1Q822

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q82200
3CCR1 3G6E1 1KQSY 1VQOZ 1VQ61 1M1K2 1Q7Y1 3CCSZ 1VQN1 1VQK1 1KC82 1VQM1 1NJI1 3CCVZ 1Q812 1YITZ 1W2BY 3CCV1 1VQ5Z 1YIT1 3CC4Z 1QVGZ 1K9M2 3CXCZ 1M901 1Q862 2OTJZ 1KD12 2OTLZ 1Q822 3CCEZ 3I561 1N8R1 3CCQZ 1YJN1 1KQSZ 2QEXZ 1QVFY 3CMEZ 3CC2Z 1VQO1 3CCQ1 3CCS1 1Q811 2QA4Z 1YI2Z 1S72Z 1JJ2Y 3CCMZ 1W2BZ 2QA41 1S721 1YJWZ 3CCUZ 3CMAZ 1VQ51 3CC41 3I55Z 1YIJZ 1Q7Y2 1K8A2 1VQ7Z 1YJW1 3CPWY 2OTJ1 3I551 2OTL1 1VQPZ 1YHQZ 1M1K1 1NJI2 1VQLZ 3CD6Z 1VQ71 3CCE1 1KC81 1K732 1VQ4Z 1VQP1 1QVFZ 3CCLZ 1VQ9Z 3CC7Z 3OW2Y 2QEX1 3CCJZ 3CME1 1VQ41 3CC21 1M902 3CCL1 3CCRZ 3CC71 1K9M1 1JJ2Z 1VQ6Z 3G71Z 1YI21 1VQNZ 1Q861 1VQKZ 3CCM1 1KD11 1VQMZ 1N8R2 3G711 1Q821 1K8A1 3CCU1 3CMA1 1YJ9Z 3CPWZ 1YIJ1 1K731 1YJ91 1VQ8Z 1YHQ1 3G4SZ 1QVGY 1VQL1 3CD61 3CXCY 1VQ81 3OW2Z 3G4S1 1VQ91 3G6EZ 3I56Z 3CCJ1 1YJNZ
chains in the Genus database with same CATH superfamily
4NBBA 1KQSY 3GTGI 1VQOZ 2ZAEB 1VQ61 1M1K2 2JA5I 1Q7Y1 3CCSZ 1X3ZA 3BG1B 1VQM1 2GTIA 2O4HA 2QRCB 3NH8A 2HU9A 2V8JA 1W2BY 1TWCI 3CC4Z 4RVHA 2PM9A 2LFUA 3MZLB 3JAMb 4NBHA 1RO2A 5A2Qf 2IZ4A 4A3BI 5C3EI 2DE5A 1VQO1 4NFRA 4E32A 5LL6f 3CCS1 3PO3S 1K83I 1PFTA 1S72Z 5D1OB 4A3GI 5IT9b 2QA41 4MH4A 3I4NI 2JIOA 1AA6A 4A3JI 1RO0A 2H85A 3CC41 2P3YA 2R93I 3S1MI 2PK7A 3D9XA 1X3WA 4E2WA 3S17I 1VQLZ 2B63I 1Z03A 2QR1B 3PO2I 1QVFZ 4QTTA 1RLYA 4NB8A 1VQ41 3HOVI 3CCRZ 2RHBA 1TWAI 1JJ2Z 4RVFA 1FDIA 2IV2X 1VQKZ 3NFZA 1P9NA 4NBAA 2W03A 4Y7NI 3U50C 4NBCA 1VLAA 4A3KI 3CPWZ 3GTQI 5C44I 3IFUA 3S16I 4A3EI 1VQL1 4A3LI 1WZNA 1QXFA 1VQ81 5IP7I 1Q16A 3OW2Z 3EEDA 3G4S1 3VMHA 3JAMf 1YJNZ 3CCR1 2DE7A 3HKZA 4A93I 1VQK1 2JR6A 1R9TI 1S7MA 1NJI1 3I4MI 1Q812 2I3CA 4MD8A 1SIWA 3CQZI 2JIRA 4DK1A 2YU9I 1ZH1A 3CCV1 1L1OC 4NOZA 3J80b 1QF8A 1QVGZ 5IT9f 4E2ZA 3CXCZ 2F4OA 1Y8CA 2OTLZ 2O53A 3VMGA 1N2FA 5FLXb 2E9HA 1NUIA 3CCEZ 4RVGA 3IX0A 2K3RA 2R6MA 3HOYI 1N8R1 3S2HI 1YJN1 2RT9A 4A3CI 5FLMI 1JWHC 2QRDB 2R92I 3CC2Z 2K5RA 3KIHA 3HOUI 3CCQ1 2JIPA 2BJOA 2YADA 4MONA 1Q811 2VPXA 3NDJA 2QREB 2QA4Z 4E30A 3VMIA 3CCMZ 4BY7I 3S1RI 5IP9I 2Q4ZA 3VB9A 3CMAZ 