2AKLA

Solution structure for phn-a like protein pa0128 from pseudomonas aeruginosa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
116
structure length
116
Chain Sequence
MVSTLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATASDDGKVIKDSVGNVLQDGDTITVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMKLKSEFVRKVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords phnA-like protein pa0128
publication title Sequence Specific Resonance Assignment of a Hypothetical Protein PA0128 from Pseudomonas Aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
total genus 15
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03831 PhnA PhnA domain
A PF08274 PhnA_Zn_Ribbon PhnA Zinc-Ribbon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2aklA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2aklA02
1BBZA 5IXFA 4NB8A 5CM2M 1MV0B 4Z88A 4Z89A 2CH4A 1AZEA 3EGUA 2LQNA 1RUWA 2BZYA 5IHNA 1X6BA 2OAWA 1RLPC 4A3KI 2D1XA 3KFVA 1UFFA 3M0UA 3RBBB 1R9TI 4AG2C 2DL5A 2KT8A 2QDLA 2YUOA 4NBAA 2EGCA 3GTOI 1GRIA 5FWBA 1VLAA 3GKQA 1OV3A 2DE7A 3PVQA 5C4XI 2PNIA 1KFZA 3HOYI 2X3XD 1USPA 2C0OA 2RQTA 3I5SA 4CC2A 1I6HI 3TVTA 2JS4A 1JO8A 1LCKA 2KRMA 1M8MA 2DRMA 2B63I 1UUEA 5C3EI 4A3BI 2JA8I 3SEMA 1ABQA 4DEYA 2NVXI 2DL3A 2RNAA 1T0JA 4ZNXA 4RTUA 1AWJA 1OPLA 2GQIA 1NYFA 4LUDA 2ED1A 2KNBB 2J6OA 2FPFA 2BJOA 2P3YA 1CKAA 2JM8A 1ZLMA 2DE0X 1TFIA 2D8HA 5IXBA 2F4OA 1UJYA 2ED0A 1M3AA 2LJ1A 1W70A 2AK5A 1HSQA 1I1JA 4A3FI 2RQVA 2CSQA 1Z9QA 2L3SA 3H0IA 1QKWA 3REAB 3S16I 1E6GA 1PFTA 3PO3S 1DL6A 1LQLA 2AKKA 2NVTI 2K2MA 2B86A 1T0HA 2SEMA 1ML8A 3K7AI 4NBBA 3I4MI 1K0XA 3IQLA 5IP9I 3EG2A 3VMHA 3VRZA 3D6WA 2YDLA 5GJVB 2DE6A 2K5RA 3FKII 1ZUYA 3EG3A 4HVUA 2PK7A 3I9QA 2DL4A 3FJ5A 1AEYA 4OMNA 4OMMA 1M3BA 5IH2A 3C0CA 5FLMI 2VVKA 1PRLC 3QWXX 2EPDA 1E7OA 3GTLI 3VB9A 1ZX6A 2KE9A 3U23A 4LN2A 1K1ZA 2OI3A 1JXMA 2EYWA 4Z8AA 1UTIA 2ROLA 1K83I 1H8KA 2EGAA 1IO6A 1WXBA 1KJWA 2D0NA 1YN8A 2F2WA 3H0GI 2VWFA 4RTYA 2KBTA 1VYVA 2CT4A 4J9EA 4JJBA 1JQQA 2X3WD 4J9HA 2EGEA 3VMIA 3ESWA 2HBWA 2E5KA 2L2PA 1AD5A 3A98A 1ZB9A 3GTQI 2BZ8A 1YWPA 2V1RA 5C4JI 1A0NB 3GTJI 4WCIA 1M27C 3S2HI 3VS2A 4BY1I 4A3EI 1WIEA 1GL5A 3EHRA 2BTTA 1ZB8A 2DA9A 3EG0A 1GFCA 2DLPA 2LNHB 2VKNA 4J9CA 1TWHI 2CUBA 2FG0A 1WFWA 1M30A 1MV3A 3PVLA 2AZSA 2CH4W 1UGVA 2AZVA 3S1NI 1NG2A 2GGRA 1GBQA 3RNJA 2RF0A 3S14I 2EYZA 3UA6A 2FRYA 3R6NA 2DL7A 4Y52I 4LE9A 2K3BA 2W0ZA 1Z9ZA 1X69A 1S1NA 5L23A 1K0SA 4GBQA 1UHCA 1N5ZA 1X43A 4F14A 1H92A 2NVQI 4F17A 4E6RA 4QTUA 1YUAA 2ABLA 2IIMA 4CC4B 2JNYA 3TSWA 1M3CA 4A3MI 5EC7A 1X2KA 2DBKA 4BBSI 2H8HA 1W1FA 2J6KA 5FW9A 2HDAA 3THKA 4RTXA 1NLOC 1NYGA 2HCKA 3VS0A 1W6XA 4AG1C 1HD3A 2W10A 3H3VJ 2JXBA 1OPKA 2KR3A 4A3CI 1RLYA 1GFDA 3UATA 1UG1A 2JTEA 1H3HA 2EKHA 2FPDA 4LNPA 2YSQA 3VS3A 4M4ZA 5FWCA 1NEBA 1SHFA 1WLPB 1WW9A 4OMPA 3O5ZA 2PZ1A 4RTVA 3RZDI 4KRTA 2DM1A 1ZUKA 5ECAA 2M51A 3VMGA 3S1QI 1V1CA 2KT1A 1VA7A 2RQUA 4AFZC 1U3OA 4NBGA 3I5RA 4JZ3A 1WDXA 2CUDA 1EFNA 5GJWB 2PTKA 1BU1A 2EBPA 2KRNA 2RN8A 2R92I 2NWMA 3LUSA 2JMCA 4J9FA 2J6AA 1U5SA 1X6GA 1Y0MA 4AFSC 2ESWA 2LMJA 1YCSB 3CQZI 1N2FA 3H41A 4NB9A 3SHWA 1SPKA 1QLYA 2V1QA 2DILA 4OMLA 4A3II 4QT7A 2DE5A 3M3YI 1VYUA 2KXCA 4A3LI 2CT3A 2LX7A 1ZSGA 4CC7A 1TUCA 3M0RA 1PRMC 2CREA 4EIKA 1TG0A 2ROTA 2LCSA 3ZL7C 1AWWA 3VRYA 1UJ0A 2K9GA 1QWEA 1I07A 2DVJA 2HEQA 1YWOA 4ESRA 3I35A 2NVYI 2KGTA 2LZ6B 4NBHA 4QTTA 2ENMA 2D8JA 3VS7A 2A36A 2YUPA 4CC3A 4A3JI 1WXTA 1NEGA 1NUIA 3M4OI 3HOZI 4A63B 1TWGI 2C0TA 4OMOA 1SHGA 4J9DA 3RZOI 2DRKA 2JR6A 2JA5I 2HSPA 2JA6I 3GTPI 2P4RA 2GTJA 4R0KA 2G6FX 4NBEA 3GTGI 1NLPC 1GCQA 1UDLA 1OOTA 2E2HI 3PO2I 2O31A 1UECA 3GCFA 5IHKA 4JZ4A 3I07A 1TWAI 2RQRA 2J06A 2J6FA 4AFUC 1OEBA 3GTMS 1YNZA 1PKTA 3HOWI 2JW4A 5IP7I 4FSSA 3GTKI 2A08A 2A28A 3H0HA 3PO3I 5I22A 1RI9A 2ECZA 4A3DI 1I50I 3H0FA 4K11A 3M0QA 3HOXI 1SRMA 2KEAA 3UA7A 1FYNA 4Y92A 1I3QI 2VUMI 1JXOA 2MCNA 1WX6A 4GLMA 2I0NA 1L1OC 2F4MA 1I0CA 1VYTA 1B07A 2F2XA 4NBFA 4D8DA 3VS4A 2L0AA 2RMOA 1G2BA 1PNJA 2O88A 1XOVA 3UF4A 2JMAA 1AWXA 2E2II 3GBQA 4HXJA 1UHFA 2YUQA 3HOVI 2EVRA 4BBRI 2E2JI 4J9BA 2MOXA 4Y7NI 1Y1VS 1B3QA 4JPBW 3EERA 1FMKA 1AZGB 1WXUA 2DX1A 2FO0A 3REBB 2RQWA 2FPEA 4XX2A 1K4US 4X6AI 4RUGA 3VS6A 1RLQC 2K6DA 4HCKA 5I11A 2JT4A 4RTTA 1X2QA 1GCPA 2L3PA 3EHQA 4BY7I 1KIKA 2DMOA 1MUZA 1G83A 1SEMA 3VS5A 1AWOA 1QWFA 2JS2A 4F16A 4J9IA 3TSZA 2O2OA 2JM9A 2R93I 3S15I 3M0TA 2KXDA 2BZXA 2O9SA 4X1VA 1USPB 1ARKA 3EG1A 3GTMI 2FEIA 2KYBA 3M0PA 1BB9A 4RTZA 1CSKA 4D8KA 1Y57A 4NBDA 2KPIA 2A37A 1ZBJA 3JV3A 3S17I 2EYYA 2K79A 3HOUI 1PHTA 3QWYA 2RBLA 2LJ0A 1X27A 3Q87A 3NGPA 4OMQA 2KYMA 2KROA 4LUEA 4HVVA 1T3LA 1X3WA 1QKXA 2L3QA 3S1RI 4AFQC 1WI7A 2YT6A 1BK2A 2EYXA 2C0IA 4IIMA 2K7AA 1UE9A 1T3SA 3ULRB 2DJQA 2HF1A 4JJCA 3S2DI 1J3TA 2SRCA 1WCMI 2MIOA 1CKBA 1NM7A 3CQTA 2J7IA 5C44I 2XMFA 2RPNA 2JA7I 1U06A 2LQWA 4IIOA 1GCQC 2AKLA 5HCKA 1TWCI 4A3GI 3U50C 2DYBA 4HVWA 2CDTA 1Y1WI 1TUDA 1YP5A 2FRWA 2EQIA 4RTWA 3VS1A 1HJDA 1Y1VI 3NMZC 2M0YA 2GNCA 1X3ZA 1GBRA 1SSHA 1JEGA 4MH4A 2OJ2A 1RO4A 2LP5A 1QYPA 4JJDA 2DNUA 2JS0A 1PWTA 4NOZA 2NUZA 2YUNA 2J05A 1JU5C 2KRSA 3NPFA 1ZUUA 1QCFA 2F2VA 3PE0A 3LH5A 1E6HA 2DL8A 2YU9I 2CSIA 3NHNA 1KSWA 1WYXA 4NBCA 1K9AA 4DEXA 4ORZA 2GBQA 1AOJA 1SRLA 2O9VA 1WA7A 4A93I 4BXXI 1SFOI 2R7ZI 2GTOA 1ABOA 5IHIA 3M0SA 4J9GA 1K76A 2DF6A 1PKSA 3I4NI 3S1MI 1AVZC 2DBMA 2LJ3A 2EW3A 1TWFI
chains in the Genus database with same CATH superfamily
4HT8A 2EYQA 1QMCA 4C92G 1AZEA 2E3HA 4BE1A 5IHNA 1U1TA 2OAWA 1RLPC 2RHYA 1UFFA 4LDXA 2KT8A 4YTLA 2RJFA 3UDCA 4FL6A 1OV3A 4E31A 3PTAA 3OB9A 1N6AA 1VQ51 5C4XI 2C0OA 1NJIR 4PJOF 2RQTA 4M77B 1QVGS 1JO8A 5LJ5j 2KRMA 2DRMA 2VASA 2WSCE 5C3EI 9ATCB 5CQXA 2O4XB 2V3VA 1NYFA 2ED1A 1WJRA 2HQEA 2J6OA 2WAQA 3V8JA 2FPFA 2P3YA 4DBQA 3CC7A 2JM8A 2H85A 4BDYA 2O4HA 2Y4YA 3G6EZ 3WXMB 2CZ1B 1UGRB 2LJ1A 2DYIA 2QA4Z 3OYNA 2AK5A 1VQMA 4C92C 3CCLT 2E3IA 4M75E 1WJ2A 4PJOG 3RUXA 1FX7A 1B7TA 1B34B 1T0HA 2KI7B 3K7AI 2DFUA 3I4MI 4C0FA 1K0XA 5CKFA 3TCJA 2OTLZ 3BDUA 3EG2A 3VRZA 1KQSA 2VPYA 2DJZA 1TU0B 4A54A 2DE6A 3CC41 3FKII 2OOXB 5GANd 2MPXC 3SDZA 4OMMA 1M3BA 1KK7A 2VVKA 4DA4A 1S72T 4BI3A 2M48A 1VQ8T 2JOYA 1Q86R 3VB9A 3GP8A 2KE9A 4QVDA 3U23A 1KRLA 1I5LA 1JXMA 3CCJT 4Z8AA 1K83I 4M7DA 1VQ6Z 1H8KA 2EGAA 3A8OB 1WXBA 3DB3A 1QXFA 1Y96B 2D0NA 2X4JA 3H0GI 2VWFA 2CT4A 1BKBA 1VQOT 4QQ6A 3VMIA 1WHMA 2E5KA 2YRCA 1AD5A 3A98A 5A0GA 4PJOC 2RHXA 2BZ8A 1YWPA 3JCMc 4BY1I 3Q1JA 1GL5A 2XDBA 3EHRA 2E1HA 4E2ZA 1F1BB 1TUGB 1ZB8A 2ZPEB 2LNVA 3CCSA 1NPRA 4J9CA 2K3RA 1TWHI 1DJ7B 5IN1A 4JS5A 2FZGB 2CH4W 4QKUA 4BY6C 2GGRA 3QG1A 3G4SQ 3MEVA 1VQNQ 2DTHA 4QQDA 1X6OA 4Y52I 1JJ2S 1TTHB 4RVDA 1VQ9Q 4FM4B 1H92A 2NVQI 3HL8A 3CCEQ 3QYGB 4F17A 4E6RA 3EG9A 3CPWZ 4CC4B 3TSWA 4PJLA 1WQWA 4R55A 2FHDA 2DEQA 2DBKA 2E6NA 5GANe 3C12A 2QQ9A 1RAAB 5GAOp 2H8HA 1W1FA 1M901 1PG5B 2HDAA 1YJNZ 2HCKA 2KMTA 1HD3A 4M77F 1VQ8A 3PMTA 4XTZA 4QVCA 1WQ7A 3CMAT 1RLYA 3DLMA 2FPDA 4LNPA 4HH4A 1Q7YU 1QF8A 1ZSZC 4M4ZA 2VPWA 2A0FB 4D6WA 4EMKB 2PM9A 1SHFA 2X4XA 4OMPA 4PJJA 1NJI1 3VYGA 2Y4XA 3RZDI 5AN9F 1ZUKA 4E7JA 2K57A 2V8KA 3VMGA 5A0DA 1VA7A 2VV5A 2Q4ZA 1U3OA 3I5RA 3G4SA 2CUDA 1EFNA 1WIIA 3I551 1SF9A 2ZPIB 4IUQA 3I56Z 2RN8A 2JIPA 2R92I 2EFIA 1LOJA 1M902 2J6AA 1U5SA 5FROA 2KY9A 4M77G 1YCSB 1VQ9A 3EFSA 4OF1A 3CQZI 1N2FA 3CCEA 3M59A 2FYKA 2W04A 2JIMA 2RHIA 2KXCA 1VQ41 4KBMB 2LRQA 3F3FC 2LX7A 2GFUA 1TUCA 1TG0A 3R6OA 2LCSA 3BG0B 3X26B 4E32A 4M78B 2DVJA 1QVFY 3V7SA 1YWOA 1NJI2 2R57A 1ZQ1A 4NBHA 3SD4A 1YCYA 4QTTA 4E7SA 1TS9A 1NEGA 2RD1A 3EGDB 3M4OI 1VQN1 1TWGI 2C0TA 2QGFB 4OMOA 4TVRA 3S3NA 4EWCA 1N8RC 1KD1C 4GY5A 4BE2A 3L2UA 4C5GA 4MDXA 2HSPA 4J8OA 2JA6I 1WHJA 1YIJQ 1P92A 4CI0C 1Q861 1K73R 2EIFA 1KQSS 4M77C 4C8QB 5IHKA 1OI1A 3S6WA 3I07A 2J06A 4IUPA 3EFOB 3M57A 3GTMS 3G6ET 4LDUA 3RIRA 4JRIA 4RCCA 2QA4T 5IP7I 2A08A 5GAMh 2NUTB 2NYSA 3QZ5B 4FT4A 3H0FA 4JLGA 4K11A 4O6JA 4PFOA 1SRMA 4KGXB 2I3CA 1G3WA 2KEAA 3UA7A 2VUMI 3CCVZ 4OGCA 5GAMf 1L1OC 4RVGA 3HTRA 4XAXB 4JRQA 2OTLT 2VPXA 4C92D 4DOWA 3CBOA 4FW1A 1GXIE 3OW2P 1M2VB 3MP6A 3VUZA 1G3YA 1BIAA 2JMAA 2YHTA 3G1JA 4F7UE 1Q862 2BE7D 1W2BY 3GBQA 4HXJA 5A2QE 3HOVI 4CRIA 2MOXA 4Y7NI 1Y1VS 1MHNA 4JPBW 1Q16A 3CBPA 1FMKA 3DLLA 5D1OA 4ZTJA 5CCAA 1YIJA 2FPEA 4X6AI 2BE9B 3PGGA 4HCZA 1YHQ1 1VQ6T 2FZKB 1RL2A 1RAGB 1QVPA 4QQGA 1Q7Y2 4PLLA 3WVDB 3M5AA 5FU7B 3VS5A 