1Q812

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1q81200
1VQK1 1NJI2 3I56Z 3CD6Z 1NJI1 3I55Z 3CXCY 2QEX1 1KQSZ 1YJ91 3CCEZ 3CCV1 3CCUZ 1S721 3CC2Z 1QVGY 2OTLZ 1VQOZ 1W2BZ 1Q7Y1 3G4SZ 2QA4Z 1K8A2 3CCS1 2OTJ1 1K8A1 1VQLZ 1YHQZ 3CD61 1N8R2 3I551 3CCQZ 3CCMZ 3OW2Y 1YJNZ 1YIJ1 3CCE1 1VQNZ 1VQ9Z 3CCU1 3G71Z 3CC21 2OTL1 1VQO1 1YIJZ 3G4S1 2QA41 1QVGZ 1VQ4Z 1VQL1 3CC4Z 1YHQ1 1JJ2Z 3CCQ1 3CCM1 1YJWZ 1YITZ 1YJN1 1VQPZ 1VQN1 1VQ91 1YI2Z 3G711 1N8R1 3CCJZ 1K9M2 3OW2Z 1K9M1 3G6EZ 3CC7Z 1VQ41 1M1K2 3CXCZ 3CMEZ 1Q862 1M1K1 3CC41 3CCLZ 1M902 1KC82 3CPWY 1M901 1KC81 1VQ5Z 1VQ7Z 1VQMZ 1YJW1 3CCRZ 1K732 1YIT1 1VQP1 3CMAZ 1VQ8Z 1K731 1Q822 1YI21 1QVFY 3CCJ1 1VQ6Z 1Q821 3G6E1 3CC71 3CME1 1VQKZ 3CCL1 1KQSY 1VQ51 1KD12 1KD11 1VQ71 1VQM1 3CPWZ 1Q7Y2 2QEXZ 3CCR1 1YJ9Z 1W2BY 1Q861 3CCVZ 1VQ81 3CMA1 1S72Z 1VQ61 1JJ2Y 1Q812 1Q811 3I561 1QVFZ 3CCSZ 2OTJZ
chains in the Genus database with same CATH superfamily
3FKII 2E2HI 2RT9A 3CXCY 2QEX1 1KQSZ 2VPWA 3HOUI 5D1OA 2WB1A 1VQOZ 4BXXI 3J81b 1ZH1A 4E2WA 5LL6f 3CCS1 3TE5B 1SFOI 3S17I 2Q51A 2QRCB 1PFTA 4DK1A 3GTMI 4A3MI 3RZDI 4A3LI 5FLXf 3OW2Y 3S1RI 1VQNZ 1VQ9Z 3GTOI 3S2DI 2DE7A 5C4XI 4NBEA 1VQO1 4RVHA 2PMZA 4NBGA 2QLVB 2O53A 3M3YI 2AKLA 1ZB8A 3D6WA 5AN9F 4NBBA 1Y1VS 5T6BA 1LQLA 2VPYA 4BY7I 3HOZI 2AYDA 1Y1WI 2I3CA 1VQN1 1VQ91 3OW2Z 1ZB9A 1QYPA 2E2II 1M1K2 1TWFI 3MZKB 2K5RA 5FLXb 3CCLZ 2V8IA 3GCFA 3QWUA 1QF8A 3J80f 3VMHA 3CCRZ 1I6HI 1VQ8Z 4Y7NI 1QVFY 3H3VJ 1TWAI 2OOXB 1Q821 4QTTA 2F4MA 3HOWI 1VQKZ 3CCL1 4NOZA 2PM9A 1RLYA 5C4JI 2OZKA 3CCR1 4MONA 2V3VA 2W03A 1W2BY 3F3PC 3CCVZ 1Q861 1VQ81 1S72Z 5D1OB 3JAMb 1JJ2Y 1QVFZ 2JIQA 2E9HA 1VQK1 3J80b 3H0GI 2QRDB 3I56Z 2V45A 4A3BI 4AYBA 2JA6I 2QR1B 3S15I 3J81f 3CCV1 1S721 3CC2Z 1QVGY 1W2BZ 5CM2M 2B63I 2QA4Z 2VPZA 2JIPA 4HGYA 3BG0B 3S2HI 2VUGA 2W04A 1N8R2 4XX2A 2LEXA 3CCMZ 5T67A 4E2YA 1YJNZ 2NVYI 3G71Z 3CC21 3MONA 4BY1I 3CQZI 4NBAA 3HKZA 4E2XA 1K83I 2QA41 1QVGZ 4MD9A 4HH4A 1Y8CA 3S1NI 3LUSA 1NUIA 2Y0SA 4HGZA 1RO2A 3GTPI 3GTQI 5FLMI 3HOYI 3GKQA 3I07A 3CCM1 2GU2A 1TWHI 1YJN1 1TFIA 2P28A 3G711 2QREB 2JS4A 3G6EZ 2JA5I 3CXCZ 