2AKLA

Solution structure for phn-a like protein pa0128 from pseudomonas aeruginosa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
116
structure length
116
Chain Sequence
MVSTLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATASDDGKVIKDSVGNVLQDGDTITVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMKLKSEFVRKVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequence Specific Resonance Assignment of a Hypothetical Protein PA0128 from Pseudomonas Aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Structural genomics, unknown function
molecule keywords phnA-like protein pa0128
total genus 15
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03831 PhnA PhnA domain
A PF08274 PhnA_Zn_Ribbon PhnA Zinc-Ribbon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2aklA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2aklA02
2DE7A 2ABLA 2R7ZI 2A08A 3HOUI 2D1XA 1UHCA 1VYVA 4J9FA 4JPBW 3VS4A 4OMPA 1UGVA 2RQVA 4QTUA 3PVLA 1X2KA 4QT7A 1K0SA 1SEMA 1UG1A 2EGAA 4NBFA 2JMCA 2KRSA 2ROLA 2X3WD 3GBQA 4D8DA 1K0XA 3ULRB 4JJDA 2I0NA 2KT1A 2ED1A 4A63B 1PRLC 2YUPA 1Y0MA 1N2FA 1G2BA 2DVJA 2DRKA 2O31A 1TFIA 1HD3A 1YN8A 3M0SA 1H3HA 1K4US 3RZDI 3UA7A 1ARKA 1B07A 1I3QI 2DX1A 1TWGI 1LCKA 2C0OA 4LUEA 2A37A 3VMIA 3NMZC 2DE6A 2EYWA 1WXTA 2JXBA 1AWJA 2LP5A 2W10A 1TG0A 2JS4A 2F4OA 3M0RA 2DRMA 2DM1A 1YNZA 1TWAI 4DEYA 1MV0B 3EG0A 3S1QI 1JQQA 3PO3S 2K6DA 3GCFA 1I6HI 1W6XA 1JXOA 1JEGA 4NBGA 1RLPC 1RI9A 2V1RA 2VWFA 5C3EI 1PFTA 1M3AA 2BZ8A 3QWYA 4CC4B 3RBBB 2EKHA 1NYGA 4A3KI 3U23A 4GBQA 2L2PA 2YSQA 1A0NB 2KXCA 2OAWA 3HOVI 2XMFA 1N5ZA 2L3PA 3GTGI 4IIOA 1UJYA 1ZB8A 4BXXI 4AFQC 3REBB 3M0TA 1SHGA 1VYTA 1WIEA 3PO2I 1QWFA 2R92I 2DE5A 1K1ZA 1M8MA 2EVRA 2P4RA 4RTZA 4Y92A 4A3II 3VRZA 1GCPA 3O5ZA 3RZOI 4F14A 2O9VA 2FG0A 4A3FI 5C44I 2KROA 1OPLA 2NVYI 2C0IA 1ABOA 3I5RA 4IIMA 2K2MA 4RUGA 4J9IA 2G6FX 1J3TA 1KFZA 1ZBJA 1E6GA 1ZSGA 4R0KA 1X69A 5ECAA 4DEXA 2PZ1A 1WXBA 1VYUA 1GRIA 3EHRA 2BJOA 4AFSC 4F17A 1TWFI 3EG2A 5IXBA 1QKWA 3REAB 1AD5A 2L3QA 3GTJI 3TSWA 2DJQA 3M0PA 1NLOC 4OMLA 1K76A 2VKNA 1ZLMA 3EG1A 1JO8A 2EGEA 5EC7A 2FRYA 1X3ZA 1T0JA 4LE9A 2E2II 5L23A 1XOVA 4A3LI 2JA6I 2KE9A 1SHFA 1PKSA 2HF1A 3NPFA 2OI3A 3PE0A 4LN2A 4OMMA 3CQTA 1UUEA 1LQLA 2DBKA 1M27C 2GGRA 2W0ZA 4K11A 2CT4A 3VS1A 2DNUA 4JJBA 2OJ2A 2VUMI 4AG2C 1HSQA 1WFWA 1E6HA 2VVKA 3H41A 4NB8A 4LNPA 4J9CA 4RTTA 4M4ZA 3EERA 5I11A 4WCIA 3UF4A 2CREA 2CSQA 1GFCA 4RTYA 1UHFA 1NYFA 2M0YA 2JM9A 3IQLA 1VA7A 1OOTA 2BTTA 1QCFA 1R9TI 4BY1I 3H0GI 1WYXA 2FPDA 1H8KA 1U3OA 2DL4A 2D0NA 4RTUA 3I4MI 1WX6A 2RMOA 1EFNA 2DE0X 2H8HA 2GBQA 3EG3A 1USPA 2O2OA 3Q87A 1TUDA 1UECA 1UE9A 4Z89A 2ECZA 1CKBA 1Z9ZA 2RF0A 2RN8A 2CUDA 1FYNA 2CSIA 1T3LA 3GTMI 3ESWA 4NOZA 1H92A 2J6OA 4KRTA 1KIKA 4FSSA 4MH4A 2K3BA 4OMOA 3U50C 1AEYA 4XX2A 3EHQA 2KT8A 3GKQA 4F16A 2QDLA 4J9EA 4Z88A 5FLMI 2EPDA 3M0QA 1I0CA 3NGPA 1NLPC 5C4XI 1QWEA 1IO6A 2J6FA 2CUBA 1TWHI 1X3WA 1WXUA 4J9BA 2DLPA 2A36A 2DL3A 2IIMA 2KRNA 1FMKA 1PNJA 2FO0A 2LJ1A 5I22A 2RQTA 4E6RA 3EGUA 3FKII 1U5SA 1QYPA 1KSWA 1NEBA 3I5SA 1YUAA 3S1RI 2RQWA 1WA7A 3GTLI 2K7AA 1YWOA 3VRYA 3PVQA 1MUZA 2ESWA 1SRLA 2YUQA 1TWCI 4AFZC 2JA8I 2HCKA 1ZX6A 1RO4A 5IHKA 1MV3A 2HDAA 4A3GI 2JMAA 2YU9I 3RNJA 1CSKA 3S17I 1HJDA 1CKAA 1ML8A 1Y1VI 2JA7I 2DF6A 3PO3I 3D6WA 2LQWA 4J9GA 2NVTI 1AZGB 4CC2A 1RUWA 4OMQA 4HVUA 1AOJA 4A3BI 2YDLA 1PHTA 1Z9QA 2JS0A 3SEMA 5FWBA 3UATA 1ZB9A 1NM7A 2V1QA 3I07A 2AK5A 2PK7A 5FW9A 3VS5A 5IP9I 2J6AA 3S15I 2FRWA 4NB9A 2JT4A 1K9AA 1M30A 3A98A 1AWWA 2CT3A 2KNBB 4JZ3A 1AVZC 5CM2M 2EQIA 2J06A 2SRCA 1VLAA 1YCSB 2C0TA 3KFVA 1NUIA 2KBTA 4AFUC 1S1NA 3VMGA 2HEQA 2KYBA 1WI7A 1YWPA 1RLYA 4GLMA 4BY7I 2AKLA 2RPNA 2L0AA 1Y57A 1V1CA 2PTKA 3VS3A 2J7IA 1X27A 2KPIA 2D8HA 4ESRA 