4RV9A 3IR7A 5T64A 1K8A2 1YJW1 2OTL1 4S1TA 3FQMA 1YHQZ 1M1K1 3GTMI 3CD6Z 3CCE1 1K732 1VQ4Z 3J7A4 3D2LA 1VQP1 2HF1A 3GTOI 3GTLI 5D1PA 1I50I 3CC21 1M902 5D1OA 3CC71 1ML8A 2VUMI 3CCM1 2E2II 2AKLA 1K8A1 2J6AA 3CMA1 2VPYA 2GTHA 4NBFA 1DL6A 3GTJI 3FKII 2V3VA 1K731 3NH5A 4A3FI 1YJ91 1VQ8Z 1YHQ1 3G4SZ 3CD61 4TNUA 3T4NB 3J80f 2DE6A 2KPIA 1TWHI 4E2YA 2JA8I 5T6BA 1LQLA 5FLXf 2JS4A 3HOWI 2JA7I 3F3FC 2OOYB 3GKQA 1KC82 1Y1VI 3CCVZ 3IF8A 1RQFA 2KI7B 2AYDA 2WAQA 1USPB 3GTPI 1X0TA 1YIT1 2NVYI 1K9M2 2JMOA 4NB9A 1Q862 3M4OI 2Q51A 1KD12 2OTJZ 3S15I 2OOXB 1Q822 2VPWA 1WCMI 4EWCA 4BBRI 3CCQZ 2JIQA 1KQSZ 4BBSI 2QEXZ 4MD7A 1TWFI 3CMEZ 1QVFY 2WB1A 1WJ2A 1SFOI 3MONA 3F3PC 1I6HI 2PMZA 1YI2Z 2EGTA 1JJ2Y 1W2BZ 2VF1A 2GU2A 4DQYB 3CCUZ 1YJWZ 2NVXI 1QYPA 1KRLA 2JA6I 1Q7Y2 4NBGA 2NVTI 3CPWY 2OTJ1 3I551 2JNYA 1VQPZ 3RZOI 3M3YI 4NH1C 3J81b 1VQ71 2E2HI 3H3VJ 4DGLA 2RIQA 2NVQI 3HOZI 3CC7Z 3OW2Y 2QEX1 3CME1 1FDOA 3S2DI 3GTMS 3H0GI 3CCL1 3KIFA 4HGZA 4XX2A 3NH4A 4NBDA 3Q87A 1YI21 1VQNZ 3EERA 4E31A 2RBLA 2M48A 4AYBA 3G711 4X6AI 3CCU1 2P28A 2VPZA 2JUBA 1YJ9Z 1ZB9A 4RVDA 2R7ZI 3TE5B 1YUKA 1QVGY 3CXCY 1Y1WI 2LIYA 2RPRA 3I56Z 3S14I 4E2XA 1WW9A 4QTUA 1RO4A 3G6E1 4NBEA 3MZKB 1VQN1 4A3II 2VUGA 4MD9A 3S1NI 1YITZ 1YUAA 3GCFA 2E2JI 1Z02A 2F4MA 1VQ5Z 1Y1VS 2V8KA 1M901 1TWGI 4HGYA 2Y0SA 3GTKI 1Z01A 3PO3I 5T67A 3I561 3P5JB 3QWUA 2E7ZA 3J81f 2QKDA 3I07A 4A3MI 1USPA 2NAPA 2W04A 3K7AI 1WIIA 2QLVB 4RS4A 3VTNA 1S721 3S1QI 1VQ51 3I55Z 1YIJZ 5C4JI 5A2Qb 1VQ7Z 3LUSA 1NJI2 1ZB8A 2M6NA 4BXXI 5AN9F 1KC81 3BG0B 3CCLZ 1RNIA 4HH4A 1VQ9Z 3FQQA 3CCJZ 3RZDI 1NP6A 2JIMA 2V45A 1K9M1 4E33A 1VQ6Z 3G71Z 4BY1I 4A3DI 1I3QI 1Q861 2OZKA 1KD11 3ESWA 1VQMZ 1N8R2 3TDHB 1Q821 1TFIA 1YIJ1 4MXUA 5CM2M 3NDIA 4CL1A 2G2KA 5C4XI 2V8IA 2LEXA 4MRIA 3G6EZ 1VQ91 3CCJ1 2IZ3A 3HOXI 3D6WA 4Y52I
chains in the Genus database with same CATH topology
