1Q822

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q82200
1K731 1VQ91 1NJI2 1VQP1 3I56Z 1K732 1M1K1 3CCJZ 3CMAZ 3CC41 1N8R1 1VQ51 3CCE1 1VQ9Z 1YJ91 1VQPZ 2OTL1 1Q7Y1 3G711 1YJWZ 3CC4Z 1YJN1 2OTLZ 3G71Z 3CC71 2QEXZ 1JJ2Y 3CCU1 1YJNZ 1VQKZ 1NJI1 1VQL1 3CXCY 3CCR1 3CC21 1VQMZ 1VQ8Z 1K8A2 1VQO1 3CC7Z 3CCQZ 3CCUZ 1YJW1 1JJ2Z 1VQLZ 3CCRZ 3CCLZ 3CC2Z 1VQN1 3CXCZ 3CME1 1VQOZ 1QVGY 3CD61 1M902 1S721 2QEX1 3I551 1VQ71 1VQK1 2OTJ1 1Q812 1VQ41 1K9M2 3CCS1 1VQNZ 3CMEZ 1VQM1 1VQ81 1VQ61 3CD6Z 1QVGZ 1YIJ1 1S72Z 3CCQ1 1YIT1 3I55Z 1VQ7Z 2OTJZ 3G4S1 1VQ4Z 1K8A1 1KQSY 3CCSZ 3CCL1 1VQ6Z 3OW2Y 1KD12 1YIJZ 1YITZ 3G4SZ 1KQSZ 1M901 3CPWY 3G6E1 1Q822 1YHQ1 3OW2Z 1Q811 1KC82 1Q861 1K9M1 1QVFY 3CCMZ 1Q862 3G6EZ 3CPWZ 1YHQZ 1W2BY 1M1K2 1QVFZ 1KD11 1N8R2 1YI21 3CCV1 2QA41 1Q7Y2 3CCM1 1VQ5Z 3CCEZ 1W2BZ 1Q821 1YI2Z 1YJ9Z 3CCVZ 1KC81 3I561 3CCJ1 2QA4Z 3CMA1
chains in the Genus database with same CATH superfamily
4A3MI 3I56Z 4MD8A 1M1K1 2JA7I 3CMAZ 1VQ51 5C3EI 1AA6A 3HOUI 1Y1WI 5T6BA 3NH8A 3CQZI 4E32A 1NUIA 3QWUA 1YJN1 3IR7A 5T64A 3S1QI 3GTKI 2V8KA 2QEXZ 3I4NI 1NJI1 2Q51A 4TNUA 2I3CA 4NBGA 3CCUZ 2JUBA 1TWAI 1JJ2Z 4X6AI 3CCLZ 2JMOA 4E2XA 1Y1VS 3CXCZ 3J7A4 2O53A 2OTJ1 1VQ71 3NH5A 1I3QI 1USPB 3D9XA 3CCS1 3CMEZ 1TWHI 3CD6Z 3JAMb 3CCQ1 3I55Z 3I4MI 4MXUA 5IT9b 2B63I 2HU9A 1YITZ 3MONA 2GTHA 5C4JI 1ML8A 2QREB 2R7ZI 2JA6I 2E9HA 1TWGI 3CPWY 1RLYA 5C4XI 1Q822 1YHQ1 4A3DI 3OW2Z 2GTIA 4A3CI 2DE5A 3H0GI 4RVHA 2WB1A 3CCMZ 4MONA 4A3KI 1Y1VI 4Y52I 2E2II 3G6EZ 3GTQI 1SIWA 2VPWA 3LUSA 1M1K2 4EWCA 1QVFZ 4NB9A 1KD11 3S2HI 4A3II 3HOYI 1NP6A 4A3LI 1I6HI 1Q16A 1X3ZA 1S7MA 4MH4A 3CCEZ 2VPXA 1YI2Z 2OOXB 3I561 1K83I 5C44I 2QR1B 4QTTA 3J81b 2QA4Z 2E7ZA 1LQLA 3CMA1 2RPRA 1KRLA 1QYPA 1K731 1QF8A 3JAMf 1NJI2 4HGYA 4S1TA 3H3VJ 3CCJZ 2RIQA 3BG0B 3EEDA 4CL1A 1ZB9A 3RZOI 2RHBA 2JIOA 1YJWZ 1L1OC 3CC4Z 5AN9F 2OTLZ 1FDIA 3G71Z 3CCU1 1VQKZ 3NH4A 1TFIA 3F3FC 2JR6A 2LIYA 2EGTA 1VQ8Z 1RQFA 2Y0SA 2JA5I 3GTGI 1VQLZ 2QLVB 3CC2Z 1WZNA 3CME1 1VQOZ 4NBCA 1I50I 3CD61 2R6MA 3I551 3PO3I 2QRDB 2ZAEB 3VMGA 2JNYA 3FQQA 2LEXA 1VQM1 3P5JB 3J81f 2W04A 1QVGZ 