1Q822

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q82200
3OW2Z 1K8A1 3CXCZ 3CMEZ 3CCR1 3OW2Y 1YJ9Z 3CXCY 2OTLZ 3I551 1YIT1 1K732 1VQ91 3G6EZ 1Q821 1VQ51 1K8A2 1VQ71 1VQKZ 1W2BZ 1M901 1YIJ1 1Q7Y1 1Q822 1JJ2Z 1YHQZ 3G4SZ 2QEXZ 3I56Z 1JJ2Y 1M902 1QVFY 1VQM1 1VQ4Z 3CCMZ 1VQ5Z 3CPWZ 1KD11 1YJN1 1Q862 3CD61 1M1K2 3CC7Z 2QA4Z 3CCV1 1VQO1 1VQLZ 3CCU1 1VQP1 1S721 3CCSZ 3CMAZ 1KD12 1KC81 3CCJ1 1VQMZ 1W2BY 1QVGZ 3CCRZ 3CD6Z 1QVGY 3CCVZ 3CCE1 1VQOZ 3I55Z 1VQPZ 1VQ61 1YITZ 1S72Z 1VQ9Z 1VQN1 3CC41 1Q7Y2 1VQ7Z 3CCQ1 3G711 3CCL1 1NJI1 3CC21 1YIJZ 3CPWY 2OTJ1 1Q811 3CME1 1K9M1 1YJ91 3CCEZ 1N8R1 1VQ6Z 2OTL1 1VQ81 1NJI2 1VQNZ 3G6E1 3CC4Z 1YJW1 1Q812 1VQK1 1YJNZ 1K731 1N8R2 2OTJZ 3CCUZ 1KC82 1YI21 1YHQ1 1KQSZ 3G4S1 2QEX1 3I561 1VQ8Z 1KQSY 3CCJZ 1YJWZ 1VQ41 3CCM1 3CC71 2QA41 1VQL1 1YI2Z 3CCS1 3CMA1 1Q861 1M1K1 1QVFZ 3CCQZ 3G71Z 1K9M2 3CCLZ 3CC2Z
chains in the Genus database with same CATH superfamily
4NB9A 3S16I 3BG1B 3GTOI 4NBDA 1K8A1 4DQYB 3GTQI 4S1TA 1ZB9A 2O53A 4A3GI 2VF1A 3K7AI 1VQ91 3M4OI 4BY1I 5C44I 4RV9A 3GTPI 1Q7Y1 4E33A 2Q4ZA 3CQZI 1WCMI 1Q822 1JJ2Z 1YHQZ 2P3YA 3EERA 2QRCB 2Q51A 1M902 1QVFY 3IX0A 2JA6I 1VQ5Z 5IP7I 3NH5A 3CPWZ 1YJN1 3PO3S 2V8JA 2QA4Z 4NBEA 5IT9f 1S721 1K83I 4EWCA 1JWHC 3HOYI 3CCJ1 1RQFA 3S1QI 2HF1A 1FDIA 3CCRZ 3CD6Z 2NAPA 2F4MA 4MH4A 3P5JB 2YU9I 1Q16A 2W04A 3H0GI 2PM9A 1RLYA 3I4MI 1YIJZ 2JA8I 1Q811 5C4JI 5CM2M 3D2LA 2OTL1 5C4XI 5FLMI 1NJI2 2QREB 3GKQA 3CC4Z 4A3FI 4RVDA 2OTJZ 3CCUZ 5LL6f 3S2DI 3MONA 3MZLB 3T4NB 1KQSZ 2QEX1 2QKDA 4Y52I 1TWFI 1Z01A 5D1OA 3CC71 2P28A 4QTUA 2LIYA 4RS4A 2QLVB 2KI7B 4Y7NI 2R92I 2VUMI 2JIMA 2JMOA 5FLXb 4NBFA 4A3BI 3OW2Z 5A2Qb 4BBRI 3CXCZ 1PFTA 1QXFA 1YJ9Z 1I6HI 3I551 2IZ4A 1K732 2QR1B 3G6EZ 4NBGA 2WAQA 1VQ71 1VQKZ 1W2BZ 2BJOA 4A3MI 1ZH1A 4A3JI 3GCFA 3S17I 3G4SZ 3I56Z 1JJ2Y 4NFRA 1VQM1 4MD9A 1VQ4Z 3CCMZ 1Z02A 3HKZA 3VB9A 4QTTA 1VQO1 1VQP1 2LEXA 3FQMA 1KD12 3EEDA 2Y0SA 3IFUA 2HU9A 4E2WA 3HOWI 2DE6A 3I07A 1YITZ 2O4HA 1S72Z 2YADA 2ZAEB 3JAMb 1VQN1 5T64A 4A3KI 3CCQ1 3CCL1 3CC21 1NP6A 2OOYB 1FDOA 4E2XA 3S2HI 2V3VA 1N2FA 4MD8A 4A3II 3VMHA 1DL6A 