2HNIA 4RG8A 1Q81R 1WGSA 2GQVA 3CC4Z 4PJMA 1K9MU 5HKCA 2O9SA 4FT2A 4Z02A 1LJOA 3EG1A 3GTMI 2KYBA 2E12A 1CSKA 1Y57A 3GF5A 1VQ7Q 2A37A 3HP9A 1HK9A 3QWYA 3CCQ1 5KYWB 4PJOD 5D6WA 2KYMA 3M55A 3OMGA 2L3QA 4AFQC 1H3ZA 2PUKB 3RKWA 1D1AA 3V7CA 2QQSA 2VUBA 1BK2A 1PD0A 2H3JA 2K7AA 3ULRB 1BYMA 1Q82C 2OZKA 2QREB 1NM7A 3CQTA 1M1FA 4X9CA 2JA7I 4NFRA 1U06A 4IIOA 1K8AU 4M78F 2HZYA 2XD0A 5HCKA 4A3GI 3U50C 3SWNB 1C6VX 1Y1WI 2CDTA 2FRWA 4RTWA 4X34A 3VS1A 1HJDA 4HT9A 3CD6Q 1Y1VI 3NMZC 5CQYA 5I2SA 5T67A 2M0YA 5LJ5g 2GNCA 4WTOB 1WPYA 2F69A 4MD8A 4IKFA 1JEGA 1RO4A 5GAN4 2R5AA 5KE2A 4JJDA 5LJ3h 3M54A 2JS0A 2BKDN 3QPHA 2J05A 4M7AB 5KYXA 2BIVA 2DXCA 5LJ3f 1ZUUA 4C8QF 1VQ7A 4BB7A 2G2KA 4NBCA 1K9AA 5GAN6 4DQ2A 4KUDK 4M78G 1IREB 1AOJA 2O9VA 1WA7A 4BXXI 3TREA 3I56T 4O5VA 1K731 2VGNA 2COYA 4XK8E 5DLOA 1KHIA 3OYBA 2L5QA 2JIQA 5I2MA 3JCMP 1YITQ 1SIWA 2DBMA 3M53A 1BBZA 4M77A 4Z88A 1MV0B 3OYMA 5GAOn 4Z89A 2CH4A 2OX7A 1XTDA 3KUFA 2LQNA 4A3KI 2O4XA 4M7DE 3M0UA 4EMGA 3NTIA 3CD6A 1R9TI 4MXUA 4C8QG 5FWBA 1VQ71 5KYNA 1SG5A 2HQHA 2M9UA 1M1GA 1TWBA 2PNIA 3I55Z 1YJW1 1HYOA 2Z0WA 1QCNA 3I5SA 2LT4A 2EAYA 1VQOZ 3LH0A 1LCKA 2XG8D 2D6FA 2DD4A 3C94A 1YJNA 1UUEA 2P0KA 2RT9A 5LJ3e 1ABQA 3CCMT 4C5IA 1KHCA 4M78C 1RI0A 4N0AC 1VQLQ 4WF2A 1KC8U 4RTUA 3A8GB 1K8A1 3OW2Z 1VQ4Z 2ZZDA 1RQFA 1R0BG 1B34A 2KI7A 2WSFE 3KBGA 1K9M2 2QQRA 4MMKA 2F4OA 2COZA 5A0LA 1M3AA 2O01E 3FQMA 2VGMA 3CD61 2KQWA 1VQ5T 1YITA 1YJ91 1Q811 1JBMA 1E6GA 4M77D 4MRIA 5KYYB 3PO3S 4C8QC 1LQLA 1Y07A 2SEMA 2ZPBB 1N9SA 1VQPQ 3J80E 3IQLA 2E4HA 3OYIA 3D6WA 2VXEA 5GJVB 1WJSA 1ZUYA 1Y96A 3EG3A 4HVUA 4DK1A 1ZSZB 4EPCA 3CC2Q 3FJ5A 1AEYA 3KIHA 2LQ8A 3G711 4RV9A 2V26A 1K8A2 1EIFA 3OMCA 3QWXX 5GAMj 3GTLI 1ZX6A 4Y91A 4F7UA 3MP1A 1QVGP 2JMOA 1VQLA 1W4SA 4LDWA 2LTOA 3NDJA 3CCUZ 3F3PC 1X75C 1ZHIA 1M1KC 3PT9A 5DM7R 1M90C 4FU6A 4II1A 4PL6A 4RTYA 4J9EA 1Q812 4JJBA 3S3OA 4KH0B 4OMFB 2X3WD 4C0DB 2DXBA 2HBWA 4M7AF 2HKNA 5CKHA 4RVFA 2V1RA 6AT1B 3KXTA 1A0NB 3CC4T 2V8IA 2PVDB 2YRDA 3TQ7P 1G3TA 3CC7Q 3OBWA 3OYFA 1BI3A 2KAFA 2BTTA 1GFCA 7AT1B 1NJIC 5FU7C 1M30A 1MV3A 1MNEA 3OS1A 3CEYA 2AZSA 2B8AA 1FMVA 1VQPA 1KC81 1GBQA 3RNJA 1QVFA 2RF0A 1YHQZ 2EYZA 3UA6A 1IHVA 1VQL1 2GTIA 5CR2A 4B6MA 2K3BA 1UB4A 1OQKA 2W0ZA 1X69A 2PU9B 3CC2A 2OTJ1 5L23A 1YI21 1K0SA 3CCVA 2IG0A 1UHCA 2EKOA 4E30A 3A5ZB 1OU8A 3CCR1 2IIMA 4M7AG 4VUBA 2JNYA 1QP2A 1BCOA 3CME1 5EC7A 4JRKA 4XU0A 5KYUB 5GAN3 4BBSI 4EMKA 2J6KA 1R8OB 1NYGA 3CCQZ 1Y7XA 5CO7A 5M9OA 3O8VA 4A3CI 3OY9A 2JTEA 1VQP1 1H641 2XHCA 2YSQA 1KC82 3JB9I 4OP0A 3SWNC 4DBRA 2FL7A 1NEBA 1WLPB 4XTVA 1WW9A 5D1PA 2HKQB 3C4SA 4NL3A 4KULA 1FMWA 2PZ1A 1RACB 2ATCB 4KRTA 3JCMd 5ECAA 2JZ2A 2XDPA 2QKDA 3OYEA 2YRVA 4JZ3A 1WDXA 1Q86C 3CCSQ 2QYZA 5GJWB 1BU1A 3DB4A 4M7AC 3LUSA 1W2BA 5FLXb 2MWOA 2ESWA 2LMJA 4M78A 5LJ3j 3EH1A 3CCLQ 3JCMg 2DILA 4KH1B 4E7LA 4FYWB 3E1SA 4ZGDB 3TDHB 4FYYB 1M2OA 1MMNA 2CT3A 3LX7A 3ZEHA 2CP0A 2RM4A 3CC71 5GANh 1PRMC 2CREA 3ZL7C 1VQKZ 4J7IA 1Q95G 1I07A 2RK2A 3FDRA 1VQM1 2E10A 5GANf 3F70A 2D8JA 2A36A 3I55T 2QRDB 3FEOA 1S72Q 5FLXf 1VQ8Q 3HOZI 4A63B 3EFOA 2PUOB 2GTHA 3M58A 1SHGA 4IURA 3RZOI 4OB0B 3BFMA 3CPWY 3CCJQ 1Q7YR 3JB9F 2RI5A 4R0KA 3IF8A 3G7ZA 3HRSA 2LT1A 2DIQA 1UDLA 1FXXA 1OOTA 2E2HI 2RK1A 1VQ4T 3UT1A 2AHJB 3GCFA 3OYCA 2MI6A 1TWAI 2RQRA 4A4HA 1RAFB 5FRNA 3JCMe 4LDVA 1JRIA 4BD3A 1PKTA 3LWIA 2ZPHB 2LCCA 4M78D 1IZ6A 1OX9A 3CCLA 2CZ0B 1M2VA 1YJWZ 1QVGZ 2A28A 2M02A 5I22A 1RI9A 4J6WA 4A3DI 3M0QA 2Y90A 2X51A 3V7RA 4Y92A 1I3QI 1JXOA 4KGVB 5IT9f 1VYTA 3OYHA 1B07A 3QYHB 2F2XA 3OYLA 4E7HA 5CVIA 3VS4A 3A8HB 3UF4A 2NUPB 3AT1B 1UHFA 2YUQA 5IAYA 3CCS1 1S72A 3QIIA 1B3QA 2RO0A 1BIBA 5GMKl 3CCJA 2JN0A 2FO0A 3REBB 1YJ9Z 3JCMV 4RUGA 1QVFS 3NH5A 3PIOA 2K6DA 3CCUT 1FWZA 3X20B 2I2LA 4RTTA 3NH4A 1GCPA 1VQOA 3EHQA 1KIKA 3CMAQ 1SEMA 1AHJB 3OYKA 1KQSP 2JS2A 1R77A 2L3RA 2O2OA 2A7YA 2JM9A 3MEWA 2R93I 2RA2A 3M0TA 3G71Z 3J7A4 3OW2A 1ARKA 1BB9A 3JV3A 4M77E 2DTIA 3S17I 4C0DC 2EYYA 3HOUI 1PHTA 1VQ81 1YFNA 3FJPA 4HGYA 3MZLB 1X27A 3Q87A 2KROA 1QKXA 5LL6f 1YHQT 3RMSA 3TU4K 3QHSA 3OYGA 3C95A 4V2SA 2CP6A 1K73C 2LDMA 5T64A 3HKSA 4ZTFA 4JJCA 1M4ZA 4C92A 1WCMI 2HSEB 2MIOA 2MYSA 3L1AA 3IR7A 2XI9A 3HRTA 5C44I 2CGHA 2QEXZ 4E33A 2RPNA 3L2RA 5DY9A 1GCQC 3G4S1 4M7AA 4CL1A 4C5HA 2EQIA 3CCMZ 1PM3A 3BE3A 5KE3A 3CCQT 3L2ZA 1W2BS 1VQ91 3GOXA 3MPUB 3CMAA 3CCE1 1QYPA 4IUTA 4IUUA 2VF1A 2DNUA 2E6ZA 3CCUA 3JB9H 4NOZA 2OTJZ 2NUZA 1YI2Z 2QTXA 2YUNA 1WJQA 2KRSA 4AT1B 3CCRZ 2ZAEA 1K9MR 1E6HA 1V29B 2YU9I 1VQ5Z 3CMEZ 2CSIA 1KSWA 1WYXA 4LXCA 2EQKA 2LCLA 1Q7Y1 1XJWB 2Q51A 1BI1A 4M7DB 4RVHA 2RH2A 3G6EQ 3BY7A 5KH6A 1ABOA 2HU9A 3M0SA 2JVVA 2QA4Q 2DF6A 1S7MA 4PJOA 2CZ6B 2MWPA 3I4NI 2K5FA 5GAMd 2OAUA 3CXCP 1IB8A 3VUBA 1TWFI 5IXFA 4NB8A 5CM2M 1Q81C 1D0XA 3MEAA 2D0QB 1RABB 4M7AD 2L8DA 1RUWA 5T6BA 2BZYA 1X6BA 5D6XA 3WVEB 2D1XA 2OTLQ 3RBBB 1K8AR 4AG2C 1VQKT 3JRZA 2EWNA 2QDLA 2YUOA 4NBAA 2EGCA 3BW1A 5GAMg 3RMQA 2VPZA 1SSFA 1NZ9A 1RAHB 3HSBA 3PVQA 2Y0SA 1KFZA 3HOYI 3M56A 1V76A 1USPA 2R58A 4NL2A 4CC2A 1I6HI 2VXFA 2DXUA 2B63I 2VYTA 1C1AA 2F5KA 1WHHA 2NVXI 2JUBA 2DL3A 1T0JA 4ZNXA 2RJEA 1LPLA 2X9HA 3EG9B 3OBYA 1OPLA 3D2LA 1VQ6Q 2QG9B 4LUDA 2DETA 5GANj 8AT1B 2KNBB 5KYYA 2LC4A 2BJOA 1YBYA 4ZN3A 1CKAA 2DO3A 1ZLMA 1TFIA 2D8HA 1UJYA 2ED0A 1RADB 3G6EA 4QVZA 4OB2B 1OULA 1W70A 2QA4A 1VQMZ 3QO3A 1HSQA 1YJWT 1I1JA 4A3FI 1ZSZA 2RQVA 1Z9QA 1YIJ1 2L3SA 1QKWA 3QKJA 4N4GA 2DZ9A 4XU2A 1M9SA 2K2MA 5LJ5d 2B86A 1N8RU 1KD1U 2CP3A 2CYZB 2GFAA 4NBBA 3H9NA 2OTLA 4HA8A 3LW5E 1KQSZ 1M8VA 2YADA 2CS7A 5CKEA 2K5RA 3MCAB 2PK7A 3I9QA 4B9WA 2DL4A 3ASKA 3P5JB 2WB1A 5IH2A 3C0CA 2GF7A 5GAOl 3OW2S 3MZKB 2EPDA 1VQKA 5GAN5 1FDIA 4LN2A 2LFUA 1PCXA 1NE8A 2EYWA 1UTIA 2ROLA 2QK0A 1YJ9T 1VQ6A 4KUIA 3H6ZA 1YJNQ 2R5MA 2F2WA 1IHWA 4ATOA 2KBTA 1KC8R 3HHTB 3E2UA 1JQQA 5GAN8 2EGEA 3ESWA 2HMAA 3OSVA 3NTHA 2IZ4A 1ZB9A 4PKCC 3GTQI 5C0MA 2OTL1 1M27C 3VS2A 4M78E 4A3EI 4ANJA 1KG1A 2CP7A 1WIEA 2XIDA 1MMDA 3QJYA 5KCOA 3G71T 2AIRB 1VUBA 3EG0A 3LGLA 2VKNA 2LNHB 1ZH1A 1WZNA 3NFZA 1RO0A 2FG0A 4M7DF 2KK4A 3CPFA 4HCBA 3S1NI 1NG2A 2ZPGB 3P8BB 1NBEB 3L2WA 2VC8A 2NLUA 5KYUA 3OW2Y 2FRYA 3X28B 1K9M1 3QDRB 2QGGA 4N4HA 3I56Q 1VQ61 5LJ5e 1Z9ZA 1S1NA 4GBQA 1N5ZA 4F14A 1YUAA 2ABLA 4DBHA 4PLIA 3CPWA 4A3MI 4AYBA 5GAN2 2QEXT 3D9XA 1MMAA 2M6NA 2E65A 2QQBA 2XDDA 4RTXA 1NLOC 1N8R1 2YLCA 3HFNA 2P4TA 4AG1C 3EH2A 4M7DG 4M75B 2DK3A 2HBPA 1JB0E 2KR3A 3CXCZ 3UATA 1UG1A 4FIBA 5AT1B 2EQUA 2XICA 2DZCA 2XKOC 3OYAA 3CCMQ 2OTJT 1YI2T 2LQKA 4RTVA 1Q82U 3CCRT 2E9HA 4TNUA 2M51A 3PFSA 3S1QI 1V1CA 4AFZC 1MGQA 3CMET 3G4SZ 1UGPB 5D1OB 4XTWA 2RJDA 3OSSC 3OYYA 4OB3B 1VQNZ 2PTKA 3A1PA 3IFUA 2EBPA 3FC3A 3PMIA 3I56A 4RCBA 1YJN1 1X6GA 4DBFA 1VQ9Z 1VQ5Q 3N5BB 3SFMA 3CCEZ 3H41A 1N8R2 1KD12 1SPKA 3SHWA 1QLYA 2EJGA 4OMLA 4E7IA 1IGQA 2DE5A 3M3YI 1VYUA 1MMGA 3BG1B 3CCVQ 4M7DC 1NPPA 1JWHC 1ZSGA 1X0TA 3M0RA 4EIKA 2RIQA 2V45A 3VRYA 2PMZA 2K9GA 1QWEA 3MHXA 2QR1B 2LZ6B 4E2WA 3BDLA 4PFZA 1YIT1 3VS7A 4MZMA 2YUPA 4CC3A 1Z02A 4A3JI 2X4WA 4MD9A 1UGSB 3CCMA 2DRKA 2IV2X 2JJ9A 3RKYA 2AT1B 2XU8A 4PFPA 4BI4A 2P4RA 2GTJA 1XNIA 1O9SA 2G6FX 4NBEA 1G5VA 4RMOA 1D0YA 4C5EA 2QRCB 4OVAA 2O31A 4JZ4A 3NTKA 4AFUC 1OEBA 3TE5B 3HOWI 2JW4A 3CC4Q 3URGA 2IPOB 4FSSA 1EZZB 5GMKm 3GTKI 3KIFA 1R0CB 3H0HA 1VQMT 3PO3I 1VQ5A 1TXQA 2ECZA 1I50I 3HOXI 4C92E 3OYJA 4S1TA 1WX6A 2K5IA 4OB1B 4ELZC 3LYIA 5KYXB 1I0CA 1OU9A 1VIFA 4M7AE 4D8DA 3LLRA 4ZGJB 1G2BA 1XOVA 2KDSA 1AWXA 5AYFA 4JDSA 1G8XA 2QDYB 3ER0A 1QP3A 3JCMW 5HY6A 4DGLA 2E2JI 4J9BA 3OYDA 3E9FA 2NAPA 3JCMb 5GAN7 1D1BA 3V8KA 1YIJZ 2RQWA 4Y28E 4XX2A 2K3YA 4M75F 3M4GA 3VS6A 3RESA 4J6YA 5I11A 2RHBA 1X2QA 3M9QA 2L3PA 3FLGA 3RERA 3CC21 4BY7I 3CCV1 1MUZA 1AWOA 3RKXA 1QWFA 3ZBDA 1M5Q1 4F16A 3JCMX 4J9IA 3VJPA 3JCMh 3CC4A 3TSZA 1Q822 3CPWS 1OZ2A 2JIRA 5CKDA 4PJOE 3S15I 2F1LA 2BZXA 3JSCA 4QW2A 1OYXA 2FEIA 3HFOA 4A4GA 4E7ZA 3JCMf 3CCST 4NBDA 5GAOq 1ZBJA 2C06A 4GLKA 4N0AA 1OX8A 2QAZA 2K79A 2HD0A 2RBLA 2LIYA 3NGPA 1JJ2P 1T3LA 3P8HA 3QJ6A 4M75G 1Q7YC 4E2FB 2YXYA 1M1KU 3EGDA 2QTVA 1M90U 2HQXA 4ME7A 3EGXB 3H8ZA 2C0IA 4IIMA 1UE9A 4UC4A 3L2VA 2IZ3A 2VUGA 5LL6S 3S2DI 3CBMA 2SRCA 1CKBA 2P84A 1QVGY 1AT1B 4BDZA 4JJNK 4C8QA 2AKLA 1TWCI 2DYBA 2QLVB 2RI2A 3DKMA 4HVWA 2QI2A 1TUDA 4FSXA 1VOMA 3T9NA 1NJIU 1X3ZA 1FDOA 5IT9b 4MH4A 2RB6A 1PC0A 1QVFP 2NUTA 1D3BB 2LP5A 2PVGB 2MF2A 3I55Q 3JCMJ 4Q5WA 1OZ3A 1VQOQ 3QDFA 