2DE5A 1M1K1 3GTKI 2V8KA 3IX0A 2GTHA 2M48A 1P9NA 4RVGA 3CMAZ 3KIFA 4QTUA 4A3II 2E7ZA 4DGLA 5C44I 3VB9A 3G6E1 2HU9A 1VLAA 3TDHB 2R6MA 1WZNA 3GTLI 4MRIA 1KD12 5IT9b 3JAMf 1TWGI 1SIWA 1N2FA 2GTIA 1YJ9Z 2EGTA 3CMA1 1Z02A 4A3KI 3NH8A 3IFUA 2K3RA 1Q812 2Q4ZA 4TNUA 2LIYA 3GTGI 2JNYA 1Y1VI 1DL6A 2YADA 1NJI2 4X6AI 3CD6Z 5D1PA 2KPIA 3VMGA 3ESWA 3I55Z 4E32A 2F4OA 2PK7A 4NB9A 2DE6A 1YJ91 3CCEZ 4A3EI 2RBLA 4NH1C 3HOVI 2JA7I 1Q7Y1 2IZ3A 3G4SZ 1K8A2 2NAPA 3Q87A 3M4OI 1YHQZ 3CD61 4NBFA 4NBCA 3K7AI 1KRLA 2JUBA 3I551 3CCQZ 2WAQA 4NFRA 1YIJ1 3CCE1 3S1QI 2JR6A 3G4S1 1S7MA 3CC4Z 4EWCA 1YHQ1 1JJ2Z 3CCQ1 4CL1A 1YJWZ 3KIHA 2V8JA 1WIIA 4NB8A 2M6NA 3CCJZ 1K9M2 1NP6A 1RQFA 3CC7Z 5T64A 1WW9A 1Q862 3CC41 4A3JI 1M902 1KC82 3CPWY 3GTJI 3GTMS 1RNIA 3I4MI 4Y52I 4NBHA 1ML8A 1VQMZ 1YJW1 1K732 3D9XA 3CCJ1 1VQ6Z 2JA8I 4RVDA 1FDOA 2LFUA 3CC71 3RZOI 5IT9f 1FDIA 2KI7B 5A2Qf 2R92I 1X3ZA 3T4NB 1KD11 3VMIA 1VQM1 1USPA 3CPWZ 4A3FI 4A3GI 2QKDA 2G2KA 2IV2X 2JIOA 2P3YA 1VQ61 4S1TA 3PO3S 1Q811 2J6AA 2OTJZ 4E30A 2E2JI 1X3WA 1NJI1 1RO4A 2JIMA 3NFZA 1AA6A 2VF1A 5C3EI 3IF8A 3NH5A 3EEDA 3CCUZ 3HOXI 4E33A 2OTLZ 5A2Qb 3PO2I 1L1OC 1YUAA 2OTJ1 1K8A1 3MZLB 1VQLZ 2VPXA 3NH4A 2R93I 3VTNA 3J7A4 1RO0A 2IZ4A 4DQYB 2NVTI 4E31A 1WJ2A 4A93I 3PO3I 2ZAEB 3CCU1 2NVQI 3I4NI 4MXUA 3EERA 2OTL1 4A3DI 4NBDA 4BBRI 1WCMI 3F3FC 1YIJZ 3S1MI 4MD7A 1I50I 1VQ4Z 1VQL1 3NDJA 3D2LA 2O4HA 3FQQA 4MD8A 3S16I 3P5JB 1YITZ 1VQPZ 4BBSI 1YI2Z 4E2ZA 1N8R1 1Z01A 1TWCI 2BJOA 1K9M1 4RVFA 3S14I 2NVXI 3NDIA 1I3QI 3BG1B 1VQ41 2OOYB 3CMEZ 1JWHC 2VUMI 1Z03A 1M901 1KC81 1VQ5Z 2RHBA 1R9TI 1VQ7Z 1YIT1 1USPB 1YUKA 1VQP1 1K731 2HF1A 1Q822 1YI21 4RS4A 2YU9I 1QXFA 1X0TA 3CME1 4RV9A 5IP7I 3U50C 1KQSY 1VQ51 2RIQA 4MH4A 2RPRA 3FQMA 1VQ71 1Q7Y2 2QEXZ 2JMOA 1Q16A 2R7ZI 2H85A 5IP9I 2JIRA 4A3CI 3I561 3IR7A 3CCSZ
chains in the Genus database with same CATH topology
