1Q812

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q81200
1QVFY 1YI21 3CCV1 1VQPZ 3CD61 1N8R2 1QVGY 2QEX1 3CC21 3CCL1 1K8A1 3CC71 1KQSZ 3CCJ1 3CCRZ 3CME1 1N8R1 3CC4Z 3CMA1 1VQM1 1VQOZ 3CCQZ 1YHQZ 3CCS1 3G6E1 1NJI2 1K9M2 3CXCY 3I551 1JJ2Y 1W2BZ 1S721 2OTL1 1VQK1 1YJ91 3I56Z 1VQ61 1YJW1 1NJI1 1K9M1 1M1K1 1YJN1 3CCMZ 1QVGZ 1VQ41 1VQ51 3G4S1 3G711 2QA4Z 3CCU1 1YITZ 1VQNZ 1VQLZ 1Q7Y2 2OTJ1 1S72Z 1Q862 1VQ81 2OTLZ 1VQ7Z 1YIJ1 1YI2Z 3CCVZ 3CPWY 3OW2Y 1VQ91 3CD6Z 2QEXZ 1K732 1Q7Y1 1Q861 1KQSY 3CC2Z 3CCLZ 3CC7Z 1VQP1 1Q812 1QVFZ 1Q822 3CCJZ 1KC82 3CMEZ 3CCE1 1K731 3CMAZ 1VQMZ 3CCR1 1VQ8Z 1Q811 3CCSZ 3G6EZ 1Q821 3I55Z 1KC81 1VQO1 3CCQ1 1YHQ1 1VQKZ 1KD12 1M902 1YJ9Z 1VQ6Z 3CXCZ 1YJWZ 3CPWZ 3OW2Z 1JJ2Z 1YJNZ 3I561 1VQ4Z 1VQ5Z 3CCEZ 1KD11 1M901 3G4SZ 3CCM1 3G71Z 3CCUZ 2OTJZ 1YIJZ 2QA41 1W2BY 3CC41 1YIT1 1VQN1 1M1K2 1VQL1 1VQ9Z 1K8A2 1VQ71
chains in the Genus database with same CATH superfamily
4MD9A 3BG1B 2M6NA 1I3QI 1N8R2 4RVGA 3S1NI 2VPZA 3CQZI 1TFIA 1TWAI 1X3WA 2V3VA 3HKZA 3GTGI 3S17I 2RT9A 3CCJ1 2QREB 3I4NI 2QRCB 2NVYI 3CMA1 4TNUA 2JA7I 1RO2A 3CCS1 3RZDI 3GTOI 4QTTA 1VLAA 1JJ2Y 1WJ2A 1W2BZ 2AYDA 5FLXf 4AYBA 4QTUA 2QRDB 2YU9I 1YJW1 3M4OI 2NVTI 2JA8I 2RIQA 3CCMZ 1QVGZ 1SIWA 1VQ51 1FDIA 3G4S1 2M48A 4NBFA 2GTHA 3GTMI 2KPIA 2Y0SA 3HOWI 1Q7Y2 1Z01A 4NBCA 2OTJ1 3J80b 3MZKB 2AKLA 1VQ7Z 1K83I 4X6AI 3CPWY 3OW2Y 1KRLA 4E33A 3CD6Z 5FLMI 2R92I 2Q4ZA 1KQSY 3CC2Z 3CCLZ 1Q812 2O4HA 3Q87A 3GTJI 1KC82 1YUKA 3CMEZ 2JUBA 2GTIA 5D1OA 2K3RA 1X3ZA 4RV9A 2IV2X 4RS4A 3G6EZ 4HGZA 5IT9b 2DE7A 4BY1I 1X0TA 1Z02A 2BJOA 2E7ZA 1WZNA 3VMGA 3J81b 2W03A 2DE5A 1JJ2Z 3I561 1VQ4Z 2JA5I 3VB9A 3S1MI 1KD11 3JAMf 3HOVI 2DE6A 4NB8A 4A3KI 1QYPA 2RBLA 4MRIA 3CCUZ 2R93I 1ZB8A 3GTMS 1W2BY 1VQN1 5C44I 1Z03A 1K8A2 3CCV1 3D2LA 2JA6I 5AN9F 1QVGY 2QEX1 3S16I 1RNIA 1KQSZ 2OOXB 2P3YA 2RHBA 4NBBA 1N8R1 2OZKA 3LUSA 3HOUI 3D6WA 2V45A 1VQM1 1VQOZ 3CCQZ 4A3JI 3I551 5IP7I 1S721 1RO4A 4MXUA 1VQK1 3K7AI 1R9TI 3TDHB 1YJ91 3U50C 1USPB 3S1QI 4BBSI 4A3DI 2I3CA 3T4NB 3GTPI 4MH4A 3G711 1YITZ 1VQLZ 2JIPA 1WIIA 2E9HA 1S72Z 1Q862 1VQ81 1YIJ1 3S2HI 