 A;  3NFZ A;  5A2Q f;  3VMI A;  2YU9 I;  4NOZ A;  2G2K A;  3S16 I;  1WZN A;  4BXX I;  2JIO A;  4HGZ A;  1SIW A;  3J81 b;  2J6A A;  1VQ5 1;  5A2Q b;  1YJN 1;  1KC8 2;  3GTP I;  2NVQ I;  1YJW 1;  1VQ8 1;  3RZD I;  3PO3 I;  1QVF Y;  3S1R I;  3CCJ 1;  4A3B I;  2R6M A;  2DE6 A;  1QVG Y;  5IP7 I;  2NAP A;  2M48 A;  5C44 I;  1VQ6 Z;  4NB8 A;  2Y0S A;  1M1K 2;  2V3V A;  3GTO I;  2E2I I;  3CCL 1;  1VQ7 Z;  3K7A I;  2OTL Z;  4X6A I;  4EWC A;  1YHQ Z;  3GCF A;  3HOU I;  1Y1V I;  2P28 A;  2NVT I;  4BY7 I;  3HOW I;  1QXF A;  2OTJ 1;  2YAD A;  2LFU A; 
#chains in the Genus database with same CATH homology
 4RVG A;  4MH4 A;  3G6E 1;  4E2Z A;  1YJW Z;  1VQ8 Z;  4NBE A;  1KRL A;  3GTM I;  1JJ2 Z;  5T67 A;  1I6H I;  1RNI A;  2R93 I;  3CXC Z;  4A3K I;  3CCL Z;  1W2B Z;  1KC8 1;  2OZK A;  4A3D I;  2AKL A;  1TWC I;  2R92 I;  3M3Y I;  5D1O B;  2IZ3 A;  3GTK I;  2QA4 Z;  1VQL Z;  3D6W A;  1K73 2;  1USP A;  3S1Q I;  3CC4 Z;  2JA6 I;  2LIY A;  1M1K 1;  5T6B A;  3S2D I;  2QEX 1;  3CC7 1;  3MON A;  1LQL A;  3CC2 1;  3CCU 1;  1Q86 2;  4A3F I;  1NP6 A;  3CCR Z;  3CCM 1;  3G4S 1;  3HOX I;  2JA7 I;  1VQK 1;  1VQO Z;  4MD8 A;  1VQN Z;  1YJ9 1;  2OOY B;  3CCQ 1;  2Q51 A;  4RS4 A;  3NDI A;  4NH1 C;  3GTJ I;  5AN9 F;  5LL6 f;  4A3M I;  2QLV B;  1S72 Z;  5C4J I;  1N8R 2;  3IFU A;  2GTI A;  5IT9 f;  1QF8 A;  2W03 A;  2IZ4 A;  3CC2 Z;  2W04 A;  3CCU Z;  1Q82 2;  2WAQ A;  1VQ4 Z;  3CCM Z;  3G4S Z;  4NBH A;  1K83 I;  4DQY B;  2M6N A;  2Q4Z A;  5IT9 b;  4A3C I;  3CME 1;  3OW2 Z;  3QWU A;  3CD6 1;  1X3W A;  3CCE 1;  1JJ2 Y;  3FKI I;  3MZL B;  3GTG I;  1K9M 1;  3D9X A;  2BJO A;  3HOZ I;  1Q86 1;  4BBS I;  3CXC Y;  1VQP 1;  2V8I A;  4Y52 I;  2JUB A;  1W2B Y;  2GU2 A;  1KD1 2;  3S1M I;  2QR1 B;  3CQZ I;  4NFR A;  2NVX I;  3H0G I;  2GTH A;  4MD7 A;  5IP9 I;  1YI2 1;  1VQ5 Z;  2V8J A;  3T4N B;  1YJN Z;  1NJI 2;  1RLY A;  3RZO I;  1L1O C;  4S1T A;  4MRI A;  3VB9 A;  3CCJ Z;  2R7Z I;  5CM2 M;  3HOV I;  1VQ9 1;  3HOY I;  2DE7 A;  4BBR I;  3P5J B;  1M90 2;  2HU9 A;  2RHB A;  1I3Q I;  2QRE B;  3IF8 A;  1R9T I;  3FQQ A;  4RVH A;  1PFT A;  1YIJ 1;  3CMA 1;  1VQP Z;  1I50 I;  3KIH A;  1Q7Y 2;  1TFI A;  3M4O I;  2HF1 A;  4CL1 A;  3LUS A;  2PMZ A;  2OTJ Z;  1KQS Z;  2F4M A;  4E2W A;  3VTN A;  4NBC A;  2JA8 I;  4MD9 A;  1RO0 A;  3G6E Z;  2JR6 A;  2VF1 A;  4E2X A;  3NH5 A;  1KD1 1;  3FQM A;  5D1O A;  1JWH C;  4E31 A;  4NBG A;  3S14 I;  3IX0 A;  1YIT 