3KIHA 1YIT1 3GTMS 4A3BI 1VQ4Z 2PK7A 1K8A1 1KQSY 1TWFI 2R93I 1KD12 4NBAA 5CM2M 1YIJZ 3MZKB 3G4SZ 3S1RI 2P3YA 3S16I 3S2DI 1R9TI 1M901 3D6WA 3G6E1 2NVQI 4MRIA 3GKQA 1RO2A 2YU9I 3RZDI 4DGLA 1Q862 1X3WA 3VTNA 3TDHB 1RO4A 1YUAA 3S15I 4BXXI 2VPYA 1YI21 2PM9A 2QRCB 3GTMI 2QA41 1WIIA 1VQ5Z 1N2FA 3J80b 1W2BZ 4DQYB 2LFUA 1X0TA 1WW9A 1Z02A 3VMIA 4RV9A 3CCJ1 3NDIA 2KPIA 2E2JI 1Z03A 3M3YI 3KIFA 1RO0A 3HOXI 2OOYB 3ESWA 3CC41 2JIRA 4A3GI 2WAQA 2Q4ZA 2DE7A 2PMZA 1VQ9Z 1YJ91 1VQPZ 4MD7A 2M48A 2JIPA 2OTL1 3G711 4A3FI 3VMHA 3T4NB 4RVFA 3S17I 5IP9I 4A3EI 1JJ2Y 4HH4A 2VUGA 4NBEA 5D1PA 1VQL1 1QXFA 3CXCY 3CC21 1K8A2 1VQO1 3CC7Z 3CCQZ 3PO3S 5IT9f 3CCRZ 2JIMA 2V8IA 3FQMA 4NBDA 3EERA 3HOWI 4RVGA 2RBLA 1M902 2QEX1 4E2WA 1VQ41 4E33A 5T67A 1VQNZ 2K5RA 1YIJ1 5FLMI 1S72Z 3G4S1 2F4MA 1WJ2A 2NVYI 3CCL1 1SFOI 4A93I 1VQ6Z 3OW2Y 3NDJA 1RNIA 1P9NA 5IP7I 1TWCI 3IX0A 3S1MI 4E30A 3GTPI 1Q811 2YADA 1K9M1 1Z01A 1QVFY 2NVTI 3HOZI 3D2LA 3CPWZ 5A2Qb 3PO2I 4RS4A 3IFUA 3I07A 1PFTA 2VPZA 1ZH1A 4HGZA 2VUMI 3CCM1 3CCVZ 1KC81 4BBRI 3GTJI 4A3JI 1VQ91 1VQP1 4NBHA 1K732 3U50C 2NAPA 1DL6A 2IZ4A 3FKII 1N8R1 3CCE1 4NFRA 4NB8A 4BY1I 5FLXb 2GU2A 2K3RA 1Q7Y1 1WCMI 2G2KA 2JS4A 2W03A 4RVDA 2V8JA 3NFZA 3S1NI 4XX2A 3CC71 2O4HA 1YJNZ 2AYDA 4E31A 3CCR1 5A2Qf 1VQMZ 4QTUA 2E2HI 2IZ3A 1YJW1 4AYBA 2R92I 2JA8I 4MD9A 4BY7I 3TE5B 5D1OA 3S14I 3K7AI 4NOZA 5LL6f 1VQN1 3HOVI 2KI7B 1QVGY 2BJOA 2OZKA 2QKDA 2IV2X 1S721 2V3VA 1VQK1 2DE6A 3HKZA 1Q812 2F4OA 1K9M2 1VQ81 2H85A 1VQ61 2OTJZ 1VQ7Z 1JWHC 3CCSZ 2JIQA 4NBBA 4NBFA 4E2YA 2P28A 1Y8CA 5FLXf 4DK1A 4NH1C 4Y7NI 1KQSZ 1VLAA 3J80f 1KC82 1Q861 2J6AA 2RT9A 3GCFA 1FDOA 2VF1A 4BBSI 1YHQZ 3MZLB 1YUKA 1W2BY 3VB9A 1N8R2 3CCV1 3Q87A 2NVXI 3GTOI 3F3PC 2AKLA 1USPA 1Q7Y2 1Q821 2M6NA 1YJ9Z 3BG1B 1ZB8A 3IF8A 5D1OB 3M4OI 2HF1A 2V45A 3GTLI 4E2ZA
chains in the Genus database with same CATH topology