4NBBA 1KQSY 3GTGI 1VQOZ 2ZAEB 1VQ61 1M1K2 2JA5I 1Q7Y1 3CCSZ 1X3ZA 3BG1B 1VQM1 2GTIA 2O4HA 2QRCB 3NH8A 2HU9A 2V8JA 1W2BY 1TWCI 3CC4Z 3D6WA 4RVHA 2PM9A 2LFUA 3MZLB 3JAMb 4NBHA 1RO2A 5A2Qf 2IZ4A 4A3BI 5C3EI 2DE5A 1VQO1 4NFRA 4E32A 5LL6f 3CCS1 3PO3S 1K83I 1PFTA 1S72Z 5D1OB 4A3GI 5IT9b 2QA41 4MH4A 3I4NI 4A3JI 1RO0A 2H85A 3CC41 2P3YA 2R93I 3S1MI 2PK7A 3D9XA 1X3WA 4E2WA 3S17I 1VQLZ 2B63I 1Z03A 2QR1B 3PO2I 1QVFZ 4QTTA 1RLYA 4NB8A 1VQ41 3HOVI 3CCRZ 2RHBA 1TWAI 1JJ2Z 4RVFA 1VQKZ 3NFZA 1P9NA 4NBAA 2W03A 4Y7NI 3U50C 4NBCA 1VLAA 4A3KI 3CPWZ 3GTQI 5C44I 3IFUA 3S16I 4A3EI 1VQL1 4A3LI 1VQ81 5IP7I 3OW2Z 3EEDA 3G4S1 3VMHA 3JAMf 1YJNZ 3CCR1 2DE7A 3HKZA 4A93I 1VQK1 2JR6A 1R9TI 1S7MA 1NJI1 3I4MI 1Q812 2I3CA 4MD8A 3CQZI 4DK1A 2YU9I 1ZH1A 3CCV1 1L1OC 4NOZA 3J80b 1QF8A 1QVGZ 5IT9f 4E2ZA 3CXCZ 2F4OA 2OTLZ 2O53A 3VMGA 1N2FA 5FLXb 2E9HA 1NUIA 3CCEZ 4RVGA 3IX0A 2K3RA 2R6MA 3HOYI 1N8R1 3S2HI 1YJN1 2RT9A 4A3CI 5FLMI 1JWHC 2QRDB 2R92I 3CC2Z 2K5RA 3KIHA 3HOUI 3CCQ1 2BJOA 2YADA 4MONA 1Q811 3NDJA 2QREB 2QA4Z 4E30A 3VMIA 3CCMZ 4BY7I 3S1RI 5IP9I 2Q4ZA 3VB9A 3CMAZ 4RV9A 5T64A 1K8A2 1YJW1 2OTL1 4S1TA 3FQMA 1YHQZ 1M1K1 3GTMI 3CD6Z 3CCE1 1K732 1VQ4Z 3J7A4 1VQP1 2HF1A 3GTOI 3GTLI 5D1PA 1I50I 3CC21 1M902 5D1OA 3CC71 1ML8A 2VUMI 3CCM1 2E2II 2AKLA 1K8A1 2J6AA 3CMA1 2GTHA 4NBFA 1DL6A 3GTJI 3FKII 1K731 3NH5A 4A3FI 1YJ91 1VQ8Z 1YHQ1 3G4SZ 3CD61 4TNUA 3T4NB 3J80f 2DE6A 2KPIA 1TWHI 4E2YA 2JA8I 5T6BA 1LQLA 5FLXf 2JS4A 3HOWI 2JA7I 3F3FC 2OOYB 3GKQA 1KC82 1Y1VI 3CCVZ 3IF8A 1RQFA 2KI7B 2WAQA 1USPB 3GTPI 1X0TA 1YIT1 2NVYI 1K9M2 2JMOA 4NB9A 1Q862 3M4OI 2Q51A 1KD12 2OTJZ 3S15I 2OOXB 1Q822 1WCMI 4EWCA 4BBRI 3CCQZ 1KQSZ 4BBSI 2QEXZ 4MD7A 1TWFI 3CMEZ 1QVFY 2WB1A 1SFOI 3MONA 3F3PC 1I6HI 2PMZA 1YI2Z 2EGTA 1JJ2Y 1W2BZ 2VF1A 2GU2A 4DQYB 3CCUZ 1YJWZ 2NVXI 1QYPA 1KRLA 2JA6I 1Q7Y2 4NBGA 2NVTI 3CPWY 2OTJ1 3I551 2JNYA 1VQPZ 3RZOI 3M3YI 4NH1C 3J81b 1VQ71 2E2HI 3H3VJ 4DGLA 2RIQA 2NVQI 3HOZI 3CC7Z 3OW2Y 2QEX1 3CME1 3S2DI 3GTMS 3H0GI 3CCL1 3KIFA 4HGZA 4XX2A 3NH4A 4NBDA 3Q87A 1YI21 1VQNZ 3EERA 4E31A 2RBLA 2M48A 4AYBA 3G711 4X6AI 3CCU1 2P28A 2JUBA 1YJ9Z 1ZB9A 4RVDA 2R7ZI 3TE5B 1YUKA 1QVGY 3CXCY 1Y1WI 2LIYA 2RPRA 3I56Z 3S14I 4E2XA 1WW9A 4QTUA 1RO4A 3G6E1 4NBEA 3MZKB 1VQN1 4A3II 2VUGA 4MD9A 3S1NI 1YITZ 1YUAA 3GCFA 2E2JI 1Z02A 2F4MA 1VQ5Z 1Y1VS 2V8KA 1M901 1TWGI 4HGYA 2Y0SA 3GTKI 1Z01A 