4DK1A 4A93I 2VPYA 4RVHA 4HH4A 1RNIA 1USPA 4BXXI 1K731 3GTMS 1S7MA 2K3RA 3J80b 1N8R2 2R7ZI 1YHQ1 3TE5B 1TWCI 1KQSY 1P9NA 2E2HI 2OOXB 3GTKI 1SFOI 3M3YI 2QA41 2OZKA 1QVFZ 3G71Z 2J6AA 3GTMI 1I3QI 3J81f 2E7ZA 3CMEZ 3CCR1 3OW2Y 3S14I 2H85A 3CXCY 4CL1A 2NVTI 2V8KA 3FQQA 1Q821 1USPB 2IZ3A 1K8A2 1M901 1YIJ1 3HOZI 1SIWA 2M6NA 3FKII 3GTGI 2K5RA 1X3ZA 3JAMf 3QWUA 2E9HA 2RT9A 1M1K2 5IT9b 3CCV1 1I50I 1VQLZ 3RZOI 5T6BA 3CCU1 3VMGA 1NUIA 3CCSZ 3CMAZ 3S1RI 4DGLA 2VPXA 5T67A 2JIRA 1R9TI 3GTJI 1TWGI 1VQMZ 4RVFA 1LQLA 1QVGZ 4E2ZA 4A3CI 3CCE1 1VQOZ 2JUBA 1VQPZ 1VQ61 1VQ9Z 2M48A 2AKLA 2JS4A 1YUAA 3VTNA 3F3PC 2NVYI 2JR6A 5D1OB 1NJI1 1ZB8A 3CPWY 2VPWA 1AA6A 4HGZA 1YJ91 4A3LI 3S1MI 1VQ81 4NBAA 2E2II 1VQNZ 3G6E1 1YJW1 1Q812 2KPIA 1Y1VS 4MD7A 1VQK1 2F4OA 1YJNZ 2VPZA 2JIPA 2NVQI 2V45A 1KC82 1YI21 4NBBA 3S1NI 1RO0A 3G4S1 3I561 1QF8A 3CCJZ 1VQ41 3CCM1 4E32A 4A3DI 1X3WA 2GU2A 3PO2I 3GTLI 1RO4A 2PK7A 1M1K1 2GTHA 3KIFA 1Y1VI 3NDIA 1K9M2 2JNYA 4XX2A 3VMIA 2R93I 2NVXI 5FLXf 3D6WA 3RZDI 2B63I 5A2Qf 4NBCA 5C3EI 2IV2X 5IP9I 2OTLZ 1YIT1 2RHBA 3NFZA 4MXUA 4A3EI 2R6MA 4NB8A 1VQ51 3BG0B 2PMZA 4E30A 1TWHI 2QEXZ 3H3VJ 3HOUI 3KIHA 4HGYA 3J7A4 1RO2A 3LUSA 1KD11 3NDJA 1Q862 3CD61 3PO3I 4NOZA 3CC7Z 1WIIA 4BY7I 1TFIA 4AYBA 2JA5I 2RPRA 2LFUA 2RIQA 1KC81 2DE7A 2RBLA 1W2BY 3ESWA 2AYDA 1WW9A 4MONA 5AN9F 1Y1WI 1QVGY 3NH4A 3CCVZ 1VLAA 3U50C 4X6AI 3I55Z 3IR7A 1Y8CA 3CC41 2JIOA 4MRIA 2EGTA 4BBSI 1Q7Y2 1VQ7Z 3G711 2I3CA 3I4NI 1TWAI 2OTJ1 3HOXI 3IF8A 3CME1 1K9M1 2QRDB 1QYPA 1YUKA 2JIQA 2WB1A 4E2YA 3CCEZ 1N8R1 1VQ6Z 2V8IA 2VUGA 3D9XA 3TDHB 1ML8A 3Q87A 1Z03A 1WZNA 1X0TA 3J80f 2DE5A 4TNUA 4RVGA 5D1PA 1VQ8Z 1WJ2A 2W03A 1L1OC 1YJWZ 3F3FC 2JA7I 4NH1C 4NBHA 1VQL1 2G2KA 1YI2Z 3CCS1 3CMA1 1Q861 3MZKB 4E31A 1KRLA 2E2JI 3S15I 2GTIA 3NH8A 3CCQZ 3J81b 3CCLZ 3HOVI 3CC2Z
chains in the Genus database with same CATH topology