4A3MI 3I56Z 4MD8A 1M1K1 2JA7I 3CMAZ 1VQ51 5C3EI 3HOUI 1Y1WI 5T6BA 3NH8A 3CQZI 4E32A 1NUIA 3QWUA 1YJN1 5T64A 3S1QI 3GTKI 2V8KA 2QEXZ 3I4NI 1NJI1 2Q51A 4TNUA 2I3CA 4NBGA 3CCUZ 2JUBA 1TWAI 1JJ2Z 4X6AI 3CCLZ 2JMOA 4E2XA 1Y1VS 3CXCZ 3J7A4 2O53A 2OTJ1 1VQ71 3NH5A 1I3QI 1USPB 3D9XA 3CCS1 3CMEZ 1TWHI 3CD6Z 3JAMb 3CCQ1 3I55Z 3I4MI 4MXUA 5IT9b 2B63I 2HU9A 1YITZ 3MONA 2GTHA 5C4JI 1ML8A 2QREB 2R7ZI 2JA6I 2E9HA 1TWGI 3CPWY 1RLYA 5C4XI 1Q822 1YHQ1 4A3DI 3OW2Z 2GTIA 4A3CI 2DE5A 3H0GI 4RVHA 2WB1A 3CCMZ 4MONA 4A3KI 1Y1VI 4Y52I 2E2II 3G6EZ 3GTQI 3LUSA 1M1K2 4EWCA 1QVFZ 4NB9A 1KD11 3S2HI 4A3II 3HOYI 1NP6A 4A3LI 1I6HI 1X3ZA 1S7MA 4MH4A 3CCEZ 1YI2Z 2OOXB 3I561 1K83I 5C44I 2QR1B 4QTTA 3J81b 2QA4Z 1LQLA 3CMA1 2RPRA 1KRLA 1QYPA 1K731 1QF8A 3JAMf 1NJI2 4HGYA 4S1TA 3H3VJ 3CCJZ 2RIQA 3BG0B 3EEDA 4CL1A 1ZB9A 3RZOI 2RHBA 1YJWZ 1L1OC 3CC4Z 5AN9F 2OTLZ 3G71Z 3CCU1 1VQKZ 3NH4A 1TFIA 3F3FC 2JR6A 2LIYA 2EGTA 1VQ8Z 1RQFA 2Y0SA 2JA5I 3GTGI 1VQLZ 2QLVB 3CC2Z 3CME1 1VQOZ 4NBCA 1I50I 3CD61 2R6MA 3I551 3PO3I 2QRDB 2ZAEB 3VMGA 2JNYA 3FQQA 1VQM1 3P5JB 3J81f 2W04A 1QVGZ 3KIHA 1YIT1 3GTMS 4A3BI 1VQ4Z 2PK7A 1K8A1 1KQSY 1TWFI 2R93I 1KD12 4NBAA 5CM2M 1YIJZ 3MZKB 3G4SZ 3S1RI 2P3YA 3S16I 3S2DI 1R9TI 1M901 3D6WA 3G6E1 2NVQI 4MRIA 3GKQA 1RO2A 2YU9I 3RZDI 4DGLA 1Q862 1X3WA 3VTNA 3TDHB 1RO4A 1YUAA 3S15I 4BXXI 1YI21 2PM9A 2QRCB 3GTMI 2QA41 1WIIA 1VQ5Z 1N2FA 3J80b 1W2BZ 4DQYB 2LFUA 1X0TA 1WW9A 1Z02A 3VMIA 4RV9A 3CCJ1 3NDIA 2KPIA 2E2JI 1Z03A 3M3YI 3KIFA 1RO0A 3HOXI 2OOYB 3ESWA 3CC41 4A3GI 2WAQA 2Q4ZA 2DE7A 2PMZA 1VQ9Z 1YJ91 1VQPZ 4MD7A 2M48A 2OTL1 3G711 4A3FI 3VMHA 3T4NB 4RVFA 3S17I 5IP9I 4A3EI 1JJ2Y 4HH4A 2VUGA 4NBEA 5D1PA 1VQL1 3CXCY 3CC21 1K8A2 1VQO1 3CC7Z 3CCQZ 3PO3S 5IT9f 3CCRZ 2V8IA 3FQMA 4NBDA 3EERA 3HOWI 4RVGA 2RBLA 1M902 2QEX1 4E2WA 1VQ41 4E33A 5T67A 1VQNZ 2K5RA 1YIJ1 5FLMI 1S72Z 3G4S1 2F4MA 2NVYI 3CCL1 1SFOI 4A93I 1VQ6Z 3OW2Y 3NDJA 1RNIA 1P9NA 5IP7I 1TWCI 3IX0A 3S1MI 4E30A 3GTPI 1Q811 2YADA 1K9M1 1Z01A 1QVFY 2NVTI 3HOZI 3CPWZ 5A2Qb 3PO2I 4RS4A 3IFUA 3I07A 1PFTA 1ZH1A 4HGZA 2VUMI 3CCM1 3CCVZ 1KC81 4BBRI 3GTJI 4A3JI 1VQ91 1VQP1 4NBHA 1K732 3U50C 1DL6A 2IZ4A 3FKII 1N8R1 3CCE1 4NFRA 4NB8A 4BY1I 5FLXb 2GU2A 2K3RA 1Q7Y1 1WCMI 2G2KA 2JS4A 2W03A 4RVDA 2V8JA 3NFZA 3S1NI 4XX2A 3CC71 2O4HA 1YJNZ 4E31A 3CCR1 5A2Qf 1VQMZ 4QTUA 2E2HI 2IZ3A 1YJW1 4AYBA 2R92I 2JA8I 4MD9A 