3CC4Z

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cc4Z00
1VQ4Z 3CCQZ 1Q821 1K8A1 1Q7Y1 1K9M2 1QVFZ 3CXCZ 1VQLZ 1VQKZ 1VQOZ 1K732 1M1K2 3CCS1 1K9M1 1YJN1 1K731 1VQ41 1M1K1 1VQL1 1VQO1 1YIT1 3CC71 1QVGZ 1YIJZ 3CME1 3CC2Z 1VQPZ 1KQSY 3CCSZ 3CCMZ 3CCL1 1NJI2 1YIJ1 1VQNZ 1YITZ 3CC7Z 3CPWY 3CC21 1NJI1 1VQP1 2QA4Z 1YI2Z 3CCM1 1JJ2Y 3CMEZ 1N8R2 3G71Z 3CC41 1VQN1 1S721 3CCUZ 3CCLZ 1N8R1 2QA41 1YI21 3G711 3I551 1YJ9Z 3CCU1 3CD6Z 3CC4Z 1VQM1 3G6E1 1YHQ1 3OW2Y 3G4S1 1S72Z 3I56Z 3CCEZ 1YJWZ 1KQSZ 1W2BY 1YJ91 2QEXZ 3CD61 1VQ51 3CMAZ 3I55Z 1QVFY 3CPWZ 3CXCY 3I561 3CCJ1 3CCE1 1Q862 3CCV1 1YJW1 3CCR1 1VQMZ 1JJ2Z 1KC82 3G6EZ 1YHQZ 3G4SZ 2QEX1 1Q861 1VQ8Z 3CMA1 2OTL1 1KC81 1VQ6Z 2OTJ1 1VQ5Z 1VQ9Z 1QVGY 1VQ7Z 1VQ71 1Q812 3CCJZ 3CCQ1 1M902 3CCVZ 1VQ81 3CCRZ 1VQK1 1Q811 1KD12 1VQ61 1M901 1VQ91 2OTLZ 3OW2Z 1KD11 2OTJZ 1Q822 1W2BZ 1K8A2 1Q7Y2 1YJNZ
chains in the Genus database with same CATH superfamily
1VQ4Z 1YUAA 1X3ZA 1RNIA 1K8A1 2OOXB 1VQOZ 1SIWA 4EWCA 4A3II 4E30A 4NBCA 4A3BI 3PO3S 1YJN1 2AYDA 1K731 3BG0B 1VQ41 2E2HI 1VQO1 3CQZI 1YIT1 2HF1A 1QVGZ 1YIJZ 4NBBA 1QF8A 4RVHA 3GKQA 1KQSY 3CCSZ 2JA6I 2QREB 3Q87A 1NJI2 3HOVI 1YIJ1 5T67A 3CPWY 3CC7Z 2O4HA 3HOYI 2HU9A 1ZB8A 1S7MA 2IZ4A 1WIIA 3J81b 2VPWA 4A3LI 3G71Z 4BXXI 4X6AI 2I3CA 3I4NI 3D6WA 3M4OI 3G711 3HOUI 2GU2A 3GTKI 3I551 2E2JI 1X0TA 1K83I 3CD6Z 2PM9A 5CM2M 1VQM1 3S2HI 3GTMI 3I56Z 1YJWZ 3S17I 3VMIA 3CD61 3I4MI 3CMAZ 3PO2I 4DQYB 1N2FA 3I561 5T64A 4NB8A 1Q862 1YJW1 4TNUA 1JJ2Z 3HOWI 4E32A 3PO3I 1WCMI 4AYBA 3CMA1 2OTL1 2R93I 2QKDA 1VQ6Z 2YADA 2OOYB 3HOZI 2OZKA 3CCQ1 1M902 2E7ZA 3ESWA 3K7AI 1QXFA 4HGZA 2JIMA 1Y8CA 1VQ61 4MXUA 4BBRI 3S16I 3J81f 1NP6A 4XX2A 3OW2Z 2F4OA 1KD11 3EERA 1W2BZ 2IV2X 1Q7Y2 4CL1A 3J7A4 5A2Qf 2KPIA 2IZ3A 1X3WA 4QTUA 1VQLZ 2JA5I 2GTHA 1K9M1 5T6BA 2RPRA 3HKZA 3IX0A 3QWUA 4A3FI 1M1K1 2JS4A 3D9XA 1VQL1 3IF8A 3GTMS 4NBDA 4QTTA 2EGTA 4RVGA 3S1NI 2YU9I 3NH5A 2JMOA 3JAMf 3CCMZ 3VMGA 1VQNZ 2R92I 5D1OB 1YITZ 1YUKA 3I07A 5FLXb 2B63I 4RVFA 2LFUA 3NFZA 3S2DI 1TWFI 2V8KA 4HGYA 3CCM1 3J80f 4A3KI 1N8R2 3CC41 1VQN1 4MD9A 3MZKB 2JNYA 2JA7I 