3ESWA 3F3FC 2F4OA 2JIMA 3GCFA 3VMHA 5CM2M 1K732 1Q7Y1 5D1OB 4A3FI 3NDJA 1VQP1 2R7ZI 3CCJZ 3HOXI 1P9NA 3CCE1 1USPA 3CMAZ 3CCR1 2ZAEB 3M3YI 1VQ8Z 1Q811 3CCSZ 4DK1A 1KC81 4RVDA 5C4XI 2QLVB 1YHQ1 3GTQI 2JMOA 1Y1VI 3FQQA 1L1OC 1YJWZ 4DQYB 2VPYA 4E2XA 1I6HI 1VQ5Z 3CCEZ 3G4SZ 3TE5B 2VPWA 4NB9A 2OTJZ 4BBRI 3NH8A 3S2DI 2PM9A 2QA41 3CC41 2VPXA 2JS4A 3FQMA 4A3EI 1ML8A 1YI21 3EERA 3J80f 4A3II 3FKII 1Y1WI 3IX0A 1I50I 2EGTA 4NBEA 5A2Qf 1K8A1 5C3EI 3CC71 5T64A 2WAQA 1RO0A 3S1RI 1TWCI 3CC4Z 2QKDA 5LL6f 5T67A 3I07A 1NJI2 1K9M2 3GTKI 4NOZA 1Y1VS 2LIYA 4NBGA 2OTL1 3I4MI 3NDIA 3P5JB 3I56Z 1VQ61 1M1K1 1YJN1 1YUAA 4NH1C 2RPRA 1VQNZ 2E2II 2O53A 2W04A 2OTLZ 2V8JA 3QWUA 3HOZI 2JNYA 3CCVZ 4BXXI 1VQ91 3NFZA 2QEXZ 3NH5A 1RLYA 1Q861 2QR1B 1SFOI 4E31A 1Q822 1WCMI 3EEDA 2R6MA 3F3PC 4NFRA 4NBDA 4E2ZA 3H0GI 2VUMI 1K731 4DGLA 1VQMZ 5FLXb 3I55Z 1TWFI 4HH4A 1VQKZ 2V8IA 1M902 1YJ9Z 2HU9A 3PO3I 4NBHA 1LQLA 3VMIA 2F4MA 4Y52I 2HF1A 3D9XA 4E2WA 2NAPA 3KIHA 4NBAA 2K5RA 3VTNA 3PO2I 1S7MA 3MZLB 4S1TA 3CCM1 3G71Z 2Q51A 2IZ4A 2PK7A 1Y8CA 2P28A 4A3CI 1YIJZ 2JR6A 2B63I 4HGYA 1VQ71 3H3VJ 1QVFY 2YADA 3HOYI 5C4JI 1VQPZ 3S14I 3CD61 2E2JI 5D1PA 5IP9I 3CC21 3CCL1 3BG0B 1FDOA 4A3MI 3CCRZ 1RQFA 1TWHI 3CME1 1AA6A 4EWCA 1YHQZ 3G6E1 4RVHA 3CXCY 1WW9A 2JIOA 1NP6A 2LFUA 5A2Qb 3PO3S 3GTLI 3JAMb 3RZOI 2H85A 3KIFA 2IZ3A 1ZB9A 4A93I 1NJI1 1K9M1 2JIQA 1VQ41 4E2YA 4MONA 2E2HI 1ZH1A 2PMZA 1N2FA 2GU2A 4E30A 5T6BA 2QA4Z 3CCU1 4RVFA 2V8KA 2LEXA 1YI2Z 3IF8A 5IT9f 3MONA 3CC7Z 1TWGI 1QVFZ 2J6AA 3J81f 4E32A 2NVXI 3GKQA 4MD8A 4Y7NI 1Q821 1VQO1 2VUGA 3CCQ1 2KI7B 1KD12 3J7A4 1NUIA 1Q16A 1PFTA 1VQ6Z 1JWHC 3CXCZ 3CPWZ 3OW2Z 2OOYB 1YJNZ 4CL1A 4A3GI 4A3LI 4XX2A 3S15I 3NH4A 1DL6A 1M901 2JIRA 4BY7I 2G2KA 2VF1A 3IR7A 4A3BI 2WB1A 1QF8A 1QXFA 1YIT1 4MD7A 1M1K2 1VQL1 2NVQI 1VQ9Z 3IFUA
chains in the Genus database with same CATH topology