4BY7I 3TE5B 5D1OA 3S14I 3K7AI 4NOZA 5LL6f 1VQN1 3HOVI 2KI7B 1QVGY 2BJOA 2OZKA 2QKDA 1S721 1VQK1 2DE6A 3HKZA 1Q812 2F4OA 1K9M2 1VQ81 2H85A 1VQ61 2OTJZ 1VQ7Z 1JWHC 3CCSZ 4NBBA 4NBFA 4E2YA 2P28A 5FLXf 4DK1A 4NH1C 4Y7NI 1KQSZ 1VLAA 3J80f 1KC82 1Q861 2J6AA 2RT9A 3GCFA 2VF1A 4BBSI 1YHQZ 3MZLB 1YUKA 1W2BY 3VB9A 1N8R2 3CCV1 3Q87A 2NVXI 3GTOI 3F3PC 2AKLA 1USPA 1Q7Y2 1Q821 2M6NA 1YJ9Z 3BG1B 1ZB8A 3IF8A 5D1OB 3M4OI 2HF1A 3GTLI 4E2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 1;  1VQ9 1;  1NJI 2;  1VQP 1;  3I56 Z;  1K73 2;  1M1K 1;  3CCJ Z;  3CMA Z;  3CC4 1;  1N8R 1;  1VQ5 1;  3CCE 1;  1VQ9 Z;  1YJ9 1;  1VQP Z;  2OTL 1;  1Q7Y 1;  3G71 1;  1YJW Z;  3CC4 Z;  1YJN 1;  2OTL Z;  3G71 Z;  3CC7 1;  2QEX Z;  1JJ2 Y;  3CCU 1;  1YJN Z;  1VQK Z;  1NJI 1;  1VQL 1;  3CXC Y;  3CCR 1;  3CC2 1;  1VQM Z;  1VQ8 Z;  1K8A 2;  1VQO 1;  3CC7 Z;  3CCQ Z;  3CCU Z;  1YJW 1;  1JJ2 Z;  1VQL Z;  3CCR Z;  3CCL Z;  3CC2 Z;  1VQN 1;  3CXC Z;  3CME 1;  1VQO Z;  1QVG Y;  3CD6 1;  1M90 2;  1S72 1;  2QEX 1;  3I55 1;  1VQ7 1;  1VQK 1;  2OTJ 1;  1Q81 2;  1VQ4 1;  1K9M 2;  3CCS 1;  1VQN Z;  3CME Z;  1VQM 1;  1VQ8 1;  1VQ6 1;  3CD6 Z;  1QVG Z;  1YIJ 1;  1S72 Z;  3CCQ 1;  1YIT 1;  3I55 Z;  1VQ7 Z;  2OTJ Z;  3G4S 1;  1VQ4 Z;  1K8A 1;  1KQS Y;  3CCS Z;  3CCL 1;  1VQ6 Z;  3OW2 Y;  1KD1 2;  1YIJ Z;  1YIT Z;  3G4S Z;  1KQS Z;  1M90 1;  3CPW Y;  3G6E 1;  1Q82 2;  1YHQ 1;  3OW2 Z;  1Q81 1;  1KC8 2;  1Q86 1;  1K9M 1;  1QVF Y;  3CCM Z;  1Q86 2;  3G6E Z;  3CPW Z;  1YHQ Z;  1W2B Y;  1M1K 2;  1QVF Z;  1KD1 1;  1N8R 2;  1YI2 1;  3CCV 1;  2QA4 1;  1Q7Y 2;  3CCM 1;  1VQ5 Z;  3CCE Z;  1W2B Z;  1Q82 1;  1YI2 Z;  1YJ9 Z;  3CCV Z;  1KC8 1;  3I56 1;  3CCJ 1;  2QA4 Z;  3CMA 1; 
#chains in the Genus database with same CATH topology
 4A3M I;  3I56 Z;  4MD8 A;  1M1K 1;  2JA7 I;  3CMA Z;  1VQ5 1;  5C3E I;  1AA6 A;  3HOU I;  1Y1W I;  5T6B A;  3NH8 A;  3CQZ I;  4E32 A;  1NUI A;  3QWU A;  1YJN 1;  3IR7 A;  5T64 A;  3S1Q I;  3GTK I;  2V8K A;  2QEX Z;  3I4N I;  1NJI 1;  2Q51 A;  4TNU A;  2I3C A;  4NBG A;  3CCU Z;  2JUB A;  1TWA I;  1JJ2 Z;  4X6A I;  