4NB9A 3S16I 3BG1B 3GTOI 4NBDA 1K8A1 4DQYB 3GTQI 4S1TA 1ZB9A 2O53A 4A3GI 2VF1A 3K7AI 1VQ91 3M4OI 4BY1I 5C44I 4RV9A 3GTPI 1Q7Y1 4E33A 2Q4ZA 3CQZI 1WCMI 1Q822 1JJ2Z 1YHQZ 2P3YA 3EERA 2QRCB 2Q51A 1M902 1QVFY 3IX0A 2JA6I 1VQ5Z 5IP7I 3NH5A 3CPWZ 1YJN1 3PO3S 2V8JA 2QA4Z 4NBEA 5IT9f 1S721 1K83I 4EWCA 1JWHC 3HOYI 3CCJ1 1RQFA 3S1QI 2HF1A 3CCRZ 3CD6Z 2F4MA 4MH4A 3P5JB 2YU9I 2W04A 3H0GI 2PM9A 1RLYA 3I4MI 1YIJZ 2JA8I 1Q811 5C4JI 5CM2M 2OTL1 5C4XI 5FLMI 1NJI2 2QREB 3GKQA 3CC4Z 4A3FI 4RVDA 2OTJZ 3CCUZ 5LL6f 3S2DI 3MONA 3MZLB 3T4NB 1KQSZ 2QEX1 2QKDA 4Y52I 1TWFI 1Z01A 5D1OA 3CC71 2P28A 4QTUA 2LIYA 4RS4A 2QLVB 2KI7B 4Y7NI 2R92I 2VUMI 2JMOA 5FLXb 4NBFA 4A3BI 3OW2Z 5A2Qb 4BBRI 3CXCZ 1PFTA 1YJ9Z 1I6HI 3I551 2IZ4A 1K732 2QR1B 3G6EZ 4NBGA 2WAQA 1VQ71 1VQKZ 1W2BZ 2BJOA 4A3MI 1ZH1A 4A3JI 3GCFA 3S17I 3G4SZ 3I56Z 1JJ2Y 4NFRA 1VQM1 4MD9A 1VQ4Z 3CCMZ 1Z02A 3HKZA 3VB9A 4QTTA 1VQO1 1VQP1 3FQMA 1KD12 3EEDA 2Y0SA 3IFUA 2HU9A 4E2WA 3HOWI 2DE6A 3I07A 1YITZ 2O4HA 1S72Z 2YADA 2ZAEB 3JAMb 1VQN1 5T64A 4A3KI 3CCQ1 3CCL1 3CC21 1NP6A 2OOYB 4E2XA 3S2HI 1N2FA 4MD8A 4A3II 3VMHA 1DL6A 4DK1A 4A93I 4RVHA 4HH4A 1RNIA 1USPA 4BXXI 1K731 3GTMS 1S7MA 2K3RA 3J80b 1N8R2 2R7ZI 1YHQ1 3TE5B 1TWCI 1KQSY 1P9NA 2E2HI 2OOXB 3GTKI 1SFOI 3M3YI 2QA41 2OZKA 1QVFZ 3G71Z 2J6AA 3GTMI 1I3QI 3J81f 3CMEZ 3CCR1 3OW2Y 3S14I 2H85A 3CXCY 4CL1A 2NVTI 2V8KA 3FQQA 1Q821 1USPB 2IZ3A 1K8A2 1M901 1YIJ1 3HOZI 2M6NA 3FKII 3GTGI 2K5RA 1X3ZA 3JAMf 3QWUA 2E9HA 2RT9A 1M1K2 5IT9b 3CCV1 1I50I 1VQLZ 3RZOI 5T6BA 3CCU1 3VMGA 1NUIA 3CCSZ 3CMAZ 3S1RI 4DGLA 5T67A 1R9TI 3GTJI 1TWGI 1VQMZ 4RVFA 1LQLA 1QVGZ 4E2ZA 4A3CI 3CCE1 1VQOZ 2JUBA 1VQPZ 1VQ61 1VQ9Z 2M48A 2AKLA 2JS4A 1YUAA 3VTNA 3F3PC 2NVYI 2JR6A 5D1OB 1NJI1 1ZB8A 3CPWY 4HGZA 1YJ91 4A3LI 3S1MI 1VQ81 4NBAA 2E2II 1VQNZ 3G6E1 1YJW1 1Q812 2KPIA 1Y1VS 4MD7A 1VQK1 2F4OA 1YJNZ 2NVQI 1KC82 1YI21 4NBBA 3S1NI 1RO0A 3G4S1 3I561 1QF8A 3CCJZ 1VQ41 3CCM1 4E32A 4A3DI 1X3WA 2GU2A 3PO2I 3GTLI 1RO4A 2PK7A 1M1K1 2GTHA 3KIFA 1Y1VI 3NDIA 1K9M2 2JNYA 4XX2A 3VMIA 2R93I 2NVXI 5FLXf 3D6WA 3RZDI 2B63I 5A2Qf 4NBCA 5C3EI 2OTLZ 5IP9I 1YIT1 2RHBA 3NFZA 4MXUA 4A3EI 2R6MA 4NB8A 1VQ51 3BG0B 2PMZA 4E30A 1TWHI 2QEXZ 3H3VJ 3HOUI 3KIHA 4HGYA 3J7A4 1RO2A 3LUSA 1KD11 3NDJA 1Q862 3CD61 3PO3I 4NOZA 3CC7Z 1WIIA 4BY7I 1TFIA 4AYBA 2JA5I 2RPRA 2LFUA 2RIQA 1KC81 2DE7A 2RBLA 1W2BY 3ESWA 1WW9A 4MONA 