2EJFA 1PWTA 5GANg 5CKBA 5FU6B 3NPFA 4KGZB 4XQ3A 1QCFA 1VQ7Z 4M75C 2DL8A 2DTOA 2KVQG 4R56A 4F7UB 1VQ4Q 3G4ST 3HPWA 4MZTA 4E47A 5FLXE 4L59A 1QCOA 1VQNT 5CIUA 2VB6A 3QSUA 1SFOI 3FB9A 4LD9K 1ZA2B 1RAIB 5IHIA 4J9GA 1VQ9T 1WZOA 3JB9G 3INZA 3L42A 3CCET 3QZ9B 4NH1C 1KQ1A 1C0MA 3QWUA 3VV0A 4C8QD 4EMHA 5GMKh 1I81A 1U8RA 3EGUA 3JB9J 2O53A 3KFVA 3UPUA 4NOYA 3CD6Z 4J7FA 2M1HA 1VIEA 2DL5A 1LVKA 1G3SA 3GTOI 1GRIA 1VLAA 3GKQA 2DE7A 4XU3A 5FRMA 3CCL1 2YWWA 3PIPA 2X3XD 3I55A 1Q86U 1M1K1 4M7DD 3TVTA 2JS4A 1M8MA 1W2BP 5IT9E 2OOYB 4A3BI 3MO8A 2JA8I 3HRUA 3SEMA 3RR6A 5KYWA 3MP8A 2EGTA 4DEYA 4MONA 4J6XA 2RNAA 1AWJA 2GQIA 3CCUQ 3CXCA 4J83A 4AMCA 1TOVA 3A8MB 1VQ4A 3ME9A 2FZCB 5EG2A 3HKZA 1N27A 5GAOm 2XK0A 2DE0X 5IXBA 4RKUE 1PSFA 1S721 2BUDA 4DOVA 5I21A 1YITZ 1JJ2Y 3CCJ1 4FYVB 2CSQA 3H0IA 3REAB 3SWNA 3IX0A 3S16I 1PFTA 2PQWA 3AHUA 4P5NA 1DL6A 1VQNA 2W03A 4MD7A 2AKKA 2NVTI 3UWNA 1Y71A 3MEUA 3NDIA 3GNGA 1VQO1 1ML8A 1M1K2 1WHGA 2LEXA 5IP9I 3VMHA 3E9GA 5GMKe 2YDLA 1YHQQ 3VTNA 3T4NB 2JTMA 1RNIA 1K9MC 4FCYA 3OQ5A 4OMNA 4BI8B 5FLMI 4RS4A 1PRLC 2K2VA 1E7OA 2K3XA 5A2Qb 2P0PA 1K1ZA 2OI3A 1XQHA 1VQLZ 2MMPA 3NFCA 1JJ2Z 3NH8A 1YIJT 1IO6A 3OS5A 1KJWA 1YN8A 2WSEE 1WHKA 3CCQQ 1VYVA 2X35A 1EX4A 5HK3A 4RG2A 1BI0A 4BACA 4J9HA 2L2PA 3JCMQ 3JAMb 3META 3EFRA 2HAXA 5C4JI 2ZCFB 3GTJI 4WCIA 4A4KA 4E7KA 3S2HI 1K8AC 4HGZA 4A53A 1I4K1 2M16A 2RI3A 1I8FA 4C0GA 4F7UF 3OS2A 2DA9A 3QBYA 5J26A 2HL5C 2X4YA 2DLPA 2K5LA 2CUBA 5A2Qf 1WFWA 3PVLA 1RO2A 4PNOA 1UGVA 2AZVA 1VQPZ 1QVFZ 3CMA1 2COWA 3S14I 2QXFA 1N8RR 1KD1R 1YHQA 3R6NA 2DL7A 3GIBA 4LE9A 1YUKA 3CCU1 3CC2Z 4LDYA 2LVMA 2MAMA 3JAMf 1X43A 4JRPA 4M75A 2PVOB 4BUGA 4QTUA 4E2XA 1M3CA 2RHZA 4BE0A 1X2KA 4C0ZA 5GMKi 4KT0E 5FW9A 3THKA 4F7UG 2QQAA 3VS0A 1D1CA 1VQKQ 1W6XA 1ACMB 2W10A 3CCQA 3H3VJ 2JXBA 1Y8CA 4LD6A 3M4YA 1OPKA 4JLIA 1KQSY 3LWHA 1GFDA 5J39A 4FW2A 1H3HA 2EKHA 2AYDA 2EQMA 3VS3A 3CC7Z 4DQYB 2DAQA 5FWCA 1AA6A 3JAME 2F5TX 3O5ZA 1K73U 2DM1A 1SKUB 1VQ7T 3MKDA 2KT1A 2RQUA 4XTXA 4NBGA 4F04B 4E2YA 1QW1A 1ZA1B 5CK9A 1P9NA 2D9TA 2QASA 4A4FA 1BCMA 1MNDA 2KRNA 5FU6C 2NWMA 1W2BZ 2JMCA 2MK5A 4J9FA 5GAMe 4AFSC 1Y0MA 4M75D 5LJ5h 4NB9A 1YJWQ 1KC8C 2ZPFB 2RPRA 2V1QA 3A8LB 3S3MA 4A3II 4QT7A 3CXCS 4A3LI 5LJ5f 4OGEA 4MMLA 2DIGA 4CC7A 2ROTA 3J81b 5C6SA 1AWWA 1U1SA 1UJ0A 3CD6T 3G6E1 2JTFA 2HEQA 4ESRA 3OA6A 3I35A 2NVYI 2QA41 1WNLA 3FQQA 2KGTA 3LGFA 1IXDA 2DVEA 3L2QA 2ENMA 5GAOr 1N9RA 1WXTA 3PNWC 2EQJA 3MONA 2CKKA 1NUIA 4J9DA 1YJNT 2V8JA 2GCXA 2JR6A 4XU1A 4N4IA 2JA5I 1I5OB 4MZPA 3GTPI 5LJ3d 1YJ9Q 4C92B 3GTGI 1NLPC 5GMKj 1GCQA 5DLQE 3PO2I 2L89A 1Q82R 1Q81U 3D7SB 1UECA 3CCSZ 3P8DA 3J81f 4J5YA 2J6FA 5D6YA 1YNZA 2R6MA 1VQK1 3CCLZ 3CXCY 5LJ3g 1YJWA 1QVGA 3G71Q 1YITT 4NS5A 2LX9A 3OS0A 1D0ZA 2CP2A 1FYNA 2DPPB 4EMKC 3JB9D 2MCNA 4GLMA 3X25B 2I0NA 3EEDA 2F4MA 4C8QE 1KQ2A 4NBFA 1O75A 2ZAEB 2FVUA 2HL3A 2L0AA 2RMOA 4PJNA 3J80b 1PNJA 2P28A 2O88A 3GPLA 4A4EA 5KCHA 3J81E 3FRNA 2E2II 1KD11 1S72Z 3EAEA 2M0OA 1QQJA 3VYHB 1VQ8Z 2EVRA 4MDWA 4BBRI 4L6V5 3ZFJA 3EERA 1BI2A 2H3EB 2QEXQ 4PJOB 1AZGB 2K4YA 3CCJZ 1WXUA 2DX1A 1VQLT 4FYXB 1K4US 2IVWA 1YJ9A 1RLQC 1TSFA 1PSEA 4HCKA 4IUVA 2E7ZA 2JT4A 5D7UA 4JUVA 1ZBXA 2E64A 4PK4A 1IRXA 4B9XA 2DMOA 2RHUA 1G83A 3MJXA 2G3RA 3J80f 4BY6B 2JIOA 1K732 1TH7A 2DERA 2JNGA 4XTUA 2A3LA 2YLBA 3QXEB 2KXDA 2OTJQ 1YI2Q 4EDUA 1IGUA 3G71A 3V8LA 4X1VA 1USPB 4L5GA 5J3BA 1D09B 4RTZA 2CZ7B 3EGXA 3M0PA 3J7AF 3CCRQ 4D8KA 1UGQB 2KPIA 1WHLA 1Z01A 3CMEQ 2LJ0A 1VQPT 2KSSA 4OMQA 4LUEA 4HVVA 1X3WA 2DEUA 3S1RI 1RAEB 1WI7A 8ATCB 2CP5A 2YT6A 3SB2A 4ZGEB 2DXTA 1Z03A 3CC2T 2EYXA 2JUFA 3CCVT 1T3SA 2DJQA 1HXDA 3GNFB 2HF1A 1J3TA 1NP6A 1D3BA 3FIFA 2J7IA 2DKGA 2XMFA 2LQWA 2QEXA 3RDVA 2ZGWA 1X01A 2EJ9A 5CAIA 1YP5A 4ELYC 3I561 2P0QA 1GBRA 4JS4A 1SSHA 2RJCA 3CMAZ 1PD1A 2OJ2A 3E19A 4HCCA 4XTYA 1LNXA 2E5QA 1JJ2A 1UEBA 2DD5A 4C92F 3TEEA 2OTJA 1YI2A 3CC7T 1JU5C 2F2VA 2FB7A 2E70A 4HKEA 3VU3C 3QUIA 3CPWP 3CCRA 3PE0A 3LH5A 2WACA 3NHNA 4X9DA 3CMEA 4ZN1A 2NUPA 4DEXA 4ORZA 2GBQA 2E41A 2GU2A 2QEX1 1SRLA 4A93I 3X24B 2R7ZI 3GLXA 5HK0A 2GTOA 1Q821 3CCM1 1K76A 3VKIA 1VQMQ 1PKSA 3S1MI 1M1KR 1AVZC 1M90R 5L8RE 2LJ3A 2EW3A
chains in the Genus database with same CATH topology
1BBZA 4NH1C 5IXFA 4NB8A 5CM2M 1MV0B 4Z88A 3QWUA 4Z89A 2CH4A 1AZEA 3EGUA 2LQNA 2O53A 5T6BA 1RUWA 1X6BA 2BZYA 1RLPC 4A3KI 2D1XA 2OAWA 3KFVA 5IHNA 1UFFA 3CD6Z 3M0UA 3RBBB 1R9TI 4AG2C 4MXUA 2DL5A 2KT8A 2QDLA 2YUOA 4NBAA 2EGCA 3GTOI 1GRIA 5FWBA 1VQ71 1VLAA 3GKQA 4E31A 1OV3A 2DE7A 3CCL1 3PVQA 2Y0SA 1VQ51 5C4XI 2PNIA 3I55Z 1YJW1 1KFZA 3HOYI 2X3XD 1USPA 2C0OA 2RQTA 1M1K1 3I5SA 4CC2A 1I6HI 3TVTA 2JS4A 1VQOZ 1JO8A 1LCKA 2KRMA 1M8MA 2DRMA 2B63I 2OOYB 1UUEA 5C3EI 4A3BI 2JA8I 3SEMA 2RT9A 1ABQA 2EGTA 4DEYA 2NVXI 2JUBA 4MONA 2DL3A 2RNAA 1T0JA 4ZNXA 4RTUA 1AWJA 1OPLA 2GQIA 1NYFA 1K8A1 2ED1A 4LUDA 3OW2Z 2KNBB 1VQ4Z 2J6OA 1RQFA 2WAQA 4J9CA 2FPFA 2BJOA 2P3YA 3HKZA 1CKAA 2JM8A 2H85A 1ZLMA 1K9M2 2DE0X 1TFIA 2D8HA 5IXBA 2O4HA 2F4OA 3G6EZ 1UJYA 2ED0A 1S721 1M3AA 2LJ1A 3FQMA 2QA4Z 3CD61 1W70A 1VQMZ 2AK5A 1YITZ 1HSQA 1JJ2Y 3CCJ1 1I1JA 4A3FI 2RQVA 2CSQA 1Z9QA 1YIJ1 2L3SA 1QKWA 3H0IA 1YJ91 1Q811 3REAB 3IX0A 3S16I 1E6GA 1PFTA 4MRIA 3PO3S 1DL6A 1LQLA 2W03A 4MD7A 2AKKA 2NVTI 2K2MA 2B86A 3NDIA 1T0HA 2SEMA 2KI7B 1VQO1 1ML8A 3K7AI 1M1K2 4NBBA 3I4MI 1K0XA 3IQLA 5IP9I 2OTLZ 3EG2A 3VMHA 3VRZA 3D6WA 2YDLA 1KQSZ 3VTNA 5GJVB 3T4NB 2YADA 2DE6A 3CC41 2K5RA 1RNIA 3FKII 1ZUYA 3EG3A 4HVUA 2PK7A 4DK1A 3I9QA 2DL4A 2OOXB 3FJ5A 1AEYA 4OMNA 3KIHA 3P5JB 2WB1A 3G711 4RV9A 1M3BA 4OMMA 5IH2A 3C0CA 1K8A2 5FLMI 2VVKA 4RS4A 1PRLC 3QWXX 3MZKB 2EPDA 2M48A 1E7OA 3GTLI 3VB9A 1ZX6A 2KE9A 5A2Qb 3U23A 4LN2A 1K1ZA 1KRLA 2OI3A 2JMOA 1VQLZ 1JXMA 2LFUA 2EYWA 4Z8AA 1UTIA 2ROLA 1JJ2Z 3NH8A 1K83I 3NDJA 3CCUZ 3F3PC 1VQ6Z 1H8KA 2EGAA 1IO6A 1WXBA 1KJWA 2D0NA 1YN8A 2F2WA 3H0GI 2VWFA 4RTYA 2KBTA 1VYVA 2CT4A 4J9EA 1Q812 4JJBA 1JQQA 2X3WD 4J9HA 2EGEA 3VMIA 3ESWA 2HBWA 2E5KA 2L2PA 1AD5A 3A98A 3JAMb 2IZ4A 1ZB9A 4RVFA 3GTQI 2BZ8A 1YWPA 2V1RA 5C4JI 2OTL1 3GTJI 4WCIA 1M27C 2V8IA 1A0NB 3S2HI 3VS2A 4BY1I 4HGZA 4A3EI 1WIEA 1GL5A 3EHRA 4E2ZA 2BTTA 1ZB8A 2DA9A 3EG0A 1GFCA 2DLPA 2LNHB 1ZH1A 2VKNA 2K3RA 1RO0A 3NFZA 1TWHI 2CUBA 5A2Qf 1WFWA 1M30A 1MV3A 2FG0A 3PVLA 2AZSA 1RO2A 2CH4W 1UGVA 2AZVA 1VQPZ 3S1NI 1NG2A 2GGRA 1KC81 1QVFZ 1GBQA 3RNJA 3CMA1 2RF0A 3S14I 1YHQZ 3OW2Y 2EYZA 2FRYA 1K9M1 3UA6A 1VQL1 3R6NA 2DL7A 2GTIA 4Y52I 4LE9A 2K3BA 1YUKA 3CCU1 1VQ61 1Z9ZA 2W0ZA 1X69A 3CC2Z 1S1NA 4RVDA 2OTJ1 5L23A 1YI21 1K0SA 4GBQA 3JAMf 1N5ZA 1UHCA 1X43A 4F14A 1H92A 2NVQI 4E30A 4F17A 4E6RA 4QTUA 4E2XA 3CCR1 1YUAA 2ABLA 3CPWZ 2IIMA 4CC4B 2JNYA 3TSWA 1M3CA 4A3MI 4AYBA 3CME1 5EC7A 1X2KA 2DBKA 3D9XA 4BBSI 2H8HA 2M6NA 1W1FA 1M901 2J6KA 5FW9A 2HDAA 3THKA 4RTXA 1YJNZ 1NLOC 1NYGA 2HCKA 3VS0A 1N8R1 1W6XA 4AG1C 1HD3A 3CCQZ 2W10A 3H3VJ 2JXBA 1OPKA 1KQSY 2KR3A 4A3CI 1RLYA 3CXCZ 1GFDA 3UATA 1UG1A 2JTEA 1VQP1 1H3HA 2EKHA 2FPDA 4LNPA 4HH4A 2YSQA 1QF8A 1KC82 3VS3A 4M4ZA 3CC7Z 2PM9A 4DQYB 5FWCA 1NEBA 1SHFA 1WLPB 1WW9A 5D1PA 4OMPA 1NJI1 3O5ZA 2PZ1A 4RTVA 3RZDI 4KRTA 2DM1A 5AN9F 1ZUKA 2E9HA 5ECAA 4TNUA 2M51A 2QKDA 2V8KA 3VMGA 3S1QI 1V1CA 2KT1A 1VA7A 2RQUA 4AFZC 2Q4ZA 1U3OA 3G4SZ 4NBGA 3I5RA 4JZ3A 1WDXA 5D1OB 4E2YA 2CUDA 1EFNA 1WIIA 3I551 5GJWB 1VQNZ 1P9NA 2PTKA 3IFUA 1BU1A 3I56Z 2EBPA 2KRNA 2RN8A 2R92I 2NWMA 1W2BZ 3LUSA 2JMCA 4J9FA 5FLXb 1M902 2J6AA 1YJN1 1U5SA 1X6GA 1Y0MA 4AFSC 2ESWA 1VQ9Z 2LMJA 1YCSB 3CQZI 1N2FA 3CCEZ 4NB9A 3H41A 1N8R2 1KD12 1SPKA 3SHWA 1QLYA 2RPRA 2W04A 2DILA 2V1QA 4OMLA 4A3II 4QT7A 2DE5A 3M3YI 1VYUA 2KXCA 3BG1B 3TDHB 4A3LI 1VQ41 2CT3A 1JWHC 3F3FC 1ZSGA 2LX7A 4CC7A 1X0TA 3CC71 1TUCA 3M0RA 1PRMC 2CREA 4EIKA 1TG0A 2ROTA 1VQKZ 3BG0B 3J81b 2RIQA 2LCSA 3VRYA 3ZL7C 1AWWA 1UJ0A 2PMZA 3G6E1 2K9GA 4E32A 1QWEA 1I07A 2DVJA 1QVFY 2HEQA 1YWOA 1NJI2 4ESRA 3I35A 2NVYI 2QA41 2KGTA 2QR1B 3FQQA 2LZ6B 4E2WA 4NBHA 1VQM1 4QTTA 2ENMA 2D8JA 1YIT1 3VS7A 2A36A 2YUPA 2QRDB 1Z02A 4CC3A 4A3JI 1WXTA 1NEGA 5FLXf 3MONA 1NUIA 4MD9A 3M4OI 1VQN1 3HOZI 4A63B 1TWGI 2C0TA 2GTHA 4OMOA 1SHGA 4J9DA 4EWCA 3RZOI 2DRKA 2V8JA 2JR6A 3CPWY 2JA5I 2HSPA 2JA6I 3GTPI 2P4RA 2GTJA 4R0KA 3IF8A 2G6FX 4NBEA 3GTGI 1NLPC 1GCQA 1UDLA 1OOTA 2QRCB 1Q861 2E2HI 3PO2I 2O31A 1UECA 3GCFA 5IHKA 3CCSZ 3J81f 4JZ4A 3I07A 1TWAI 2RQRA 2J06A 2J6FA 4AFUC 1OEBA 3GTMS 1YNZA 2R6MA 3TE5B 1PKTA 3HOWI 2JW4A 1VQK1 