4MD9A 3BG1B 2M6NA 1I3QI 1N8R2 4RVGA 3S1NI 3CQZI 1TFIA 1TWAI 1X3WA 3HKZA 3GTGI 3S17I 2RT9A 3CCJ1 2QREB 3I4NI 2QRCB 2NVYI 3CMA1 4TNUA 2JA7I 1RO2A 3CCS1 3RZDI 3GTOI 4QTTA 1VLAA 1JJ2Y 1W2BZ 5FLXf 4AYBA 4QTUA 2QRDB 2YU9I 1YJW1 3M4OI 2NVTI 2JA8I 2RIQA 3CCMZ 1QVGZ 1VQ51 3G4S1 2M48A 4NBFA 2GTHA 3GTMI 2KPIA 2Y0SA 3HOWI 1Q7Y2 1Z01A 4NBCA 2OTJ1 3J80b 3MZKB 2AKLA 1VQ7Z 1K83I 4X6AI 3CPWY 3OW2Y 1KRLA 4E33A 3CD6Z 5FLMI 2R92I 2Q4ZA 1KQSY 3CC2Z 3CCLZ 1Q812 2O4HA 3Q87A 3GTJI 1KC82 1YUKA 3CMEZ 2JUBA 2GTIA 5D1OA 2K3RA 1X3ZA 4RV9A 4RS4A 3G6EZ 4HGZA 5IT9b 2DE7A 4BY1I 1X0TA 1Z02A 2BJOA 3VMGA 3J81b 2W03A 2DE5A 1JJ2Z 3I561 1VQ4Z 2JA5I 3VB9A 3S1MI 1KD11 3JAMf 3HOVI 2DE6A 4NB8A 4A3KI 1QYPA 2RBLA 4MRIA 3CCUZ 2R93I 1ZB8A 3GTMS 1W2BY 1VQN1 5C44I 1Z03A 1K8A2 3CCV1 2JA6I 5AN9F 1QVGY 2QEX1 3S16I 1RNIA 1KQSZ 2OOXB 2P3YA 2RHBA 4NBBA 1N8R1 2OZKA 3LUSA 3HOUI 3D6WA 1VQM1 1VQOZ 3CCQZ 4A3JI 3I551 5IP7I 1S721 1RO4A 4MXUA 1VQK1 3K7AI 1R9TI 3TDHB 1YJ91 3U50C 1USPB 3S1QI 4BBSI 4A3DI 2I3CA 3T4NB 3GTPI 4MH4A 3G711 1YITZ 1VQLZ 1WIIA 2E9HA 1S72Z 1Q862 1VQ81 1YIJ1 3S2HI 3ESWA 3F3FC 2F4OA 3GCFA 3VMHA 5CM2M 1K732 1Q7Y1 5D1OB 4A3FI 3NDJA 1VQP1 2R7ZI 3CCJZ 3HOXI 1P9NA 3CCE1 1USPA 3CMAZ 3CCR1 2ZAEB 3M3YI 1VQ8Z 1Q811 3CCSZ 4DK1A 1KC81 4RVDA 5C4XI 2QLVB 1YHQ1 3GTQI 2JMOA 1Y1VI 3FQQA 1L1OC 1YJWZ 4DQYB 4E2XA 1I6HI 1VQ5Z 3CCEZ 3G4SZ 3TE5B 4NB9A 2OTJZ 4BBRI 3NH8A 3S2DI 2PM9A 2QA41 3CC41 2JS4A 3FQMA 4A3EI 1ML8A 1YI21 3EERA 3J80f 4A3II 3FKII 1Y1WI 3IX0A 1I50I 2EGTA 4NBEA 5A2Qf 1K8A1 5C3EI 3CC71 5T64A 2WAQA 1RO0A 3S1RI 1TWCI 3CC4Z 2QKDA 5LL6f 5T67A 3I07A 1NJI2 1K9M2 3GTKI 4NOZA 1Y1VS 2LIYA 4NBGA 2OTL1 3I4MI 3NDIA 3P5JB 3I56Z 1VQ61 1M1K1 1YJN1 1YUAA 4NH1C 2RPRA 1VQNZ 2E2II 2O53A 2W04A 2OTLZ 2V8JA 3QWUA 3HOZI 2JNYA 3CCVZ 4BXXI 1VQ91 3NFZA 2QEXZ 3NH5A 1RLYA 1Q861 2QR1B 1SFOI 4E31A 1Q822 1WCMI 3EEDA 2R6MA 3F3PC 4NFRA 4NBDA 4E2ZA 3H0GI 2VUMI 1K731 4DGLA 1VQMZ 5FLXb 3I55Z 1TWFI 4HH4A 1VQKZ 2V8IA 1M902 1YJ9Z 2HU9A 3PO3I 4NBHA 1LQLA 3VMIA 2F4MA 4Y52I 2HF1A 3D9XA 4E2WA 3KIHA 4NBAA 2K5RA 3VTNA 3PO2I 1S7MA 3MZLB 4S1TA 3CCM1 3G71Z 2Q51A 2IZ4A 2PK7A 2P28A 4A3CI 1YIJZ 2JR6A 2B63I 4HGYA 1VQ71 3H3VJ 1QVFY 2YADA 3HOYI 5C4JI 1VQPZ 3S14I 3CD61 2E2JI 5D1PA 5IP9I 3CC21 3CCL1 3BG0B 4A3MI 3CCRZ 1RQFA 1TWHI 3CME1 4EWCA 1YHQZ 3G6E1 4RVHA 3CXCY 1WW9A 1NP6A 2LFUA 5A2Qb 3PO3S 3GTLI 3JAMb 3RZOI 2H85A 