5AN9F 1Y1WI 1QVGY 3NH4A 3CCVZ 1VLAA 3U50C 4X6AI 3I55Z 3CC41 4MRIA 2EGTA 4BBSI 1Q7Y2 1VQ7Z 3G711 2I3CA 3I4NI 1TWAI 2OTJ1 3HOXI 3IF8A 3CME1 1K9M1 2QRDB 1QYPA 1YUKA 4E2YA 2WB1A 3CCEZ 1N8R1 1VQ6Z 2V8IA 2VUGA 3D9XA 3TDHB 1ML8A 3Q87A 1Z03A 1X0TA 3J80f 2DE5A 4TNUA 4RVGA 5D1PA 1VQ8Z 2W03A 1L1OC 1YJWZ 3F3FC 2JA7I 4NH1C 4NBHA 1VQL1 2G2KA 1YI2Z 3CCS1 3CMA1 1Q861 3MZKB 4E31A 1KRLA 2E2JI 3S15I 2GTIA 3NH8A 3CCQZ 3J81b 3CCLZ 3HOVI 3CC2Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 Z;  1K8A 1;  3CXC Z;  3CME Z;  3CCR 1;  3OW2 Y;  1YJ9 Z;  3CXC Y;  2OTL Z;  3I55 1;  1YIT 1;  1K73 2;  1VQ9 1;  3G6E Z;  1Q82 1;  1VQ5 1;  1K8A 2;  1VQ7 1;  1VQK Z;  1W2B Z;  1M90 1;  1YIJ 1;  1Q7Y 1;  1Q82 2;  1JJ2 Z;  1YHQ Z;  3G4S Z;  2QEX Z;  3I56 Z;  1JJ2 Y;  1M90 2;  1QVF Y;  1VQM 1;  1VQ4 Z;  3CCM Z;  1VQ5 Z;  3CPW Z;  1KD1 1;  1YJN 1;  1Q86 2;  3CD6 1;  1M1K 2;  3CC7 Z;  2QA4 Z;  3CCV 1;  1VQO 1;  1VQL Z;  3CCU 1;  1VQP 1;  1S72 1;  3CCS Z;  3CMA Z;  1KD1 2;  1KC8 1;  3CCJ 1;  1VQM Z;  1W2B Y;  1QVG Z;  3CCR Z;  3CD6 Z;  1QVG Y;  3CCV Z;  3CCE 1;  1VQO Z;  3I55 Z;  1VQP Z;  1VQ6 1;  1YIT Z;  1S72 Z;  1VQ9 Z;  1VQN 1;  3CC4 1;  1Q7Y 2;  1VQ7 Z;  3CCQ 1;  3G71 1;  3CCL 1;  1NJI 1;  3CC2 1;  1YIJ Z;  3CPW Y;  2OTJ 1;  1Q81 1;  3CME 1;  1K9M 1;  1YJ9 1;  3CCE Z;  1N8R 1;  1VQ6 Z;  2OTL 1;  1VQ8 1;  1NJI 2;  1VQN Z;  3G6E 1;  3CC4 Z;  1YJW 1;  1Q81 2;  1VQK 1;  1YJN Z;  1K73 1;  1N8R 2;  2OTJ Z;  3CCU Z;  1KC8 2;  1YI2 1;  1YHQ 1;  1KQS Z;  3G4S 1;  2QEX 1;  3I56 1;  1VQ8 Z;  1KQS Y;  3CCJ Z;  1YJW Z;  1VQ4 1;  3CCM 1;  3CC7 1;  2QA4 1;  1VQL 1;  1YI2 Z;  3CCS 1;  3CMA 1;  1Q86 1;  1M1K 1;  1QVF Z;  3CCQ Z;  3G71 Z;  1K9M 2;  3CCL Z;  3CC2 Z; 
#chains in the Genus database with same CATH topology
 4NB9 A;  3S16 I;  3BG1 B;  3GTO I;  4NBD A;  1K8A 1;  4DQY B;  3GTQ I;  4S1T A;  1ZB9 A;  2O53 A;  4A3G I;  2VF1 A;  3K7A I;  1VQ9 1;  3M4O I;  4BY1 I;  5C44 I;  4RV9 A;  3GTP I;  1Q7Y 1;  4E33 A;  2Q4Z A;  3CQZ I;  1WCM I;  1Q82 2;  1JJ2 Z;  1YHQ Z;  2P3Y A;  3EER A;  2QRC B;  2Q51 A;  1M90 2;  1QVF Y;  3IX0 A;  2JA6 