3FKII 2E2HI 2RT9A 3CXCY 2QEX1 1KQSZ 3HOUI 5D1OA 2WB1A 1VQOZ 4BXXI 3J81b 1ZH1A 4E2WA 5LL6f 3CCS1 3TE5B 1SFOI 3S17I 2Q51A 2QRCB 1PFTA 4DK1A 3GTMI 4A3MI 3RZDI 4A3LI 5FLXf 3OW2Y 3S1RI 1VQNZ 1VQ9Z 3GTOI 3S2DI 2DE7A 5C4XI 4NBEA 1VQO1 4RVHA 2PMZA 4NBGA 2QLVB 2O53A 3M3YI 2AKLA 1ZB8A 3D6WA 5AN9F 4NBBA 1Y1VS 5T6BA 1LQLA 4BY7I 3HOZI 1Y1WI 2I3CA 1VQN1 1VQ91 3OW2Z 1ZB9A 1QYPA 2E2II 1M1K2 1TWFI 3MZKB 2K5RA 5FLXb 3CCLZ 2V8IA 3GCFA 3QWUA 1QF8A 3J80f 3VMHA 3CCRZ 1I6HI 1VQ8Z 4Y7NI 1QVFY 3H3VJ 1TWAI 2OOXB 1Q821 4QTTA 2F4MA 3HOWI 1VQKZ 3CCL1 4NOZA 2PM9A 1RLYA 5C4JI 2OZKA 3CCR1 4MONA 2W03A 1W2BY 1Q861 3F3PC 3CCVZ 1VQ81 1S72Z 5D1OB 3JAMb 1JJ2Y 1QVFZ 2E9HA 1VQK1 3J80b 3H0GI 2QRDB 3I56Z 4A3BI 4AYBA 2JA6I 2QR1B 3S15I 3J81f 3CCV1 1S721 3CC2Z 1QVGY 1W2BZ 5CM2M 2B63I 2QA4Z 4HGYA 3BG0B 3S2HI 2VUGA 2W04A 1N8R2 4XX2A 3CCMZ 5T67A 4E2YA 1YJNZ 2NVYI 3G71Z 3CC21 3MONA 4BY1I 3CQZI 4NBAA 3HKZA 4E2XA 1K83I 2QA41 1QVGZ 4MD9A 4HH4A 3S1NI 3LUSA 1NUIA 2Y0SA 4HGZA 1RO2A 3GTPI 3GTQI 5FLMI 3HOYI 3GKQA 3I07A 3CCM1 2GU2A 1TWHI 1YJN1 1TFIA 2P28A 3G711 2QREB 2JS4A 3G6EZ 2JA5I 3CXCZ 2DE5A 1M1K1 3GTKI 2V8KA 3IX0A 2GTHA 2M48A 1P9NA 4RVGA 3CMAZ 3KIFA 4QTUA 4A3II 4DGLA 5C44I 3VB9A 3G6E1 2HU9A 1VLAA 3TDHB 2R6MA 3GTLI 4MRIA 1KD12 5IT9b 3JAMf 1TWGI 1N2FA 2GTIA 1YJ9Z 2EGTA 3CMA1 1Z02A 4A3KI 3NH8A 3IFUA 2K3RA 1Q812 2Q4ZA 4TNUA 2LIYA 3GTGI 2JNYA 1Y1VI 1DL6A 2YADA 1NJI2 4X6AI 3CD6Z 5D1PA 2KPIA 3VMGA 3ESWA 3I55Z 4E32A 2F4OA 2PK7A 4NB9A 2DE6A 1YJ91 3CCEZ 4A3EI 2RBLA 4NH1C 3HOVI 2JA7I 1Q7Y1 2IZ3A 3G4SZ 1K8A2 3Q87A 3M4OI 1YHQZ 3CD61 4NBFA 4NBCA 3K7AI 1KRLA 2JUBA 3I551 3CCQZ 2WAQA 4NFRA 1YIJ1 3CCE1 3S1QI 2JR6A 3G4S1 1S7MA 3CC4Z 4EWCA 1YHQ1 1JJ2Z 3CCQ1 4CL1A 1YJWZ 3KIHA 2V8JA 1WIIA 4NB8A 2M6NA 3CCJZ 1K9M2 1NP6A 1RQFA 3CC7Z 5T64A 1WW9A 1Q862 3CC41 4A3JI 1M902 1KC82 3CPWY 3GTJI 3GTMS 1RNIA 3I4MI 4Y52I 4NBHA 1ML8A 1VQMZ 1YJW1 1K732 3D9XA 3CCJ1 1VQ6Z 2JA8I 4RVDA 2LFUA 3CC71 3RZOI 5IT9f 2KI7B 5A2Qf 2R92I 1X3ZA 3T4NB 1KD11 3VMIA 1VQM1 1USPA 3CPWZ 4A3FI 4A3GI 2QKDA 2G2KA 2P3YA 1VQ61 4S1TA 3PO3S 1Q811 2J6AA 2OTJZ 4E30A 2E2JI 1X3WA 1NJI1 1RO4A 3NFZA 2VF1A 5C3EI 3IF8A 3NH5A 3EEDA 3CCUZ 3HOXI 4E33A 2OTLZ 5A2Qb 3PO2I 1L1OC 1YUAA 2OTJ1 1K8A1 3MZLB 1VQLZ 3NH4A 2R93I 3VTNA 3J7A4 1RO0A 2IZ4A 4DQYB 2NVTI 4E31A 4A93I 3PO3I 2ZAEB 3CCU1 2NVQI 3I4NI 4MXUA 3EERA 2OTL1 4A3DI 4NBDA 4BBRI 1WCMI 3F3FC 