3KIFA 2IZ3A 1ZB9A 4A93I 1NJI1 1K9M1 1VQ41 4E2YA 4MONA 2E2HI 1ZH1A 2PMZA 1N2FA 2GU2A 4E30A 5T6BA 2QA4Z 3CCU1 4RVFA 2V8KA 1YI2Z 3IF8A 5IT9f 3MONA 3CC7Z 1TWGI 1QVFZ 2J6AA 3J81f 4E32A 2NVXI 3GKQA 4MD8A 4Y7NI 1Q821 1VQO1 2VUGA 3CCQ1 2KI7B 1KD12 3J7A4 1NUIA 1PFTA 1VQ6Z 1JWHC 3CXCZ 3CPWZ 3OW2Z 2OOYB 1YJNZ 4CL1A 4A3GI 4A3LI 4XX2A 3S15I 3NH4A 1DL6A 1M901 4BY7I 2G2KA 2VF1A 4A3BI 2WB1A 1QF8A 1YIT1 4MD7A 1M1K2 1VQL1 2NVQI 1VQ9Z 3IFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF Y;  1YI2 1;  3CCV 1;  1VQP Z;  3CD6 1;  1N8R 2;  1QVG Y;  2QEX 1;  3CC2 1;  3CCL 1;  1K8A 1;  3CC7 1;  1KQS Z;  3CCJ 1;  3CCR Z;  3CME 1;  1N8R 1;  3CC4 Z;  3CMA 1;  1VQM 1;  1VQO Z;  3CCQ Z;  1YHQ Z;  3CCS 1;  3G6E 1;  1NJI 2;  1K9M 2;  3CXC Y;  3I55 1;  1JJ2 Y;  1W2B Z;  1S72 1;  2OTL 1;  1VQK 1;  1YJ9 1;  3I56 Z;  1VQ6 1;  1YJW 1;  1NJI 1;  1K9M 1;  1M1K 1;  1YJN 1;  3CCM Z;  1QVG Z;  1VQ4 1;  1VQ5 1;  3G4S 1;  3G71 1;  2QA4 Z;  3CCU 1;  1YIT Z;  1VQN Z;  1VQL Z;  1Q7Y 2;  2OTJ 1;  1S72 Z;  1Q86 2;  1VQ8 1;  2OTL Z;  1VQ7 Z;  1YIJ 1;  1YI2 Z;  3CCV Z;  3CPW Y;  3OW2 Y;  1VQ9 1;  3CD6 Z;  2QEX Z;  1K73 2;  1Q7Y 1;  1Q86 1;  1KQS Y;  3CC2 Z;  3CCL Z;  3CC7 Z;  1VQP 1;  1Q81 2;  1QVF Z;  1Q82 2;  3CCJ Z;  1KC8 2;  3CME Z;  3CCE 1;  1K73 1;  3CMA Z;  1VQM Z;  3CCR 1;  1VQ8 Z;  1Q81 1;  3CCS Z;  3G6E Z;  1Q82 1;  3I55 Z;  1KC8 1;  1VQO 1;  3CCQ 1;  1YHQ 1;  1VQK Z;  1KD1 2;  1M90 2;  1YJ9 Z;  1VQ6 Z;  3CXC Z;  1YJW Z;  3CPW Z;  3OW2 Z;  1JJ2 Z;  1YJN Z;  3I56 1;  1VQ4 Z;  1VQ5 Z;  3CCE Z;  1KD1 1;  1M90 1;  3G4S Z;  3CCM 1;  3G71 Z;  3CCU Z;  2OTJ Z;  1YIJ Z;  2QA4 1;  1W2B Y;  3CC4 1;  1YIT 1;  1VQN 1;  1M1K 2;  1VQL 1;  1VQ9 Z;  1K8A 2;  1VQ7 1; 
#chains in the Genus database with same CATH topology
 4MD9 A;  3BG1 B;  2M6N A;  1I3Q I;  1N8R 2;  4RVG A;  3S1N I;  2VPZ A;  3CQZ I;  1TFI A;  1TWA I;  1X3W A;  2V3V A;  3HKZ A;  3GTG I;  3S17 I;  2RT9 A;  3CCJ 1;  2QRE B;  3I4N I;  2QRC B;  2NVY I;  3CMA 1;  4TNU A;  2JA7 I;  1RO2 A;  3CCS 1;  3RZD I;  3GTO I;  4QTT A;  1VLA A;  1JJ2 Y;  1WJ2 A;  1W2B Z;  2AYD A;  