I;  1VQ5 Z;  5IP7 I;  3NH5 A;  3CPW Z;  1YJN 1;  3PO3 S;  2V8J A;  2QA4 Z;  4NBE A;  5IT9 f;  1S72 1;  1K83 I;  4EWC A;  1JWH C;  3HOY I;  3CCJ 1;  1RQF A;  3S1Q I;  2HF1 A;  1FDI A;  3CCR Z;  3CD6 Z;  2NAP A;  2F4M A;  4MH4 A;  3P5J B;  2YU9 I;  1Q16 A;  2W04 A;  3H0G I;  2PM9 A;  1RLY A;  3I4M I;  1YIJ Z;  2JA8 I;  1Q81 1;  5C4J I;  5CM2 M;  3D2L A;  2OTL 1;  5C4X I;  5FLM I;  1NJI 2;  2QRE B;  3GKQ A;  3CC4 Z;  4A3F I;  4RVD A;  2OTJ Z;  3CCU Z;  5LL6 f;  3S2D I;  3MON A;  3MZL B;  3T4N B;  1KQS Z;  2QEX 1;  2QKD A;  4Y52 I;  1TWF I;  1Z01 A;  5D1O A;  3CC7 1;  2P28 A;  4QTU A;  2LIY A;  4RS4 A;  2QLV B;  2KI7 B;  4Y7N I;  2R92 I;  2VUM I;  2JIM A;  2JMO A;  5FLX b;  4NBF A;  4A3B I;  3OW2 Z;  5A2Q b;  4BBR I;  3CXC Z;  1PFT A;  1QXF A;  1YJ9 Z;  1I6H I;  3I55 1;  2IZ4 A;  1K73 2;  2QR1 B;  3G6E Z;  4NBG A;  2WAQ A;  1VQ7 1;  1VQK Z;  1W2B Z;  2BJO A;  4A3M I;  1ZH1 A;  4A3J I;  3GCF A;  3S17 I;  3G4S Z;  3I56 Z;  1JJ2 Y;  4NFR A;  1VQM 1;  4MD9 A;  1VQ4 Z;  3CCM Z;  1Z02 A;  3HKZ A;  3VB9 A;  4QTT A;  1VQO 1;  1VQP 1;  2LEX A;  3FQM A;  1KD1 2;  3EED A;  2Y0S A;  3IFU A;  2HU9 A;  4E2W A;  3HOW I;  2DE6 A;  3I07 A;  1YIT Z;  2O4H A;  1S72 Z;  2YAD A;  2ZAE B;  3JAM b;  1VQN 1;  5T64 A;  4A3K I;  3CCQ 1;  3CCL 1;  3CC2 1;  1NP6 A;  2OOY B;  1FDO A;  4E2X A;  3S2H I;  2V3V A;  1N2F A;  4MD8 A;  4A3I I;  3VMH A;  1DL6 A;  4DK1 A;  4A93 I;  2VPY A;  4RVH A;  4HH4 A;  1RNI A;  1USP A;  4BXX I;  1K73 1;  3GTM S;  1S7M A;  2K3R A;  3J80 b;  1N8R 2;  2R7Z I;  1YHQ 1;  3TE5 B;  1TWC I;  1KQS Y;  1P9N A;  2E2H I;  2OOX B;  3GTK I;  1SFO I;  3M3Y I;  2QA4 1;  2OZK A;  1QVF Z;  3G71 Z;  2J6A A;  3GTM I;  1I3Q I;  3J81 f;  2E7Z A;  3CME Z;  3CCR 1;  3OW2 Y;  3S14 I;  2H85 A;  3CXC Y;  4CL1 A;  2NVT I;  2V8K A;  3FQQ A;  1Q82 1;  1USP B;  2IZ3 A;  1K8A 2;  1M90 1;  1YIJ 1;  3HOZ I;  1SIW A;  2M6N A;  3FKI I;  3GTG I;  2K5R A;  1X3Z A;  3JAM f;  3QWU A;  2E9H A;  2RT9 A;  1M1K 2;  5IT9 b;  3CCV 1;  1I50 I;  1VQL Z;  3RZO I;  5T6B A;  3CCU 1;  3VMG A;  1NUI A;  3CCS Z;  3CMA Z;  3S1R I;  