1YIJZ 3S1MI 4MD7A 1I50I 1VQ4Z 1VQL1 3NDJA 2O4HA 3FQQA 4MD8A 3S16I 3P5JB 1YITZ 1VQPZ 4BBSI 1YI2Z 4E2ZA 1N8R1 1Z01A 1TWCI 2BJOA 1K9M1 4RVFA 3S14I 2NVXI 3NDIA 1I3QI 3BG1B 1VQ41 2OOYB 3CMEZ 1JWHC 2VUMI 1Z03A 1M901 1KC81 1VQ5Z 2RHBA 1R9TI 1VQ7Z 1YIT1 1USPB 1YUKA 1VQP1 1K731 2HF1A 1Q822 1YI21 4RS4A 2YU9I 1X0TA 3CME1 4RV9A 5IP7I 3U50C 1KQSY 1VQ51 2RIQA 4MH4A 2RPRA 3FQMA 1VQ71 1Q7Y2 2QEXZ 2JMOA 2R7ZI 2H85A 5IP9I 4A3CI 3I561 3CCSZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK 1;  1NJI 2;  3I56 Z;  3CD6 Z;  1NJI 1;  3I55 Z;  3CXC Y;  2QEX 1;  1KQS Z;  1YJ9 1;  3CCE Z;  3CCV 1;  3CCU Z;  1S72 1;  3CC2 Z;  1QVG Y;  2OTL Z;  1VQO Z;  1W2B Z;  1Q7Y 1;  3G4S Z;  2QA4 Z;  1K8A 2;  3CCS 1;  2OTJ 1;  1K8A 1;  1VQL Z;  1YHQ Z;  3CD6 1;  1N8R 2;  3I55 1;  3CCQ Z;  3CCM Z;  3OW2 Y;  1YJN Z;  1YIJ 1;  3CCE 1;  1VQN Z;  1VQ9 Z;  3CCU 1;  3G71 Z;  3CC2 1;  2OTL 1;  1VQO 1;  1YIJ Z;  3G4S 1;  2QA4 1;  1QVG Z;  1VQ4 Z;  1VQL 1;  3CC4 Z;  1YHQ 1;  1JJ2 Z;  3CCQ 1;  3CCM 1;  1YJW Z;  1YIT Z;  1YJN 1;  1VQP Z;  1VQN 1;  1VQ9 1;  1YI2 Z;  3G71 1;  1N8R 1;  3CCJ Z;  1K9M 2;  3OW2 Z;  1K9M 1;  3G6E Z;  3CC7 Z;  1VQ4 1;  1M1K 2;  3CXC Z;  3CME Z;  1Q86 2;  1M1K 1;  3CC4 1;  3CCL Z;  1M90 2;  1KC8 2;  3CPW Y;  1M90 1;  1KC8 1;  1VQ5 Z;  1VQ7 Z;  1VQM Z;  1YJW 1;  3CCR Z;  1K73 2;  1YIT 1;  1VQP 1;  3CMA Z;  1VQ8 Z;  1K73 1;  1Q82 2;  1YI2 1;  1QVF Y;  3CCJ 1;  1VQ6 Z;  1Q82 1;  3G6E 1;  3CC7 1;  3CME 1;  1VQK Z;  3CCL 1;  1KQS Y;  1VQ5 1;  1KD1 2;  1KD1 1;  1VQ7 1;  1VQM 1;  3CPW Z;  1Q7Y 2;  2QEX Z;  3CCR 1;  1YJ9 Z;  1W2B Y;  1Q86 1;  3CCV Z;  1VQ8 1;  3CMA 1;  1S72 Z;  1VQ6 1;  1JJ2 Y;  1Q81 2;  1Q81 1;  3I56 1;  1QVF Z;  3CCS Z;  2OTJ Z; 
#chains in the Genus database with same CATH topology
 3FKI I;  2E2H I;  2RT9 A;  3CXC Y;  2QEX 1;  1KQS Z;  2VPW A;  3HOU I;  5D1O A;  2WB1 A;  1VQO Z;  4BXX I;  3J81 b;  1ZH1 A;  4E2W A;  5LL6 f;  3CCS 1;  3TE5 B;  1SFO I;  3S17 I;  2Q51 A;  2QRC B;  1PFT A;  4DK1 A;  3GTM I;  4A3M I;  3RZD I;  4A3L I;  5FLX f;  3OW2 Y;  3S1R I;  1VQN Z;  1VQ9 Z;  3GTO I;  3S2D I;  