3CCLZ 3CXCY 5IP7I 4FSSA 1YJWZ 3KIFA 1QVGZ 3GTKI 2A08A 3PO3I 2A28A 1RI9A 2ECZA 3H0HA 5I22A 4A3DI 1I50I 3H0FA 4K11A 3M0QA 3HOXI 1SRMA 2I3CA 2KEAA 3UA7A 1FYNA 4S1TA 4Y92A 1I3QI 2VUMI 1JXOA 3CCVZ 2MCNA 1WX6A 4GLMA 2I0NA 3EEDA 1L1OC 2F4MA 5IT9f 4RVGA 1I0CA 1VYTA 1B07A 2F2XA 4NBFA 4D8DA 2ZAEB 3VS4A 2L0AA 2RMOA 1G2BA 3J80b 1PNJA 2P28A 2O88A 1XOVA 3UF4A 2JMAA 1AWXA 1Q862 1W2BY 1KD11 2E2II 3GBQA 1S72Z 4HXJA 4DGLA 1UHFA 1VQ8Z 3CCS1 3HOVI 2EVRA 2YUQA 4BBRI 2E2JI 4J9BA 2MOXA 4Y7NI 1Y1VS 1B3QA 4JPBW 3EERA 1FMKA 1AZGB 3CCJZ 1WXUA 5D1OA 2DX1A 2FO0A 1YIJZ 3REBB 2RQWA 1YJ9Z 2FPEA 4XX2A 1K4US 4X6AI 4RUGA 3VS6A 3NH5A 1RLQC 1YHQ1 2K6DA 4HCKA 5I11A 2JT4A 2RHBA 4RTTA 3NH4A 1GCPA 1X2QA 2L3PA 3EHQA 3CC21 1Q7Y2 4BY7I 3CCV1 2DMOA 1MUZA 1KIKA 1G83A 1SEMA 3VS5A 1AWOA 1QWFA 3J80f 2JS2A 1K732 4F16A 4J9IA 3CC4Z 3TSZA 1Q822 2O2OA 2JM9A 2R93I 3S15I 3M0TA 2KXDA 3G71Z 3J7A4 2BZXA 2O9SA 4X1VA 1USPB 1ARKA 3EG1A 3GTMI 2FEIA 2KYBA 3M0PA 1BB9A 4RTZA 1CSKA 4D8KA 1Y57A 4NBDA 2KPIA 2A37A 1ZBJA 3JV3A 1Z01A 3S17I 2EYYA 2K79A 3HOUI 1PHTA 1VQ81 3CCQ1 2RBLA 3QWYA 2LIYA 4HGYA 3MZLB 1X27A 2LJ0A 3Q87A 3NGPA 4OMQA 2KYMA 2KROA 4LUEA 4HVVA 1T3LA 1X3WA 1QKXA 2L3QA 5LL6f 3S1RI 4AFQC 1WI7A 2YT6A 1Z03A 1BK2A 2EYXA 2C0IA 4IIMA 2K7AA 1UE9A 1T3SA 3ULRB 2DJQA 5T64A 2IZ3A 2OZKA 2VUGA 2HF1A 2QREB 1NP6A 3S2DI 4JJCA 2SRCA 1J3TA 1WCMI 2MIOA 1CKBA 1NM7A 3CQTA 1QVGY 2J7IA 5C44I 2XMFA 2QEXZ 4E33A 2JA7I 2RPNA 4NFRA 1U06A 2LQWA 4IIOA 1GCQC 3G4S1 2AKLA 5HCKA 1TWCI 4A3GI 3U50C 2QLVB 2DYBA 4HVWA 4CL1A 1Y1WI 2CDTA 1TUDA 1YP5A 2FRWA 2EQIA 4RTWA 3VS1A 1HJDA 3CCMZ 1Y1VI 3I561 3NMZC 5T67A 2M0YA 2GNCA 1X3ZA 1GBRA 5IT9b 4MD8A 1SSHA 4MH4A 1JEGA 3CMAZ 1VQ91 1RO4A 2OJ2A 2LP5A 3CCE1 1QYPA 4JJDA 2VF1A 2DNUA 2JS0A 1PWTA 4NOZA 2OTJZ 2NUZA 1YI2Z 2YUNA 2J05A 1JU5C 2KRSA 3NPFA 3CCRZ 1QCFA 1ZUUA 2F2VA 1VQ7Z 3PE0A 3LH5A 1E6HA 2DL8A 2YU9I 1VQ5Z 3CMEZ 2CSIA 1KSWA 1WYXA 3NHNA 2G2KA 4NBCA 1K9AA 4DEXA 4ORZA 2GBQA 1Q7Y1 2GU2A 2QEX1 1AOJA 1SRLA 2Q51A 2O9VA 1WA7A 4RVHA 4A93I 4BXXI 1SFOI 2R7ZI 1K731 2GTOA 1ABOA 5IHIA 2HU9A 3M0SA 1Q821 4J9GA 3CCM1 1K76A 1S7MA 2DF6A 1PKSA 3I4NI 3S1MI 1AVZC 2DBMA 2LJ3A 2EW3A 1TWFI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBZ A;  5IXF A;  4NB8 A;  5CM2 M;  1MV0 B;  4Z88 A;  4Z89 A;  2CH4 A;  1AZE A;  3EGU A;  2LQN A;  1RUW A;  2BZY A;  5IHN A;  1X6B A;  2OAW A;  1RLP C;  4A3K I;  2D1X A;  3KFV A;  1UFF A;  3M0U A;  3RBB B;  1R9T I;  4AG2 C;  2DL5 A;  2KT8 A;  2QDL A;  2YUO A;  4NBA A;  2EGC A;  3GTO I;  1GRI A;  5FWB A;  1VLA A;  3GKQ A;  1OV3 A;  2DE7 A;  3PVQ A;  5C4X I;  2PNI A;  1KFZ A;  3HOY I;  2X3X D;  1USP A;  2C0O A;  2RQT A;  3I5S A;  4CC2 A;  1I6H I;  3TVT A;  2JS4 A;  1JO8 A;  1LCK A;  2KRM A;  1M8M A;  2DRM A;  2B63 I;  1UUE A;  5C3E I;  4A3B I;  2JA8 I;  3SEM A;  1ABQ A;  4DEY A;  2NVX I;  2DL3 A;  2RNA A;  1T0J A;  4ZNX A;  4RTU A;  1AWJ A;  1OPL A;  2GQI A;  1NYF A;  4LUD A;  2ED1 A;  2KNB B;  2J6O A;  2FPF A;  2BJO A;  2P3Y A;  1CKA A;  2JM8 A;  1ZLM A;  2DE0 X;  1TFI A;  2D8H A;  5IXB A;  2F4O A;  1UJY A;  2ED0 A;  1M3A A;  2LJ1 A;  1W70 A;  2AK5 A;  1HSQ A;  1I1J A;  4A3F I;  2RQV A;  2CSQ A;  1Z9Q A;  2L3S A;  3H0I A;  1QKW A;  3REA B;  3S16 I;  1E6G A;  1PFT A;  3PO3 S;  1DL6 A;  1LQL A;  2AKK A;  2NVT I;  2K2M A;  2B86 A;  1T0H A;  2SEM A;  1ML8 A;  3K7A I;  4NBB A;  3I4M I;  1K0X A;  3IQL A;  5IP9 I;  3EG2 A;  3VMH A;  3VRZ A;  3D6W A;  2YDL A;  5GJV B;  2DE6 A;  2K5R A;  3FKI I;  1ZUY A;  3EG3 A;  4HVU A;  2PK7 A;  3I9Q A;  2DL4 A;  3FJ5 A;  1AEY A;  4OMN A;  4OMM A;  1M3B A;  5IH2 A;  3C0C A;  5FLM I;  2VVK A;  1PRL C;  3QWX X;  2EPD A;  1E7O A;  3GTL I;  3VB9 A;  1ZX6 A;  2KE9 A;  3U23 A;  4LN2 A;  1K1Z A;  2OI3 A;  1JXM A;  2EYW A;  4Z8A A;  1UTI A;  2ROL A;  1K83 I;  1H8K A;  2EGA A;  1IO6 A;  1WXB A;  1KJW A;  2D0N A;  1YN8 A;  2F2W A;  3H0G I;  2VWF A;  4RTY A;  2KBT A;  1VYV A;  2CT4 A;  4J9E A;  4JJB A;  1JQQ A;  2X3W D;  4J9H A;  2EGE A;  3VMI A;  3ESW A;  2HBW A;  2E5K A;  2L2P A;  1AD5 A;  3A98 A;  1ZB9 A;  3GTQ I;  2BZ8 A;  1YWP A;  2V1R A;  5C4J I;  1A0N B;  3GTJ I;  4WCI A;  1M27 C;  3S2H I;  3VS2 A;  4BY1 I;  4A3E I;  1WIE A;  1GL5 A;  3EHR A;  2BTT A;  1ZB8 A;  2DA9 A;  3EG0 A;  1GFC A;  2DLP A;  2LNH B;  2VKN A;  4J9C A;  1TWH I;  2CUB A;  2FG0 A;  1WFW A;  1M30 A;  1MV3 A;  3PVL A;  2AZS A;  2CH4 W;  1UGV A;  2AZV A;  3S1N I;  1NG2 A;  2GGR A;  1GBQ A;  3RNJ A;  2RF0 A;  3S14 I;  2EYZ A;  3UA6 A;  2FRY A;  3R6N A;  2DL7 A;  4Y52 I;  4LE9 A;  2K3B A;  2W0Z A;  1Z9Z A;  1X69 A;  1S1N A;  5L23 A;  1K0S A;  4GBQ A;  1UHC A;  1N5Z A;  1X43 A;  4F14 A;  1H92 A;  2NVQ I;  4F17 A;  4E6R A;  4QTU A;  1YUA A;  2ABL A;  2IIM A;  4CC4 B;  2JNY A;  3TSW A;  1M3C A;  4A3M I;  5EC7 A;  1X2K A;  2DBK A;  4BBS I;  2H8H A;  1W1F A;  2J6K A;  5FW9 A;  2HDA A;  3THK A;  4RTX A;  1NLO C;  1NYG A;  2HCK A;  3VS0 A;  1W6X A;  4AG1 C;  1HD3 A;  2W10 A;  3H3V J;  2JXB A;  1OPK A;  2KR3 A;  4A3C I;  1RLY A;  1GFD A;  3UAT A;  1UG1 A;  2JTE A;  1H3H A;  2EKH A;  2FPD A;  4LNP A;  2YSQ A;  3VS3 A;  4M4Z A;  5FWC A;  1NEB A;  1SHF A;  1WLP B;  1WW9 A;  4OMP A;  3O5Z A;  2PZ1 A;  4RTV A;  3RZD I;  4KRT A;  2DM1 A;  1ZUK A;  5ECA A;  2M51 A;  3VMG A;  3S1Q I;  1V1C A;  2KT1 A;  1VA7 A;  2RQU A;  4AFZ C;  1U3O A;  4NBG A;  3I5R A;  4JZ3 A;  1WDX A;  2CUD A;  1EFN A;  5GJW B;  2PTK A;  1BU1 A;  2EBP A;  2KRN A;  2RN8 A;  2R92 I;  2NWM A;  3LUS A;  2JMC A;  4J9F A;  2J6A A;  1U5S A;  1X6G A;  1Y0M A;  4AFS C;  2ESW A;  2LMJ A;  1YCS B;  3CQZ I;  1N2F A;  3H41 A;  4NB9 A;  3SHW A;  1SPK A;  1QLY A;  2V1Q A;  2DIL A;  4OML A;  4A3I I;  4QT7 A;  2DE5 A;  3M3Y I;  1VYU A;  2KXC A;  4A3L I;  2CT3 A;  2LX7 A;  1ZSG A;  4CC7 A;  1TUC A;  3M0R A;  1PRM C;  2CRE A;  4EIK A;  1TG0 A;  2ROT A;  2LCS A;  3ZL7 C;  1AWW A;  3VRY A;  1UJ0 A;  2K9G A;  1QWE A;  1I07 A;  2DVJ A;  2HEQ A;  1YWO A;  4ESR A;  3I35 A;  2NVY I;  2KGT A;  2LZ6 B;  4NBH A;  4QTT A;  2ENM A;  2D8J A;  3VS7 A;  2A36 A;  2YUP A;  4CC3 A;  4A3J I;  1WXT A;  1NEG A;  1NUI A;  3M4O I;  3HOZ I;  4A63 B;  1TWG I;  2C0T A;  4OMO A;  1SHG A;  4J9D A;  3RZO I;  2DRK A;  2JR6 A;  2JA5 I;  2HSP A;  2JA6 I;  3GTP I;  2P4R A;  2GTJ A;  4R0K A;  2G6F X;  4NBE A;  3GTG I;  1NLP C;  1GCQ A;  1UDL A;  1OOT A;  2E2H I;  3PO2 I;  2O31 A;  1UEC A;  3GCF A;  5IHK A;  4JZ4 A;  3I07 A;  1TWA I;  2RQR A;  2J06 A;  2J6F A;  4AFU C;  1OEB A;  3GTM S;  1YNZ A;  1PKT A;  3HOW I;  2JW4 A;  5IP7 I;  4FSS A;  3GTK I;  2A08 A;  2A28 A;  3H0H A;  3PO3 I;  5I22 A;  1RI9 A;  2ECZ A;  4A3D I;  1I50 I;  3H0F A;  4K11 A;  3M0Q A;  3HOX I;  1SRM A;  2KEA A;  3UA7 A;  1FYN A;  4Y92 A;  1I3Q I;  2VUM I;  1JXO A;  2MCN A;  1WX6 A;  4GLM A;  2I0N A;  1L1O C;  2F4M A;  1I0C A;  1VYT A;  1B07 A;  2F2X A;  4NBF A;  4D8D A;  3VS4 A;  2L0A A;  2RMO A;  1G2B A;  1PNJ A;  2O88 A;  1XOV A;  3UF4 A;  2JMA A;  1AWX A;  2E2I I;  3GBQ A;  4HXJ A;  1UHF A;  2YUQ A;  3HOV I;  2EVR A;  4BBR I;  2E2J I;  4J9B A;  2MOX A;  4Y7N I;  1Y1V S;  1B3Q A;  4JPB W;  3EER A;  1FMK A;  1AZG B;  1WXU A;  2DX1 A;  2FO0 A;  3REB B;  2RQW A;  2FPE A;  4XX2 A;  1K4U S;  4X6A I;  4RUG A;  3VS6 A;  1RLQ C;  2K6D A;  4HCK A;  5I11 A;  2JT4 A;  4RTT A;  1X2Q A;  1GCP A;  2L3P A;  3EHQ A;  4BY7 I;  1KIK A;  2DMO A;  1MUZ A;  1G83 A;  1SEM A;  3VS5 A;  1AWO A;  1QWF A;  2JS2 A;  4F16 A;  4J9I A;  3TSZ A;  2O2O A;  2JM9 A;  2R93 I;  3S15 I;  3M0T A;  2KXD A;  2BZX A;  2O9S A;  4X1V A;  1USP B;  1ARK A;  3EG1 A;  3GTM I;  2FEI A;  2KYB A;  3M0P A;  1BB9 A;  4RTZ A;  1CSK A;  4D8K A;  1Y57 A;  4NBD A;  2KPI A;  2A37 A;  1ZBJ A;  3JV3 A;  3S17 I;  2EYY A;  2K79 A;  3HOU I;  1PHT A;  3QWY A;  2RBL A;  2LJ0 A;  1X27 A;  3Q87 A;  3NGP A;  4OMQ A;  2KYM A;  2KRO A;  4LUE A;  4HVV A;  1T3L A;  1X3W A;  1QKX A;  2L3Q A;  3S1R I;  4AFQ C;  1WI7 A;  2YT6 A;  1BK2 A;  2EYX A;  2C0I A;  4IIM A;  2K7A A;  1UE9 A;  1T3S A;  3ULR B;  2DJQ A;  2HF1 A;  4JJC A;  3S2D I;  1J3T A;  2SRC A;  1WCM I;  2MIO A;  1CKB A;  1NM7 A;  3CQT A;  2J7I A;  5C44 I;  2XMF A;  2RPN A;  2JA7 I;  1U06 A;  2LQW A;  4IIO A;  1GCQ C;  2AKL A;  5HCK A;  1TWC I;  4A3G I;  3U50 C;  2DYB A;  4HVW A;  2CDT A;  1Y1W I;  1TUD A;  1YP5 A;  2FRW A;  2EQI A;  4RTW A;  3VS1 A;  1HJD A;  1Y1V I;  3NMZ C;  2M0Y A;  2GNC A;  1X3Z A;  1GBR A;  1SSH A;  1JEG A;  4MH4 A;  2OJ2 A;  1RO4 A;  2LP5 A;  1QYP A;  4JJD A;  2DNU A;  2JS0 A;  1PWT A;  4NOZ A;  2NUZ A;  2YUN A;  2J05 A;  1JU5 C;  2KRS A;  3NPF A;  1ZUU A;  1QCF A;  2F2V A;  3PE0 A;  3LH5 A;  1E6H A;  2DL8 A;  2YU9 I;  2CSI A;  3NHN A;  1KSW A;  1WYX A;  4NBC A;  1K9A A;  4DEX A;  4ORZ A;  2GBQ A;  1AOJ A;  1SRL A;  2O9V A;  1WA7 A;  4A93 I;  4BXX I;  1SFO I;  2R7Z I;  2GTO A;  1ABO A;  5IHI A;  3M0S A;  4J9G A;  1K76 A;  2DF6 A;  1PKS A;  3I4N I;  3S1M I;  1AVZ C;  2DBM A;  2LJ3 A;  2EW3 A;  1TWF I; 