3CCL Z;  2JMO A;  4E2X A;  1Y1V S;  3CXC Z;  3J7A 4;  2O53 A;  2OTJ 1;  1VQ7 1;  3NH5 A;  1I3Q I;  1USP B;  3D9X A;  3CCS 1;  3CME Z;  1TWH I;  3CD6 Z;  3JAM b;  3CCQ 1;  3I55 Z;  3I4M I;  4MXU A;  5IT9 b;  2B63 I;  2HU9 A;  1YIT Z;  3MON A;  2GTH A;  5C4J I;  1ML8 A;  2QRE B;  2R7Z I;  2JA6 I;  2E9H A;  1TWG I;  3CPW Y;  1RLY A;  5C4X I;  1Q82 2;  1YHQ 1;  4A3D I;  3OW2 Z;  2GTI A;  4A3C I;  2DE5 A;  3H0G I;  4RVH A;  2WB1 A;  3CCM Z;  4MON A;  4A3K I;  1Y1V I;  4Y52 I;  2E2I I;  3G6E Z;  3GTQ I;  1SIW A;  2VPW A;  3LUS A;  1M1K 2;  4EWC A;  1QVF Z;  4NB9 A;  1KD1 1;  3S2H I;  4A3I I;  3HOY I;  1NP6 A;  4A3L I;  1I6H I;  1Q16 A;  1X3Z A;  1S7M A;  4MH4 A;  3CCE Z;  2VPX A;  1YI2 Z;  2OOX B;  3I56 1;  1K83 I;  5C44 I;  2QR1 B;  4QTT A;  3J81 b;  2QA4 Z;  2E7Z A;  1LQL A;  3CMA 1;  2RPR A;  1KRL A;  1QYP A;  1K73 1;  1QF8 A;  3JAM f;  1NJI 2;  4HGY A;  4S1T A;  3H3V J;  3CCJ Z;  2RIQ A;  3BG0 B;  3EED A;  4CL1 A;  1ZB9 A;  3RZO I;  2RHB A;  2JIO A;  1YJW Z;  1L1O C;  3CC4 Z;  5AN9 F;  2OTL Z;  1FDI A;  3G71 Z;  3CCU 1;  1VQK Z;  3NH4 A;  1TFI A;  3F3F C;  2JR6 A;  2LIY A;  2EGT A;  1VQ8 Z;  1RQF A;  2Y0S A;  2JA5 I;  3GTG I;  1VQL Z;  2QLV B;  3CC2 Z;  1WZN A;  3CME 1;  1VQO Z;  4NBC A;  1I50 I;  3CD6 1;  2R6M A;  3I55 1;  3PO3 I;  2QRD B;  2ZAE B;  3VMG A;  2JNY A;  3FQQ A;  2LEX A;  1VQM 1;  3P5J B;  3J81 f;  2W04 A;  1QVG Z;  3KIH A;  1YIT 1;  3GTM S;  4A3B I;  1VQ4 Z;  2PK7 A;  1K8A 1;  1KQS Y;  1TWF I;  2R93 I;  1KD1 2;  4NBA A;  5CM2 M;  1YIJ Z;  3MZK B;  3G4S Z;  3S1R I;  2P3Y A;  3S16 I;  3S2D I;  1R9T I;  1M90 1;  3D6W A;  3G6E 1;  2NVQ I;  4MRI A;  3GKQ A;  1RO2 A;  2YU9 I;  3RZD I;  4DGL A;  1Q86 2;  1X3W A;  3VTN A;  3TDH B;  1RO4 A;  1YUA A;  3S15 I;  4BXX I;  2VPY A;  1YI2 1;  2PM9 A;  2QRC B;  3GTM I;  2QA4 1;  1WII A;  1VQ5 Z;  1N2F A;  3J80 b;  1W2B Z;  4DQY B;  2LFU A;  1X0T A;  1WW9 A;  1Z02 A;  3VMI A;  4RV9 A;  3CCJ 1;  3NDI A;  2KPI A;  2E2J I;  1Z03 A;  3M3Y I;  3KIF A;  1RO0 A;  3HOX I;  2OOY B;  3ESW A;  3CC4 1;  2JIR A;  4A3G I;  2WAQ A;  2Q4Z A;  2DE7 A;  