2DE7 A;  5C4X I;  4NBE A;  1VQO 1;  4RVH A;  2PMZ A;  4NBG A;  2QLV B;  2O53 A;  3M3Y I;  2AKL A;  1ZB8 A;  3D6W A;  5AN9 F;  4NBB A;  1Y1V S;  5T6B A;  1LQL A;  2VPY A;  4BY7 I;  3HOZ I;  2AYD A;  1Y1W I;  2I3C A;  1VQN 1;  1VQ9 1;  3OW2 Z;  1ZB9 A;  1QYP A;  2E2I I;  1M1K 2;  1TWF I;  3MZK B;  2K5R A;  5FLX b;  3CCL Z;  2V8I A;  3GCF A;  3QWU A;  1QF8 A;  3J80 f;  3VMH A;  3CCR Z;  1I6H I;  1VQ8 Z;  4Y7N I;  1QVF Y;  3H3V J;  1TWA I;  2OOX B;  1Q82 1;  4QTT A;  2F4M A;  3HOW I;  1VQK Z;  3CCL 1;  4NOZ A;  2PM9 A;  1RLY A;  5C4J I;  2OZK A;  3CCR 1;  4MON A;  2V3V A;  2W03 A;  1W2B Y;  3F3P C;  3CCV Z;  1Q86 1;  1VQ8 1;  1S72 Z;  5D1O B;  3JAM b;  1JJ2 Y;  1QVF Z;  2JIQ A;  2E9H A;  1VQK 1;  3J80 b;  3H0G I;  2QRD B;  3I56 Z;  2V45 A;  4A3B I;  4AYB A;  2JA6 I;  2QR1 B;  3S15 I;  3J81 f;  3CCV 1;  1S72 1;  3CC2 Z;  1QVG Y;  1W2B Z;  5CM2 M;  2B63 I;  2QA4 Z;  2VPZ A;  2JIP A;  4HGY A;  3BG0 B;  3S2H I;  2VUG A;  2W04 A;  1N8R 2;  4XX2 A;  2LEX A;  3CCM Z;  5T67 A;  4E2Y A;  1YJN Z;  2NVY I;  3G71 Z;  3CC2 1;  3MON A;  4BY1 I;  3CQZ I;  4NBA A;  3HKZ A;  4E2X A;  1K83 I;  2QA4 1;  1QVG Z;  4MD9 A;  4HH4 A;  1Y8C A;  3S1N I;  3LUS A;  1NUI A;  2Y0S A;  4HGZ A;  1RO2 A;  3GTP I;  3GTQ I;  5FLM I;  3HOY I;  3GKQ A;  3I07 A;  3CCM 1;  2GU2 A;  1TWH I;  1YJN 1;  1TFI A;  2P28 A;  3G71 1;  2QRE B;  2JS4 A;  3G6E Z;  2JA5 I;  3CXC Z;  2DE5 A;  1M1K 1;  3GTK I;  2V8K A;  3IX0 A;  2GTH A;  2M48 A;  1P9N A;  4RVG A;  3CMA Z;  3KIF A;  4QTU A;  4A3I I;  2E7Z A;  4DGL A;  5C44 I;  3VB9 A;  3G6E 1;  2HU9 A;  1VLA A;  3TDH B;  2R6M A;  1WZN A;  3GTL I;  4MRI A;  1KD1 2;  5IT9 b;  3JAM f;  1TWG I;  1SIW A;  1N2F A;  2GTI A;  1YJ9 Z;  2EGT A;  3CMA 1;  1Z02 A;  4A3K I;  3NH8 A;  3IFU A;  2K3R A;  1Q81 2;  2Q4Z A;  4TNU A;  2LIY A;  3GTG I;  2JNY A;  1Y1V I;  1DL6 A;  2YAD A;  1NJI 2;  4X6A I;  3CD6 Z;  5D1P A;  2KPI A;  3VMG A;  3ESW A;  3I55 Z;  4E32 A;  2F4O A;  2PK7 A;  4NB9 A;  2DE6 A;  1YJ9 1;  3CCE Z;  4A3E I;  2RBL A;  4NH1 C;  3HOV I;  2JA7 I;  1Q7Y 1;  2IZ3 A;  3G4S Z;  1K8A 2;  2NAP A;  