#chains in the Genus database with same CATH topology
 4HT8 A;  2EYQ A;  1QMC A;  4C92 G;  1AZE A;  2E3H A;  4BE1 A;  5IHN A;  1U1T A;  2OAW A;  1RLP C;  2RHY A;  1UFF A;  4LDX A;  2KT8 A;  4YTL A;  2RJF A;  3UDC A;  4FL6 A;  1OV3 A;  4E31 A;  3PTA A;  3OB9 A;  1N6A A;  1VQ5 1;  5C4X I;  2C0O A;  1NJI R;  4PJO F;  2RQT A;  4M77 B;  1QVG S;  1JO8 A;  5LJ5 j;  2KRM A;  2DRM A;  2VAS A;  2WSC E;  5C3E I;  9ATC B;  5CQX A;  2O4X B;  2V3V A;  1NYF A;  2ED1 A;  1WJR A;  2HQE A;  2J6O A;  2WAQ A;  3V8J A;  2FPF A;  2P3Y A;  4DBQ A;  3CC7 A;  2JM8 A;  2H85 A;  4BDY A;  2O4H A;  2Y4Y A;  3G6E Z;  3WXM B;  2CZ1 B;  1UGR B;  2LJ1 A;  2DYI A;  2QA4 Z;  3OYN A;  2AK5 A;  1VQM A;  4C92 C;  3CCL T;  2E3I A;  4M75 E;  1WJ2 A;  4PJO G;  3RUX A;  1FX7 A;  1B7T A;  1B34 B;  1T0H A;  2KI7 B;  3K7A I;  2DFU A;  3I4M I;  4C0F A;  1K0X A;  5CKF A;  3TCJ A;  2OTL Z;  3BDU A;  3EG2 A;  3VRZ A;  1KQS A;  2VPY A;  2DJZ A;  1TU0 B;  4A54 A;  2DE6 A;  3CC4 1;  3FKI I;  2OOX B;  5GAN d;  2MPX C;  3SDZ A;  4OMM A;  1M3B A;  1KK7 A;  2VVK A;  4DA4 A;  1S72 T;  4BI3 A;  2M48 A;  1VQ8 T;  2JOY A;  1Q86 R;  3VB9 A;  3GP8 A;  2KE9 A;  4QVD A;  3U23 A;  1KRL A;  1I5L A;  1JXM A;  3CCJ T;  4Z8A A;  1K83 I;  4M7D A;  1VQ6 Z;  1H8K A;  2EGA A;  3A8O B;  1WXB A;  3DB3 A;  1QXF A;  1Y96 B;  2D0N A;  2X4J A;  3H0G I;  2VWF A;  2CT4 A;  1BKB A;  1VQO T;  4QQ6 A;  3VMI A;  1WHM A;  2E5K A;  2YRC A;  1AD5 A;  3A98 A;  5A0G A;  4PJO C;  2RHX A;  2BZ8 A;  1YWP A;  3JCM c;  4BY1 I;  3Q1J A;  1GL5 A;  2XDB A;  3EHR A;  2E1H A;  4E2Z A;  1F1B B;  1TUG B;  1ZB8 A;  2ZPE B;  2LNV A;  3CCS A;  1NPR A;  4J9C A;  2K3R A;  1TWH I;  1DJ7 B;  5IN1 A;  4JS5 A;  2FZG B;  2CH4 W;  4QKU A;  4BY6 C;  2GGR A;  3QG1 A;  3G4S Q;  3MEV A;  1VQN Q;  2DTH A;  4QQD A;  1X6O A;  4Y52 I;  1JJ2 S;  1TTH B;  4RVD A;  1VQ9 Q;  4FM4 B;  1H92 A;  2NVQ I;  3HL8 A;  3CCE Q;  3QYG B;  4F17 A;  4E6R A;  3EG9 A;  3CPW Z;  4CC4 B;  3TSW A;  4PJL A;  1WQW A;  4R55 A;  2FHD A;  2DEQ A;  2DBK A;  2E6N A;  5GAN e;  3C12 A;  2QQ9 A;  1RAA B;  5GAO p;  2H8H A;  1W1F A;  1M90 1;  1PG5 B;  2HDA A;  1YJN Z;  2HCK A;  2KMT A;  1HD3 A;  4M77 F;  1VQ8 A;  3PMT A;  4XTZ A;  4QVC A;  1WQ7 A;  3CMA T;  1RLY A;  3DLM A;  2FPD A;  4LNP A;  4HH4 A;  1Q7Y U;  1QF8 A;  1ZSZ C;  4M4Z A;  2VPW A;  2A0F B;  4D6W A;  4EMK B;  2PM9 A;  1SHF A;  2X4X A;  4OMP A;  4PJJ A;  1NJI 1;  3VYG A;  2Y4X A;  3RZD I;  5AN9 F;  1ZUK A;  4E7J A;  2K57 A;  2V8K A;  3VMG A;  5A0D A;  1VA7 A;  2VV5 A;  2Q4Z A;  1U3O A;  3I5R A;  3G4S A;  2CUD A;  1EFN A;  1WII A;  3I55 1;  1SF9 A;  2ZPI B;  4IUQ A;  3I56 Z;  2RN8 A;  2JIP A;  2R92 I;  2EFI A;  1LOJ A;  1M90 2;  2J6A A;  1U5S A;  5FRO A;  2KY9 A;  4M77 G;  1YCS B;  1VQ9 A;  3EFS A;  4OF1 A;  3CQZ I;  1N2F A;  3CCE A;  3M59 A;  2FYK A;  2W04 A;  2JIM A;  2RHI A;  2KXC A;  1VQ4 1;  4KBM B;  2LRQ A;  3F3F C;  2LX7 A;  2GFU A;  1TUC A;  1TG0 A;  3R6O A;  2LCS A;  3BG0 B;  3X26 B;  4E32 A;  4M78 B;  2DVJ A;  1QVF Y;  3V7S A;  1YWO A;  1NJI 2;  2R57 A;  1ZQ1 A;  4NBH A;  3SD4 A;  1YCY A;  4QTT A;  4E7S A;  1TS9 A;  1NEG A;  2RD1 A;  3EGD B;  3M4O I;  1VQN 1;  1TWG I;  2C0T A;  2QGF B;  4OMO A;  4TVR A;  3S3N A;  4EWC A;  1N8R C;  1KD1 C;  4GY5 A;  4BE2 A;  3L2U A;  4C5G A;  4MDX A;  2HSP A;  4J8O A;  2JA6 I;  1WHJ A;  1YIJ Q;  1P92 A;  4CI0 C;  1Q86 1;  1K73 R;  2EIF A;  1KQS S;  4M77 C;  4C8Q B;  5IHK A;  1OI1 A;  3S6W A;  3I07 A;  2J06 A;  4IUP A;  3EFO B;  3M57 A;  3GTM S;  3G6E T;  4LDU A;  3RIR A;  4JRI A;  4RCC A;  2QA4 T;  5IP7 I;  2A08 A;  5GAM h;  2NUT B;  2NYS A;  3QZ5 B;  4FT4 A;  3H0F A;  4JLG A;  4K11 A;  4O6J A;  4PFO A;  1SRM A;  4KGX B;  2I3C A;  1G3W A;  2KEA A;  3UA7 A;  2VUM I;  3CCV Z;  4OGC A;  5GAM f;  1L1O C;  4RVG A;  3HTR A;  4XAX B;  4JRQ A;  2OTL T;  2VPX A;  4C92 D;  4DOW A;  3CBO A;  4FW1 A;  1GXI E;  3OW2 P;  1M2V B;  3MP6 A;  3VUZ A;  1G3Y A;  1BIA A;  2JMA A;  2YHT A;  3G1J A;  4F7U E;  1Q86 2;  2BE7 D;  1W2B Y;  3GBQ A;  4HXJ A;  5A2Q E;  3HOV I;  4CRI A;  2MOX A;  4Y7N I;  1Y1V S;  1MHN A;  4JPB W;  1Q16 A;  3CBP A;  1FMK A;  3DLL A;  5D1O A;  4ZTJ A;  5CCA A;  1YIJ A;  2FPE A;  4X6A I;  2BE9 B;  3PGG A;  4HCZ A;  1YHQ 1;  1VQ6 T;  2FZK B;  1RL2 A;  1RAG B;  1QVP A;  4QQG A;  1Q7Y 2;  4PLL A;  3WVD B;  3M5A A;  5FU7 B;  3VS5 A;  2HNI A;  4RG8 A;  1Q81 R;  1WGS A;  2GQV A;  3CC4 Z;  4PJM A;  1K9M U;  5HKC A;  2O9S A;  4FT2 A;  4Z02 A;  1LJO A;  3EG1 A;  3GTM I;  2KYB A;  2E12 A;  1CSK A;  1Y57 A;  3GF5 A;  1VQ7 Q;  2A37 A;  3HP9 A;  1HK9 A;  3QWY A;  3CCQ 1;  5KYW B;  4PJO D;  5D6W A;  2KYM A;  3M55 A;  3OMG A;  2L3Q A;  4AFQ C;  1H3Z A;  2PUK B;  3RKW A;  1D1A A;  3V7C A;  2QQS A;  2VUB A;  1BK2 A;  1PD0 A;  2H3J A;  2K7A A;  3ULR B;  1BYM A;  1Q82 C;  2OZK A;  2QRE B;  1NM7 A;  3CQT A;  1M1F A;  4X9C A;  2JA7 I;  4NFR A;  1U06 A;  4IIO A;  1K8A U;  4M78 F;  2HZY A;  2XD0 A;  5HCK A;  4A3G I;  3U50 C;  3SWN B;  1C6V X;  1Y1W I;  2CDT A;  2FRW A;  4RTW A;  4X34 A;  3VS1 A;  1HJD A;  4HT9 A;  3CD6 Q;  1Y1V I;  3NMZ C;  5CQY A;  5I2S A;  5T67 A;  2M0Y A;  5LJ5 g;  2GNC A;  4WTO B;  1WPY A;  2F69 A;  4MD8 A;  4IKF A;  1JEG A;  1RO4 A;  5GAN 4;  2R5A A;  5KE2 A;  4JJD A;  5LJ3 h;  3M54 A;  2JS0 A;  2BKD N;  3QPH A;  2J05 A;  4M7A B;  5KYX A;  2BIV A;  2DXC A;  5LJ3 f;  1ZUU A;  4C8Q F;  1VQ7 A;  4BB7 A;  2G2K A;  4NBC A;  1K9A A;  5GAN 6;  4DQ2 A;  4KUD K;  4M78 G;  1IRE B;  1AOJ A;  2O9V A;  1WA7 A;  4BXX I;  3TRE A;  3I56 T;  4O5V A;  1K73 1;  2VGN A;  2COY A;  4XK8 E;  5DLO A;  1KHI A;  3OYB A;  2L5Q A;  2JIQ A;  5I2M A;  3JCM P;  1YIT Q;  1SIW A;  2DBM A;  3M53 A;  1BBZ A;  4M77 A;  4Z88 A;  1MV0 B;  3OYM A;  5GAO n;  4Z89 A;  2CH4 A;  2OX7 A;  1XTD A;  3KUF A;  2LQN A;  4A3K I;  2O4X A;  4M7D E;  3M0U A;  4EMG A;  3NTI A;  3CD6 A;  1R9T I;  4MXU A;  4C8Q G;  5FWB A;  1VQ7 1;  5KYN A;  1SG5 A;  2HQH A;  2M9U A;  1M1G A;  1TWB A;  2PNI A;  3I55 Z;  1YJW 1;  1HYO A;  2Z0W A;  1QCN A;  3I5S A;  2LT4 A;  2EAY A;  1VQO Z;  3LH0 A;  1LCK A;  2XG8 D;  2D6F A;  2DD4 A;  3C94 A;  1YJN A;  1UUE A;  2P0K A;  2RT9 A;  5LJ3 e;  1ABQ A;  3CCM T;  4C5I A;  1KHC A;  4M78 C;  1RI0 A;  4N0A C;  1VQL Q;  4WF2 A;  1KC8 U;  4RTU A;  3A8G B;  1K8A 1;  3OW2 Z;  1VQ4 Z;  2ZZD A;  1RQF A;  1R0B G;  1B34 A;  2KI7 A;  2WSF E;  3KBG A;  1K9M 2;  2QQR A;  4MMK A;  2F4O A;  2COZ A;  5A0L A;  1M3A A;  2O01 E;  3FQM A;  2VGM A;  3CD6 1;  2KQW A;  1VQ5 T;  1YIT A;  1YJ9 1;  1Q81 1;  1JBM A;  1E6G A;  4M77 D;  4MRI A;  5KYY B;  3PO3 S;  4C8Q C;  1LQL A;  1Y07 A;  2SEM A;  2ZPB B;  1N9S A;  1VQP Q;  3J80 E;  3IQL A;  2E4H A;  3OYI A;  3D6W A;  2VXE A;  5GJV B;  1WJS A;  1ZUY A;  1Y96 A;  3EG3 A;  4HVU A;  4DK1 A;  1ZSZ B;  4EPC A;  3CC2 Q;  3FJ5 A;  1AEY A;  3KIH A;  2LQ8 A;  3G71 1;  4RV9 A;  2V26 A;  1K8A 2;  1EIF A;  3OMC A;  3QWX X;  5GAM j;  3GTL I;  1ZX6 A;  4Y91 A;  4F7U A;  3MP1 A;  1QVG P;  2JMO A;  1VQL A;  1W4S A;  4LDW A;  2LTO A;  3NDJ A;  3CCU Z;  3F3P C;  1X75 C;  1ZHI A;  1M1K C;  3PT9 A;  5DM7 R;  1M90 C;  4FU6 A;  4II1 A;  4PL6 A;  4RTY A;  4J9E A;  1Q81 2;  4JJB A;  3S3O A;  4KH0 B;  4OMF B;  2X3W D;  4C0D B;  2DXB A;  2HBW A;  4M7A F;  2HKN A;  5CKH A;  4RVF A;  2V1R A;  6AT1 B;  3KXT A;  1A0N B;  3CC4 T;  2V8I A;  2PVD B;  2YRD A;  3TQ7 P;  1G3T A;  3CC7 Q;  3OBW A;  3OYF A;  1BI3 A;  2KAF A;  2BTT A;  1GFC A;  7AT1 B;  1NJI C;  5FU7 C;  1M30 A;  1MV3 A;  1MNE A;  3OS1 A;  3CEY A;  2AZS A;  2B8A A;  1FMV A;  1VQP A;  1KC8 1;  1GBQ A;  3RNJ A;  1QVF A;  2RF0 A;  1YHQ Z;  2EYZ A;  3UA6 