3PO3I 5T67A 3I561 3P5JB 3QWUA 3J81f 2QKDA 3I07A 4A3MI 1USPA 2W04A 3K7AI 1WIIA 2QLVB 4RS4A 3VTNA 1S721 3S1QI 1VQ51 3I55Z 1YIJZ 5C4JI 5A2Qb 1VQ7Z 3LUSA 1NJI2 1ZB8A 2M6NA 4BXXI 5AN9F 1KC81 3BG0B 3CCLZ 1RNIA 4HH4A 1VQ9Z 3FQQA 3CCJZ 1NP6A 1K9M1 4E33A 1VQ6Z 3G71Z 4BY1I 4A3DI 1I3QI 1Q861 2OZKA 1KD11 3ESWA 1VQMZ 1N8R2 3TDHB 1Q821 1TFIA 1YIJ1 4MXUA 5CM2M 3NDIA 4CL1A 2G2KA 5C4XI 2V8IA 4MRIA 3G6EZ 1VQ91 3CCJ1 2IZ3A 3HOXI 3RZDI 4Y52I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR 1;  3G6E 1;  1KQS Y;  1VQO Z;  1VQ6 1;  1M1K 2;  1Q7Y 1;  3CCS Z;  1VQN 1;  1VQK 1;  1KC8 2;  1VQM 1;  1NJI 1;  3CCV Z;  1Q81 2;  1YIT Z;  1W2B Y;  3CCV 1;  1VQ5 Z;  1YIT 1;  3CC4 Z;  1QVG Z;  1K9M 2;  3CXC Z;  1M90 1;  1Q86 2;  2OTJ Z;  1KD1 2;  2OTL Z;  1Q82 2;  3CCE Z;  3I56 1;  1N8R 1;  3CCQ Z;  1YJN 1;  1KQS Z;  2QEX Z;  1QVF Y;  3CME Z;  3CC2 Z;  1VQO 1;  3CCQ 1;  3CCS 1;  1Q81 1;  2QA4 Z;  1YI2 Z;  1S72 Z;  1JJ2 Y;  3CCM Z;  1W2B Z;  2QA4 1;  1S72 1;  1YJW Z;  3CCU Z;  3CMA Z;  1VQ5 1;  3CC4 1;  3I55 Z;  1YIJ Z;  1Q7Y 2;  1K8A 2;  1VQ7 Z;  1YJW 1;  3CPW Y;  2OTJ 1;  3I55 1;  2OTL 1;  1VQP Z;  1YHQ Z;  1M1K 1;  1NJI 2;  1VQL Z;  3CD6 Z;  1VQ7 1;  3CCE 1;  1KC8 1;  1K73 2;  1VQ4 Z;  1VQP 1;  1QVF Z;  3CCL Z;  1VQ9 Z;  3CC7 Z;  3OW2 Y;  2QEX 1;  3CCJ Z;  3CME 1;  1VQ4 1;  3CC2 1;  1M90 2;  3CCL 1;  3CCR Z;  3CC7 1;  1K9M 1;  1JJ2 Z;  1VQ6 Z;  3G71 Z;  1YI2 1;  1VQN Z;  1Q86 1;  1VQK Z;  3CCM 1;  1KD1 1;  1VQM Z;  1N8R 2;  3G71 1;  1Q82 1;  1K8A 1;  3CCU 1;  3CMA 1;  1YJ9 Z;  3CPW Z;  1YIJ 1;  1K73 1;  1YJ9 1;  1VQ8 Z;  1YHQ 1;  3G4S Z;  1QVG Y;  1VQL 1;  3CD6 1;  3CXC Y;  1VQ8 1;  3OW2 Z;  3G4S 1;  1VQ9 1;  3G6E Z;  3I56 Z;  3CCJ 1;  1YJN Z; 
#chains in the Genus database with same CATH topology
 4NBB A;  1KQS Y;  3GTG I;  1VQO Z;  2ZAE B;  1VQ6 1;  1M1K 2;  2JA5 I;  1Q7Y 1;  3CCS Z;  1X3Z A;  3BG1 B;  1VQM 1;  2GTI A;  2O4H A;  2QRC B;  3NH8 A;  2HU9 A;  2V8J A;  1W2B Y;  1TWC I;  3CC4 Z;  4RVH A;  2PM9 A;  2LFU A;  3MZL B;  3JAM b;  4NBH A;  1RO2 A;  5A2Q f;  2IZ4 A;  4A3B I;  5C3E I;  2DE5 A;  1VQO 1;  