1;  4MXU A;  3S17 I;  3OW2 Y;  3HKZ A;  2WB1 A;  2E2H I;  4NBB A;  1VQ6 1;  1X0T A;  1VLA A;  1WW9 A;  3J80 f;  3CCS 1;  2QRC B;  5FLX f;  4TNU A;  2QRD B;  1VQ7 1;  1WII A;  2PK7 A;  2OTL 1;  4Y7N I;  2QEX Z;  3J81 f;  1YHQ 1;  3CC7 Z;  1ZB8 A;  3S2H I;  4DK1 A;  1YUK A;  2K5R A;  2VUM I;  3S15 I;  2E9H A;  1K8A 2;  3Q87 A;  3I4M I;  3ESW A;  2B63 I;  1N2F A;  1Z03 A;  1X3Z A;  4RV9 A;  2JMO A;  1P9N A;  1K73 1;  2JS4 A;  3CCV 1;  1Q7Y 1;  3J80 b;  3KIF A;  1Z01 A;  5FLX b;  1RO2 A;  3PO2 I;  1S7M A;  1VQK Z;  5T64 A;  2ZAE B;  3VMH A;  1YJ9 Z;  3MZK B;  3NH4 A;  3CCQ Z;  4NBD A;  4DGL A;  4XX2 A;  3BG1 B;  4HGY A;  1YIT Z;  3JAM f;  1TWH I;  2OOX B;  4E2Y A;  2DE5 A;  4RVF A;  3CCS Z;  2JNY A;  1RQF A;  1ML8 A;  1WCM I;  3EED A;  2RIQ A;  1TWA I;  3JAM b;  1Z02 A;  4A3J I;  3H3V J;  3PO3 S;  5C3E I;  3I55 1;  2QA4 1;  2JA5 I;  1VQL 1;  3NDJ A;  4NB9 A;  3CC4 1;  1KQS Y;  2PM9 A;  3CCV Z;  3BG0 B;  3I56 1;  1QVF Z;  2KPI A;  3GKQ A;  3CME Z;  3GTQ I;  1ZB9 A;  2QKD A;  1Q81 2;  1QVG Z;  3CCE Z;  4QTU A;  1VQM 1;  1N8R 1;  3CD6 Z;  1NUI A;  2RBL A;  1USP B;  2VUG A;  1K8A 1;  1TWG I;  2RPR A;  3EER A;  4HH4 A;  3CPW Y;  3I07 A;  3VMG A;  4NBA A;  3S1N I;  1Q82 1;  3CCR 1;  4RVD A;  1Y1V S;  3G71 1;  3GTL I;  3J7A 4;  3I4N I;  1QYP A;  1YI2 Z;  1VQO 1;  2P3Y A;  1VQN 1;  4BY1 I;  4A3G I;  2K3R A;  2O4H A;  2O53 A;  1SFO I;  5C4X I;  3TDH B;  2KI7 B;  3I55 Z;  3GTM S;  1VQ9 Z;  2I3C A;  2E2J I;  3TE5 B;  3CPW Z;  4QTT A;  3I56 Z;  4A3I I;  1S72 1;  1TWF I;  2V8K A;  4A3L I;  1VQM Z;  4E30 A;  1Y1W I;  1NJI 1;  1K9M 2;  4NBF A;  2RT9 A;  2EGT A;  3F3P C;  4E33 A;  4A3E I;  1YIJ Z;  3CMA Z;  1DL6 A;  2NVY I;  5FLM I;  1VQ4 1;  1YUA A;  2H85 A;  3NH8 A;  4AYB A;  1M90 1;  3G71 Z;  1ZH1 A;  3F3F C;  1Q81 1;  5D1P A;  2F4O A;  4MON A;  3U50 C;  4A93 I;  4E32 A;  1RO4 A;  3NFZ A;  5A2Q f;  3VMI A;  2YU9 I;  4NOZ A;  2G2K A;  3S16 I;  4BXX I;  4HGZ A;  3J81 b;  2J6A A;  1VQ5 1;  5A2Q b;  1YJN 1;  1KC8 2;  3GTP I;  2NVQ I;  1YJW 1;  1VQ8 1;  3RZD I;  3PO3 I;  1QVF Y;  3S1R I;  3CCJ 1;  4A3B I;  2R6M A;  2DE6 A;  1QVG Y;  5IP7 I;  2M48 A;  5C44 I;  1VQ6 Z;  4NB8 A;  2Y0S A;  1M1K 2;  3GTO I;  2E2I I;  3CCL 1;  1VQ7 Z;  3K7A I;  2OTL Z;  4X6A I;  4EWC A;  1YHQ Z;  3GCF A;  3HOU I;  1Y1V I;  2P28 A;  2NVT I;  4BY7 I;  3HOW I;  2OTJ 1;  2YAD A;  2LFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...