2PMZ A;  1VQ9 Z;  1YJ9 1;  1VQP Z;  4MD7 A;  2M48 A;  2JIP A;  2OTL 1;  3G71 1;  4A3F I;  3VMH A;  3T4N B;  4RVF A;  3S17 I;  5IP9 I;  4A3E I;  1JJ2 Y;  4HH4 A;  2VUG A;  4NBE A;  5D1P A;  1VQL 1;  1QXF A;  3CXC Y;  3CC2 1;  1K8A 2;  1VQO 1;  3CC7 Z;  3CCQ Z;  3PO3 S;  5IT9 f;  3CCR Z;  2JIM A;  2V8I A;  3FQM A;  4NBD A;  3EER A;  3HOW I;  4RVG A;  2RBL A;  1M90 2;  2QEX 1;  4E2W A;  1VQ4 1;  4E33 A;  5T67 A;  1VQN Z;  2K5R A;  1YIJ 1;  5FLM I;  1S72 Z;  3G4S 1;  2F4M A;  1WJ2 A;  2NVY I;  3CCL 1;  1SFO I;  4A93 I;  1VQ6 Z;  3OW2 Y;  3NDJ A;  1RNI A;  1P9N A;  5IP7 I;  1TWC I;  3IX0 A;  3S1M I;  4E30 A;  3GTP I;  1Q81 1;  2YAD A;  1K9M 1;  1Z01 A;  1QVF Y;  2NVT I;  3HOZ I;  3D2L A;  3CPW Z;  5A2Q b;  3PO2 I;  4RS4 A;  3IFU A;  3I07 A;  1PFT A;  2VPZ A;  1ZH1 A;  4HGZ A;  2VUM I;  3CCM 1;  3CCV Z;  1KC8 1;  4BBR I;  3GTJ I;  4A3J I;  1VQ9 1;  1VQP 1;  4NBH A;  1K73 2;  3U50 C;  2NAP A;  1DL6 A;  2IZ4 A;  3FKI I;  1N8R 1;  3CCE 1;  4NFR A;  4NB8 A;  4BY1 I;  5FLX b;  2GU2 A;  2K3R A;  1Q7Y 1;  1WCM I;  2G2K A;  2JS4 A;  2W03 A;  4RVD A;  2V8J A;  3NFZ A;  3S1N I;  4XX2 A;  3CC7 1;  2O4H A;  1YJN Z;  2AYD A;  4E31 A;  3CCR 1;  5A2Q f;  1VQM Z;  4QTU A;  2E2H I;  2IZ3 A;  1YJW 1;  4AYB A;  2R92 I;  2JA8 I;  4MD9 A;  4BY7 I;  3TE5 B;  5D1O A;  3S14 I;  3K7A I;  4NOZ A;  5LL6 f;  1VQN 1;  3HOV I;  2KI7 B;  1QVG Y;  2BJO A;  2OZK A;  2QKD A;  2IV2 X;  1S72 1;  2V3V A;  1VQK 1;  2DE6 A;  3HKZ A;  1Q81 2;  2F4O A;  1K9M 2;  1VQ8 1;  2H85 A;  1VQ6 1;  2OTJ Z;  1VQ7 Z;  1JWH C;  3CCS Z;  2JIQ A;  4NBB A;  4NBF A;  4E2Y A;  2P28 A;  1Y8C A;  5FLX f;  4DK1 A;  4NH1 C;  4Y7N I;  1KQS Z;  1VLA A;  3J80 f;  1KC8 2;  1Q86 1;  2J6A A;  2RT9 A;  3GCF A;  1FDO A;  2VF1 A;  4BBS I;  1YHQ Z;  3MZL B;  1YUK A;  1W2B Y;  3VB9 A;  1N8R 2;  3CCV 1;  3Q87 A;  2NVX I;  3GTO I;  3F3P C;  2AKL A;  1USP A;  1Q7Y 2;  1Q82 1;  2M6N A;  1YJ9 Z;  3BG1 B;  1ZB8 A;  3IF8 A;  5D1O B;  3M4O I;  2HF1 A;  2V45 A;  3GTL I;  4E2Z A; 
#chains in the Genus database with same CATH homology