4NFR A;  4E32 A;  5LL6 f;  3CCS 1;  3PO3 S;  1K83 I;  1PFT A;  1S72 Z;  5D1O B;  4A3G I;  5IT9 b;  2QA4 1;  4MH4 A;  3I4N I;  2JIO A;  1AA6 A;  4A3J I;  1RO0 A;  2H85 A;  3CC4 1;  2P3Y A;  2R93 I;  3S1M I;  2PK7 A;  3D9X A;  1X3W A;  4E2W A;  3S17 I;  1VQL Z;  2B63 I;  1Z03 A;  2QR1 B;  3PO2 I;  1QVF Z;  4QTT A;  1RLY A;  4NB8 A;  1VQ4 1;  3HOV I;  3CCR Z;  2RHB A;  1TWA I;  1JJ2 Z;  4RVF A;  1FDI A;  2IV2 X;  1VQK Z;  3NFZ A;  1P9N A;  4NBA A;  2W03 A;  4Y7N I;  3U50 C;  4NBC A;  1VLA A;  4A3K I;  3CPW Z;  3GTQ I;  5C44 I;  3IFU A;  3S16 I;  4A3E I;  1VQL 1;  4A3L I;  1WZN A;  1QXF A;  1VQ8 1;  5IP7 I;  1Q16 A;  3OW2 Z;  3EED A;  3G4S 1;  3VMH A;  3JAM f;  1YJN Z;  3CCR 1;  2DE7 A;  3HKZ A;  4A93 I;  1VQK 1;  2JR6 A;  1R9T I;  1S7M A;  1NJI 1;  3I4M I;  1Q81 2;  2I3C A;  4MD8 A;  1SIW A;  3CQZ I;  2JIR A;  4DK1 A;  2YU9 I;  1ZH1 A;  3CCV 1;  1L1O C;  4NOZ A;  3J80 b;  1QF8 A;  1QVG Z;  5IT9 f;  4E2Z A;  3CXC Z;  2F4O A;  1Y8C A;  2OTL Z;  2O53 A;  3VMG A;  1N2F A;  5FLX b;  2E9H A;  1NUI A;  3CCE Z;  4RVG A;  3IX0 A;  2K3R A;  2R6M A;  3HOY I;  1N8R 1;  3S2H I;  1YJN 1;  2RT9 A;  4A3C I;  5FLM I;  1JWH C;  2QRD B;  2R92 I;  3CC2 Z;  2K5R A;  3KIH A;  3HOU I;  3CCQ 1;  2JIP A;  2BJO A;  2YAD A;  4MON A;  1Q81 1;  2VPX A;  3NDJ A;  2QRE B;  2QA4 Z;  4E30 A;  3VMI A;  3CCM Z;  4BY7 I;  3S1R I;  5IP9 I;  2Q4Z A;  3VB9 A;  3CMA Z;  4RV9 A;  3IR7 A;  5T64 A;  1K8A 2;  1YJW 1;  2OTL 1;  4S1T A;  3FQM A;  1YHQ Z;  1M1K 1;  3GTM I;  3CD6 Z;  3CCE 1;  1K73 2;  1VQ4 Z;  3J7A 4;  3D2L A;  1VQP 1;  2HF1 A;  3GTO I;  3GTL I;  5D1P A;  1I50 I;  3CC2 1;  1M90 2;  5D1O A;  3CC7 1;  1ML8 A;  2VUM I;  3CCM 1;  2E2I I;  2AKL A;  1K8A 1;  2J6A A;  3CMA 1;  2VPY A;  2GTH A;  4NBF A;  1DL6 A;  3GTJ I;  3FKI I;  2V3V A;  1K73 1;  3NH5 A;  4A3F I;  1YJ9 1;  1VQ8 Z;  1YHQ 1;  3G4S Z;  3CD6 1;  4TNU A;  3T4N B;  3J80 f;  2DE6 A;  2KPI A;  1TWH I;  4E2Y A;  2JA8 I;  5T6B A;  1LQL A;  5FLX f;  2JS4 A;  3HOW I;  2JA7 I;  3F3F C;  2OOY B;  3GKQ A;  1KC8 2;  1Y1V I;  3CCV Z;  3IF8 A;  1RQF A;  2KI7 B;  2AYD A;  