A;  1IHV A;  1VQL 1;  2GTI A;  5CR2 A;  4B6M A;  2K3B A;  1UB4 A;  1OQK A;  2W0Z A;  1X69 A;  2PU9 B;  3CC2 A;  2OTJ 1;  5L23 A;  1YI2 1;  1K0S A;  3CCV A;  2IG0 A;  1UHC A;  2EKO A;  4E30 A;  3A5Z B;  1OU8 A;  3CCR 1;  2IIM A;  4M7A G;  4VUB A;  2JNY A;  1QP2 A;  1BCO A;  3CME 1;  5EC7 A;  4JRK A;  4XU0 A;  5KYU B;  5GAN 3;  4BBS I;  4EMK A;  2J6K A;  1R8O B;  1NYG A;  3CCQ Z;  1Y7X A;  5CO7 A;  5M9O A;  3O8V A;  4A3C I;  3OY9 A;  2JTE A;  1VQP 1;  1H64 1;  2XHC A;  2YSQ A;  1KC8 2;  3JB9 I;  4OP0 A;  3SWN C;  4DBR A;  2FL7 A;  1NEB A;  1WLP B;  4XTV A;  1WW9 A;  5D1P A;  2HKQ B;  3C4S A;  4NL3 A;  4KUL A;  1FMW A;  2PZ1 A;  1RAC B;  2ATC B;  4KRT A;  3JCM d;  5ECA A;  2JZ2 A;  2XDP A;  2QKD A;  3OYE A;  2YRV A;  4JZ3 A;  1WDX A;  1Q86 C;  3CCS Q;  2QYZ A;  5GJW B;  1BU1 A;  3DB4 A;  4M7A C;  3LUS A;  1W2B A;  5FLX b;  2MWO A;  2ESW A;  2LMJ A;  4M78 A;  5LJ3 j;  3EH1 A;  3CCL Q;  3JCM g;  2DIL A;  4KH1 B;  4E7L A;  4FYW B;  3E1S A;  4ZGD B;  3TDH B;  4FYY B;  1M2O A;  1MMN A;  2CT3 A;  3LX7 A;  3ZEH A;  2CP0 A;  2RM4 A;  3CC7 1;  5GAN h;  1PRM C;  2CRE A;  3ZL7 C;  1VQK Z;  4J7I A;  1Q95 G;  1I07 A;  2RK2 A;  3FDR A;  1VQM 1;  2E10 A;  5GAN f;  3F70 A;  2D8J A;  2A36 A;  3I55 T;  2QRD B;  3FEO A;  1S72 Q;  5FLX f;  1VQ8 Q;  3HOZ I;  4A63 B;  3EFO A;  2PUO B;  2GTH A;  3M58 A;  1SHG A;  4IUR A;  3RZO I;  4OB0 B;  3BFM A;  3CPW Y;  3CCJ Q;  1Q7Y R;  3JB9 F;  2RI5 A;  4R0K A;  3IF8 A;  3G7Z A;  3HRS A;  2LT1 A;  2DIQ A;  1UDL A;  1FXX A;  1OOT A;  2E2H I;  2RK1 A;  1VQ4 T;  3UT1 A;  2AHJ B;  3GCF A;  3OYC A;  2MI6 A;  1TWA I;  2RQR A;  4A4H A;  1RAF B;  5FRN A;  3JCM e;  4LDV A;  1JRI A;  4BD3 A;  1PKT A;  3LWI A;  2ZPH B;  2LCC A;  4M78 D;  1IZ6 A;  1OX9 A;  3CCL A;  2CZ0 B;  1M2V A;  1YJW Z;  1QVG Z;  2A28 A;  2M02 A;  5I22 A;  1RI9 A;  4J6W A;  4A3D I;  3M0Q A;  2Y90 A;  2X51 A;  3V7R A;  4Y92 A;  1I3Q I;  1JXO A;  4KGV B;  5IT9 f;  1VYT A;  3OYH A;  1B07 A;  3QYH B;  2F2X A;  3OYL A;  4E7H A;  5CVI A;  3VS4 A;  3A8H B;  3UF4 A;  2NUP B;  3AT1 B;  1UHF A;  2YUQ A;  5IAY A;  3CCS 1;  1S72 A;  3QII A;  1B3Q A;  2RO0 A;  1BIB A;  5GMK l;  3CCJ A;  2JN0 A;  2FO0 A;  3REB B;  1YJ9 Z;  3JCM V;  4RUG A;  1QVF S;  3NH5 A;  3PIO A;  2K6D A;  3CCU T;  1FWZ A;  3X20 B;  2I2L A;  4RTT A;  3NH4 A;  1GCP A;  1VQO A;  3EHQ A;  1KIK A;  3CMA Q;  1SEM A;  1AHJ B;  3OYK A;  1KQS P;  2JS2 A;  1R77 A;  2L3R A;  2O2O A;  2A7Y A;  2JM9 A;  3MEW A;  2R93 I;  2RA2 A;  3M0T A;  3G71 Z;  3J7A 4;  3OW2 A;  1ARK A;  1BB9 A;  3JV3 A;  4M77 E;  2DTI A;  3S17 I;  4C0D C;  2EYY A;  3HOU I;  1PHT A;  1VQ8 1;  1YFN A;  3FJP A;  4HGY A;  3MZL B;  1X27 A;  3Q87 A;  2KRO A;  1QKX A;  5LL6 f;  1YHQ T;  3RMS A;  3TU4 K;  3QHS A;  3OYG A;  3C95 A;  4V2S A;  2CP6 A;  1K73 C;  2LDM A;  5T64 A;  3HKS A;  4ZTF A;  4JJC A;  1M4Z A;  4C92 A;  1WCM I;  2HSE B;  2MIO A;  2MYS A;  3L1A A;  3IR7 A;  2XI9 A;  3HRT A;  5C44 I;  2CGH A;  2QEX Z;  4E33 A;  2RPN A;  3L2R A;  5DY9 A;  1GCQ C;  3G4S 1;  4M7A A;  4CL1 A;  4C5H A;  2EQI A;  3CCM Z;  1PM3 A;  3BE3 A;  5KE3 A;  3CCQ T;  3L2Z A;  1W2B S;  1VQ9 1;  3GOX A;  3MPU B;  3CMA A;  3CCE 1;  1QYP A;  4IUT A;  4IUU A;  2VF1 A;  2DNU A;  2E6Z A;  3CCU A;  3JB9 H;  4NOZ A;  2OTJ Z;  2NUZ A;  1YI2 Z;  2QTX A;  2YUN A;  1WJQ A;  2KRS A;  4AT1 B;  3CCR Z;  2ZAE A;  1K9M R;  1E6H A;  1V29 B;  2YU9 I;  1VQ5 Z;  3CME Z;  2CSI A;  1KSW A;  1WYX A;  4LXC A;  2EQK A;  2LCL A;  1Q7Y 1;  1XJW B;  2Q51 A;  1BI1 A;  4M7D B;  4RVH A;  2RH2 A;  3G6E Q;  3BY7 A;  5KH6 A;  1ABO A;  2HU9 A;  3M0S A;  2JVV A;  2QA4 Q;  2DF6 A;  1S7M A;  4PJO A;  2CZ6 B;  2MWP A;  3I4N I;  2K5F A;  5GAM d;  2OAU A;  3CXC P;  1IB8 A;  3VUB A;  1TWF I;  5IXF A;  4NB8 A;  5CM2 M;  1Q81 C;  1D0X A;  3MEA A;  2D0Q B;  1RAB B;  4M7A D;  2L8D A;  1RUW A;  5T6B A;  2BZY A;  1X6B A;  5D6X A;  3WVE B;  2D1X A;  2OTL Q;  3RBB B;  1K8A R;  4AG2 C;  1VQK T;  3JRZ A;  2EWN A;  2QDL A;  2YUO A;  4NBA A;  2EGC A;  3BW1 A;  5GAM g;  3RMQ A;  2VPZ A;  1SSF A;  1NZ9 A;  1RAH B;  3HSB A;  3PVQ A;  2Y0S A;  1KFZ A;  3HOY I;  3M56 A;  1V76 A;  1USP A;  2R58 A;  4NL2 A;  4CC2 A;  1I6H I;  2VXF A;  2DXU A;  2B63 I;  2VYT A;  1C1A A;  2F5K A;  1WHH A;  2NVX I;  2JUB A;  2DL3 A;  1T0J A;  4ZNX A;  2RJE A;  1LPL A;  2X9H A;  3EG9 B;  3OBY A;  1OPL A;  3D2L A;  1VQ6 Q;  2QG9 B;  4LUD A;  2DET A;  5GAN j;  8AT1 B;  2KNB B;  5KYY A;  2LC4 A;  2BJO A;  1YBY A;  4ZN3 A;  1CKA A;  2DO3 A;  1ZLM A;  1TFI A;  2D8H A;  1UJY A;  2ED0 A;  1RAD B;  3G6E A;  4QVZ A;  4OB2 B;  1OUL A;  1W70 A;  2QA4 A;  1VQM Z;  3QO3 A;  1HSQ A;  1YJW T;  1I1J A;  4A3F I;  1ZSZ A;  2RQV A;  1Z9Q A;  1YIJ 1;  2L3S A;  1QKW A;  3QKJ A;  4N4G A;  2DZ9 A;  4XU2 A;  1M9S A;  2K2M A;  5LJ5 d;  2B86 A;  1N8R U;  1KD1 U;  2CP3 A;  2CYZ B;  2GFA A;  4NBB A;  3H9N A;  2OTL A;  4HA8 A;  3LW5 E;  1KQS Z;  1M8V A;  2YAD A;  2CS7 A;  5CKE A;  2K5R A;  3MCA B;  2PK7 A;  3I9Q A;  4B9W A;  2DL4 A;  3ASK A;  3P5J B;  2WB1 A;  5IH2 A;  3C0C A;  2GF7 A;  5GAO l;  3OW2 S;  3MZK B;  2EPD A;  1VQK A;  5GAN 5;  1FDI A;  4LN2 A;  2LFU A;  1PCX A;  1NE8 A;  2EYW A;  1UTI A;  2ROL A;  2QK0 A;  1YJ9 T;  1VQ6 A;  4KUI A;  3H6Z A;  1YJN Q;  2R5M A;  2F2W A;  1IHW A;  4ATO A;  2KBT A;  1KC8 R;  3HHT B;  3E2U A;  1JQQ A;  5GAN 8;  2EGE A;  3ESW A;  2HMA A;  3OSV A;  3NTH A;  2IZ4 A;  1ZB9 A;  4PKC C;  3GTQ I;  5C0M A;  2OTL 1;  1M27 C;  3VS2 A;  4M78 E;  4A3E I;  4ANJ A;  1KG1 A;  2CP7 A;  1WIE A;  2XID A;  1MMD A;  3QJY A;  5KCO A;  3G71 T;  2AIR B;  1VUB A;  3EG0 A;  3LGL A;  2VKN A;  2LNH B;  1ZH1 A;  1WZN A;  3NFZ A;  1RO0 A;  2FG0 A;  4M7D F;  2KK4 A;  3CPF A;  4HCB A;  3S1N I;  1NG2 A;  2ZPG B;  3P8B B;  1NBE B;  3L2W A;  2VC8 A;  2NLU A;  5KYU A;  3OW2 Y;  2FRY A;  3X28 B;  1K9M 1;  3QDR B;  2QGG A;  4N4H A;  3I56 Q;  1VQ6 1;  5LJ5 e;  1Z9Z A;  1S1N A;  4GBQ A;  1N5Z A;  4F14 A;  1YUA A;  2ABL A;  4DBH A;  4PLI A;  3CPW A;  4A3M I;  4AYB A;  5GAN 2;  2QEX T;  3D9X A;  1MMA A;  2M6N A;  2E65 A;  2QQB A;  2XDD A;  4RTX A;  1NLO C;  1N8R 1;  2YLC A;  3HFN A;  2P4T A;  4AG1 C;  3EH2 A;  4M7D G;  4M75 B;  2DK3 A;  2HBP A;  1JB0 E;  2KR3 A;  3CXC Z;  3UAT A;  1UG1 A;  4FIB A;  5AT1 B;  2EQU A;  2XIC A;  2DZC A;  2XKO C;  3OYA A;  3CCM Q;  2OTJ T;  1YI2 T;  2LQK A;  4RTV A;  1Q82 U;  3CCR T;  2E9H A;  4TNU A;  2M51 A;  3PFS A;  3S1Q I;  1V1C A;  4AFZ C;  1MGQ A;  3CME T;  3G4S Z;  1UGP B;  5D1O B;  4XTW A;  2RJD A;  3OSS C;  3OYY A;  4OB3 B;  1VQN Z;  2PTK A;  3A1P A;  3IFU A;  2EBP A;  3FC3 A;  3PMI A;  3I56 A;  4RCB A;  1YJN 1;  1X6G A;  4DBF A;  1VQ9 Z;  1VQ5 Q;  3N5B B;  3SFM A;  3CCE Z;  3H41 A;  1N8R 2;  1KD1 2;  1SPK A;  3SHW A;  1QLY A;  2EJG A;  4OML A;  4E7I A;  1IGQ A;  2DE5 A;  3M3Y I;  1VYU A;  1MMG A;  3BG1 B;  3CCV Q;  4M7D C;  1NPP A;  1JWH C;  1ZSG A;  1X0T A;  3M0R A;  4EIK A;  2RIQ A;  2V45 A;  3VRY A;  2PMZ A;  2K9G A;  1QWE A;  3MHX A;  2QR1 B;  2LZ6 B;  4E2W A;  3BDL A;  4PFZ A;  1YIT 1;  3VS7 A;  4MZM A;  2YUP A;  4CC3 A;  1Z02 A;  4A3J I;  2X4W A;  4MD9 A;  1UGS B;  3CCM A;  2DRK A;  2IV2 X;  2JJ9 A;  3RKY A;  2AT1 B;  2XU8 A;  4PFP A;  4BI4 A;  2P4R A;  2GTJ A;  1XNI A;  1O9S A;  2G6F X;  4NBE A;  1G5V A;  4RMO A;  1D0Y A;  4C5E A;  2QRC B;  4OVA A;  2O31 A;  4JZ4 A;  3NTK A;  4AFU C;  1OEB A;  3TE5 B;  3HOW I;  2JW4 A;  3CC4 Q;  3URG A;  2IPO B;  4FSS A;  1EZZ B;  5GMK m;  3GTK I;  3KIF A;  1R0C B;  3H0H A;  1VQM T;  3PO3 I;  1VQ5 A;  1TXQ A;  2ECZ A;  1I50 I;  3HOX I;  4C92 E;  3OYJ A;  4S1T A;  1WX6 A;  2K5I A;  4OB1 B;  4ELZ C;  3LYI A;  5KYX B;  1I0C A;  1OU9 A;  1VIF A;  4M7A E;  4D8D A;  3LLR A;  4ZGJ B;  1G2B A;  1XOV A;  2KDS A;  1AWX A;  5AYF A;  4JDS A;  1G8X A;  2QDY B;  3ER0 A;  1QP3 A;  3JCM W;  5HY6 A;  4DGL A;  2E2J I;  4J9B A;  3OYD A;  3E9F A;  2NAP A;  3JCM b;  5GAN 7;  1D1B A;  3V8K A;  1YIJ Z;  2RQW A;  4Y28 E;  4XX2 A;  2K3Y A;  4M75 F;  3M4G A;  3VS6 A;  3RES A;  4J6Y A;  5I11 A;  2RHB A;  1X2Q A;  3M9Q A;  2L3P A;  3FLG A;  3RER A;  3CC2 1;  4BY7 I;  3CCV 1;  1MUZ A;  1AWO A;  3RKX A;  1QWF A;  3ZBD A;  1M5Q 1;  4F16 A;  3JCM X;  4J9I A;  3VJP A;  3JCM h;  3CC4 A;  3TSZ A;  1Q82 2;  3CPW S;  1OZ2 A;  2JIR