5FLX f;  4AYB A;  4QTU A;  2QRD B;  2YU9 I;  1YJW 1;  3M4O I;  2NVT I;  2JA8 I;  2RIQ A;  3CCM Z;  1QVG Z;  1SIW A;  1VQ5 1;  1FDI A;  3G4S 1;  2M48 A;  4NBF A;  2GTH A;  3GTM I;  2KPI A;  2Y0S A;  3HOW I;  1Q7Y 2;  1Z01 A;  4NBC A;  2OTJ 1;  3J80 b;  3MZK B;  2AKL A;  1VQ7 Z;  1K83 I;  4X6A I;  3CPW Y;  3OW2 Y;  1KRL A;  4E33 A;  3CD6 Z;  5FLM I;  2R92 I;  2Q4Z A;  1KQS Y;  3CC2 Z;  3CCL Z;  1Q81 2;  2O4H A;  3Q87 A;  3GTJ I;  1KC8 2;  1YUK A;  3CME Z;  2JUB A;  2GTI A;  5D1O A;  2K3R A;  1X3Z A;  4RV9 A;  2IV2 X;  4RS4 A;  3G6E Z;  4HGZ A;  5IT9 b;  2DE7 A;  4BY1 I;  1X0T A;  1Z02 A;  2BJO A;  2E7Z A;  1WZN A;  3VMG A;  3J81 b;  2W03 A;  2DE5 A;  1JJ2 Z;  3I56 1;  1VQ4 Z;  2JA5 I;  3VB9 A;  3S1M I;  1KD1 1;  3JAM f;  3HOV I;  2DE6 A;  4NB8 A;  4A3K I;  1QYP A;  2RBL A;  4MRI A;  3CCU Z;  2R93 I;  1ZB8 A;  3GTM S;  1W2B Y;  1VQN 1;  5C44 I;  1Z03 A;  1K8A 2;  3CCV 1;  3D2L A;  2JA6 I;  5AN9 F;  1QVG Y;  2QEX 1;  3S16 I;  1RNI A;  1KQS Z;  2OOX B;  2P3Y A;  2RHB A;  4NBB A;  1N8R 1;  2OZK A;  3LUS A;  3HOU I;  3D6W A;  2V45 A;  1VQM 1;  1VQO Z;  3CCQ Z;  4A3J I;  3I55 1;  5IP7 I;  1S72 1;  1RO4 A;  4MXU A;  1VQK 1;  3K7A I;  1R9T I;  3TDH B;  1YJ9 1;  3U50 C;  1USP B;  3S1Q I;  4BBS I;  4A3D I;  2I3C A;  3T4N B;  3GTP I;  4MH4 A;  3G71 1;  1YIT Z;  1VQL Z;  2JIP A;  1WII A;  2E9H A;  1S72 Z;  1Q86 2;  1VQ8 1;  1YIJ 1;  3S2H I;  3ESW A;  3F3F C;  2F4O A;  2JIM A;  3GCF A;  3VMH A;  5CM2 M;  1K73 2;  1Q7Y 1;  5D1O B;  4A3F I;  3NDJ A;  1VQP 1;  2R7Z I;  3CCJ Z;  3HOX I;  1P9N A;  3CCE 1;  1USP A;  3CMA Z;  3CCR 1;  2ZAE B;  3M3Y I;  1VQ8 Z;  1Q81 1;  3CCS Z;  4DK1 A;  1KC8 1;  4RVD A;  5C4X I;  2QLV B;  1YHQ 1;  3GTQ I;  2JMO A;  1Y1V I;  3FQQ A;  1L1O C;  1YJW Z;  4DQY B;  2VPY A;  4E2X A;  1I6H I;  1VQ5 Z;  3CCE Z;  3G4S Z;  3TE5 B;  2VPW A;  4NB9 A;  2OTJ Z;  4BBR I;  3NH8 A;  3S2D I;  2PM9 A;  2QA4 1;  3CC4 1;  2VPX A;  2JS4 A;  3FQM A;  4A3E I;  1ML8 A;  1YI2 1;  3EER A;  3J80 f;  4A3I I;  3FKI I;  1Y1W I;  3IX0 A;  1I50 I;  2EGT A;  4NBE A;  5A2Q f;  1K8A 1;  5C3E I;  3CC7 1;  