4DGL A;  2VPX A;  5T67 A;  2JIR A;  1R9T I;  3GTJ I;  1TWG I;  1VQM Z;  4RVF A;  1LQL A;  1QVG Z;  4E2Z A;  4A3C I;  3CCE 1;  1VQO Z;  2JUB A;  1VQP Z;  1VQ6 1;  1VQ9 Z;  2M48 A;  2AKL A;  2JS4 A;  1YUA A;  3VTN A;  3F3P C;  2NVY I;  2JR6 A;  5D1O B;  1NJI 1;  1ZB8 A;  3CPW Y;  2VPW A;  1AA6 A;  4HGZ A;  1YJ9 1;  4A3L I;  3S1M I;  1VQ8 1;  4NBA A;  2E2I I;  1VQN Z;  3G6E 1;  1YJW 1;  1Q81 2;  2KPI A;  1Y1V S;  4MD7 A;  1VQK 1;  2F4O A;  1YJN Z;  2VPZ A;  2JIP A;  2NVQ I;  2V45 A;  1KC8 2;  1YI2 1;  4NBB A;  3S1N I;  1RO0 A;  3G4S 1;  3I56 1;  1QF8 A;  3CCJ Z;  1VQ4 1;  3CCM 1;  4E32 A;  4A3D I;  1X3W A;  2GU2 A;  3PO2 I;  3GTL I;  1RO4 A;  2PK7 A;  1M1K 1;  2GTH A;  3KIF A;  1Y1V I;  3NDI A;  1K9M 2;  2JNY A;  4XX2 A;  3VMI A;  2R93 I;  2NVX I;  5FLX f;  3D6W A;  3RZD I;  2B63 I;  5A2Q f;  4NBC A;  5C3E I;  2IV2 X;  5IP9 I;  2OTL Z;  1YIT 1;  2RHB A;  3NFZ A;  4MXU A;  4A3E I;  2R6M A;  4NB8 A;  1VQ5 1;  3BG0 B;  2PMZ A;  4E30 A;  1TWH I;  2QEX Z;  3H3V J;  3HOU I;  3KIH A;  4HGY A;  3J7A 4;  1RO2 A;  3LUS A;  1KD1 1;  3NDJ A;  1Q86 2;  3CD6 1;  3PO3 I;  4NOZ A;  3CC7 Z;  1WII A;  4BY7 I;  1TFI A;  4AYB A;  2JA5 I;  2RPR A;  2LFU A;  2RIQ A;  1KC8 1;  2DE7 A;  2RBL A;  1W2B Y;  3ESW A;  2AYD A;  1WW9 A;  4MON A;  5AN9 F;  1Y1W I;  1QVG Y;  3NH4 A;  3CCV Z;  1VLA A;  3U50 C;  4X6A I;  3I55 Z;  3IR7 A;  1Y8C A;  3CC4 1;  2JIO A;  4MRI A;  2EGT A;  4BBS I;  1Q7Y 2;  1VQ7 Z;  3G71 1;  2I3C A;  3I4N I;  1TWA I;  2OTJ 1;  3HOX I;  3IF8 A;  3CME 1;  1K9M 1;  2QRD B;  1QYP A;  1YUK A;  2JIQ A;  2WB1 A;  4E2Y A;  3CCE Z;  1N8R 1;  1VQ6 Z;  2V8I A;  2VUG A;  3D9X A;  3TDH B;  1ML8 A;  3Q87 A;  1Z03 A;  1WZN A;  1X0T A;  3J80 f;  2DE5 A;  4TNU A;  4RVG A;  5D1P A;  1VQ8 Z;  1WJ2 A;  2W03 A;  1L1O C;  1YJW Z;  3F3F C;  2JA7 I;  4NH1 C;  4NBH A;  1VQL 1;  2G2K A;  1YI2 Z;  3CCS 1;  3CMA 1;  1Q86 1;  3MZK B;  4E31 A;  1KRL A;  2E2J I;  3S15 I;  2GTI A;  3NH8 A;  3CCQ Z;  3J81 b;  3CCL Z;  3HOV I;  3CC2 Z; 
#chains in the Genus database with same CATH homology