A;  5CKD A;  4PJO E;  3S15 I;  2F1L A;  2BZX A;  3JSC A;  4QW2 A;  1OYX A;  2FEI A;  3HFO A;  4A4G A;  4E7Z A;  3JCM f;  3CCS T;  4NBD A;  5GAO q;  1ZBJ A;  2C06 A;  4GLK A;  4N0A A;  1OX8 A;  2QAZ A;  2K79 A;  2HD0 A;  2RBL A;  2LIY A;  3NGP A;  1JJ2 P;  1T3L A;  3P8H A;  3QJ6 A;  4M75 G;  1Q7Y C;  4E2F B;  2YXY A;  1M1K U;  3EGD A;  2QTV A;  1M90 U;  2HQX A;  4ME7 A;  3EGX B;  3H8Z A;  2C0I A;  4IIM A;  1UE9 A;  4UC4 A;  3L2V A;  2IZ3 A;  2VUG A;  5LL6 S;  3S2D I;  3CBM A;  2SRC A;  1CKB A;  2P84 A;  1QVG Y;  1AT1 B;  4BDZ A;  4JJN K;  4C8Q A;  2AKL A;  1TWC I;  2DYB A;  2QLV B;  2RI2 A;  3DKM A;  4HVW A;  2QI2 A;  1TUD A;  4FSX A;  1VOM A;  3T9N A;  1NJI U;  1X3Z A;  1FDO A;  5IT9 b;  4MH4 A;  2RB6 A;  1PC0 A;  1QVF P;  2NUT A;  1D3B B;  2LP5 A;  2PVG B;  2MF2 A;  3I55 Q;  3JCM J;  4Q5W A;  1OZ3 A;  1VQO Q;  3QDF A;  2EJF A;  1PWT A;  5GAN g;  5CKB A;  5FU6 B;  3NPF A;  4KGZ B;  4XQ3 A;  1QCF A;  1VQ7 Z;  4M75 C;  2DL8 A;  2DTO A;  2KVQ G;  4R56 A;  4F7U B;  1VQ4 Q;  3G4S T;  3HPW A;  4MZT A;  4E47 A;  5FLX E;  4L59 A;  1QCO A;  1VQN T;  5CIU A;  2VB6 A;  3QSU A;  1SFO I;  3FB9 A;  4LD9 K;  1ZA2 B;  1RAI B;  5IHI A;  4J9G A;  1VQ9 T;  1WZO A;  3JB9 G;  3INZ A;  3L42 A;  3CCE T;  3QZ9 B;  4NH1 C;  1KQ1 A;  1C0M A;  3QWU A;  3VV0 A;  4C8Q D;  4EMH A;  5GMK h;  1I81 A;  1U8R A;  3EGU A;  3JB9 J;  2O53 A;  3KFV A;  3UPU A;  4NOY A;  3CD6 Z;  4J7F A;  2M1H A;  1VIE A;  2DL5 A;  1LVK A;  1G3S A;  3GTO I;  1GRI A;  1VLA A;  3GKQ A;  2DE7 A;  4XU3 A;  5FRM A;  3CCL 1;  2YWW A;  3PIP A;  2X3X D;  3I55 A;  1Q86 U;  1M1K 1;  4M7D D;  3TVT A;  2JS4 A;  1M8M A;  1W2B P;  5IT9 E;  2OOY B;  4A3B I;  3MO8 A;  2JA8 I;  3HRU A;  3SEM A;  3RR6 A;  5KYW A;  3MP8 A;  2EGT A;  4DEY A;  4MON A;  4J6X A;  2RNA A;  1AWJ A;  2GQI A;  3CCU Q;  3CXC A;  4J83 A;  4AMC A;  1TOV A;  3A8M B;  1VQ4 A;  3ME9 A;  2FZC B;  5EG2 A;  3HKZ A;  1N27 A;  5GAO m;  2XK0 A;  2DE0 X;  5IXB A;  4RKU E;  1PSF A;  1S72 1;  2BUD A;  4DOV A;  5I21 A;  1YIT Z;  1JJ2 Y;  3CCJ 1;  4FYV B;  2CSQ A;  3H0I A;  3REA B;  3SWN A;  3IX0 A;  3S16 I;  1PFT A;  2PQW A;  3AHU A;  4P5N A;  1DL6 A;  1VQN A;  2W03 A;  4MD7 A;  2AKK A;  2NVT I;  3UWN A;  1Y71 A;  3MEU A;  3NDI A;  3GNG A;  1VQO 1;  1ML8 A;  1M1K 2;  1WHG A;  2LEX A;  5IP9 I;  3VMH A;  3E9G A;  5GMK e;  2YDL A;  1YHQ Q;  3VTN A;  3T4N B;  2JTM A;  1RNI A;  1K9M C;  4FCY A;  3OQ5 A;  4OMN A;  4BI8 B;  5FLM I;  4RS4 A;  1PRL C;  2K2V A;  1E7O A;  2K3X A;  5A2Q b;  2P0P A;  1K1Z A;  2OI3 A;  1XQH A;  1VQL Z;  2MMP A;  3NFC A;  1JJ2 Z;  3NH8 A;  1YIJ T;  1IO6 A;  3OS5 A;  1KJW A;  1YN8 A;  2WSE E;  1WHK A;  3CCQ Q;  1VYV A;  2X35 A;  1EX4 A;  5HK3 A;  4RG2 A;  1BI0 A;  4BAC A;  4J9H A;  2L2P A;  3JCM Q;  3JAM b;  3MET A;  3EFR A;  2HAX A;  5C4J I;  2ZCF B;  3GTJ I;  4WCI A;  4A4K A;  4E7K A;  3S2H I;  1K8A C;  4HGZ A;  4A53 A;  1I4K 1;  2M16 A;  2RI3 A;  1I8F A;  4C0G A;  4F7U F;  3OS2 A;  2DA9 A;  3QBY A;  5J26 A;  2HL5 C;  2X4Y A;  2DLP A;  2K5L A;  2CUB A;  5A2Q f;  1WFW A;  3PVL A;  1RO2 A;  4PNO A;  1UGV A;  2AZV A;  1VQP Z;  1QVF Z;  3CMA 1;  2COW A;  3S14 I;  2QXF A;  1N8R R;  1KD1 R;  1YHQ A;  3R6N A;  2DL7 A;  3GIB A;  4LE9 A;  1YUK A;  3CCU 1;  3CC2 Z;  4LDY A;  2LVM A;  2MAM A;  3JAM f;  1X43 A;  4JRP A;  4M75 A;  2PVO B;  4BUG A;  4QTU A;  4E2X A;  1M3C A;  2RHZ A;  4BE0 A;  1X2K A;  4C0Z A;  5GMK i;  4KT0 E;  5FW9 A;  3THK A;  4F7U G;  2QQA A;  3VS0 A;  1D1C A;  1VQK Q;  1W6X A;  1ACM B;  2W10 A;  3CCQ A;  3H3V J;  2JXB A;  1Y8C A;  4LD6 A;  3M4Y A;  1OPK A;  4JLI A;  1KQS Y;  3LWH A;  1GFD A;  5J39 A;  4FW2 A;  1H3H A;  2EKH A;  2AYD A;  2EQM A;  3VS3 A;  3CC7 Z;  4DQY B;  2DAQ A;  5FWC A;  1AA6 A;  3JAM E;  2F5T X;  3O5Z A;  1K73 U;  2DM1 A;  1SKU B;  1VQ7 T;  3MKD A;  2KT1 A;  2RQU A;  4XTX A;  4NBG A;  4F04 B;  4E2Y A;  1QW1 A;  1ZA1 B;  5CK9 A;  1P9N A;  2D9T A;  2QAS A;  4A4F A;  1BCM A;  1MND A;  2KRN A;  5FU6 C;  2NWM A;  1W2B Z;  2JMC A;  2MK5 A;  4J9F A;  5GAM e;  4AFS C;  1Y0M A;  4M75 D;  5LJ5 h;  4NB9 A;  1YJW Q;  1KC8 C;  2ZPF B;  2RPR A;  2V1Q A;  3A8L B;  3S3M A;  4A3I I;  4QT7 A;  3CXC S;  4A3L I;  5LJ5 f;  4OGE A;  4MML A;  2DIG A;  4CC7 A;  2ROT A;  3J81 b;  5C6S A;  1AWW A;  1U1S A;  1UJ0 A;  3CD6 T;  3G6E 1;  2JTF A;  2HEQ A;  4ESR A;  3OA6 A;  3I35 A;  2NVY I;  2QA4 1;  1WNL A;  3FQQ A;  2KGT A;  3LGF A;  1IXD A;  2DVE A;  3L2Q A;  2ENM A;  5GAO r;  1N9R A;  1WXT A;  3PNW C;  2EQJ A;  3MON A;  2CKK A;  1NUI A;  4J9D A;  1YJN T;  2V8J A;  2GCX A;  2JR6 A;  4XU1 A;  4N4I A;  2JA5 I;  1I5O B;  4MZP A;  3GTP I;  5LJ3 d;  1YJ9 Q;  4C92 B;  3GTG I;  1NLP C;  5GMK j;  1GCQ A;  5DLQ E;  3PO2 I;  2L89 A;  1Q82 R;  1Q81 U;  3D7S B;  1UEC A;  3CCS Z;  3P8D A;  3J81 f;  4J5Y A;  2J6F A;  5D6Y A;  1YNZ A;  2R6M A;  1VQK 1;  3CCL Z;  3CXC Y;  5LJ3 g;  1YJW A;  1QVG A;  3G71 Q;  1YIT T;  4NS5 A;  2LX9 A;  3OS0 A;  1D0Z A;  2CP2 A;  1FYN A;  2DPP B;  4EMK C;  3JB9 D;  2MCN A;  4GLM A;  3X25 B;  2I0N A;  3EED A;  2F4M A;  4C8Q E;  1KQ2 A;  4NBF A;  1O75 A;  2ZAE B;  2FVU A;  2HL3 A;  2L0A A;  2RMO A;  4PJN A;  3J80 b;  1PNJ A;  2P28 A;  2O88 A;  3GPL A;  4A4E A;  5KCH A;  3J81 E;  3FRN A;  2E2I I;  1KD1 1;  1S72 Z;  3EAE A;  2M0O A;  1QQJ A;  3VYH B;  1VQ8 Z;  2EVR A;  4MDW A;  4BBR I;  4L6V 5;  3ZFJ A;  3EER A;  1BI2 A;  2H3E B;  2QEX Q;  4PJO B;  1AZG B;  2K4Y A;  3CCJ Z;  1WXU A;  2DX1 A;  1VQL T;  4FYX B;  1K4U S;  2IVW A;  1YJ9 A;  1RLQ C;  1TSF A;  1PSE A;  4HCK A;  4IUV A;  2E7Z A;  2JT4 A;  5D7U A;  4JUV A;  1ZBX A;  2E64 A;  4PK4 A;  1IRX A;  4B9X A;  2DMO A;  2RHU A;  1G83 A;  3MJX A;  2G3R A;  3J80 f;  4BY6 B;  2JIO A;  1K73 2;  1TH7 A;  2DER A;  2JNG A;  4XTU A;  2A3L A;  2YLB A;  3QXE B;  2KXD A;  2OTJ Q;  1YI2 Q;  4EDU A;  1IGU A;  3G71 A;  3V8L A;  4X1V A;  1USP B;  4L5G A;  5J3B A;  1D09 B;  4RTZ A;  2CZ7 B;  3EGX A;  3M0P A;  3J7A F;  3CCR Q;  4D8K A;  1UGQ B;  2KPI A;  1WHL A;  1Z01 A;  3CME Q;  2LJ0 A;  1VQP T;  2KSS A;  4OMQ A;  4LUE A;  4HVV A;  1X3W A;  2DEU A;  3S1R I;  1RAE B;  1WI7 A;  8ATC B;  2CP5 A;  2YT6 A;  3SB2 A;  4ZGE B;  2DXT A;  1Z03 A;  3CC2 T;  2EYX A;  2JUF A;  3CCV T;  1T3S A;  2DJQ A;  1HXD A;  3GNF B;  2HF1 A;  1J3T A;  1NP6 A;  1D3B A;  3FIF A;  2J7I A;  2DKG A;  2XMF A;  2LQW A;  2QEX A;  3RDV A;  2ZGW A;  1X01 A;  2EJ9 A;  5CAI A;  1YP5 A;  4ELY C;  3I56 1;  2P0Q A;  1GBR A;  4JS4 A;  1SSH A;  2RJC A;  3CMA Z;  1PD1 A;  2OJ2 A;  3E19 A;  4HCC A;  4XTY A;  1LNX A;  2E5Q A;  1JJ2 A;  1UEB A;  2DD5 A;  4C92 F;  3TEE A;  2OTJ A;  1YI2 A;  3CC7 T;  1JU5 C;  2F2V A;  2FB7 A;  2E70 A;  4HKE A;  3VU3 C;  3QUI A;  3CPW P;  3CCR A;  3PE0 A;  3LH5 A;  2WAC A;  3NHN A;  4X9D A;  3CME A;  4ZN1 A;  2NUP A;  4DEX A;  4ORZ A;  2GBQ A;  2E41 A;  2GU2 A;  2QEX 1;  1SRL A;  4A93 I;  3X24 B;  2R7Z I;  3GLX A;  5HK0 A;  2GTO A;  1Q82 1;  3CCM 1;  1K76 A;  3VKI A;  1VQM Q;  1PKS A;  3S1M I;  1M1K R;  1AVZ C;  1M90 R;  5L8R E;  2LJ3 A;  2EW3 A; 
#chains in the Genus database with same CATH homology