2L3SA 2P3YA 4NBHA 2KRMA 3R6NA 5GJWB 1G83A 2YUNA 4RTXA 1Y1VS 2YT6A 1RLQC 2CH4W 2MIOA 4JJCA 4HXJA 4ZNXA 1GBRA 3S1MI 3S2HI 5IHIA 3HOXI 2RNAA 1ABQA 1AZEA 2NVQI 3I35A 5IP7I 2EBPA 3LUSA 3HOWI 2HBWA 2LZ6B 4NBBA 4CC3A 1SRMA 3THKA 1UFFA 2JTEA 3M4OI 2BZXA 1L1OC 2NWMA 4LUDA 1Y1WI 4HVVA 3UA6A 2PNIA 3M3YI 1GCQA 4AG1C 2F4MA 4A3DI 3S16I 1YP5A 4J9DA 1T0HA 1NG2A 2MOXA 1B3QA 4RTVA 3GTPI 2DYBA 1M3CA 2R93I 1PWTA 2KYMA 5C4JI 1BU1A 4QTTA 1UDLA 2CH4A 2A28A 2F2XA 2YUOA 1DL6A 1I50I 4A93I 4HVWA 2DBMA 1UJ0A 5IH2A 1W1FA 1M3BA 2B86A 2LJ3A 2LCSA 2DL8A 3S1NI 2K5RA 3HOYI 1OPKA 3H0IA 2NUZA 2GTJA 3I9QA 3GTKI 1PRMC 1ZUKA 3TSZA 3I4NI 2BZYA 4RTWA 1JXMA 4BBSI 3SHWA 2LNHB 4NBCA 2CDTA 4JZ4A 3VS2A 1TUCA 2KXDA 2K79A 1K83I 4BBRI 2F2WA 3CQZI 2FPEA 4X6AI 1ZUYA 2GQIA 2J05A 5IXFA 1T3SA 2DL5A 2B63I 2LX7A 2DL7A 2DA9A 2O88A 2AZVA 2DILA 1SFOI 2JR6A 2E2JI 2O9SA 4EIKA 1E7OA 2GTOA 1ZUUA 2ENMA 1BBZA 2KGTA 4A3CI 3GTMS 4CC7A 4ORZA 4NBDA 2EYYA 4A3MI 4Z8AA 1GL5A 1NEGA 4HCKA 2ED0A 1W70A 5GJVB 1SSHA 1KJWA 3C0CA 4D8KA 1BB9A 2NVXI 1GCQC 3VS6A 2AKKA 2EGCA 2LMJA 4OMNA 1AWOA 5FWCA 2MCNA 1U06A 1X43A 3K7AI 3TVTA 2EW3A 2JA5I 3H0FA 5HCKA 2SEMA 1BK2A 3S14I 2E5KA 2KEAA 2ROTA 1OV3A 2FEIA 1UTIA 1WLPB 2RQUA 3VB9A 2EYXA 4A3EI 2LJ0A 2GNCA 1PKTA 3S2DI 3GTQI 2JW4A 2FPFA 3JV3A 2JNYA 1X6GA 1I07A 1OEBA 2JS2A 3ZL7C 3QWXX 3GTOI 1X2QA 1GBQA 1X6BA 1QLYA 2RBLA 3FJ5A 1JU5C 2J6KA 1GFDA 3H0HA 2EYZA 1WCMI 2HSPA 3VS0A 2X3XD 1QKXA 2K9GA 2M51A 4NBEA 3LH5A 3VS7A 2E2HI 2AZSA 4Y7NI 2LQNA 3H3VJ 2RQRA 2DMOA 1AWXA 4X1VA 3M0UA 1USPB 4J9HA 4NBAA 2JM8A 1WDXA 4Y52I 1WW9A 3NHNA 3HOZI 2KR3A 1SPKA 4A3JI 5IHNA 3VMHA 1I1JA 2F2VA 2D8JA
chains in the Genus database with same CATH superfamily
3OYKA 2ABLA 2R7ZI 4BDZA 4C92C 3VKIA 2QA4A 1UHCA 3HRSA 4KUDK 3VS4A 4KGXB 1UGVA 4E7KA 3PMIA 2YRCA 3TEEA 4QQ6A 1UB4A 3GBQA 3G4S1 4EMKA 4JJDA 2I0NA 1OYXA 3VUZA 1V76A 1VQOA 5KYNA 2DAQA 4DQ2A 3JAMf 1N2FA 5LJ3e 1Y07A 1NJIC 2JJ9A 2M0OA 2Y4YA 1K4US 3ZEHA 5GAN7 1B07A 1S72Z 3CC71 2HU9A 2K57A 1TWGI 4XTVA 3VMIA 3SWNB 2DE6A 3X28B 3DB3A 2JXBA 1AWJA 3QYHB 1TG0A 2E10A 2JS4A 2LFUA 2DRMA 2LC4A 4DA4A 1TWAI 4DEYA 1RAIB 4OF1A 2E7ZA 3DLLA 1YIJT 1FMVA 4F04B 2R5MA 1JXOA 1C0MA 3OW2Z 2FHDA 4HGZA 5C3EI 1PFTA 4MD8A 1M3AA 2NUTA 4CC4B 3G6EZ 4E2ZA 3QJYA 2L2PA 2PM9A 4FU6A 4LDVA 3GNFB 1VQLZ 3RMSA 3VTNA 2MWPA 5KE2A 1Y96A 3REBB 1N8RC 2K3RA 1YJWQ 1QWFA 1K1ZA 4F7UB 1GCPA 1VQMZ 1VQ8Q 2O9VA 2RH2A 1M1GA 2NVYI 4FW1A 3I5RA 3HHTB 3CCM1 4JLGA 3CCJT 2G6FX 1KFZA 1EZZB 4X9CA 4R0KA 1X69A 5GAOp 1WHMA 4DEXA 1S721 1VYUA 1VQNZ 2I2LA 2ZPIB 5LJ5h 3C4SA 5IXBA 2F5TX 5A0GA 3J80b 1TSFA 3GTJI 1NJI2 3OA6A 1K73C 3M0PA 4E33A 4OMLA 4PJJA 3QBYA 2VKNA 1ZLMA 2CP0A 1T0JA 4LE9A 1VQMA 3P8HA 3TCJA 5L23A 1XOVA 3CD6Q 4NFRA 2JA6I 2KE9A 4DBHA 1B7TA 1JRIA 3NPFA 3PE0A 1V29B 2RJEA 1LJOA 4C8QC 2DXTA 3SWNC 1PSEA 2W0ZA 4K11A 1N9SA 2NUTB 4M75C 3CCUZ 2E3HA 4JRPA 1KD1U 5FU6B 4M7DB 3QZ9B 2GTIA 2VVKA 5GMKe 1KD1R 2X35A 1NPPA 5I11A 2VPXA 2CREA 2O4XB 2RO0A 5GAOn 4BACA 2HMAA 4ZN1A 3J80f 4Q5WA 2OTJT 3HRTA 1N9RA 5T64A 2RD1A 5GAMj 1QW1A 3H0GI 2MAMA 3UPUA 1QF8A 1H8KA 2DL4A 3D2LA 2D0NA 4M7DE 5GAOl 2GBQA 3I56Q 1IB8A 4QVCA 1UE9A 2EJ9A 2OX7A 2W04A 2LT4A 1Z9ZA 2RF0A 4FM4B 2E6NA 3CCST 2RN8A 4B6MA 2CSIA 4NOZA 1KQSP 4FSSA 4S1TA 2PVGB 3GP8A 1RAHB 1AEYA 1K9MU 4XX2A 1VQLT 2KT8A 1NLPC 4NH1C 3CD6Z 1YJWZ 1RO0A 1X75C 1X3WA 2CUBA 1M9SA 3VJPA 4WTOB 3I56A 1FMKA 1KRLA 3LW5E 5D1OB 5D6WA 1VQKZ 2Q4ZA 3OYMA 5CAIA 4RG2A 1BI1A 1WA7A 5HY6A 1MNEA 2R57A 3CCQQ 4RV9A 1ACMB 2JA8I 2XK0A 1BIBA 2R58A 5D6YA 1MV3A 3A8MB 1QVGA 2YU9I 3AHUA 4EMKB 3CEYA 1CKAA 1Y1VI 2O01E 3CCLZ 2KI7B 4C92A 3HKZA 1YHQ1 4CC2A 4E7LA 2K5FA 2P28A 4OMQA 4HVUA 3WXMB 4A3BI 1PHTA 3UATA 3SEMA 3LWIA 5DLOA 1NM7A 2RK2A 3I07A 2AK5A 3VS5A 5FRNA 2A0FB 3OYCA 4A53A 3GOXA 4NB9A 