2WAQ A;  1USP B;  3GTP I;  1X0T A;  1YIT 1;  2NVY I;  1K9M 2;  2JMO A;  4NB9 A;  1Q86 2;  3M4O I;  2Q51 A;  1KD1 2;  2OTJ Z;  3S15 I;  2OOX B;  1Q82 2;  2VPW A;  1WCM I;  4EWC A;  4BBR I;  3CCQ Z;  2JIQ A;  1KQS Z;  4BBS I;  2QEX Z;  4MD7 A;  1TWF I;  3CME Z;  1QVF Y;  2WB1 A;  1WJ2 A;  1SFO I;  3MON A;  3F3P C;  1I6H I;  2PMZ A;  1YI2 Z;  2EGT A;  1JJ2 Y;  1W2B Z;  2VF1 A;  2GU2 A;  4DQY B;  3CCU Z;  1YJW Z;  2NVX I;  1QYP A;  1KRL A;  2JA6 I;  1Q7Y 2;  4NBG A;  2NVT I;  3CPW Y;  2OTJ 1;  3I55 1;  2JNY A;  1VQP Z;  3RZO I;  3M3Y I;  4NH1 C;  3J81 b;  1VQ7 1;  2E2H I;  3H3V J;  4DGL A;  2RIQ A;  2NVQ I;  3HOZ I;  3CC7 Z;  3OW2 Y;  2QEX 1;  3CME 1;  1FDO A;  3S2D I;  3GTM S;  3H0G I;  3CCL 1;  3KIF A;  4HGZ A;  4XX2 A;  3NH4 A;  4NBD A;  3Q87 A;  1YI2 1;  1VQN Z;  3EER A;  4E31 A;  2RBL A;  2M48 A;  4AYB A;  3G71 1;  4X6A I;  3CCU 1;  2P28 A;  2VPZ A;  2JUB A;  1YJ9 Z;  1ZB9 A;  4RVD A;  2R7Z I;  3TE5 B;  1YUK A;  1QVG Y;  3CXC Y;  1Y1W I;  2LIY A;  2RPR A;  3I56 Z;  3S14 I;  4E2X A;  1WW9 A;  4QTU A;  1RO4 A;  3G6E 1;  4NBE A;  3MZK B;  1VQN 1;  4A3I I;  2VUG A;  4MD9 A;  3S1N I;  1YIT Z;  1YUA A;  3GCF A;  2E2J I;  1Z02 A;  2F4M A;  1VQ5 Z;  1Y1V S;  2V8K A;  1M90 1;  1TWG I;  4HGY A;  2Y0S A;  3GTK I;  1Z01 A;  3PO3 I;  5T67 A;  3I56 1;  3P5J B;  3QWU A;  2E7Z A;  3J81 f;  2QKD A;  3I07 A;  4A3M I;  1USP A;  2NAP A;  2W04 A;  3K7A I;  1WII A;  2QLV B;  4RS4 A;  3VTN A;  1S72 1;  3S1Q I;  1VQ5 1;  3I55 Z;  1YIJ Z;  5C4J I;  5A2Q b;  1VQ7 Z;  3LUS A;  1NJI 2;  1ZB8 A;  2M6N A;  4BXX I;  5AN9 F;  1KC8 1;  3BG0 B;  3CCL Z;  1RNI A;  4HH4 A;  1VQ9 Z;  3FQQ A;  3CCJ Z;  3RZD I;  1NP6 A;  2JIM A;  2V45 A;  1K9M 1;  4E33 A;  1VQ6 Z;  3G71 Z;  4BY1 I;  4A3D I;  1I3Q I;  1Q86 1;  2OZK A;  1KD1 1;  3ESW A;  1VQM Z;  1N8R 2;  3TDH B;  1Q82 1;  1TFI A;  1YIJ 1;  4MXU A;  5CM2 M;  3NDI A;  4CL1 A;  2G2K A;  5C4X I;  2V8I A;  2LEX A;  4MRI A;  3G6E Z;  1VQ9 1;  3CCJ 1;  2IZ3 A;  3HOX I;  3D6W A;  4Y52 I; 
#chains in the Genus database with same CATH homology