 4NB9 A;  3S16 I;  3BG1 B;  3GTO I;  4NBD A;  1K8A 1;  4DQY B;  3GTQ I;  4S1T A;  1ZB9 A;  2O53 A;  4A3G I;  2VF1 A;  3K7A I;  1VQ9 1;  3M4O I;  4BY1 I;  5C44 I;  4RV9 A;  3GTP I;  1Q7Y 1;  4E33 A;  2Q4Z A;  3CQZ I;  1WCM I;  1Q82 2;  1JJ2 Z;  1YHQ Z;  2P3Y A;  3EER A;  2QRC B;  2Q51 A;  1M90 2;  1QVF Y;  3IX0 A;  2JA6 I;  1VQ5 Z;  5IP7 I;  3NH5 A;  3CPW Z;  1YJN 1;  3PO3 S;  2V8J A;  2QA4 Z;  4NBE A;  5IT9 f;  1S72 1;  1K83 I;  4EWC A;  1JWH C;  3HOY I;  3CCJ 1;  1RQF A;  3S1Q I;  2HF1 A;  3CCR Z;  3CD6 Z;  2F4M A;  4MH4 A;  3P5J B;  2YU9 I;  2W04 A;  3H0G I;  2PM9 A;  1RLY A;  3I4M I;  1YIJ Z;  2JA8 I;  1Q81 1;  5C4J I;  5CM2 M;  2OTL 1;  5C4X I;  5FLM I;  1NJI 2;  2QRE B;  3GKQ A;  3CC4 Z;  4A3F I;  4RVD A;  2OTJ Z;  3CCU Z;  5LL6 f;  3S2D I;  3MON A;  3MZL B;  3T4N B;  1KQS Z;  2QEX 1;  2QKD A;  4Y52 I;  1TWF I;  1Z01 A;  5D1O A;  3CC7 1;  2P28 A;  4QTU A;  2LIY A;  4RS4 A;  2QLV B;  2KI7 B;  4Y7N I;  2R92 I;  2VUM I;  2JMO A;  5FLX b;  4NBF A;  4A3B I;  3OW2 Z;  5A2Q b;  4BBR I;  3CXC Z;  1PFT A;  1YJ9 Z;  1I6H I;  3I55 1;  2IZ4 A;  1K73 2;  2QR1 B;  3G6E Z;  4NBG A;  2WAQ A;  1VQ7 1;  1VQK Z;  1W2B Z;  2BJO A;  4A3M I;  1ZH1 A;  4A3J I;  3GCF A;  3S17 I;  3G4S Z;  3I56 Z;  1JJ2 Y;  4NFR A;  1VQM 1;  4MD9 A;  1VQ4 Z;  3CCM Z;  1Z02 A;  3HKZ A;  3VB9 A;  4QTT A;  1VQO 1;  1VQP 1;  3FQM A;  1KD1 2;  3EED A;  2Y0S A;  3IFU A;  2HU9 A;  4E2W A;  3HOW I;  2DE6 A;  3I07 A;  1YIT Z;  2O4H A;  1S72 Z;  2YAD A;  2ZAE B;  3JAM b;  1VQN 1;  5T64 A;  4A3K I;  3CCQ 1;  3CCL 1;  3CC2 1;  1NP6 A;  2OOY B;  4E2X A;  3S2H I;  1N2F A;  4MD8 A;  4A3I I;  3VMH A;  1DL6 A;  4DK1 A;  4A93 I;  4RVH A;  4HH4 A;  1RNI A;  1USP A;  4BXX I;  1K73 1;  3GTM S;  1S7M A;  2K3R A;  3J80 b;  1N8R 2;  2R7Z I;  1YHQ 1;  3TE5 B;  1TWC I;  1KQS Y;  1P9N A;  2E2H I;  2OOX B;  3GTK I;  1SFO I;  3M3Y I;  2QA4 1;  2OZK A;  1QVF Z;  3G71 Z;  2J6A A;  3GTM I;  1I3Q I;  3J81 f;  3CME Z;  3CCR 1;  3OW2 Y;  3S14 I;  2H85 A;  3CXC Y;  4CL1 A;  2NVT I;  2V8K A;  3FQQ A;  1Q82 1;  1USP B;  2IZ3 A;  1K8A 2;  1M90 1;  1YIJ 1;  3HOZ I;  2M6N A;  3FKI I;  3GTG I;  