 4A3M I;  3I56 Z;  4MD8 A;  1M1K 1;  2JA7 I;  3CMA Z;  1VQ5 1;  5C3E I;  3HOU I;  1Y1W I;  5T6B A;  3NH8 A;  3CQZ I;  4E32 A;  1NUI A;  3QWU A;  1YJN 1;  5T64 A;  3S1Q I;  3GTK I;  2V8K A;  2QEX Z;  3I4N I;  1NJI 1;  2Q51 A;  4TNU A;  2I3C A;  4NBG A;  3CCU Z;  2JUB A;  1TWA I;  1JJ2 Z;  4X6A I;  3CCL Z;  2JMO A;  4E2X A;  1Y1V S;  3CXC Z;  3J7A 4;  2O53 A;  2OTJ 1;  1VQ7 1;  3NH5 A;  1I3Q I;  1USP B;  3D9X A;  3CCS 1;  3CME Z;  1TWH I;  3CD6 Z;  3JAM b;  3CCQ 1;  3I55 Z;  3I4M I;  4MXU A;  5IT9 b;  2B63 I;  2HU9 A;  1YIT Z;  3MON A;  2GTH A;  5C4J I;  1ML8 A;  2QRE B;  2R7Z I;  2JA6 I;  2E9H A;  1TWG I;  3CPW Y;  1RLY A;  5C4X I;  1Q82 2;  1YHQ 1;  4A3D I;  3OW2 Z;  2GTI A;  4A3C I;  2DE5 A;  3H0G I;  4RVH A;  2WB1 A;  3CCM Z;  4MON A;  4A3K I;  1Y1V I;  4Y52 I;  2E2I I;  3G6E Z;  3GTQ I;  3LUS A;  1M1K 2;  4EWC A;  1QVF Z;  4NB9 A;  1KD1 1;  3S2H I;  4A3I I;  3HOY I;  1NP6 A;  4A3L I;  1I6H I;  1X3Z A;  1S7M A;  4MH4 A;  3CCE Z;  1YI2 Z;  2OOX B;  3I56 1;  1K83 I;  5C44 I;  2QR1 B;  4QTT A;  3J81 b;  2QA4 Z;  1LQL A;  3CMA 1;  2RPR A;  1KRL A;  1QYP A;  1K73 1;  1QF8 A;  3JAM f;  1NJI 2;  4HGY A;  4S1T A;  3H3V J;  3CCJ Z;  2RIQ A;  3BG0 B;  3EED A;  4CL1 A;  1ZB9 A;  3RZO I;  2RHB A;  1YJW Z;  1L1O C;  3CC4 Z;  5AN9 F;  2OTL Z;  3G71 Z;  3CCU 1;  1VQK Z;  3NH4 A;  1TFI A;  3F3F C;  2JR6 A;  2LIY A;  2EGT A;  1VQ8 Z;  1RQF A;  2Y0S A;  2JA5 I;  3GTG I;  1VQL Z;  2QLV B;  3CC2 Z;  3CME 1;  1VQO Z;  4NBC A;  1I50 I;  3CD6 1;  2R6M A;  3I55 1;  3PO3 I;  2QRD B;  2ZAE B;  3VMG A;  2JNY A;  3FQQ A;  1VQM 1;  3P5J B;  3J81 f;  2W04 A;  1QVG Z;  3KIH A;  1YIT 1;  3GTM S;  4A3B I;  1VQ4 Z;  2PK7 A;  1K8A 1;  1KQS Y;  1TWF I;  2R93 I;  1KD1 2;  4NBA A;  5CM2 M;  1YIJ Z;  3MZK B;  3G4S Z;  3S1R I;  2P3Y A;  3S16 I;  3S2D I;  1R9T I;  1M90 1;  3D6W A;  3G6E 1;  2NVQ I;  4MRI A;  3GKQ A;  1RO2 A;  2YU9 I;  3RZD I;  4DGL A;  1Q86 2;  1X3W A;  3VTN A;  3TDH B;  1RO4 A;  1YUA A;  3S15 I;  4BXX I;  1YI2 1;  2PM9 A;  2QRC B;  3GTM I;  2QA4 1;  1WII A;  1VQ5 Z;  1N2F A;  3J80 b;  1W2B Z;  4DQY B;  2LFU A;  1X0T A;  1WW9 A;  1Z02 