5T64 A;  2WAQ A;  1RO0 A;  3S1R I;  1TWC I;  3CC4 Z;  2QKD A;  5LL6 f;  5T67 A;  3I07 A;  1NJI 2;  1K9M 2;  3GTK I;  4NOZ A;  1Y1V S;  2LIY A;  4NBG A;  2OTL 1;  3I4M I;  3NDI A;  3P5J B;  3I56 Z;  1VQ6 1;  1M1K 1;  1YJN 1;  1YUA A;  4NH1 C;  2RPR A;  1VQN Z;  2E2I I;  2O53 A;  2W04 A;  2OTL Z;  2V8J A;  3QWU A;  3HOZ I;  2JNY A;  3CCV Z;  4BXX I;  1VQ9 1;  3NFZ A;  2QEX Z;  3NH5 A;  1RLY A;  1Q86 1;  2QR1 B;  1SFO I;  4E31 A;  1Q82 2;  1WCM I;  3EED A;  2R6M A;  3F3P C;  4NFR A;  4NBD A;  4E2Z A;  3H0G I;  2VUM I;  1K73 1;  4DGL A;  1VQM Z;  5FLX b;  3I55 Z;  1TWF I;  4HH4 A;  1VQK Z;  2V8I A;  1M90 2;  1YJ9 Z;  2HU9 A;  3PO3 I;  4NBH A;  1LQL A;  3VMI A;  2F4M A;  4Y52 I;  2HF1 A;  3D9X A;  4E2W A;  2NAP A;  3KIH A;  4NBA A;  2K5R A;  3VTN A;  3PO2 I;  1S7M A;  3MZL B;  4S1T A;  3CCM 1;  3G71 Z;  2Q51 A;  2IZ4 A;  2PK7 A;  1Y8C A;  2P28 A;  4A3C I;  1YIJ Z;  2JR6 A;  2B63 I;  4HGY A;  1VQ7 1;  3H3V J;  1QVF Y;  2YAD A;  3HOY I;  5C4J I;  1VQP Z;  3S14 I;  3CD6 1;  2E2J I;  5D1P A;  5IP9 I;  3CC2 1;  3CCL 1;  3BG0 B;  1FDO A;  4A3M I;  3CCR Z;  1RQF A;  1TWH I;  3CME 1;  1AA6 A;  4EWC A;  1YHQ Z;  3G6E 1;  4RVH A;  3CXC Y;  1WW9 A;  2JIO A;  1NP6 A;  2LFU A;  5A2Q b;  3PO3 S;  3GTL I;  3JAM b;  3RZO I;  2H85 A;  3KIF A;  2IZ3 A;  1ZB9 A;  4A93 I;  1NJI 1;  1K9M 1;  2JIQ A;  1VQ4 1;  4E2Y A;  4MON A;  2E2H I;  1ZH1 A;  2PMZ A;  1N2F A;  2GU2 A;  4E30 A;  5T6B A;  2QA4 Z;  3CCU 1;  4RVF A;  2V8K A;  2LEX A;  1YI2 Z;  3IF8 A;  5IT9 f;  3MON A;  3CC7 Z;  1TWG I;  1QVF Z;  2J6A A;  3J81 f;  4E32 A;  2NVX I;  3GKQ A;  4MD8 A;  4Y7N I;  1Q82 1;  1VQO 1;  2VUG A;  3CCQ 1;  2KI7 B;  1KD1 2;  3J7A 4;  1NUI A;  1Q16 A;  1PFT A;  1VQ6 Z;  1JWH C;  3CXC Z;  3CPW Z;  3OW2 Z;  2OOY B;  1YJN Z;  4CL1 A;  4A3G I;  4A3L I;  4XX2 A;  3S15 I;  3NH4 A;  1DL6 A;  1M90 1;  2JIR A;  4BY7 I;  2G2K A;  2VF1 A;  3IR7 A;  4A3B I;  2WB1 A;  1QF8 A;  1QXF A;  1YIT 1;  4MD7 A;  1M1K 2;  1VQL 1;  2NVQ I;  1VQ9 Z;  3IFU A; 
#chains in the Genus database with same CATH homology