 4NBB A;  1KQS Y;  3GTG I;  1VQO Z;  2ZAE B;  1VQ6 1;  1M1K 2;  2JA5 I;  1Q7Y 1;  3CCS Z;  1X3Z A;  3BG1 B;  1VQM 1;  2GTI A;  2O4H A;  2QRC B;  3NH8 A;  2HU9 A;  2V8J A;  1W2B Y;  1TWC I;  3CC4 Z;  3D6W A;  4RVH A;  2PM9 A;  2LFU A;  3MZL B;  3JAM b;  4NBH A;  1RO2 A;  5A2Q f;  2IZ4 A;  4A3B I;  5C3E I;  2DE5 A;  1VQO 1;  4NFR A;  4E32 A;  5LL6 f;  3CCS 1;  3PO3 S;  1K83 I;  1PFT A;  1S72 Z;  5D1O B;  4A3G I;  5IT9 b;  2QA4 1;  4MH4 A;  3I4N I;  4A3J I;  1RO0 A;  2H85 A;  3CC4 1;  2P3Y A;  2R93 I;  3S1M I;  2PK7 A;  3D9X A;  1X3W A;  4E2W A;  3S17 I;  1VQL Z;  2B63 I;  1Z03 A;  2QR1 B;  3PO2 I;  1QVF Z;  4QTT A;  1RLY A;  4NB8 A;  1VQ4 1;  3HOV I;  3CCR Z;  2RHB A;  1TWA I;  1JJ2 Z;  4RVF A;  1VQK Z;  3NFZ A;  1P9N A;  4NBA A;  2W03 A;  4Y7N I;  3U50 C;  4NBC A;  1VLA A;  4A3K I;  3CPW Z;  3GTQ I;  5C44 I;  3IFU A;  3S16 I;  4A3E I;  1VQL 1;  4A3L I;  1VQ8 1;  5IP7 I;  3OW2 Z;  3EED A;  3G4S 1;  3VMH A;  3JAM f;  1YJN Z;  3CCR 1;  2DE7 A;  3HKZ A;  4A93 I;  1VQK 1;  2JR6 A;  1R9T I;  1S7M A;  1NJI 1;  3I4M I;  1Q81 2;  2I3C A;  4MD8 A;  3CQZ I;  4DK1 A;  2YU9 I;  1ZH1 A;  3CCV 1;  1L1O C;  4NOZ A;  3J80 b;  1QF8 A;  1QVG Z;  5IT9 f;  4E2Z A;  3CXC Z;  2F4O A;  2OTL Z;  2O53 A;  3VMG A;  1N2F A;  5FLX b;  2E9H A;  1NUI A;  3CCE Z;  4RVG A;  3IX0 A;  2K3R A;  2R6M A;  3HOY I;  1N8R 1;  3S2H I;  1YJN 1;  2RT9 A;  4A3C I;  5FLM I;  1JWH C;  2QRD B;  2R92 I;  3CC2 Z;  2K5R A;  3KIH A;  3HOU I;  3CCQ 1;  2BJO A;  2YAD A;  4MON A;  1Q81 1;  3NDJ A;  2QRE B;  2QA4 Z;  4E30 A;  3VMI A;  3CCM Z;  4BY7 I;  3S1R I;  5IP9 I;  2Q4Z A;  3VB9 A;  3CMA Z;  4RV9 A;  5T64 A;  1K8A 2;  1YJW 1;  2OTL 1;  4S1T A;  3FQM A;  1YHQ Z;  1M1K 1;  3GTM I;  3CD6 Z;  3CCE 1;  1K73 2;  1VQ4 Z;  3J7A 4;  1VQP 1;  2HF1 A;  3GTO I;  3GTL I;  5D1P A;  1I50 I;  3CC2 1;  1M90 2;  5D1O A;  3CC7 1;  1ML8 A;  2VUM I;  3CCM 1;  2E2I I;  2AKL A;  1K8A 1;  2J6A A;  3CMA 1;  2GTH A;  4NBF A;  1DL6 A;  3GTJ I;  3FKI I;  1K73 1;  3NH5 A;  4A3F I;  1YJ9 1;  1VQ8 Z;  1YHQ 1;  3G4S Z;  3CD6 1;  4TNU A;  3T4N B;  3J80 f;  2DE6 A;  2KPI A;  1TWH I;  4E2Y A;  2JA8 I;  