1Y1VS 2R7ZI 2JR6A 4E2WA 2E2II 4A3MI 4NOZA 1I50I 4A3DI 2V8JA 3S15I 2J6AA 1KQSZ 4Y52I 2AKLA 2JUBA 1VQ51 2QRCB 2NVYI 3I55Z 1QVFY 3CPWZ 3CXCY 3CCV1 5IT9b 3CCR1 1VQMZ 4BY1I 5A2Qb 3GTLI 1KRLA 1LQLA 2Q51A 1VQ8Z 2KI7B 4NBGA 1KC81 3GTGI 2V8IA 1NUIA 3GTQI 3H0GI 1Q812 5C44I 4A3JI 1ML8A 2W03A 1VQ81 4NBHA 5FLXf 1VQK1 2OTLZ 1WW9A 2VF1A 1USPB 2RBLA 1YJNZ 3JAMb 2WAQA 1K8A2 2F4MA 3CCQZ 1Q821 1TWGI 2P28A 5D1OA 1K732 3KIFA 1P9NA 3J80b 1Z02A 3U50C 1Y1VI 1L1OC 4S1TA 4E2ZA 3EEDA 2Y0SA 1Z03A 3TDHB 3CME1 1RO2A 3CC2Z 2QR1B 2VUGA 2W04A 5IT9f 1Y1WI 3CCL1 4E31A 3NDJA 3IFUA 3RZDI 3F3PC 2Q4ZA 5C3EI 3FQMA 1WJ2A 3HOXI 3CC21 1ZB9A 2K5RA 1NJI1 1AA6A 3MONA 1TWCI 3NDIA 1S721 3CCUZ 2PMZA 2BJOA 5FLMI 2QRDB 4A3CI 2VPXA 2E9HA 2JIPA 3VB9A 2DE7A 4MD8A 3CCU1 3RZOI 3CC4Z 4DK1A 3G6E1 1YHQ1 3G4S1 2P3YA 4NFRA 3CCEZ 2RHBA 3S1RI 3M3YI 2GTIA 3BG1B 2M48A 4RS4A 3NH4A 2DE6A 3GTOI 2NVTI 1USPA 4BY7I 3CCJ1 3CCE1 3GTPI 1I3QI 3S14I 1R9TI 1Q861 4DGLA 2LIYA 2NVXI 2QLVB 2OTJ1 1VQ5Z 1QVGY 3S1MI 4NH1C 1VQ71 2NAPA 1PFTA 2WB1A 1I6HI 3MZLB 3CCVZ 3CCRZ 2NVQI 1KD12 1M901 2ZAEB 1RO4A 5AN9F 4NBFA 4E2XA 2V45A 1SFOI 3H3VJ 1RO0A 4MH4A 3F3FC 4HH4A 1FDOA 3GTJI 2V3VA 4MONA 1Q7Y1 1K9M2 1QVFZ 2JIOA 3CXCZ 1VLAA 1VQKZ 1Z01A 1TWAI 1M1K2 2VPZA 3CCS1 1RLYA 5C4XI 2H85A 3P5JB 1DL6A 3CC71 2DE5A 2O53A 2JIRA 4RVDA 3D2LA 4E33A 5IP7I 1VQPZ 2M6NA 1ZH1A 1WZNA 3IR7A 4Y7NI 2VPYA 2PK7A 3TE5B 1RQFA 1VQP1 2QA4Z 1YI2Z 1JJ2Y 2K3RA 3CMEZ 2LEXA 4A3GI 3CCLZ 1N8R1 3GCFA 2QA41 1YI21 3LUSA 3T4NB 4NBEA 2G2KA 2VUMI 1YJ9Z 3NH8A 4BBSI 2RIQA 4NB9A 3OW2Y 1S72Z 1FDIA 1W2BY 1YJ91 2QEXZ 1QYPA 1JWHC 1TWHI 1KC82 2RT9A 4RV9A 3G6EZ 1YHQZ 1TFIA 3KIHA 3S1QI 4A93I 3G4SZ 2QEX1 5C4JI 2R6MA 3VMHA 4A3EI 4NBAA 3FKII 1VQ9Z 3FQQA 4MD7A 3CCJZ 3VTNA 2JA8I 1Q811 5D1PA 5IP9I 1VQ91 2JIQA 1Q16A 2OTJZ 5LL6f 1Q822 4E2YA 4MRIA 1VQ7Z
chains in the Genus database with same CATH topology