 4MD9 A;  3BG1 B;  2M6N A;  1I3Q I;  1N8R 2;  4RVG A;  3S1N I;  3CQZ I;  1TFI A;  1TWA I;  1X3W A;  3HKZ A;  3GTG I;  3S17 I;  2RT9 A;  3CCJ 1;  2QRE B;  3I4N I;  2QRC B;  2NVY I;  3CMA 1;  4TNU A;  2JA7 I;  1RO2 A;  3CCS 1;  3RZD I;  3GTO I;  4QTT A;  1VLA A;  1JJ2 Y;  1W2B Z;  5FLX f;  4AYB A;  4QTU A;  2QRD B;  2YU9 I;  1YJW 1;  3M4O I;  2NVT I;  2JA8 I;  2RIQ A;  3CCM Z;  1QVG Z;  1VQ5 1;  3G4S 1;  2M48 A;  4NBF A;  2GTH A;  3GTM I;  2KPI A;  2Y0S A;  3HOW I;  1Q7Y 2;  1Z01 A;  4NBC A;  2OTJ 1;  3J80 b;  3MZK B;  2AKL A;  1VQ7 Z;  1K83 I;  4X6A I;  3CPW Y;  3OW2 Y;  1KRL A;  4E33 A;  3CD6 Z;  5FLM I;  2R92 I;  2Q4Z A;  1KQS Y;  3CC2 Z;  3CCL Z;  1Q81 2;  2O4H A;  3Q87 A;  3GTJ I;  1KC8 2;  1YUK A;  3CME Z;  2JUB A;  2GTI A;  5D1O A;  2K3R A;  1X3Z A;  4RV9 A;  4RS4 A;  3G6E Z;  4HGZ A;  5IT9 b;  2DE7 A;  4BY1 I;  1X0T A;  1Z02 A;  2BJO A;  3VMG A;  3J81 b;  2W03 A;  2DE5 A;  1JJ2 Z;  3I56 1;  1VQ4 Z;  2JA5 I;  3VB9 A;  3S1M I;  1KD1 1;  3JAM f;  3HOV I;  2DE6 A;  4NB8 A;  4A3K I;  1QYP A;  2RBL A;  4MRI A;  3CCU Z;  2R93 I;  1ZB8 A;  3GTM S;  1W2B Y;  1VQN 1;  5C44 I;  1Z03 A;  1K8A 2;  3CCV 1;  2JA6 I;  5AN9 F;  1QVG Y;  2QEX 1;  3S16 I;  1RNI A;  1KQS Z;  2OOX B;  2P3Y A;  2RHB A;  4NBB A;  1N8R 1;  2OZK A;  3LUS A;  3HOU I;  3D6W A;  1VQM 1;  1VQO Z;  3CCQ Z;  4A3J I;  3I55 1;  5IP7 I;  1S72 1;  1RO4 A;  4MXU A;  1VQK 1;  3K7A I;  1R9T I;  3TDH B;  1YJ9 1;  3U50 C;  1USP B;  3S1Q I;  4BBS I;  4A3D I;  2I3C A;  3T4N B;  3GTP I;  4MH4 A;  3G71 1;  1YIT Z;  1VQL Z;  1WII A;  2E9H A;  1S72 Z;  1Q86 2;  1VQ8 1;  1YIJ 1;  3S2H I;  3ESW A;  3F3F C;  2F4O A;  3GCF A;  3VMH A;  5CM2 M;  1K73 2;  1Q7Y 1;  5D1O B;  4A3F I;  3NDJ A;  1VQP 1;  2R7Z I;  3CCJ Z;  3HOX I;  1P9N A;  3CCE 1;  1USP A;  3CMA Z;  3CCR 1;  2ZAE B;  3M3Y I;  1VQ8 Z;  1Q81 1;  3CCS Z;  4DK1 A;  1KC8 1;  4RVD A;  5C4X I;  2QLV B;  1YHQ 1;  3GTQ I;  2JMO A;  1Y1V I;  3FQQ A;  1L1O C;  1YJW Z;  4DQY B;  4E2X A;  1I6H I;  1VQ5 Z;  3CCE Z;  3G4S Z;  3TE5 B;  4NB9 A;  2OTJ Z;  4BBR I;  3NH8 A;  3S2D I;  2PM9 A;  2QA4 1;  3CC4 1;  2JS4 A;  3FQM A;  4A3E