5T6B A;  1LQL A;  5FLX f;  2JS4 A;  3HOW I;  2JA7 I;  3F3F C;  2OOY B;  3GKQ A;  1KC8 2;  1Y1V I;  3CCV Z;  3IF8 A;  1RQF A;  2KI7 B;  2WAQ A;  1USP B;  3GTP I;  1X0T A;  1YIT 1;  2NVY I;  1K9M 2;  2JMO A;  4NB9 A;  1Q86 2;  3M4O I;  2Q51 A;  1KD1 2;  2OTJ Z;  3S15 I;  2OOX B;  1Q82 2;  1WCM I;  4EWC A;  4BBR I;  3CCQ Z;  1KQS Z;  4BBS I;  2QEX Z;  4MD7 A;  1TWF I;  3CME Z;  1QVF Y;  2WB1 A;  1SFO I;  3MON A;  3F3P C;  1I6H I;  2PMZ A;  1YI2 Z;  2EGT A;  1JJ2 Y;  1W2B Z;  2VF1 A;  2GU2 A;  4DQY B;  3CCU Z;  1YJW Z;  2NVX I;  1QYP A;  1KRL A;  2JA6 I;  1Q7Y 2;  4NBG A;  2NVT I;  3CPW Y;  2OTJ 1;  3I55 1;  2JNY A;  1VQP Z;  3RZO I;  3M3Y I;  4NH1 C;  3J81 b;  1VQ7 1;  2E2H I;  3H3V J;  4DGL A;  2RIQ A;  2NVQ I;  3HOZ I;  3CC7 Z;  3OW2 Y;  2QEX 1;  3CME 1;  3S2D I;  3GTM S;  3H0G I;  3CCL 1;  3KIF A;  4HGZ A;  4XX2 A;  3NH4 A;  4NBD A;  3Q87 A;  1YI2 1;  1VQN Z;  3EER A;  4E31 A;  2RBL A;  2M48 A;  4AYB A;  3G71 1;  4X6A I;  3CCU 1;  2P28 A;  2JUB A;  1YJ9 Z;  1ZB9 A;  4RVD A;  2R7Z I;  3TE5 B;  1YUK A;  1QVG Y;  3CXC Y;  1Y1W I;  2LIY A;  2RPR A;  3I56 Z;  3S14 I;  4E2X A;  1WW9 A;  4QTU A;  1RO4 A;  3G6E 1;  4NBE A;  3MZK B;  1VQN 1;  4A3I I;  2VUG A;  4MD9 A;  3S1N I;  1YIT Z;  1YUA A;  3GCF A;  2E2J I;  1Z02 A;  2F4M A;  1VQ5 Z;  1Y1V S;  2V8K A;  1M90 1;  1TWG I;  4HGY A;  2Y0S A;  3GTK I;  1Z01 A;  3PO3 I;  5T67 A;  3I56 1;  3P5J B;  3QWU A;  3J81 f;  2QKD A;  3I07 A;  4A3M I;  1USP A;  2W04 A;  3K7A I;  1WII A;  2QLV B;  4RS4 A;  3VTN A;  1S72 1;  3S1Q I;  1VQ5 1;  3I55 Z;  1YIJ Z;  5C4J I;  5A2Q b;  1VQ7 Z;  3LUS A;  1NJI 2;  1ZB8 A;  2M6N A;  4BXX I;  5AN9 F;  1KC8 1;  3BG0 B;  3CCL Z;  1RNI A;  4HH4 A;  1VQ9 Z;  3FQQ A;  3CCJ Z;  1NP6 A;  1K9M 1;  4E33 A;  1VQ6 Z;  3G71 Z;  4BY1 I;  4A3D I;  1I3Q I;  1Q86 1;  2OZK A;  1KD1 1;  3ESW A;  1VQM Z;  1N8R 2;  3TDH B;  1Q82 1;  1TFI A;  1YIJ 1;  4MXU A;  5CM2 M;  3NDI A;  4CL1 A;  2G2K A;  5C4X I;  2V8I A;  4MRI A;  3G6E Z;  1VQ9 1;  3CCJ 1;  2IZ3 A;  3HOX I;  3RZD I;  4Y52 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...