4IUUA 2JT4A 2QQBA 2K5IA 3A98A 3L42A 1AWWA 4JZ3A 1KQ1A 2MMPA 2J06A 2SRCA 3JCMc 3M56A 2C0TA 1N8R1 1NUIA 3CBPA 1S1NA 2KYBA 2ZPEB 1YITT 2AKLA 2AT1B 2RPNA 3QZ5B 4NOYA 2PVDB 1OZ2A 5L8RE 3SDZA 1QVFA 2D8HA 2KPIA 2DJZA 2VYTA 2ZGWA 3R6NA 5GJWB 1G83A 3PNWC 4PNOA 3CPWA 5CKHA 2E6ZA 2HD0A 4A4GA 2M48A 3S1MI 1VQ91 4J6YA 2DTOA 4M7DC 4FCYA 4A4EA 2RPRA 1K8A1 4PJOD 3DKMA 1AZEA 2PVOB 3I35A 3HOWI 3CCUA 4J8OA 1U8RA 4CC3A 2CKKA 1SRMA 4LD6A 3LYIA 1XNIA 5GAMd 3THKA 1MNDA 1UFFA 3CXCP 2CP6A 3JB9I 2W03A 3C12A 3CCQT 4HVVA 1Q82U 4JS5A 4C8QF 3BG1B 3M3YI 1GCQA 3CMA1 4IUTA 4PL6A 3OYHA 2JMOA 5KYXA 2EQUA 2MOXA 3GTPI 1YFNA 2DYBA 4BY6B 1M3CA 2HQEA 2R93I 1YJ9T 4BE2A 2A28A 3QXEB 4A93I 5C6SA 4HVWA 2DBMA 1JJ2S 2EQKA 1W1FA 3MP6A 4Y91A 4XQ3A 3NFCA 1QVPA 5IT9E 3HOYI 1QVFS 2NUZA 3LWHA 3I9QA 1VQ9Q 3L2ZA 2DEUA 4F7UG 5AN9F 1B34A 3FJPA 3CXCA 3I4NI 2BZYA 5D6XA 1JXMA 3SHWA 3VS2A 2CZ1B 4FT4A 1D1AA 5CQXA 3A8LB 3GLXA 2XU8A 2L3RA 4C92G 1WQ7A 2FPEA 2QEXZ 4C0FA 2DL5A 2B63I 2LX7A 5GMKh 2DL7A 2OTLQ 4EDUA 3T4NB 2DXBA 2O9SA 4J7FA 3CD6A 2GTOA 3I561 1BBZA 5KCOA 4A3CI 3GTMS 1LOJA 2K4YA 3BFMA 4ORZA 4A3MI 4HCZA 1GL5A 2ED0A 1N27A 3JCMg 1OX8A 3F3FC 1SSHA 2E4HA 1BB9A 5GANe 4MZMA 1FMWA 1YJ91 1VQ7A 3TVTA 4RVHA 2CS7A 1N8R2 5HCKA 1VQ9T 3S14I 1WHGA 2E5KA 3NDJA 2ROTA 2FEIA 1WLPB 3G7ZA 4E2XA 2EYXA 4ELZC 1K732 1I5LA 4PFZA 4TVRA 1VQPA 3JV3A 3LX7A 1Q821 3JCMf 1X6GA 3QDFA 3QWXX 3GTOI 2F69A 1X2QA 3G4SQ 3CCQ1 4IURA 2RBLA 3SB2A 3FJ5A 1JWHC 1WHHA 2DFUA 2J6KA 2JVVA 4DK1A 1JBMA 1D1BA 1SG5A 1KQSA 2HSPA 5GAOr 3NFZA 1D3BB 2HAXA 3I55Z 2DKGA 2HSEB 3KBGA 1QKXA 1FDOA 2M51A 3LH5A 2XD0A 2E2HI 4Y7NI 3CCE1 1AWXA 3M0UA 3CD6T 4J9HA 4M78F 1WDXA 3CCQZ 1WW9A 1NBEB 5KH6A 3JB9J 1SPKA 1DJ7B 3G71Q 3MZLB 5IHNA 3S3NA 4ATOA 1F1BB 2GNCA 1AT1B 2LQ8A 2A08A 5CKEA 1YIJZ 4OMPA 3G71A 2RK1A 4M78E 2YXYA 2EGAA 4R55A 2JMCA 2KRSA 1K0XA 3ULRB 4F7UA 2OTLZ 2ED1A 5GAMh 2P84A 4XTXA 2QDYB 3CCU1 3FC3A 5GANg 1QVGZ 3EFRA 4C0DC 1Y8CA 1MMNA 1G2BA 1ZH1A 4O5VA 2DRKA 4FL6A 3CCJ1 1BCMA 1HD3A 2QAZA 1H3HA 4E47A 2QGFB 1ARKA 1I3QI 5A2Qf 2ZZDA 2C0OA 1LCKA 4FYVB 3CC2Q 2DK3A 3CCL1 2W10A 4F7UE 3EFOB 2V45A 2F4OA 3BW1A 3NDIA 3CC2A 3OW2A 3CC4T 1MV0B 5CR2A 1JQQA 3M59A 2K6DA 3G1JA 3RERA 3GCFA 3CCV1 2M02A 5CCAA 4NL3A 4LDXA 4Z89A 3UDCA 3QWYA 1K8AR 2FZCB 4M7AE 3RBBB 1NYGA 1VQK1 2GF7A 3U23A 1A0NB 2QLVB 2L5QA 5J39A 2OOYB 3ZFJA 2XMFA 1N5ZA 1K731 3GTGI 4BXXI 3MEWA 1OI1A 1X6OA 1VQ6Q 1WIEA 3PO2I 5EG2A 2E3IA 4EPCA 2DE5A 1Q7YU 4Y92A 4M7AF 4JS4A 2HQHA 2VXFA 3OMCA 2BIVA 2FG0A 4A4HA 4E30A 1OX9A 2DVEA 2X4WA 1B34B 4M77D 3CCET 1J3TA 1SIWA 5T67A 1E6GA 5J26A 1X0TA 1YI2Z 5ECAA 4ME7A 2PZ1A 1WXBA 5LJ5e 1VQ6T 1GRIA 4OMFB 3EHRA 2OZKA 1G5VA 2RA2A 2L3QA 5LJ5j 1YCYA 4DGLA 1NLOC 1IGUA 3CMEA 1K76A 1TXQA 1ZA2B 3D9XA 2X9HA 1NP6A 1WHKA 3TDHB 5KYWB 2C06A 1JJ2A 4A3LI 2VGNA 3META 3OYAA 4C92B 3KXTA 1WQWA 1KC8C 4LN2A 4OMMA 1QCOA 4M78A 1UUEA 2G2KA 5LJ3d 4M77B 3C94A 1IHVA 1MHNA 1VQPZ 1RAFB 1ZSZB 2NLUA 2XDDA 5IN1A 1M902 2CT4A 5GAMe 2EJGA 2RI5A 3CMEQ 1YUKA 4OGEA 2QQRA 2VUMI 1WFWA 4E7JA 3X25B 1XTDA 3L2WA 4NB8A 4LNPA 4RTTA 4XTWA 1W2BP 2NUPB 3VV0A 4B9WA 3JB9G 5GMKj 3CCEA 3QJ6A 1NYFA 3VYGA 1WGSA 2M0YA 5GAN5 1I4K1 1VA7A 2ZAEA 1YITA 1QCFA 4C8QE 1R9TI 4M7AC 3MCAB 1VQKT 4RTUA 3I4MI 2LIYA 4E2FB 1VQ7T 4RMOA 1AA6A 1X01A 4M75A 4QKUA 1YHQZ 2QI2A 4L59A 2QTXA 2ECZA 1RQFA 3UWNA 6AT1B 2IV2X 2K2VA 1T3LA 3GTMI 3JB9F 2VPWA 3FLGA 4MH4A 4OMOA 1Q7Y2 3GKQA 4D6WA 1I0CA 5C4XI 3CXCY 1M1K2 4BD3A 1VQ6Z 1H641 1UEBA 1IO6A 4M78B 1WXUA 4IUVA 3EH1A 2DL3A 2KRNA 1PNJA 2FO0A 2RI2A 3EGUA 1QYPA 1TH7A 3C95A 3I56Z 2M1HA 3SWNA 4HCBA 4M7DD 5GANd 1VIEA 3AT1B 1ZSZC 3S3OA 1MMAA 3GTLI 2QA4T 3OYNA 2L89A 3PVQA 1MUZA 1TWCI 3RR6A 1VQ5T 1Y71A 1MMDA 4XTZA 4LDYA 2LCCA 1I5OB 2JMAA 4E32A 3RNJA 4C92D 1M2VA 2DYIA 4XTYA 5CKBA 2DF6A 2H3EB 