1VQ4Z 1YUAA 1X3ZA 1RNIA 1K8A1 2OOXB 1VQOZ 4EWCA 4A3II 4E30A 4NBCA 4A3BI 3PO3S 1YJN1 1K731 3BG0B 1VQ41 2E2HI 1VQO1 3CQZI 1YIT1 2HF1A 1QVGZ 1YIJZ 4NBBA 1QF8A 4RVHA 3GKQA 1KQSY 3CCSZ 2JA6I 2QREB 3Q87A 1NJI2 3HOVI 1YIJ1 5T67A 3CPWY 3CC7Z 2O4HA 3HOYI 2HU9A 1ZB8A 1S7MA 2IZ4A 1WIIA 3J81b 4A3LI 3G71Z 4BXXI 4X6AI 2I3CA 3I4NI 3D6WA 3M4OI 3G711 3HOUI 2GU2A 3GTKI 3I551 2E2JI 1X0TA 1K83I 3CD6Z 2PM9A 5CM2M 1VQM1 3S2HI 3GTMI 3I56Z 1YJWZ 3S17I 3VMIA 3CD61 3I4MI 3CMAZ 3PO2I 4DQYB 1N2FA 3I561 5T64A 4NB8A 1Q862 1YJW1 4TNUA 1JJ2Z 3HOWI 4E32A 3PO3I 1WCMI 4AYBA 3CMA1 2OTL1 2R93I 2QKDA 1VQ6Z 2YADA 2OOYB 3HOZI 2OZKA 3CCQ1 1M902 3ESWA 3K7AI 4HGZA 1VQ61 4MXUA 4BBRI 3S16I 3J81f 1NP6A 4XX2A 3OW2Z 2F4OA 1KD11 3EERA 1W2BZ 1Q7Y2 4CL1A 3J7A4 5A2Qf 2KPIA 2IZ3A 1X3WA 4QTUA 1VQLZ 2JA5I 2GTHA 1K9M1 5T6BA 2RPRA 3HKZA 3IX0A 3QWUA 4A3FI 1M1K1 2JS4A 3D9XA 1VQL1 3IF8A 3GTMS 4NBDA 4QTTA 2EGTA 4RVGA 3S1NI 2YU9I 3NH5A 2JMOA 3JAMf 3CCMZ 3VMGA 1VQNZ 2R92I 5D1OB 1YITZ 1YUKA 3I07A 5FLXb 2B63I 4RVFA 2LFUA 3NFZA 3S2DI 1TWFI 2V8KA 4HGYA 3CCM1 3J80f 4A3KI 1N8R2 3CC41 1VQN1 4MD9A 3MZKB 2JNYA 2JA7I 1Y1VS 2R7ZI 2JR6A 4E2WA 2E2II 4A3MI 4NOZA 1I50I 4A3DI 2V8JA 3S15I 2J6AA 1KQSZ 4Y52I 2AKLA 2JUBA 1VQ51 2QRCB 2NVYI 3I55Z 1QVFY 3CPWZ 3CXCY 3CCV1 5IT9b 3CCR1 1VQMZ 4BY1I 5A2Qb 3GTLI 1KRLA 1LQLA 2Q51A 1VQ8Z 2KI7B 4NBGA 1KC81 3GTGI 2V8IA 1NUIA 3GTQI 3H0GI 1Q812 5C44I 4A3JI 1ML8A 2W03A 1VQ81 4NBHA 5FLXf 1VQK1 2OTLZ 1WW9A 2VF1A 1USPB 2RBLA 1YJNZ 3JAMb 2WAQA 1K8A2 2F4MA 3CCQZ 1Q821 1TWGI 2P28A 5D1OA 1K732 3KIFA 1P9NA 3J80b 1Z02A 3U50C 1Y1VI 1L1OC 4S1TA 4E2ZA 3EEDA 2Y0SA 1Z03A 3TDHB 3CME1 1RO2A 3CC2Z 2QR1B 2VUGA 2W04A 5IT9f 1Y1WI 3CCL1 4E31A 3NDJA 3IFUA 3RZDI 3F3PC 2Q4ZA 5C3EI 3FQMA 3HOXI 3CC21 1ZB9A 2K5RA 1NJI1 3MONA 1TWCI 3NDIA 1S721 3CCUZ 2PMZA 2BJOA 5FLMI 2QRDB 4A3CI 2E9HA 3VB9A 2DE7A 4MD8A 3CCU1 3RZOI 3CC4Z 4DK1A 3G6E1 1YHQ1 3G4S1 2P3YA 4NFRA 3CCEZ 2RHBA 3S1RI 3M3YI 2GTIA 3BG1B 2M48A 4RS4A 3NH4A 2DE6A 3GTOI 2NVTI 1USPA 4BY7I 3CCJ1 3CCE1 3GTPI 1I3QI 3S14I 1R9TI 1Q861 4DGLA 2LIYA 2NVXI 2QLVB 2OTJ1 1VQ5Z 1QVGY 3S1MI 4NH1C 1VQ71 1PFTA 2WB1A 1I6HI 3MZLB 3CCVZ 3CCRZ 2NVQI 1KD12 1M901 2ZAEB 1RO4A 5AN9F 4NBFA 4E2XA 1SFOI 3H3VJ 1RO0A 4MH4A 3F3FC 4HH4A 3GTJI 4MONA 1Q7Y1 1K9M2 1QVFZ 3CXCZ 1VLAA 1VQKZ 1Z01A 1TWAI 1M1K2 3CCS1 1RLYA 5C4XI 2H85A 3P5JB 1DL6A 3CC71 2DE5A 2O53A 4RVDA 4E33A 