3Q87 A;  3M4O I;  1YHQ Z;  3CD6 1;  4NBF A;  4NBC A;  3K7A I;  1KRL A;  2JUB A;  3I55 1;  3CCQ Z;  2WAQ A;  4NFR A;  1YIJ 1;  3CCE 1;  3S1Q I;  2JR6 A;  3G4S 1;  1S7M A;  3CC4 Z;  4EWC A;  1YHQ 1;  1JJ2 Z;  3CCQ 1;  4CL1 A;  1YJW Z;  3KIH A;  2V8J A;  1WII A;  4NB8 A;  2M6N A;  3CCJ Z;  1K9M 2;  1NP6 A;  1RQF A;  3CC7 Z;  5T64 A;  1WW9 A;  1Q86 2;  3CC4 1;  4A3J I;  1M90 2;  1KC8 2;  3CPW Y;  3GTJ I;  3GTM S;  1RNI A;  3I4M I;  4Y52 I;  4NBH A;  1ML8 A;  1VQM Z;  1YJW 1;  1K73 2;  3D9X A;  3CCJ 1;  1VQ6 Z;  2JA8 I;  4RVD A;  1FDO A;  2LFU A;  3CC7 1;  3RZO I;  5IT9 f;  1FDI A;  2KI7 B;  5A2Q f;  2R92 I;  1X3Z A;  3T4N B;  1KD1 1;  3VMI A;  1VQM 1;  1USP A;  3CPW Z;  4A3F I;  4A3G I;  2QKD A;  2G2K A;  2IV2 X;  2JIO A;  2P3Y A;  1VQ6 1;  4S1T A;  3PO3 S;  1Q81 1;  2J6A A;  2OTJ Z;  4E30 A;  2E2J I;  1X3W A;  1NJI 1;  1RO4 A;  2JIM A;  3NFZ A;  1AA6 A;  2VF1 A;  5C3E I;  3IF8 A;  3NH5 A;  3EED A;  3CCU Z;  3HOX I;  4E33 A;  2OTL Z;  5A2Q b;  3PO2 I;  1L1O C;  1YUA A;  2OTJ 1;  1K8A 1;  3MZL B;  1VQL Z;  2VPX A;  3NH4 A;  2R93 I;  3VTN A;  3J7A 4;  1RO0 A;  2IZ4 A;  4DQY B;  2NVT I;  4E31 A;  1WJ2 A;  4A93 I;  3PO3 I;  2ZAE B;  3CCU 1;  2NVQ I;  3I4N I;  4MXU A;  3EER A;  2OTL 1;  4A3D I;  4NBD A;  4BBR I;  1WCM I;  3F3F C;  1YIJ Z;  3S1M I;  4MD7 A;  1I50 I;  1VQ4 Z;  1VQL 1;  3NDJ A;  3D2L A;  2O4H A;  3FQQ A;  4MD8 A;  3S16 I;  3P5J B;  1YIT Z;  1VQP Z;  4BBS I;  1YI2 Z;  4E2Z A;  1N8R 1;  1Z01 A;  1TWC I;  2BJO A;  1K9M 1;  4RVF A;  3S14 I;  2NVX I;  3NDI A;  1I3Q I;  3BG1 B;  1VQ4 1;  2OOY B;  3CME Z;  1JWH C;  2VUM I;  1Z03 A;  1M90 1;  1KC8 1;  1VQ5 Z;  2RHB A;  1R9T I;  1VQ7 Z;  1YIT 1;  1USP B;  1YUK A;  1VQP 1;  1K73 1;  2HF1 A;  1Q82 2;  1YI2 1;  4RS4 A;  2YU9 I;  1QXF A;  1X0T A;  3CME 1;  4RV9 A;  5IP7 I;  3U50 C;  1KQS Y;  1VQ5 1;  2RIQ A;  4MH4 A;  2RPR A;  3FQM A;  1VQ7 1;  1Q7Y 2;  2QEX Z;  2JMO A;  1Q16 A;  2R7Z I;  2H85 A;  5IP9 I;  2JIR A;  4A3C I;  3I56 1;  3IR7 A;  3CCS Z; 
#chains in the Genus database with same CATH homology