4J9GA 4M7AD 4II1A 1Q86U 3CCS1 2EFIA 2P0KA 4KUIA 2JS0A 2XDPA 3RUXA 1Q7YR 1ZB9A 2V1QA 2JUBA 3OYGA 5FW9A 2J6AA 3JCMP 3FB9A 2QGGA 4OVAA 2YADA 4EWCA 2JNGA 5KCHA 1YI2A 1M30A 4IUQA 2HKNA 5GAMf 1AVZC 5CM2M 1YCSB 5LJ5d 3EGDB 3KFVA 3FQMA 1BI2A 2KBTA 4DBFA 5LJ3j 4E7HA 3PT9A 1VQ61 1ZHIA 4GLMA 3TREA 3OW2S 2L0AA 3Q1JA 2E64A 1Y57A 3FIFA 2PTKA 3VS3A 4QVZA 3JCMe 4O6JA 2PMZA 1JJ2Z 3FDRA 1VQNT 4DOWA 3NH5A 5D7UA 4HXJA 4VUBA 4C92F 2VXEA 3CCRT 1GBRA 1QVFZ 1M90R 3S2HI 3TU4K 5IHIA 1R0CB 1VQ41 3I55Q 2AHJB 5I2MA 3LUSA 1P92A 1TOVA 2BKDN 2HBWA 1IHWA 2LZ6B 3P5JB 1HXDA 2X4YA 4DBRA 1YHQT 4UC4A 4B9XA 3CPWS 3M4OI 1VQ8Z 2BZXA 3X26B 4C0ZA 4LUDA 3EEDA 3M53A 3UA6A 2YRDA 5FLXE 4BI4A 2PNIA 1Q7YC 1WHLA 4E7ZA 1YP5A 4BB7A 3M9QA 3CCEZ 1WJSA 4X9DA 4CRIA 1M1KU 1NJI1 3M58A 2F2XA 2YUOA 1KHIA 3QSUA 1DL6A 1BI0A 2OOXB 3G71T 3F3PC 1UJ0A 4F7UF 5IH2A 4HKEA 1R8OB 3JCMW 4OP0A 4MD9A 1VQN1 3GTKI 1VQ9A 1ZUKA 3TSZA 3ZBDA 2OTJQ 5FLXb 1K73R 1I81A 1W2BS 2Q51A 3EGXA 3JRZA 4JZ4A 4FYYB 3BDLA 1KD11 2KXDA 2GFAA 4N4HA 3VYHB 1K83I 4C8QD 4X6AI 3QHSA 1ZUYA 3CMAQ 3ME9A 1OQKA 2FZKB 2GQIA 3V7SA 2DA9A 2O88A 1FWZA 1PCXA 1AHJB 3EFOA 4EIKA 4PJOA 3HL8A 2KGTA 5CVIA 4M78D 1D0YA 1QCNA 2FL7A 1VQ81 2LNVA 1WJQA 1D0ZA 3CCVZ 5GANf 3OS1A 3C0CA 5LJ5f 2VF1A 1TUGB 3CC41 1KC8U 4FW2A 3JCMh 1AWOA 1U06A 2V8IA 3GPLA 1TTHB 3K7AI 5KYYB 1Q16A 1BK2A 2RI3A 5GAN3 1VIFA 3RKYA 2GFUA 2JUFA 4A3EI 2LJ0A 3GTQI 4DOVA 5LL6f 3CCUT 4M7AA 2XI9A 3IR7A 2HL5C 4M77G 1VQ7Q 4OB1B 1I07A 4J6WA 3ZL7C 1X6BA 4OGCA 1QVGS 2QRDB 1Q811 1JU5C 4M75F 2OTLT 3H0HA 2KAFA 3T9NA 1YI21 2LRQA 2CP3A 2DEQA 3CCJQ 2X3XD 1QP3A 2LQNA 2AZSA 3H3VJ 4X1VA 2LX9A 2RHYA 4PFOA 3JCMJ 1G3YA 2RM4A 3NHNA 4V2SA 1Q861 1VQ6A 3E1SA 2CGHA 1M90C 1YJ9A 2F2VA 2D8JA 2DXCA 5LJ3h 4XU3A 1K8A2 3HOUI 2H85A 4JJNK 2D1XA 4J9FA 4LXCA 4N4GA 4QTUA 4M78C 4HH4A 2BUDA 1K0SA 4M77A 2V26A 1YITZ 3RDVA 3BG0B 1K9M1 1VQ5Z 1UG1A 1VQOT 4NBFA 2ROLA 2RIQA 4EMKC 1VQP1 2AIRB 2E41A 2KQWA 1GXIE 3CXCS 4HCCA 4A63B 1KG1A 4RVFA 3JCMV 2YUPA 3JB9D 4J83A 2DVJA 2IZ4A 4BY6C 2QQAA 2KDSA 4A54A 3RZDI 2P4TA 5AT1B 3UA7A 1M1K1 3QO3A 1VQLA 5KE3A 4EMGA 2A37A 2MK5A 2EYWA 4C5IA 1PSFA 3VUBA 2DM1A 4HT8A 1VQ4Q 3EAEA 3EG0A 3S1QI 3PO3S 1BCOA 2JZ2A 1W6XA 1VQOZ 3NTIA 4PKCC 4NBGA 4GLKA 2V1RA 2VWFA 2BZ8A 2XIDA 4PJNA 3CPFA 1VQM1 2EJFA 2QQSA 4A3KI 4N0AA 4OB0B 1Q81U 2YSQA 2AYDA 2IG0A 3KIFA 4PJMA 5GMKl 2F1LA 3V8KA 1PC0A 1UGSB 2L3PA 3S6WA 3G4SA 1UJYA 1ZB8A 1QMCA 3CCRZ 2LVMA 1VQO1 1SHGA 1VYTA 2LCLA 2P4RA 4RTZA 4A3II 2RT9A 4PK4A 4F14A 5GAOm 2V3VA 2XICA 1OPLA 2C0IA 4PJOB 3EG9B 4M7DG 2K2MA 3J81E 2QKDA 3CD61 1QVGP 3OQ5A 4M77F 2ZPGB 1KD1C 2BJOA 4AFSC 4F17A 1TWFI 3EG2A 3LLRA 3A8GB 1AD5A 2CYZB 1Q81C 2O53A 2D0QB 3CC7Z 3CCVA 1BI3A 2HKQB 4KBMB 1Q95G 3EG1A 1JO8A 2JIPA 5EC7A 1IREB 1VQ71 2RJDA 4RCCA 4L5GA 2E2II 2WSCE 1WZNA 3J81b 1SHFA 2R6MA 1D3BA 1PKSA 2OI3A 3CQTA 1OU8A 4DBQA 2BE9B 2GGRA 2DTHA 2JIMA 3VS1A 4C92E 1XJWB 1K9M2 3CCQA 2DZCA 1D09B 1HSQA 1LVKA 1E6HA 4FYWB 4JDSA 3CCLT 3CCMQ 3FRNA 3H41A 4J9CA 4LDWA 1P9NA 3EERA 2OTLA 3JB9H 4WCIA 4DQYB 3E9FA 4BUGA 1GFCA 2JIQA 4RTYA 1UHFA 3R6OA 3JCMQ 3IQLA 1TWBA 2QEX1 4ZN3A 1PD0A 1WJRA 1Q86R 1VQ51 3I55T 3EG9A 1WYXA 2VPZA 2FPDA 1U3OA 2LT1A 2RMOA 2QK0A 1W2BY 4PLLA 2O2OA 3Q87A 1M2OA 1UECA 1Y96B 2E12A 3QPHA 4RCBA 3HKSA 2NUPA 4N0AC 5CIUA 4XK8E 3CCR1 1TS9A 1UGPB 4Z02A 2CUDA 1FYNA 1NE8A 2Y0SA 2ZCFB 3LGLA 2QXFA 1KIKA 4KRTA 3U50C 2M9UA 3D7SB 4F16A 4J9EA 2EAYA 4Z88A 5FLMI 2DO3A 3M0QA 3LH0A 3IX0A 3L2UA 1QVFY 1RAAB 3PIPA 2J6FA 1YIJQ 2JTMA 2IIMA 4BE1A 2LJ1A 5I22A 2JOYA 4E6RA 3G6E1 4KT0E 3M5AA 1KSWA 2IPOB 3OY9A 1YJWT 1YHQQ 1YIT1 3I5SA 2E5QA 3JCMb 2E65A 2MYSA 2OTJ1 5GANj 4MONA 2K7AA 1YWOA 3VRYA 2ESWA 1SRLA 3OYEA 1VQOQ 3OB9A 1ZX6A 1RO4A 2RHBA 2XHCA 1VQ4Z 4PJLA 5CKFA 2YHTA 3RIRA 3S3MA 1Z01A 1CSKA 2JA7I 3D6WA 