5IP7I 1VQPZ 2M6NA 1ZH1A 4Y7NI 2PK7A 3TE5B 1RQFA 1VQP1 2QA4Z 1YI2Z 1JJ2Y 2K3RA 3CMEZ 4A3GI 3CCLZ 1N8R1 3GCFA 2QA41 1YI21 3LUSA 3T4NB 4NBEA 2G2KA 2VUMI 1YJ9Z 3NH8A 4BBSI 2RIQA 4NB9A 3OW2Y 1S72Z 1W2BY 1YJ91 2QEXZ 1QYPA 1JWHC 1TWHI 1KC82 2RT9A 4RV9A 3G6EZ 1YHQZ 1TFIA 3KIHA 3S1QI 4A93I 3G4SZ 2QEX1 5C4JI 2R6MA 3VMHA 4A3EI 4NBAA 3FKII 1VQ9Z 3FQQA 4MD7A 3CCJZ 3VTNA 2JA8I 1Q811 5D1PA 5IP9I 1VQ91 2OTJZ 5LL6f 1Q822 4E2YA 4MRIA 1VQ7Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 Z;  3CCQ Z;  1Q82 1;  1K8A 1;  1Q7Y 1;  1K9M 2;  1QVF Z;  3CXC Z;  1VQL Z;  1VQK Z;  1VQO Z;  1K73 2;  1M1K 2;  3CCS 1;  1K9M 1;  1YJN 1;  1K73 1;  1VQ4 1;  1M1K 1;  1VQL 1;  1VQO 1;  1YIT 1;  3CC7 1;  1QVG Z;  1YIJ Z;  3CME 1;  3CC2 Z;  1VQP Z;  1KQS Y;  3CCS Z;  3CCM Z;  3CCL 1;  1NJI 2;  1YIJ 1;  1VQN Z;  1YIT Z;  3CC7 Z;  3CPW Y;  3CC2 1;  1NJI 1;  1VQP 1;  2QA4 Z;  1YI2 Z;  3CCM 1;  1JJ2 Y;  3CME Z;  1N8R 2;  3G71 Z;  3CC4 1;  1VQN 1;  1S72 1;  3CCU Z;  3CCL Z;  1N8R 1;  2QA4 1;  1YI2 1;  3G71 1;  3I55 1;  1YJ9 Z;  3CCU 1;  3CD6 Z;  3CC4 Z;  1VQM 1;  3G6E 1;  1YHQ 1;  3OW2 Y;  3G4S 1;  1S72 Z;  3I56 Z;  3CCE Z;  1YJW Z;  1KQS Z;  1W2B Y;  1YJ9 1;  2QEX Z;  3CD6 1;  1VQ5 1;  3CMA Z;  3I55 Z;  1QVF Y;  3CPW Z;  3CXC Y;  3I56 1;  3CCJ 1;  3CCE 1;  1Q86 2;  3CCV 1;  1YJW 1;  3CCR 1;  1VQM Z;  1JJ2 Z;  1KC8 2;  3G6E Z;  1YHQ Z;  3G4S Z;  2QEX 1;  1Q86 1;  1VQ8 Z;  3CMA 1;  2OTL 1;  1KC8 1;  1VQ6 Z;  2OTJ 1;  1VQ5 Z;  1VQ9 Z;  1QVG Y;  1VQ7 Z;  1VQ7 1;  1Q81 2;  3CCJ Z;  3CCQ 1;  1M90 2;  3CCV Z;  1VQ8 1;  3CCR Z;  1VQK 1;  1Q81 1;  1KD1 2;  1VQ6 1;  1M90 1;  1VQ9 1;  2OTL Z;  3OW2 Z;  1KD1 1;  2OTJ Z;  1Q82 2;  1W2B Z;  1K8A 2;  1Q7Y 2;  1YJN Z; 
#chains in the Genus database with same CATH topology
 1VQ4 Z;  1YUA A;  1X3Z A;  1RNI A;  1K8A 1;  2OOX B;  1VQO Z;  1SIW A;  4EWC A;  4A3I I;  4E30 A;  4NBC A;  4A3B I;  3PO3 S;  1YJN 1;  2AYD A;  1K73 1;  3BG0 B;  1VQ4 1;  2E2H I;  1VQO 1;  3CQZ I;  1YIT 1;  2HF1 A;  1QVG Z;  1YIJ Z;  4NBB A;  1QF8 A;  4RVH A;  3GKQ A;  1KQS Y;  3CCS Z;  2JA6 I;  2QRE B;  3Q87 A;  1NJI 