I;  1ML8 A;  1YI2 1;  3EER A;  3J80 f;  4A3I I;  3FKI I;  1Y1W I;  3IX0 A;  1I50 I;  2EGT A;  4NBE A;  5A2Q f;  1K8A 1;  5C3E I;  3CC7 1;  5T64 A;  2WAQ A;  1RO0 A;  3S1R I;  1TWC I;  3CC4 Z;  2QKD A;  5LL6 f;  5T67 A;  3I07 A;  1NJI 2;  1K9M 2;  3GTK I;  4NOZ A;  1Y1V S;  2LIY A;  4NBG A;  2OTL 1;  3I4M I;  3NDI A;  3P5J B;  3I56 Z;  1VQ6 1;  1M1K 1;  1YJN 1;  1YUA A;  4NH1 C;  2RPR A;  1VQN Z;  2E2I I;  2O53 A;  2W04 A;  2OTL Z;  2V8J A;  3QWU A;  3HOZ I;  2JNY A;  3CCV Z;  4BXX I;  1VQ9 1;  3NFZ A;  2QEX Z;  3NH5 A;  1RLY A;  1Q86 1;  2QR1 B;  1SFO I;  4E31 A;  1Q82 2;  1WCM I;  3EED A;  2R6M A;  3F3P C;  4NFR A;  4NBD A;  4E2Z A;  3H0G I;  2VUM I;  1K73 1;  4DGL A;  1VQM Z;  5FLX b;  3I55 Z;  1TWF I;  4HH4 A;  1VQK Z;  2V8I A;  1M90 2;  1YJ9 Z;  2HU9 A;  3PO3 I;  4NBH A;  1LQL A;  3VMI A;  2F4M A;  4Y52 I;  2HF1 A;  3D9X A;  4E2W A;  3KIH A;  4NBA A;  2K5R A;  3VTN A;  3PO2 I;  1S7M A;  3MZL B;  4S1T A;  3CCM 1;  3G71 Z;  2Q51 A;  2IZ4 A;  2PK7 A;  2P28 A;  4A3C I;  1YIJ Z;  2JR6 A;  2B63 I;  4HGY A;  1VQ7 1;  3H3V J;  1QVF Y;  2YAD A;  3HOY I;  5C4J I;  1VQP Z;  3S14 I;  3CD6 1;  2E2J I;  5D1P A;  5IP9 I;  3CC2 1;  3CCL 1;  3BG0 B;  4A3M I;  3CCR Z;  1RQF A;  1TWH I;  3CME 1;  4EWC A;  1YHQ Z;  3G6E 1;  4RVH A;  3CXC Y;  1WW9 A;  1NP6 A;  2LFU A;  5A2Q b;  3PO3 S;  3GTL I;  3JAM b;  3RZO I;  2H85 A;  3KIF A;  2IZ3 A;  1ZB9 A;  4A93 I;  1NJI 1;  1K9M 1;  1VQ4 1;  4E2Y A;  4MON A;  2E2H I;  1ZH1 A;  2PMZ A;  1N2F A;  2GU2 A;  4E30 A;  5T6B A;  2QA4 Z;  3CCU 1;  4RVF A;  2V8K A;  1YI2 Z;  3IF8 A;  5IT9 f;  3MON A;  3CC7 Z;  1TWG I;  1QVF Z;  2J6A A;  3J81 f;  4E32 A;  2NVX I;  3GKQ A;  4MD8 A;  4Y7N I;  1Q82 1;  1VQO 1;  2VUG A;  3CCQ 1;  2KI7 B;  1KD1 2;  3J7A 4;  1NUI A;  1PFT A;  1VQ6 Z;  1JWH C;  3CXC Z;  3CPW Z;  3OW2 Z;  2OOY B;  1YJN Z;  4CL1 A;  4A3G I;  4A3L I;  4XX2 A;  3S15 I;  3NH4 A;  1DL6 A;  1M90 1;  4BY7 I;  2G2K A;  2VF1 A;  4A3B I;  2WB1 A;  1QF8 A;  1YIT 1;  4MD7 A;  1M1K 2;  1VQL 1;  2NVQ I;  1VQ9 Z;  3IFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...