4MZPA 3V7RA 3IFUA 2M6NA 5C0MA 3CXCZ 1S72Q 2JIOA 4NL2A 2I3CA 5FWBA 2D6FA 4M78G 1PD1A 1UGRB 2EQJA 1KQSZ 2DD5A 2PK7A 4M75D 3S15I 1LNXA 1O75A 2QYZA 4MMLA 3EGXB 5HK3A 2KNBB 3GNGA 2JIRA 4XAXB 3G6EQ 2QEXT 3OS0A 1VLAA 2IZ3A 1YITQ 2XG8D 3PMTA 4PJOE 1YWPA 1YJW1 4BY7I 3J80E 3QWUA 5D1PA 1V1CA 8ATCB 4KGZB 1NZ9A 4RVDA 4M7AG 2L3SA 2P3YA 4NBHA 2QA41 4JRKA 4C8QA 3MEAA 1BKBA 2YT6A 2MIOA 1RO2A 1K73U 3QKJA 2RNAA 2NVQI 1YI2Q 4XU2A 4JLIA 2EIFA 4AT1B 4NBBA 3WVDB 2KK4A 3EGDA 4ZTFA 2JTEA 1L1OC 2NWMA 1QVGY 2OAUA 1Y1WI 4YTLA 1M1KC 1BYMA 3ASKA 4M7AB 4KULA 1RNIA 2Y4XA 3CC4Z 2FZGB 2OTL1 3PIOA 4AG1C 2F4MA 4J9DA 3S16I 2GQVA 1B3QA 4RTVA 1NJIU 3P8DA 4R56A 3OS2A 2CH4A 4QTTA 1UDLA 3P8BB 3CC2T 1I50I 3A8OB 3PTAA 3MHXA 4MMKA 2B86A 2WSEE 3CC4Q 2DETA 2K5RA 3H0IA 2DPPB 4FT2A 1KC82 2GTJA 5A2Qb 5A0LA 4M77C 1PRMC 4CL1A 3OYDA 4BBSI 4L6V5 3GF5A 1YJNQ 4NBCA 2CDTA 2M16A 1TUCA 2LQKA 1VQ7Z 1VQ4T 3F70A 5M9OA 1QQJA 3BY7A 1G3TA 1KD12 2DILA 3NTKA 4ZGDB 1SFOI 2JR6A 4AMCA 1JJ2Y 1E7OA 2K5LA 1WPYA 4E31A 1RAEB 8AT1B 4NBDA 5A2QE 2EYYA 3INZA 3OBYA 2QR1B 1YJNA 4HCKA 3TQ7P 1W70A 1FDIA 5GJVB 2MI6A 3JCMd 2DXUA 3HRUA 3CCVQ 1KJWA 5LJ3f 2NVXI 1HYOA 1GCQC 2WAQA 3VS6A 4E2WA 2EGCA 4M77E 2MCNA 1X43A 5IT9b 1K8AU 3H0FA 2YRVA 3A8HB 3JAMb 1VQPT 1OV3A 1VQNA 2RQUA 3LGFA 3VB9A 3CCEQ 5LJ5g 4C8QG 1PKTA 3S2DI 2F5KA 5FU7C 3M57A 2FPFA 3L2RA 2JNYA 4M7DA 3OW2Y 3L2QA 1OEBA 2GCXA 1KHCA 5FROA 3CPWP 3EFSA 3CCSA 1BIAA 2KY9A 4QW2A 1OULA 2QASA 3OBWA 2KMTA 1QVFP 1Q7Y1 1ZSZA 2OTJZ 1QP2A 4RG8A 2WSFE 1WCMI 1IRXA 2H3JA 4OB3B 3VS0A 2E70A 3EH2A 5GAN8 2YLBA 2VB6A 2DMOA 3HFOA 4RVGA 1USPB 3QIIA 4NBAA 1WIIA 1WNLA 1G3WA 2JM8A 3RKXA 1VQ8A 2K3XA 4CI0C 4FSXA 1YJWA 3DB4A 5A0DA 1YJNT 3VMHA 1ZBXA 1I1JA 2LP5A 2DE7A 3CCSZ 5J3BA 1N8RU 1VYVA 4JPBW 5D1OA 1FXXA 2RQVA 3PVLA 2VC8A 1X2KA 2LTOA 3M4YA 4QT7A 1SEMA 2HL3A 1YBYA 2COWA 5GAMg 2X3WD 4D8DA 2KT1A 5LL6S 1W2BA 4TNUA 1PRLC 4A4KA 2Z0WA 2DERA 1Y0MA 3NH4A 2GU2A 1LPLA 5DY9A 2O31A 1H3ZA 1TFIA 1YN8A 3M0SA 2QEXQ 1R0BG 4BI3A 5KYXB 3OYIA 4BDYA 3HP9A 2BE7D 3CCMA 2DX1A 3MP1A 1IXDA 3HTRA 2V8JA 4LUEA 3OSSC 1YJNZ 3NMZC 4PJOC 1WXTA 5KYUB 4C0GA 2E9HA 1S72A 1FX7A 3M0RA 1YNZA 1VQ9Z 3MKDA 4PLIA 4RS4A 1I6HI 4RKUE 1HK9A 3PGGA 1JEGA 2ZAEB 1RLPC 1RI9A 2FB7A 5IAYA 1Z03A 1VUBA 1N8RR 2EKHA 4GBQA 3QG1A 4P5NA 2RHIA 3E19A 2KXCA 3CCMZ 3BE3A 2V8KA 2OAWA 3HOVI 1OZ3A 2QA4Q 2ATCB 1PM3A 4IIOA 4AFQC 1YHQA 4M75B 3M0TA 2R92I 2EVRA 1M8MA 1UGQB 1M901 4C8QB 3VRZA 3O5ZA 3CPWZ 2K3YA 3RMQA 3RZOI 3IF8A 4A3FI 1YI2T 5C44I 4QQGA 2KROA 2RB6A 1ABOA 2QREB 4C5GA 1SF9A 4IIMA 1VQL1 2A7YA 4RUGA 4J9IA 1ZBJA 9ATCB 1NJIR 1ZSGA 3CCLA 2YLCA 1G8XA 1M4ZA 3J81f 2D9TA 1QKWA 3REAB 2PUKB 1YJN1 3A5ZB 3TSWA 2DJQA 2ZPBB 4MD7A 1KQ2A 3CC4A 2XKOC 2EGEA 2FRYA 1S7MA 1X3ZA 2HBPA 3KIHA 2EQMA 4EMHA 4PJOF 3G4ST 1KC8R 2RJFA 2WB1A 2MWOA 1W2BZ 2HF1A 2JN0A 2RJCA 3JAME 1LQLA 2DBKA 1M27C 4QQDA 1K8AC 1W4SA 2DNUA 2COYA 3CCRQ 3KUFA 4JJBA 2OJ2A 4LD9K 2X4JA 3CBMA 4AG2C 5AYFA 3CMEZ 1VQLQ 1YJ9Z 1Y7XA 1VQPQ 4M4ZA 4OB2B 2XDBA 3UF4A 1I8FA 3O8VA 4M7DF 3CCLQ 1N6AA 2CSQA 4M75E 2JM9A 1YIJ1 2EWNA 1M5Q1 4C5EA 2X51A 1OOTA 2BTTA 5I21A 4MXUA 2HQXA 1TU0B 4BY1I 5DLQE 3OYBA 3CME1 3MPUB 5GAOq 3VU3C 4E2YA 1WX6A 3MEVA 1EFNA 2DE0X 2H8HA 3EG3A 3J7AF 1USPA 2HZYA 2P0PA 5CO7A 5GAN2 1RABB 2CZ0B 1RACB 3OYJA 2VPYA 4MZTA 2PQWA 1TUDA 1YJ9Q 1VQKQ 3OYYA 3OSVA 1K9MR 1CKBA 2COZA 1Q822 2G3RA 3V8JA 3ESWA 3A1PA 5CQYA 1H92A 2J6OA 2K3BA 3MZKB 1MMGA 3EHQA 3CCMT 2QDLA 4XTUA 1RL2A 1U1TA 2EPDA 3NGPA 1QWEA 4PFPA 1TWHI 4J9BA 2DLPA 2A36A 2FYKA 3OW2P 2RQTA 3OS5A 1Q81R 3FKII 2QA4Z 1U5SA 1NEBA 1EIFA 2E1HA 2O4XA 4KH0B 4XU0A 4FIBA 7AT1B 1YUAA 4AYBA 3J7A4 3S1RI 2QEXA 2RQWA 1VQ5A 3QYGB 1Q862 3MP8A 1D0XA 2CP7A 1ZQ1A 2ZPHB 3E9GA 2YUQA 2DD4A 3ER0A 2QG9B 4AFZC 2VASA 2HCKA 2KVQG 4KGVB 4A4FA 5IHKA 1WZOA 