2;  3HOV I;  1YIJ 1;  5T67 A;  3CPW Y;  3CC7 Z;  2O4H A;  3HOY I;  2HU9 A;  1ZB8 A;  1S7M A;  2IZ4 A;  1WII A;  3J81 b;  2VPW A;  4A3L I;  3G71 Z;  4BXX I;  4X6A I;  2I3C A;  3I4N I;  3D6W A;  3M4O I;  3G71 1;  3HOU I;  2GU2 A;  3GTK I;  3I55 1;  2E2J I;  1X0T A;  1K83 I;  3CD6 Z;  2PM9 A;  5CM2 M;  1VQM 1;  3S2H I;  3GTM I;  3I56 Z;  1YJW Z;  3S17 I;  3VMI A;  3CD6 1;  3I4M I;  3CMA Z;  3PO2 I;  4DQY B;  1N2F A;  3I56 1;  5T64 A;  4NB8 A;  1Q86 2;  1YJW 1;  4TNU A;  1JJ2 Z;  3HOW I;  4E32 A;  3PO3 I;  1WCM I;  4AYB A;  3CMA 1;  2OTL 1;  2R93 I;  2QKD A;  1VQ6 Z;  2YAD A;  2OOY B;  3HOZ I;  2OZK A;  3CCQ 1;  1M90 2;  2E7Z A;  3ESW A;  3K7A I;  1QXF A;  4HGZ A;  2JIM A;  1Y8C A;  1VQ6 1;  4MXU A;  4BBR I;  3S16 I;  3J81 f;  1NP6 A;  4XX2 A;  3OW2 Z;  2F4O A;  1KD1 1;  3EER A;  1W2B Z;  2IV2 X;  1Q7Y 2;  4CL1 A;  3J7A 4;  5A2Q f;  2KPI A;  2IZ3 A;  1X3W A;  4QTU A;  1VQL Z;  2JA5 I;  2GTH A;  1K9M 1;  5T6B A;  2RPR A;  3HKZ A;  3IX0 A;  3QWU A;  4A3F I;  1M1K 1;  2JS4 A;  3D9X A;  1VQL 1;  3IF8 A;  3GTM S;  4NBD A;  4QTT A;  2EGT A;  4RVG A;  3S1N I;  2YU9 I;  3NH5 A;  2JMO A;  3JAM f;  3CCM Z;  3VMG A;  1VQN Z;  2R92 I;  5D1O B;  1YIT Z;  1YUK A;  3I07 A;  5FLX b;  2B63 I;  4RVF A;  2LFU A;  3NFZ A;  3S2D I;  1TWF I;  2V8K A;  4HGY A;  3CCM 1;  3J80 f;  4A3K I;  1N8R 2;  3CC4 1;  1VQN 1;  4MD9 A;  3MZK B;  2JNY A;  2JA7 I;  1Y1V S;  2R7Z I;  2JR6 A;  4E2W A;  2E2I I;  4A3M I;  4NOZ A;  1I50 I;  4A3D I;  2V8J A;  3S15 I;  2J6A A;  1KQS Z;  4Y52 I;  2AKL A;  2JUB A;  1VQ5 1;  2QRC B;  2NVY I;  3I55 Z;  1QVF Y;  3CPW Z;  3CXC Y;  3CCV 1;  5IT9 b;  3CCR 1;  1VQM Z;  4BY1 I;  5A2Q b;  3GTL I;  1KRL A;  1LQL A;  2Q51 A;  1VQ8 Z;  2KI7 B;  4NBG A;  1KC8 1;  3GTG I;  2V8I A;  1NUI A;  3GTQ I;  3H0G I;  1Q81 2;  5C44 I;  4A3J I;  1ML8 A;  2W03 A;  1VQ8 1;  4NBH A;  5FLX f;  1VQK 1;  2OTL Z;  1WW9 A;  2VF1 A;  1USP B;  2RBL A;  1YJN Z;  3JAM b;  2WAQ A;  1K8A 2;  2F4M A;  3CCQ Z;  1Q82 1;  1TWG I;  2P28 A;  5D1O A;  1K73 2;  3KIF A;  1P9N A;  3J80 b;  1Z02 A;  3U50 C;  1Y1V I;  1L1O C;  