2K5R A;  1X3Z A;  3JAM f;  3QWU A;  2E9H A;  2RT9 A;  1M1K 2;  5IT9 b;  3CCV 1;  1I50 I;  1VQL Z;  3RZO I;  5T6B A;  3CCU 1;  3VMG A;  1NUI A;  3CCS Z;  3CMA Z;  3S1R I;  4DGL A;  5T67 A;  1R9T I;  3GTJ I;  1TWG I;  1VQM Z;  4RVF A;  1LQL A;  1QVG Z;  4E2Z A;  4A3C I;  3CCE 1;  1VQO Z;  2JUB A;  1VQP Z;  1VQ6 1;  1VQ9 Z;  2M48 A;  2AKL A;  2JS4 A;  1YUA A;  3VTN A;  3F3P C;  2NVY I;  2JR6 A;  5D1O B;  1NJI 1;  1ZB8 A;  3CPW Y;  4HGZ A;  1YJ9 1;  4A3L I;  3S1M I;  1VQ8 1;  4NBA A;  2E2I I;  1VQN Z;  3G6E 1;  1YJW 1;  1Q81 2;  2KPI A;  1Y1V S;  4MD7 A;  1VQK 1;  2F4O A;  1YJN Z;  2NVQ I;  1KC8 2;  1YI2 1;  4NBB A;  3S1N I;  1RO0 A;  3G4S 1;  3I56 1;  1QF8 A;  3CCJ Z;  1VQ4 1;  3CCM 1;  4E32 A;  4A3D I;  1X3W A;  2GU2 A;  3PO2 I;  3GTL I;  1RO4 A;  2PK7 A;  1M1K 1;  2GTH A;  3KIF A;  1Y1V I;  3NDI A;  1K9M 2;  2JNY A;  4XX2 A;  3VMI A;  2R93 I;  2NVX I;  5FLX f;  3D6W A;  3RZD I;  2B63 I;  5A2Q f;  4NBC A;  5C3E I;  2OTL Z;  5IP9 I;  1YIT 1;  2RHB A;  3NFZ A;  4MXU A;  4A3E I;  2R6M A;  4NB8 A;  1VQ5 1;  3BG0 B;  2PMZ A;  4E30 A;  1TWH I;  2QEX Z;  3H3V J;  3HOU I;  3KIH A;  4HGY A;  3J7A 4;  1RO2 A;  3LUS A;  1KD1 1;  3NDJ A;  1Q86 2;  3CD6 1;  3PO3 I;  4NOZ A;  3CC7 Z;  1WII A;  4BY7 I;  1TFI A;  4AYB A;  2JA5 I;  2RPR A;  2LFU A;  2RIQ A;  1KC8 1;  2DE7 A;  2RBL A;  1W2B Y;  3ESW A;  1WW9 A;  4MON A;  5AN9 F;  1Y1W I;  1QVG Y;  3NH4 A;  3CCV Z;  1VLA A;  3U50 C;  4X6A I;  3I55 Z;  3CC4 1;  4MRI A;  2EGT A;  4BBS I;  1Q7Y 2;  1VQ7 Z;  3G71 1;  2I3C A;  3I4N I;  1TWA I;  2OTJ 1;  3HOX I;  3IF8 A;  3CME 1;  1K9M 1;  2QRD B;  1QYP A;  1YUK A;  4E2Y A;  2WB1 A;  3CCE Z;  1N8R 1;  1VQ6 Z;  2V8I A;  2VUG A;  3D9X A;  3TDH B;  1ML8 A;  3Q87 A;  1Z03 A;  1X0T A;  3J80 f;  2DE5 A;  4TNU A;  4RVG A;  5D1P A;  1VQ8 Z;  2W03 A;  1L1O C;  1YJW Z;  3F3F C;  2JA7 I;  4NH1 C;  4NBH A;  1VQL 1;  2G2K A;  1YI2 Z;  3CCS 1;  3CMA 1;  1Q86 1;  3MZK B;  4E31 A;  1KRL A;  2E2J I;  3S15 I;  2GTI A;  3NH8 A;  3CCQ Z;  3J81 b;  3CCL Z;  3HOV I;  3CC2 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...