 3FKI I;  2E2H I;  2RT9 A;  3CXC Y;  2QEX 1;  1KQS Z;  3HOU I;  5D1O A;  2WB1 A;  1VQO Z;  4BXX I;  3J81 b;  1ZH1 A;  4E2W A;  5LL6 f;  3CCS 1;  3TE5 B;  1SFO I;  3S17 I;  2Q51 A;  2QRC B;  1PFT A;  4DK1 A;  3GTM I;  4A3M I;  3RZD I;  4A3L I;  5FLX f;  3OW2 Y;  3S1R I;  1VQN Z;  1VQ9 Z;  3GTO I;  3S2D I;  2DE7 A;  5C4X I;  4NBE A;  1VQO 1;  4RVH A;  2PMZ A;  4NBG A;  2QLV B;  2O53 A;  3M3Y I;  2AKL A;  1ZB8 A;  3D6W A;  5AN9 F;  4NBB A;  1Y1V S;  5T6B A;  1LQL A;  4BY7 I;  3HOZ I;  1Y1W I;  2I3C A;  1VQN 1;  1VQ9 1;  3OW2 Z;  1ZB9 A;  1QYP A;  2E2I I;  1M1K 2;  1TWF I;  3MZK B;  2K5R A;  5FLX b;  3CCL Z;  2V8I A;  3GCF A;  3QWU A;  1QF8 A;  3J80 f;  3VMH A;  3CCR Z;  1I6H I;  1VQ8 Z;  4Y7N I;  1QVF Y;  3H3V J;  1TWA I;  2OOX B;  1Q82 1;  4QTT A;  2F4M A;  3HOW I;  1VQK Z;  3CCL 1;  4NOZ A;  2PM9 A;  1RLY A;  5C4J I;  2OZK A;  3CCR 1;  4MON A;  2W03 A;  1W2B Y;  1Q86 1;  3F3P C;  3CCV Z;  1VQ8 1;  1S72 Z;  5D1O B;  3JAM b;  1JJ2 Y;  1QVF Z;  2E9H A;  1VQK 1;  3J80 b;  3H0G I;  2QRD B;  3I56 Z;  4A3B I;  4AYB A;  2JA6 I;  2QR1 B;  3S15 I;  3J81 f;  3CCV 1;  1S72 1;  3CC2 Z;  1QVG Y;  1W2B Z;  5CM2 M;  2B63 I;  2QA4 Z;  4HGY A;  3BG0 B;  3S2H I;  2VUG A;  2W04 A;  1N8R 2;  4XX2 A;  3CCM Z;  5T67 A;  4E2Y A;  1YJN Z;  2NVY I;  3G71 Z;  3CC2 1;  3MON A;  4BY1 I;  3CQZ I;  4NBA A;  3HKZ A;  4E2X A;  1K83 I;  2QA4 1;  1QVG Z;  4MD9 A;  4HH4 A;  3S1N I;  3LUS A;  1NUI A;  2Y0S A;  4HGZ A;  1RO2 A;  3GTP I;  3GTQ I;  5FLM I;  3HOY I;  3GKQ A;  3I07 A;  3CCM 1;  2GU2 A;  1TWH I;  1YJN 1;  1TFI A;  2P28 A;  3G71 1;  2QRE B;  2JS4 A;  3G6E Z;  2JA5 I;  3CXC Z;  2DE5 A;  1M1K 1;  3GTK I;  2V8K A;  3IX0 A;  2GTH A;  2M48 A;  1P9N A;  4RVG A;  3CMA Z;  3KIF A;  4QTU A;  4A3I I;  4DGL A;  5C44 I;  3VB9 A;  3G6E 1;  2HU9 A;  1VLA A;  3TDH B;  2R6M A;  3GTL I;  4MRI A;  1KD1 2;  5IT9 b;  3JAM f;  1TWG I;  1N2F A;  2GTI A;  1YJ9 Z;  2EGT A;  3CMA 1;  1Z02 A;  4A3K I;  3NH8 A;  3IFU A;  2K3R A;  1Q81 2;  2Q4Z A;  4TNU A;  2LIY A;  3GTG I;  2JNY A;  1Y1V I;  1DL6 A;  2YAD A;  1NJI 2;  4X6A I;  3CD6 Z;  5D1P A;  2KPI A;  3VMG A;  3ESW