4S1T A;  4E2Z A;  3EED A;  2Y0S A;  1Z03 A;  3TDH B;  3CME 1;  1RO2 A;  3CC2 Z;  2QR1 B;  2VUG A;  2W04 A;  5IT9 f;  1Y1W I;  3CCL 1;  4E31 A;  3NDJ A;  3IFU A;  3RZD I;  3F3P C;  2Q4Z A;  5C3E I;  3FQM A;  1WJ2 A;  3HOX I;  3CC2 1;  1ZB9 A;  2K5R A;  1NJI 1;  1AA6 A;  3MON A;  1TWC I;  3NDI A;  1S72 1;  3CCU Z;  2PMZ A;  2BJO A;  5FLM I;  2QRD B;  4A3C I;  2VPX A;  2E9H A;  2JIP A;  3VB9 A;  2DE7 A;  4MD8 A;  3CCU 1;  3RZO I;  3CC4 Z;  4DK1 A;  3G6E 1;  1YHQ 1;  3G4S 1;  2P3Y A;  4NFR A;  3CCE Z;  2RHB A;  3S1R I;  3M3Y I;  2GTI A;  3BG1 B;  2M48 A;  4RS4 A;  3NH4 A;  2DE6 A;  3GTO I;  2NVT I;  1USP A;  4BY7 I;  3CCJ 1;  3CCE 1;  3GTP I;  1I3Q I;  3S14 I;  1R9T I;  1Q86 1;  4DGL A;  2LIY A;  2NVX I;  2QLV B;  2OTJ 1;  1VQ5 Z;  1QVG Y;  3S1M I;  4NH1 C;  1VQ7 1;  2NAP A;  1PFT A;  2WB1 A;  1I6H I;  3MZL B;  3CCV Z;  3CCR Z;  2NVQ I;  1KD1 2;  1M90 1;  2ZAE B;  1RO4 A;  5AN9 F;  4NBF A;  4E2X A;  2V45 A;  1SFO I;  3H3V J;  1RO0 A;  4MH4 A;  3F3F C;  4HH4 A;  1FDO A;  3GTJ I;  2V3V A;  4MON A;  1Q7Y 1;  1K9M 2;  1QVF Z;  2JIO A;  3CXC Z;  1VLA A;  1VQK Z;  1Z01 A;  1TWA I;  1M1K 2;  2VPZ A;  3CCS 1;  1RLY A;  5C4X I;  2H85 A;  3P5J B;  1DL6 A;  3CC7 1;  2DE5 A;  2O53 A;  2JIR A;  4RVD A;  3D2L A;  4E33 A;  5IP7 I;  1VQP Z;  2M6N A;  1ZH1 A;  1WZN A;  3IR7 A;  4Y7N I;  2VPY A;  2PK7 A;  3TE5 B;  1RQF A;  1VQP 1;  2QA4 Z;  1YI2 Z;  1JJ2 Y;  2K3R A;  3CME Z;  2LEX A;  4A3G I;  3CCL Z;  1N8R 1;  3GCF A;  2QA4 1;  1YI2 1;  3LUS A;  3T4N B;  4NBE A;  2G2K A;  2VUM I;  1YJ9 Z;  3NH8 A;  4BBS I;  2RIQ A;  4NB9 A;  3OW2 Y;  1S72 Z;  1FDI A;  1W2B Y;  1YJ9 1;  2QEX Z;  1QYP A;  1JWH C;  1TWH I;  1KC8 2;  2RT9 A;  4RV9 A;  3G6E Z;  1YHQ Z;  1TFI A;  3KIH A;  3S1Q I;  4A93 I;  3G4S Z;  2QEX 1;  5C4J I;  2R6M A;  3VMH A;  4A3E I;  4NBA A;  3FKI I;  1VQ9 Z;  3FQQ A;  4MD7 A;  3CCJ Z;  3VTN A;  2JA8 I;  1Q81 1;  5D1P A;  5IP9 I;  1VQ9 1;  2JIQ A;  1Q16 A;  2OTJ Z;  5LL6 f;  1Q82 2;  4E2Y A;  4MRI A;  1VQ7 Z; 
#chains in the Genus database with same CATH homology