4JUVA 2HDAA 1JJ2P 4A3GI 2LDMA 3X20B 3V8LA 3OYFA 3S17I 1HJDA 2RHUA 4N4IA 1ML8A 2DZ9A 3PO3I 2LQWA 3JCMX 3OMGA 5T6BA 4LDUA 1VQ4A 1Q82R 2NVTI 1AZGB 5GMKm 1RUWA 4KH1B 2DTIA 1JB0E 1AOJA 3CBOA 5LJ3g 3DLMA 2YDLA 2X4XA 1Z9QA 2QQ9A 3L2VA 3NH8A 3HFNA 4JRQA 4PJOG 5DM7R 2QTVA 3CCUQ 3CMAT 4BI8B 5IP9I 2FRWA 1K9AA 3CMAA 2CT3A 1C6VX 3X24B 4ELYC 1M90U 1Z02A 3G6EA 2EQIA 3I551 1EX4A 3CMET 4AFUC 3G6ET 3VMGA 4XU1A 2HEQA 1WI7A 1RLYA 2OTJA 2P0QA 3CCSQ 5GANh 1ZA1B 2J7IA 2FVUA 2HNIA 1X27A 4ESRA 5KYUA 3CC7Q 2KRMA 3CC2Z 2YUNA 4RTXA 1Y1VS 3BDUA 1RLQC 2CH4W 2VV5A 2EYQA 3HPWA 4HA8A 4JJCA 4HGYA 4ZNXA 3SD4A 3JSCA 5KYYA 1VQNQ 3HOXI 4ZGJB 1ABQA 3CMAZ 4J6XA 3WVEB 3NTHA 2PUOB 4M75G 4E7IA 1D1CA 5IP7I 2EBPA 1KQSY 1XQHA 5CKDA 2QRCB 5I2SA 1KQSS 3CCJA 2RHXA 3RESA 3QDRB 4J5YA 1VQMQ 2R5AA 3I56T 1M1KR 4JRIA 2JTFA 5FRMA 3CC7A 3M4GA 1SSFA 2IVWA 1Q86C 1VQ8T 3FQQA 4A3DI 1RAGB 1T0HA 1NG2A 5GAN6 4NS5A 1RI0A 5CK9A 3G71Z 1YIJA 5HK0A 4HT9A 2NAPA 1PWTA 1Q82C 2KYMA 5C4JI 1BU1A 1KC81 5IT9f 4C5HA 1IZ6A 1U1SA 5GMKi 5FU6C 1IGQA 2WACA 1M3BA 2LJ3A 4GY5A 2B8AA 4MRIA 3PFSA 2LCSA 1M8VA 2DL8A 3S1NI 1VQKA 2KSSA 1OPKA 2RHZA 1KK7A 4E7SA 4X34A 4QVDA 4J7IA 4RTWA 4ZTJA 3CCRA 4WF2A 2CZ6B 2YWWA 2DIGA 2CP2A 1PG5B 3G4SZ 2LNHB 2K79A 2Y90A 4BBRI 1R77A 2F2WA 3CQZI 4ZGEB 3TE5B 4ANJA 3QUIA 3H8ZA 1Q812 3H9NA 2J05A 2MPXC 2NYSA 5IXFA 1T3SA 4Y28E 2AZVA 3UT1A 2E2JI 2VUBA 2O4HA 1ZUUA 2ENMA 5FLXf 1OU9A 1M1FA 3CC7T 3MONA 4CC7A 2VUGA 1VQ5Q 4Z8AA 3OYLA 1NEGA 4IUPA 5KYWA 4D8KA 2ZPFB 2AKKA 2LMJA 4OMNA 5FU7B 5FWCA 2EW3A 2JA5I 3CCVT 2SEMA 3E2UA 1M2VB 3SFMA 1WJ2A 3G711 3RKWA 2KEAA 4IKFA 1K9MC 2CZ7B 1UTIA 1VQMT 3FEOA 5GAN4 3HSBA 2JW4A 4MDWA 3GIBA 1O9SA 4C0DB 1QXFA 3CCJZ 3H6ZA 2JS2A 4BE0A 3MEUA 3N5BB 1RADB 1G3SA 3M55A 3MO8A 1MGQA 1GBQA 2EGTA 2A3LA 2LEXA 1VOMA 1QLYA 2DIQA 3MJXA 4FYXB 4MDXA 1GFDA 2EYZA 1SKUB 2L8DA 2MF2A 3L1AA 5HKCA 1NPRA 2EKOA 2K9GA 3V7CA 4NBEA 3M54A 3VS7A 2RQRA 1C1AA 2CP5A 3I55A 3CC21 2VGMA 3CPWY 4Y52I 2PU9B 1S72T 3HOZI 2KR3A 3URGA 2GTHA 4A3JI 1WHJA 2KI7A
chains in the Genus database with same CATH topology
2DE7A 2ABLA 3CCSZ 2R7ZI 2A08A 1K8A2 3HOUI 2H85A 2D1XA 1UHCA 1VYVA 4J9FA 4JPBW 3VS4A 1YIJZ 4OMPA 1UGVA 5D1OA 2RQVA 4QTUA 3PVLA 4HH4A 1X2KA 4QT7A 1K0SA 1SEMA 1YITZ 3BG0B 1K9M1 1VQ5Z 1UG1A 2EGAA 4NBFA 2JMCA 2KRSA 2RIQA 3G4S1 2ROLA 2X3WD 3GBQA 1VQP1 4D8DA 1K0XA 3ULRB 4JJDA 2I0NA 2KT1A 2OTLZ 2ED1A 4A63B 4TNUA 3CCU1 1PRLC 4RVFA 1QVGZ 2YUPA 3JAMf 1Y0MA 3NH4A 1N2FA 1G2BA 1ZH1A 2IZ4A 2DVJA 2GU2A 2DRKA 2O31A 3CCJ1 1TFIA 1HD3A 1YN8A 3M0SA 1H3HA 1K4US 3RZDI 3UA7A 1ARKA 1M1K1 1S72Z 1I3QI 5A2Qf 1B07A 3CC71 2DX1A 2HU9A 1TWGI 1LCKA 2V8JA 2C0OA 4LUEA 2A37A 3VMIA 3CCL1 1YJNZ 2DE6A 2EYWA 3NMZC 1WXTA 2JXBA 1AWJA 2LP5A 2E9HA 2W10A 1TG0A 2JS4A 2F4OA 3M0RA 2LFUA 2DRMA 2DM1A 3NDIA 1VQ9Z 1YNZA 1TWAI 4DEYA 1MV0B 3EG0A 3S1QI 1JQQA 3PO3S 4RS4A 2K6DA 3GCFA 3CCV1 1I6HI 1W6XA 1JXOA 1VQOZ 3OW2Z 1JEGA 2ZAEB 4NBGA 4HGZA 1RI9A 1RLPC 2V1RA 5C3EI 1PFTA 4MD8A 1M3AA 2BZ8A 2VWFA 3QWYA 4CC4B 3G6EZ 1VQM1 4E2ZA 1Z03A 3RBBB 2EKHA 1NYGA 4A3KI 1VQK1 3U23A 4GBQA 2L2PA 2QLVB 2YSQA 2PM9A 1A0NB 3KIFA 2KXCA 3CCMZ 1VQLZ 2V8KA 2OOYB 2OAWA 3HOVI 2XMFA 1N5ZA 2L3PA 1K731 3GTGI 4IIOA 3VTNA 1UJYA 1ZB8A 4BXXI 4AFQC 3CCRZ 3REBB 2K3RA 1VQO1 1SHGA 3M0TA 1VYTA 1WIEA 3PO2I 1QWFA 2R92I 2DE5A 1K1ZA 1M8MA 2EVRA 2P4RA 4RTZA 1M901 4Y92A 4A3II 3VRZA 2RT9A 3CPWZ 1VQMZ 1GCPA 3O5ZA 3RZOI 4F14A 3IF8A 2O9VA 2FG0A 4A3FI 4E30A 5C44I 2KROA 1OPLA 2NVYI 2C0IA 1ABOA 2QREB 3I5RA 4IIMA 2K2MA 3CCM1 1VQL1 4RUGA 2QKDA 4J9IA 2G6FX 1J3TA 1KFZA 3CD61 1ZBJA 5T67A 1E6GA 1ZSGA 1X0TA 1YI2Z 1X69A 4R0KA 5ECAA 4DEXA 2PZ1A 1WXBA 1S721 1VYUA 1GRIA 3J81f 2BJOA 1VQNZ 2OZKA 3EHRA 4AFSC 1TWFI 3EG2A 4F17A 1QKWA 5IXBA 3REAB 1YJN1 3J80b 1AD5A 2L3QA 3GTJI 1NJI2 2O53A 