A;  3VMI A;  4RV9 A;  3CCJ 1;  3NDI A;  2KPI A;  2E2J I;  1Z03 A;  3M3Y I;  3KIF A;  1RO0 A;  3HOX I;  2OOY B;  3ESW A;  3CC4 1;  4A3G I;  2WAQ A;  2Q4Z A;  2DE7 A;  2PMZ A;  1VQ9 Z;  1YJ9 1;  1VQP Z;  4MD7 A;  2M48 A;  2OTL 1;  3G71 1;  4A3F I;  3VMH A;  3T4N B;  4RVF A;  3S17 I;  5IP9 I;  4A3E I;  1JJ2 Y;  4HH4 A;  2VUG A;  4NBE A;  5D1P A;  1VQL 1;  3CXC Y;  3CC2 1;  1K8A 2;  1VQO 1;  3CC7 Z;  3CCQ Z;  3PO3 S;  5IT9 f;  3CCR Z;  2V8I A;  3FQM A;  4NBD A;  3EER A;  3HOW I;  4RVG A;  2RBL A;  1M90 2;  2QEX 1;  4E2W A;  1VQ4 1;  4E33 A;  5T67 A;  1VQN Z;  2K5R A;  1YIJ 1;  5FLM I;  1S72 Z;  3G4S 1;  2F4M A;  2NVY I;  3CCL 1;  1SFO I;  4A93 I;  1VQ6 Z;  3OW2 Y;  3NDJ A;  1RNI A;  1P9N A;  5IP7 I;  1TWC I;  3IX0 A;  3S1M I;  4E30 A;  3GTP I;  1Q81 1;  2YAD A;  1K9M 1;  1Z01 A;  1QVF Y;  2NVT I;  3HOZ I;  3CPW Z;  5A2Q b;  3PO2 I;  4RS4 A;  3IFU A;  3I07 A;  1PFT A;  1ZH1 A;  4HGZ A;  2VUM I;  3CCM 1;  3CCV Z;  1KC8 1;  4BBR I;  3GTJ I;  4A3J I;  1VQ9 1;  1VQP 1;  4NBH A;  1K73 2;  3U50 C;  1DL6 A;  2IZ4 A;  3FKI I;  1N8R 1;  3CCE 1;  4NFR A;  4NB8 A;  4BY1 I;  5FLX b;  2GU2 A;  2K3R A;  1Q7Y 1;  1WCM I;  2G2K A;  2JS4 A;  2W03 A;  4RVD A;  2V8J A;  3NFZ A;  3S1N I;  4XX2 A;  3CC7 1;  2O4H A;  1YJN Z;  4E31 A;  3CCR 1;  5A2Q f;  1VQM Z;  4QTU A;  2E2H I;  2IZ3 A;  1YJW 1;  4AYB A;  2R92 I;  2JA8 I;  4MD9 A;  4BY7 I;  3TE5 B;  5D1O A;  3S14 I;  3K7A I;  4NOZ A;  5LL6 f;  1VQN 1;  3HOV I;  2KI7 B;  1QVG Y;  2BJO A;  2OZK A;  2QKD A;  1S72 1;  1VQK 1;  2DE6 A;  3HKZ A;  1Q81 2;  2F4O A;  1K9M 2;  1VQ8 1;  2H85 A;  1VQ6 1;  2OTJ Z;  1VQ7 Z;  1JWH C;  3CCS Z;  4NBB A;  4NBF A;  4E2Y A;  2P28 A;  5FLX f;  4DK1 A;  4NH1 C;  4Y7N I;  1KQS Z;  1VLA A;  3J80 f;  1KC8 2;  1Q86 1;  2J6A A;  2RT9 A;  3GCF A;  2VF1 A;  4BBS I;  1YHQ Z;  3MZL B;  1YUK A;  1W2B Y;  3VB9 A;  1N8R 2;  3CCV 1;  3Q87 A;  2NVX I;  3GTO I;  3F3P C;  2AKL A;  1USP A;  1Q7Y 2;  1Q82 1;  2M6N A;  1YJ9 Z;  3BG1 B;  1ZB8 A;  3IF8 A;  5D1O B;  3M4O I;  2HF1 A;  3GTL I;  4E2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...