 1VQ4 Z;  1YUA A;  1X3Z A;  1RNI A;  1K8A 1;  2OOX B;  1VQO Z;  4EWC A;  4A3I I;  4E30 A;  4NBC A;  4A3B I;  3PO3 S;  1YJN 1;  1K73 1;  3BG0 B;  1VQ4 1;  2E2H I;  1VQO 1;  3CQZ I;  1YIT 1;  2HF1 A;  1QVG Z;  1YIJ Z;  4NBB A;  1QF8 A;  4RVH A;  3GKQ A;  1KQS Y;  3CCS Z;  2JA6 I;  2QRE B;  3Q87 A;  1NJI 2;  3HOV I;  1YIJ 1;  5T67 A;  3CPW Y;  3CC7 Z;  2O4H A;  3HOY I;  2HU9 A;  1ZB8 A;  1S7M A;  2IZ4 A;  1WII A;  3J81 b;  4A3L I;  3G71 Z;  4BXX I;  4X6A I;  2I3C A;  3I4N I;  3D6W A;  3M4O I;  3G71 1;  3HOU I;  2GU2 A;  3GTK I;  3I55 1;  2E2J I;  1X0T A;  1K83 I;  3CD6 Z;  2PM9 A;  5CM2 M;  1VQM 1;  3S2H I;  3GTM I;  3I56 Z;  1YJW Z;  3S17 I;  3VMI A;  3CD6 1;  3I4M I;  3CMA Z;  3PO2 I;  4DQY B;  1N2F A;  3I56 1;  5T64 A;  4NB8 A;  1Q86 2;  1YJW 1;  4TNU A;  1JJ2 Z;  3HOW I;  4E32 A;  3PO3 I;  1WCM I;  4AYB A;  3CMA 1;  2OTL 1;  2R93 I;  2QKD A;  1VQ6 Z;  2YAD A;  2OOY B;  3HOZ I;  2OZK A;  3CCQ 1;  1M90 2;  3ESW A;  3K7A I;  4HGZ A;  1VQ6 1;  4MXU A;  4BBR I;  3S16 I;  3J81 f;  1NP6 A;  4XX2 A;  3OW2 Z;  2F4O A;  1KD1 1;  3EER A;  1W2B Z;  1Q7Y 2;  4CL1 A;  3J7A 4;  5A2Q f;  2KPI A;  2IZ3 A;  1X3W A;  4QTU A;  1VQL Z;  2JA5 I;  2GTH A;  1K9M 1;  5T6B A;  2RPR A;  3HKZ A;  3IX0 A;  3QWU A;  4A3F I;  1M1K 1;  2JS4 A;  3D9X A;  1VQL 1;  3IF8 A;  3GTM S;  4NBD A;  4QTT A;  2EGT A;  4RVG A;  3S1N I;  2YU9 I;  3NH5 A;  2JMO A;  3JAM f;  3CCM Z;  3VMG A;  1VQN Z;  2R92 I;  5D1O B;  1YIT Z;  1YUK A;  3I07 A;  5FLX b;  2B63 I;  4RVF A;  2LFU A;  3NFZ A;  3S2D I;  1TWF I;  2V8K A;  4HGY A;  3CCM 1;  3J80 f;  4A3K I;  1N8R 2;  3CC4 1;  1VQN 1;  4MD9 A;  3MZK B;  2JNY A;  2JA7 I;  1Y1V S;  2R7Z I;  2JR6 A;  4E2W A;  2E2I I;  4A3M I;  4NOZ A;  1I50 I;  4A3D I;  2V8J A;  3S15 I;  2J6A A;  1KQS Z;  4Y52 I;  2AKL A;  2JUB A;  1VQ5 1;  2QRC B;  2NVY I;  3I55 Z;  1QVF Y;  3CPW Z;  3CXC Y;  3CCV 1;  5IT9 b;  3CCR 1;  1VQM Z;  4BY1 I;  5A2Q b;  3GTL I;  1KRL A;  1LQL A;  2Q51 A;  1VQ8 Z;  2KI7 B;  4NBG A;  1KC8 1;  3GTG I;  2V8I A;  1NUI A;  3GTQ I;  3H0G I;  1Q81 2;  5C44 I;  4A3J I;  1ML8 A;  2W03 A;  1VQ8 1;  4NBH A;  5FLX f;  1VQK 1;  