2DJQA 3TSWA 3M0PA 4DGLA 3CC7Z 4MD7A 4E33A 1NLOC 4OMLA 1K76A 2VKNA 1ZLMA 3EG1A 1JO8A 2EGEA 5EC7A 3D9XA 1VQ71 2FRYA 1NP6A 1S7MA 1X3ZA 1T0JA 3TDHB 4LE9A 2E2II 3KIHA 5L23A 1XOVA 4A3LI 4NFRA 2JA6I 3J81b 2KE9A 1SHFA 2WB1A 2R6MA 1W2BZ 2HF1A 1PKSA 2OI3A 3NPFA 3PE0A 4LN2A 4OMMA 3CQTA 1UUEA 1LQLA 2G2KA 2DBKA 1M27C 1VQPZ 2GGRA 2W0ZA 4K11A 1M902 2CT4A 3VS1A 2DNUA 1YUKA 1K9M2 3CCUZ 4JJBA 2OJ2A 2VUMI 4AG2C 1HSQA 1WFWA 1E6HA 3CMEZ 2GTIA 2VVKA 3H41A 4NB8A 1YJ9Z 4J9CA 4LNPA 4RTTA 4M4ZA 1P9NA 3EERA 5I11A 4WCIA 3UF4A 2CREA 4DQYB 2CSQA 1GFCA 4RTYA 3J80f 1UHFA 1NYFA 2M0YA 2JM9A 3IQLA 1YIJ1 1VA7A 1OOTA 2BTTA 2QEX1 1QCFA 4MXUA 1R9TI 5T64A 4BY1I 1VQ51 3H0GI 1WYXA 1QF8A 2FPDA 3CME1 1H8KA 1U3OA 2DL4A 4E2YA 2D0NA 4RTUA 3I4MI 1WX6A 2RMOA 1W2BY 1EFNA 2LIYA 2DE0X 2H8HA 2GBQA 3EG3A 1USPA 2O2OA 3Q87A 1TUDA 1UECA 1YHQZ 1UE9A 4Z89A 2ECZA 2W04A 1RQFA 1CKBA 1Z9ZA 3CCR1 2RF0A 1Q822 2RN8A 2CUDA 1FYNA 2Y0SA 2CSIA 1T3LA 3GTMI 3ESWA 4NOZA 1H92A 2J6OA 4KRTA 1KIKA 4FSSA 4MH4A 4S1TA 3MZKB 2K3BA 3U50C 4OMOA 1AEYA 4XX2A 3EHQA 1Q7Y2 2KT8A 3GKQA 4F16A 2QDLA 4J9EA 4Z88A 5FLMI 2EPDA 3M0QA 1I0CA 3NGPA 1NLPC 3IX0A 5C4XI 3CXCY 1M1K2 4NH1C 1QVFY 3CD6Z 1QWEA 1YJWZ 1VQ6Z 1IO6A 2J6FA 1RO0A 2CUBA 1TWHI 1X3WA 1WXUA 4J9BA 2DLPA 2A36A 2DL3A 2IIMA 2KRNA 1FMKA 1PNJA 2FO0A 2LJ1A 5I22A 2RQTA 1KRLA 4E6RA 5D1OB 3G6E1 3EGUA 3FKII 2QA4Z 1U5SA 1QYPA 1KSWA 1NEBA 1YIT1 3I5SA 1YUAA 4AYBA 1VQKZ 2Q4ZA 3I56Z 3S1RI 3J7A4 2RQWA 1WA7A 2OTJ1 3GTLI 1Q862 4MONA 2K7AA 1YWOA 3VRYA 4RV9A 3PVQA 1MUZA 2ESWA 1SRLA 2YUQA 1TWCI 4AFZC 2JA8I 2HCKA 1ZX6A 1RO4A 2RHBA 1MV3A 5IHKA 2HDAA 4A3GI 1VQ4Z 2JMAA 2YU9I 4E32A 3RNJA 1Z01A 1CSKA 3S17I 1HJDA 1CKAA 1ML8A 1Y1VI 2JA7I 2DF6A 3PO3I 3D6WA 3CCLZ 2LQWA 4J9GA 2KI7B 5T6BA 2NVTI 1AZGB 3HKZA 1YHQ1 4CC2A 1RUWA 3IFUA 2M6NA 2P28A 3CXCZ 4OMQA 4HVUA 3CCS1 1AOJA 4A3BI 2YDLA 1PHTA 1Z9QA 2JS0A 2I3CA 5FWBA 3SEMA 3UATA 1ZB9A 1NM7A 3NH8A 2V1QA 3I07A 1KQSZ 2AK5A 2JUBA 2PK7A 5FW9A 3VS5A 5IP9I 2J6AA 3S15I 2FRWA 4NB9A 2JT4A 2YADA 4EWCA 1K9AA 1M30A 3A98A 1AWWA 2CT3A 2KNBB 4JZ3A 1Z02A 1AVZC 5CM2M 2EQIA 2J06A 2SRCA 1VLAA 2IZ3A 1YCSB 2C0TA 3I551 1N8R1 3KFVA 3FQMA 1NUIA 2KBTA 4AFUC 1S1NA 3VMGA 2HEQA 2KYBA 1WI7A 1RLYA 1YWPA 1YJW1 1VQ61 4BY7I 4GLMA 2AKLA 2RPNA 2L0AA 3QWUA 5D1PA 1Y57A 1V1CA 2PTKA 3VS3A 2J7IA 4RVDA 2PMZA 1JJ2Z 2KPIA 1X27A 2D8HA 4ESRA 2L3SA 2P3YA 4NBHA 2QA41 2KRMA 3R6NA 5GJWB 3NH5A 1G83A 3CC2Z 2YUNA 4RTXA 1Y1VS 2YT6A 1RLQC 2CH4W 1RO2A 2MIOA 4HXJA 4JJCA 4ZNXA 1GBRA 4HGYA 1QVFZ 2M48A 3S1MI 3S2HI 1VQ91 5IHIA 3HOXI 2RNAA 2RPRA 1ABQA 3CMAZ 1K8A1 1AZEA 2NVQI 1VQ41 3I35A 5IP7I 2EBPA 3LUSA 1KQSY 3HOWI 2HBWA 2LZ6B 3P5JB 4NBBA 4CC3A 1SRMA 2QRCB 3THKA 1UFFA 2JTEA 3M4OI 1VQ8Z 2BZXA 1L1OC 2NWMA 2W03A 1QVGY 4LUDA 3EEDA 1Y1WI 4HVVA 3UA6A 1RNIA 3BG1B 2PNIA 3M3YI 1GCQA 3CC4Z 3CMA1 2OTL1 2JMOA 4AG1C 2F4MA 3FQQA 4A3DI 3S16I 1YP5A 4J9DA 1T0HA 1NG2A 2MOXA 1B3QA 4RTVA 3GTPI 2DYBA 3CCEZ 3G71Z 1M3CA 2R93I 1PWTA 2KYMA 5C4JI 1BU1A 4QTTA 1UDLA 2CH4A 1NJI1 2A28A 2F2XA 2YUOA 1KC81 5IT9f 1DL6A 1I50I 4A93I 4HVWA 2OOXB 2DBMA 3F3PC 1UJ0A 5IH2A 1W1FA 1M3BA 2B86A 2LJ3A 4MRIA 2LCSA 2DL8A 3S1NI 4MD9A 2K5RA 3HOYI 1OPKA 3H0IA 2NUZA 1KC82 2GTJA 3I9QA 1VQN1 5A2Qb 3GTKI 1PRMC 4CL1A 1ZUKA 5AN9F 3TSZA 3I4NI 2BZYA 5FLXb 1JXMA 4RTWA 4BBSI 2Q51A 3SHWA 3G4SZ 2LNHB 4NBCA 2CDTA 4JZ4A 3VS2A 1TUCA 1KD11 2KXDA 2K79A 1VQ7Z 1K83I 4BBRI 2F2WA 3CQZI 3TE5B 2FPEA 2QEXZ 4X6AI 1ZUYA 2GQIA 1Q812 2J05A 5IXFA 1T3SA 2DL5A 2B63I 2LX7A 2DL7A 2DA9A 2O88A 2AZVA 1KD12 2DILA 1SFOI 2JR6A 3T4NB 2E2JI 2O9SA 1JJ2Y 2O4HA 4EIKA 1E7OA 2GTOA 3I561 1ZUUA 2ENMA 1BBZA 5FLXf 2KGTA 4A3CI 3GTMS 3MONA 4E31A 4CC7A 2VUGA 4ORZA 4NBDA 2EYYA 4A3MI 4Z8AA 1VQ81 2QR1B 1NEGA 4HCKA 2ED0A 1W70A 1GL5A 5GJVB 3CCVZ 3F3FC 1KJWA 1SSHA 3C0CA 1BB9A 4D8KA 