A;  3I55 Z;  4E32 A;  2F4O A;  2PK7 A;  4NB9 A;  2DE6 A;  1YJ9 1;  3CCE Z;  4A3E I;  2RBL A;  4NH1 C;  3HOV I;  2JA7 I;  1Q7Y 1;  2IZ3 A;  3G4S Z;  1K8A 2;  3Q87 A;  3M4O I;  1YHQ Z;  3CD6 1;  4NBF A;  4NBC A;  3K7A I;  1KRL A;  2JUB A;  3I55 1;  3CCQ Z;  2WAQ A;  4NFR A;  1YIJ 1;  3CCE 1;  3S1Q I;  2JR6 A;  3G4S 1;  1S7M A;  3CC4 Z;  4EWC A;  1YHQ 1;  1JJ2 Z;  3CCQ 1;  4CL1 A;  1YJW Z;  3KIH A;  2V8J A;  1WII A;  4NB8 A;  2M6N A;  3CCJ Z;  1K9M 2;  1NP6 A;  1RQF A;  3CC7 Z;  5T64 A;  1WW9 A;  1Q86 2;  3CC4 1;  4A3J I;  1M90 2;  1KC8 2;  3CPW Y;  3GTJ I;  3GTM S;  1RNI A;  3I4M I;  4Y52 I;  4NBH A;  1ML8 A;  1VQM Z;  1YJW 1;  1K73 2;  3D9X A;  3CCJ 1;  1VQ6 Z;  2JA8 I;  4RVD A;  2LFU A;  3CC7 1;  3RZO I;  5IT9 f;  2KI7 B;  5A2Q f;  2R92 I;  1X3Z A;  3T4N B;  1KD1 1;  3VMI A;  1VQM 1;  1USP A;  3CPW Z;  4A3F I;  4A3G I;  2QKD A;  2G2K A;  2P3Y A;  1VQ6 1;  4S1T A;  3PO3 S;  1Q81 1;  2J6A A;  2OTJ Z;  4E30 A;  2E2J I;  1X3W A;  1NJI 1;  1RO4 A;  3NFZ A;  2VF1 A;  5C3E I;  3IF8 A;  3NH5 A;  3EED A;  3CCU Z;  3HOX I;  4E33 A;  2OTL Z;  5A2Q b;  3PO2 I;  1L1O C;  1YUA A;  2OTJ 1;  1K8A 1;  3MZL B;  1VQL Z;  3NH4 A;  2R93 I;  3VTN A;  3J7A 4;  1RO0 A;  2IZ4 A;  4DQY B;  2NVT I;  4E31 A;  4A93 I;  3PO3 I;  2ZAE B;  3CCU 1;  2NVQ I;  3I4N I;  4MXU A;  3EER A;  2OTL 1;  4A3D I;  4NBD A;  4BBR I;  1WCM I;  3F3F C;  1YIJ Z;  3S1M I;  4MD7 A;  1I50 I;  1VQ4 Z;  1VQL 1;  3NDJ A;  2O4H A;  3FQQ A;  4MD8 A;  3S16 I;  3P5J B;  1YIT Z;  1VQP Z;  4BBS I;  1YI2 Z;  4E2Z A;  1N8R 1;  1Z01 A;  1TWC I;  2BJO A;  1K9M 1;  4RVF A;  3S14 I;  2NVX I;  3NDI A;  1I3Q I;  3BG1 B;  1VQ4 1;  2OOY B;  3CME Z;  1JWH C;  2VUM I;  1Z03 A;  1M90 1;  1KC8 1;  1VQ5 Z;  2RHB A;  1R9T I;  1VQ7 Z;  1YIT 1;  1USP B;  1YUK A;  1VQP 1;  1K73 1;  2HF1 A;  1Q82 2;  1YI2 1;  4RS4 A;  2YU9 I;  1X0T A;  3CME 1;  4RV9 A;  5IP7 I;  3U50 C;  1KQS Y;  1VQ5 1;  2RIQ A;  4MH4 A;  2RPR A;  3FQM A;  1VQ7 1;  1Q7Y 2;  2QEX Z;  2JMO A;  2R7Z I;  2H85 A;  5IP9 I;  4A3C I;  3I56 1;  3CCS Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...