2OTL Z;  1WW9 A;  2VF1 A;  1USP B;  2RBL A;  1YJN Z;  3JAM b;  2WAQ A;  1K8A 2;  2F4M A;  3CCQ Z;  1Q82 1;  1TWG I;  2P28 A;  5D1O A;  1K73 2;  3KIF A;  1P9N A;  3J80 b;  1Z02 A;  3U50 C;  1Y1V I;  1L1O C;  4S1T A;  4E2Z A;  3EED A;  2Y0S A;  1Z03 A;  3TDH B;  3CME 1;  1RO2 A;  3CC2 Z;  2QR1 B;  2VUG A;  2W04 A;  5IT9 f;  1Y1W I;  3CCL 1;  4E31 A;  3NDJ A;  3IFU A;  3RZD I;  3F3P C;  2Q4Z A;  5C3E I;  3FQM A;  3HOX I;  3CC2 1;  1ZB9 A;  2K5R A;  1NJI 1;  3MON A;  1TWC I;  3NDI A;  1S72 1;  3CCU Z;  2PMZ A;  2BJO A;  5FLM I;  2QRD B;  4A3C I;  2E9H A;  3VB9 A;  2DE7 A;  4MD8 A;  3CCU 1;  3RZO I;  3CC4 Z;  4DK1 A;  3G6E 1;  1YHQ 1;  3G4S 1;  2P3Y A;  4NFR A;  3CCE Z;  2RHB A;  3S1R I;  3M3Y I;  2GTI A;  3BG1 B;  2M48 A;  4RS4 A;  3NH4 A;  2DE6 A;  3GTO I;  2NVT I;  1USP A;  4BY7 I;  3CCJ 1;  3CCE 1;  3GTP I;  1I3Q I;  3S14 I;  1R9T I;  1Q86 1;  4DGL A;  2LIY A;  2NVX I;  2QLV B;  2OTJ 1;  1VQ5 Z;  1QVG Y;  3S1M I;  4NH1 C;  1VQ7 1;  1PFT A;  2WB1 A;  1I6H I;  3MZL B;  3CCV Z;  3CCR Z;  2NVQ I;  1KD1 2;  1M90 1;  2ZAE B;  1RO4 A;  5AN9 F;  4NBF A;  4E2X A;  1SFO I;  3H3V J;  1RO0 A;  4MH4 A;  3F3F C;  4HH4 A;  3GTJ I;  4MON A;  1Q7Y 1;  1K9M 2;  1QVF Z;  3CXC Z;  1VLA A;  1VQK Z;  1Z01 A;  1TWA I;  1M1K 2;  3CCS 1;  1RLY A;  5C4X I;  2H85 A;  3P5J B;  1DL6 A;  3CC7 1;  2DE5 A;  2O53 A;  4RVD A;  4E33 A;  5IP7 I;  1VQP Z;  2M6N A;  1ZH1 A;  4Y7N I;  2PK7 A;  3TE5 B;  1RQF A;  1VQP 1;  2QA4 Z;  1YI2 Z;  1JJ2 Y;  2K3R A;  3CME Z;  4A3G I;  3CCL Z;  1N8R 1;  3GCF A;  2QA4 1;  1YI2 1;  3LUS A;  3T4N B;  4NBE A;  2G2K A;  2VUM I;  1YJ9 Z;  3NH8 A;  4BBS I;  2RIQ A;  4NB9 A;  3OW2 Y;  1S72 Z;  1W2B Y;  1YJ9 1;  2QEX Z;  1QYP A;  1JWH C;  1TWH I;  1KC8 2;  2RT9 A;  4RV9 A;  3G6E Z;  1YHQ Z;  1TFI A;  3KIH A;  3S1Q I;  4A93 I;  3G4S Z;  2QEX 1;  5C4J I;  2R6M A;  3VMH A;  4A3E I;  4NBA A;  3FKI I;  1VQ9 Z;  3FQQ A;  4MD7 A;  3CCJ Z;  3VTN A;  2JA8 I;  1Q81 1;  5D1P A;  5IP9 I;  1VQ9 1;  2OTJ Z;  5LL6 f;  1Q82 2;  4E2Y A;  4MRI A;  1VQ7 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...