 1BBZ A;  4NH1 C;  5IXF A;  4NB8 A;  5CM2 M;  1MV0 B;  4Z88 A;  3QWU A;  4Z89 A;  2CH4 A;  1AZE A;  3EGU A;  2LQN A;  2O53 A;  5T6B A;  1RUW A;  1X6B A;  2BZY A;  1RLP C;  4A3K I;  2D1X A;  2OAW A;  3KFV A;  5IHN A;  1UFF A;  3CD6 Z;  3M0U A;  3RBB B;  1R9T I;  4AG2 C;  4MXU A;  2DL5 A;  2KT8 A;  2QDL A;  2YUO A;  4NBA A;  2EGC A;  3GTO I;  1GRI A;  5FWB A;  1VQ7 1;  1VLA A;  3GKQ A;  4E31 A;  1OV3 A;  2DE7 A;  3CCL 1;  3PVQ A;  2Y0S A;  1VQ5 1;  5C4X I;  2PNI A;  3I55 Z;  1YJW 1;  1KFZ A;  3HOY I;  2X3X D;  1USP A;  2C0O A;  2RQT A;  1M1K 1;  3I5S A;  4CC2 A;  1I6H I;  3TVT A;  2JS4 A;  1VQO Z;  1JO8 A;  1LCK A;  2KRM A;  1M8M A;  2DRM A;  2B63 I;  2OOY B;  1UUE A;  5C3E I;  4A3B I;  2JA8 I;  3SEM A;  2RT9 A;  1ABQ A;  2EGT A;  4DEY A;  2NVX I;  2JUB A;  4MON A;  2DL3 A;  2RNA A;  1T0J A;  4ZNX A;  4RTU A;  1AWJ A;  1OPL A;  2GQI A;  1NYF A;  1K8A 1;  2ED1 A;  4LUD A;  3OW2 Z;  2KNB B;  1VQ4 Z;  2J6O A;  1RQF A;  2WAQ A;  4J9C A;  2FPF A;  2BJO A;  2P3Y A;  3HKZ A;  1CKA A;  2JM8 A;  2H85 A;  1ZLM A;  1K9M 2;  2DE0 X;  1TFI A;  2D8H A;  5IXB A;  2O4H A;  2F4O A;  3G6E Z;  1UJY A;  2ED0 A;  1S72 1;  1M3A A;  2LJ1 A;  3FQM A;  2QA4 Z;  3CD6 1;  1W70 A;  1VQM Z;  2AK5 A;  1YIT Z;  1HSQ A;  1JJ2 Y;  3CCJ 1;  1I1J A;  4A3F I;  2RQV A;  2CSQ A;  1Z9Q A;  1YIJ 1;  2L3S A;  1QKW A;  3H0I A;  1YJ9 1;  1Q81 1;  3REA B;  3IX0 A;  3S16 I;  1E6G A;  1PFT A;  4MRI A;  3PO3 S;  1DL6 A;  1LQL A;  2W03 A;  4MD7 A;  2AKK A;  2NVT I;  2K2M A;  2B86 A;  3NDI A;  1T0H A;  2SEM A;  2KI7 B;  1VQO 1;  1ML8 A;  3K7A I;  1M1K 2;  4NBB A;  3I4M I;  1K0X A;  3IQL A;  5IP9 I;  2OTL Z;  3EG2 A;  3VMH A;  3VRZ A;  3D6W A;  2YDL A;  1KQS Z;  3VTN A;  5GJV B;  3T4N B;  2YAD A;  2DE6 A;  3CC4 1;  2K5R A;  1RNI A;  3FKI I;  1ZUY A;  3EG3 A;  4HVU A;  2PK7 A;  4DK1 A;  3I9Q A;  2DL4 A;  2OOX B;  3FJ5 A;  1AEY A;  4OMN A;  3KIH A;  3P5J B;  2WB1 A;  3G71 1;  4RV9 A;  1M3B A;  4OMM A;  5IH2 A;  3C0C A;  1K8A 2;  5FLM I;  2VVK A;  4RS4 A;  1PRL C;  3QWX X;  3MZK B;  2EPD A;  2M48 A;  1E7O A;  3GTL I;  3VB9 A;  1ZX6 A;  2KE9 A;  5A2Q b;  3U23 A;  4LN2 A;  1K1Z A;  1KRL A;  2OI3 A;  2JMO A;  1VQL Z;  1JXM A;  2LFU A;  2EYW A;  4Z8A A;  1UTI A;  2ROL A;  1JJ2 Z;  3NH8 A;  1K83 I;  3NDJ A;  3CCU Z;  3F3P C;  1VQ6 Z;  1H8K A;  2EGA A;  1IO6 A;  1WXB A;  1KJW A;  2D0N A;  1YN8 A;  2F2W A;  3H0G I;  2VWF A;  4RTY A;  2KBT A;  1VYV A;  2CT4 A;  4J9E A;  1Q81 2;  4JJB A;  1JQQ A;  2X3W D;  4J9H A;  2EGE A;  3VMI A;  3ESW A;  2HBW A;  2E5K A;  2L2P A;  1AD5 A;  3A98 A;  3JAM b;  2IZ4 A;  1ZB9 A;  4RVF A;  3GTQ I;  2BZ8 A;  1YWP A;  2V1R A;  5C4J I;  2OTL 1;  3GTJ I;  4WCI A;  1M27 C;  2V8I A;  1A0N B;  3S2H I;  3VS2 A;  4BY1 I;  4HGZ A;  4A3E I;  1WIE A;  1GL5 A;  3EHR A;  4E2Z A;  2BTT A;  1ZB8 A;  2DA9 A;  3EG0 A;  1GFC A;  2DLP A;  2LNH B;  1ZH1 A;  2VKN A;  2K3R A;  1RO0 A;  3NFZ A;  1TWH I;  2CUB A;  5A2Q f;  1WFW A;  1M30 A;  1MV3 A;  2FG0 A;  3PVL A;  2AZS A;  1RO2 A;  2CH4 W;  1UGV A;  2AZV A;  1VQP Z;  3S1N I;  1NG2 A;  2GGR A;  1KC8 1;  1QVF Z;  1GBQ A;  3RNJ A;  3CMA 1;  2RF0 A;  3S14 I;  1YHQ Z;  3OW2 Y;  2EYZ A;  2FRY A;  1K9M 1;  3UA6 A;  1VQL 1;  3R6N A;  2DL7 A;  2GTI A;  4Y52 I;  4LE9 A;  2K3B A;  1YUK A;  3CCU 1;  1VQ6 1;  1Z9Z A;  2W0Z A;  1X69 A;  3CC2 Z;  1S1N A;  4RVD A;  2OTJ 1;  5L23 A;  1YI2 1;  1K0S A;  4GBQ A;  3JAM f;  1N5Z A;  1UHC A;  1X43 A;  4F14 A;  1H92 A;  2NVQ I;  4E30 A;  4F17 A;  4E6R A;  4QTU A;  4E2X A;  3CCR 1;  1YUA A;  2ABL A;  3CPW Z;  2IIM A;  4CC4 B;  2JNY A;  3TSW A;  1M3C A;  4A3M I;  4AYB A;  3CME 1;  5EC7 A;  1X2K A;  2DBK A;  3D9X A;  4BBS I;  2H8H A;  2M6N A;  1W1F A;  1M90 1;  2J6K A;  5FW9 A;  2HDA A;  3THK A;  4RTX A;  1YJN Z;  1NLO C;  1NYG A;  2HCK A;  3VS0 A;  1N8R 1;  1W6X A;  4AG1 C;  1HD3 A;  3CCQ Z;  2W10 A;  3H3V J;  2JXB A;  1OPK A;  1KQS Y;  2KR3 A;  4A3C I;  1RLY A;  3CXC Z;  1GFD A;  3UAT A;  1UG1 A;  2JTE A;  1VQP 1;  1H3H A;  2EKH A;  2FPD A;  4LNP A;  4HH4 A;  2YSQ A;  1QF8 A;  1KC8 2;  3VS3 A;  4M4Z A;  3CC7 Z;  2PM9 A;  4DQY B;  5FWC A;  1NEB A;  1SHF A;  1WLP B;  1WW9 A;  5D1P A;  4OMP A;  1NJI 1;  3O5Z A;  2PZ1 A;  4RTV A;  3RZD I;  4KRT A;  2DM1 A;  5AN9 F;  1ZUK A;  2E9H A;  5ECA A;  4TNU A;  2M51 A;  2QKD A;  2V8K A;  3VMG A;  3S1Q I;  1V1C A;  2KT1 A;  1VA7 A;  2RQU A;  4AFZ C;  2Q4Z A;  1U3O A;  3G4S Z;  4NBG A;  3I5R A;  4JZ3 A;  1WDX A;  5D1O B;  4E2Y A;  2CUD A;  1EFN A;  1WII A;  3I55 1;  5GJW B;  1VQN Z;  1P9N A;  2PTK A;  3IFU A;  1BU1 A;  3I56 Z;  2EBP A;  2KRN A;  2RN8 A;  2R92 I;  2NWM A;  1W2B Z;  3LUS A;  2JMC A;  4J9F A;  5FLX b;  1M90 2;  2J6A A;  1YJN 1;  1U5S A;  1X6G A;  1Y0M A;  4AFS C;  2ESW A;  1VQ9 Z;  2LMJ A;  1YCS B;  3CQZ I;  1N2F A;  3CCE Z;  4NB9 A;  3H41 A;  1N8R 2;  1KD1 2;  1SPK A;  3SHW A;  1QLY A;  2RPR A;  2W04 A;  2DIL A;  2V1Q A;  4OML A;  4A3I I;  4QT7 A;  2DE5 A;  3M3Y I;  1VYU A;  2KXC A;  3BG1 B;  3TDH B;  4A3L I;  1VQ4 1;  2CT3 A;  1JWH C;  3F3F C;  1ZSG A;  2LX7 A;  4CC7 A;  1X0T A;  3CC7 1;  1TUC A;  3M0R A;  1PRM C;  2CRE A;  4EIK A;  1TG0 A;  2ROT A;  1VQK Z;  3BG0 B;  3J81 b;  2RIQ A;  2LCS A;  3VRY A;  3ZL7 C;  1AWW A;  1UJ0 A;  2PMZ A;  3G6E 1;  2K9G A;  4E32 A;  1QWE A;  1I07 A;  2DVJ A;  1QVF Y;  2HEQ A;  1YWO A;  1NJI 2;  4ESR A;  3I35 A;  2NVY I;  2QA4 1;  2KGT A;  2QR1 B;  3FQQ A;  2LZ6 B;  4E2W A;  4NBH A;  1VQM 1;  4QTT A;  2ENM A;  2D8J A;  1YIT 1;  3VS7 A;  2A36 A;  2YUP A;  2QRD B;  1Z02 A;  4CC3 A;  4A3J I;  1WXT A;  1NEG A;  5FLX f;  3MON A;  1NUI A;  4MD9 A;  3M4O I;  1VQN 1;  3HOZ I;  4A63 B;  1TWG I;  2C0T A;  2GTH A;  4OMO A;  1SHG A;  4J9D A;  4EWC A;  3RZO I;  2DRK A;  2V8J A;  2JR6 A;  3CPW Y;  2JA5 I;  2HSP A;  2JA6 I;  3GTP I;  2P4R A;  2GTJ A;  4R0K A;  3IF8 A;  2G6F X;  4NBE A;  3GTG I;  1NLP C;  1GCQ A;  1UDL A;  1OOT A;  2QRC B;  1Q86 1;  2E2H I;  3PO2 I;  2O31 A;  1UEC A;  3GCF A;  5IHK A;  3CCS Z;  3J81 f;  4JZ4 A;  3I07 A;  1TWA I;  2RQR A;  2J06 A;  2J6F A;  4AFU C;  1OEB A;  3GTM S;  1YNZ A;  2R6M A;  3TE5 B;  1PKT A;  3HOW I;  2JW4 A;  1VQK 1;  3CCL Z;  3CXC Y;  5IP7 I;  4FSS A;  1YJW Z;  3KIF A;  1QVG Z;  3GTK I;  2A08 A;  3PO3 I;  2A28 A;  1RI9 A;  2ECZ A;  3H0H A;  5I22 A;  4A3D I;  1I50 I;  3H0F A;  4K11 A;  3M0Q A;  3HOX I;  1SRM A;  2I3C A;  2KEA A;  3UA7 A;  1FYN A;  4S1T A;  4Y92 A;  1I3Q I;  2VUM I;  1JXO A;  3CCV Z;  2MCN A;  1WX6 A;  4GLM A;  2I0N A;  3EED A;  1L1O C;  2F4M A;  5IT9 f;  4RVG A;  1I0C A;  1VYT A;  1B07 A;  2F2X A;  4NBF A;  4D8D A;  2ZAE B;  3VS4 A;  2L0A A;  2RMO A;  1G2B A;  3J80 b;  1PNJ A;  2P28 A;  2O88 A;  1XOV A;  3UF4 A;  2JMA A;  1AWX A;  1Q86 2;  1W2B Y;  1KD1 1;  2E2I I;  3GBQ A;  1S72 Z;  4HXJ A;  4DGL A;  1UHF A;  1VQ8 Z;  3CCS 1;  3HOV I;  2EVR A;  2YUQ A;  4BBR I;  2E2J I;  4J9B A;  2MOX A;  4Y7N I;  1Y1V S;  1B3Q A;  4JPB W;  3EER A;  1FMK A;  1AZG B;  3CCJ Z;  1WXU A;  5D1O A;  2DX1 A;  2FO0 A;  1YIJ Z;  3REB B;  2RQW A;  1YJ9 Z;  2FPE A;  4XX2 A;  1K4U S;  4X6A I;  4RUG A;  3VS6 A;  3NH5 A;  1RLQ C;  1YHQ 1;  2K6D A;  4HCK A;  5I11 A;  2JT4 A;  2RHB A;  4RTT A;  3NH4 A;  1GCP A;  1X2Q A;  2L3P A;  3EHQ A;  3CC2 1;  1Q7Y 2;  4BY7 I;  3CCV 1;  2DMO A;  1MUZ A;  1KIK A;  1G83 A;  1SEM A;  3VS5 A;  1AWO A;  1QWF A;  3J80 f;  2JS2 A;  1K73 2;  4F16 A;  4J9I A;  3CC4 Z;  3TSZ A;  1Q82 2;  2O2O A;  2JM9 A;  2R93 I;  3S15 I;  3M0T A;  2KXD A;  3G71 Z;  3J7A 4;  2BZX A;  2O9S A;  4X1V A;  1USP B;  1ARK A;  3EG1 A;  3GTM I;  2FEI A;  2KYB A;  3M0P A;  1BB9 A;  4RTZ A;  1CSK A;  4D8K A;  1Y57 A;  4NBD A;  2KPI A;  2A37 A;  1ZBJ A;  3JV3 A;  1Z01 A;  3S17 I;  2EYY A;  2K79 A;  3HOU I;  1PHT A;  1VQ8 1;  3CCQ 1;  2RBL A;  3QWY A;  2LIY A;  4HGY A;  3MZL B;  1X27 A;  2LJ0 A;  3Q87 A;  3NGP A;  4OMQ A;  2KYM A;  2KRO A;  4LUE A;  4HVV A;  1T3L A;  1X3W A;  1QKX A;  2L3Q A;  5LL6 f;  3S1R I;  4AFQ C;  1WI7 A;  2YT6 A;  1Z03 A;  1BK2 A;  2EYX A;  2C0I A;  4IIM A;  2K7A A;  1UE9 A;  1T3S A;  3ULR B;  2DJQ A;  5T64 A;  2IZ3 A;  2OZK A;  2VUG A;  2HF1 A;  2QRE B;  1NP6 A;  3S2D I;  4JJC A;  2SRC A;  1J3T A;  1WCM I;  2MIO A;  1CKB A;  1NM7 A;  3CQT A;  1QVG Y;  2J7I A;  5C44 I;  2XMF A;  2QEX Z;  4E33 A;  2JA7 I;  2RPN A;  4NFR A;  1U06 A;  2LQW A;  4IIO A;  1GCQ C;  3G4S 1;  2AKL A;  5HCK A;  1TWC I;  4A3G I;  3U50 C;  2QLV B;  2DYB A;  4HVW A;  4CL1 A;  1Y1W I;  2CDT A;  1TUD A;  1YP5 A;  2FRW A;  2EQI A;  4RTW A;  3VS1 A;  1HJD A;  3CCM Z;  1Y1V I;  3I56 1;  3NMZ C;  5T67 A;  2M0Y A;  2GNC A;  1X3Z A;  1GBR A;  5IT9 b;  4MD8 A;  1SSH A;  4MH4 A;  1JEG A;  3CMA Z;  1VQ9 1;  1RO4 A;  2OJ2 A;  2LP5 A;  3CCE 1;  1QYP A;  4JJD A;  2VF1 A;  2DNU A;  2JS0 A;  1PWT A;  4NOZ A;  2OTJ Z;  2NUZ A;  1YI2 Z;  2YUN A;  2J05 A;  1JU5 C;  2KRS A;  3NPF A;  3CCR Z;  1QCF A;  1ZUU A;  2F2V A;  1VQ7 Z;  3PE0 A;  3LH5 A;  1E6H A;  2DL8 A;  2YU9 I;  1VQ5 Z;  3CME Z;  2CSI A;  1KSW A;  1WYX A;  3NHN A;  2G2K A;  4NBC A;  1K9A A;  4DEX A;  4ORZ A;  2GBQ A;  1Q7Y 1;  2GU2 A;  2QEX 1;  1AOJ A;  1SRL A;  2Q51 A;  2O9V A;  1WA7 A;  4RVH A;  4A93 I;  4BXX I;  1SFO I;  2R7Z I;  1K73 1;  2GTO A;  1ABO A;  5IHI A;  2HU9 A;  3M0S A;  1Q82 1;  4J9G A;  3CCM 1;  1K76 A;  1S7M A;  2DF6 A;  1PKS A;  3I4N I;  3S1M I;  1AVZ C;  2DBM A;  2LJ3 A;  2EW3 A;  1TWF I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...