2NVXI 1GCQC 2VF1A 2WAQA 3VS6A 4E2WA 3CC41 2AKKA 2EGCA 2LMJA 4OMNA 1AWOA 5FWCA 1YJ91 1U06A 2V8IA 2MCNA 1X43A 3K7AI 5IT9b 2EW3A 2JA5I 3TVTA 4RVHA 3H0FA 1N8R2 5HCKA 2SEMA 1BK2A 3S14I 3G711 2E5KA 2KEAA 3NDJA 2ROTA 3JAMb 1OV3A 2FEIA 1UTIA 1WLPB 2RQUA 3VB9A 4E2XA 2EYXA 4A3EI 2LJ0A 1K732 1PKTA 3S2DI 3GTQI 2GNCA 5LL6f 2JW4A 2FPFA 3JV3A 1Q821 3CCJZ 2JNYA 3OW2Y 1X6GA 1I07A 1OEBA 2JS2A 3ZL7C 3QWXX 3GTOI 1X2QA 1GBQA 2EGTA 3CCQ1 1X6BA 1QLYA 2RBLA 2QRDB 1Q811 1Q7Y1 1JWHC 2OTJZ 1JU5C 3FJ5A 2J6KA 1GFDA 3H0HA 4DK1A 2EYZA 1WCMI 2HSPA 3NFZA 1YI21 3VS0A 3I55Z 2X3XD 1QKXA 2K9GA 2M51A 4NBEA 3LH5A 3VS7A 2E2HI 2AZSA 4Y7NI 2LQNA 3CCE1 3H3VJ 2RQRA 2DMOA 4RVGA 1AWXA 3M0UA 4X1VA 1USPB 4J9HA 4NBAA 3CC21 1WIIA 2JM8A 1WDXA 3CPWY 3CCQZ 4Y52I 1WW9A 3NHNA 3HOZI 2KR3A 1SPKA 1Q861 2GTHA 4A3JI 3MZLB 5IHNA 3VMHA 1I1JA 2F2VA 2D8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE7 A;  2ABL A;  2R7Z I;  2A08 A;  3HOU I;  2D1X A;  1UHC A;  1VYV A;  4J9F A;  4JPB W;  3VS4 A;  4OMP A;  1UGV A;  2RQV A;  4QTU A;  3PVL A;  1X2K A;  4QT7 A;  1K0S A;  1SEM A;  1UG1 A;  2EGA A;  4NBF A;  2JMC A;  2KRS A;  2ROL A;  2X3W D;  3GBQ A;  4D8D A;  1K0X A;  3ULR B;  4JJD A;  2I0N A;  2KT1 A;  2ED1 A;  4A63 B;  1PRL C;  2YUP A;  1Y0M A;  1N2F A;  1G2B A;  2DVJ A;  2DRK A;  2O31 A;  1TFI A;  1HD3 A;  1YN8 A;  3M0S A;  1H3H A;  1K4U S;  3RZD I;  3UA7 A;  1ARK A;  1B07 A;  1I3Q I;  2DX1 A;  1TWG I;  1LCK A;  2C0O A;  4LUE A;  2A37 A;  3VMI A;  3NMZ C;  2DE6 A;  2EYW A;  1WXT A;  2JXB A;  1AWJ A;  2LP5 A;  2W10 A;  1TG0 A;  2JS4 A;  2F4O A;  3M0R A;  2DRM A;  2DM1 A;  1YNZ A;  1TWA I;  4DEY A;  1MV0 B;  3EG0 A;  3S1Q I;  1JQQ A;  3PO3 S;  2K6D A;  3GCF A;  1I6H I;  1W6X A;  1JXO A;  1JEG A;  4NBG A;  1RLP C;  1RI9 A;  2V1R A;  2VWF A;  5C3E I;  1PFT A;  1M3A A;  2BZ8 A;  3QWY A;  4CC4 B;  3RBB B;  2EKH A;  1NYG A;  4A3K I;  3U23 A;  4GBQ A;  2L2P A;  2YSQ A;  1A0N B;  2KXC A;  2OAW A;  3HOV I;  2XMF A;  1N5Z A;  2L3P A;  3GTG I;  4IIO A;  1UJY A;  1ZB8 A;  4BXX I;  4AFQ C;  3REB B;  3M0T A;  1SHG A;  1VYT A;  1WIE A;  3PO2 I;  1QWF A;  2R92 I;  2DE5 A;  1K1Z A;  1M8M A;  2EVR A;  2P4R A;  4RTZ A;  4Y92 A;  4A3I I;  3VRZ A;  1GCP A;  3O5Z A;  3RZO I;  4F14 A;  2O9V A;  2FG0 A;  4A3F I;  5C44 I;  2KRO A;  1OPL A;  2NVY I;  2C0I A;  1ABO A;  3I5R A;  4IIM A;  2K2M A;  4RUG A;  4J9I A;  2G6F X;  1J3T A;  1KFZ A;  1ZBJ A;  1E6G A;  1ZSG A;  4R0K A;  1X69 A;  5ECA A;  4DEX A;  2PZ1 A;  1WXB A;  1VYU A;  1GRI A;  3EHR A;  2BJO A;  4AFS C;  4F17 A;  1TWF I;  3EG2 A;  5IXB A;  1QKW A;  3REA B;  1AD5 A;  2L3Q A;  3GTJ I;  3TSW A;  2DJQ A;  3M0P A;  1NLO C;  4OML A;  1K76 A;  2VKN A;  1ZLM A;  3EG1 A;  1JO8 A;  2EGE A;  5EC7 A;  2FRY A;  1X3Z A;  1T0J A;  4LE9 A;  2E2I I;  5L23 A;  1XOV A;  4A3L I;  2JA6 I;  2KE9 A;  1SHF A;  1PKS A;  2HF1 A;  3NPF A;  2OI3 A;  3PE0 A;  4LN2 A;  4OMM A;  3CQT A;  1UUE A;  1LQL A;  2DBK A;  1M27 C;  2GGR A;  2W0Z A;  4K11 A;  2CT4 A;  3VS1 A;  2DNU A;  4JJB A;  2OJ2 A;  2VUM I;  4AG2 C;  1HSQ A;  1WFW A;  1E6H A;  2VVK A;  3H41 A;  4NB8 A;  4LNP A;  4J9C A;  4RTT A;  4M4Z A;  3EER A;  5I11 A;  4WCI A;  3UF4 A;  2CRE A;  2CSQ A;  1GFC A;  4RTY A;  1UHF A;  1NYF A;  2M0Y A;  2JM9 A;  3IQL A;  1VA7 A;  1OOT A;  2BTT A;  1QCF A;  1R9T I;  4BY1 I;  3H0G I;  1WYX A;  2FPD A;  1H8K A;  1U3O A;  2DL4 A;  2D0N A;  4RTU A;  3I4M I;  1WX6 A;  2RMO A;  1EFN A;  2DE0 X;  2H8H A;  2GBQ A;  3EG3 A;  1USP A;  2O2O A;  3Q87 A;  1TUD A;  1UEC A;  1UE9 A;  4Z89 A;  2ECZ A;  1CKB A;  1Z9Z A;  2RF0 A;  2RN8 A;  2CUD A;  1FYN A;  2CSI A;  1T3L A;  3GTM I;  3ESW A;  4NOZ A;  1H92 A;  2J6O A;  4KRT A;  1KIK A;  4FSS A;  4MH4 A;  2K3B A;  4OMO A;  3U50 C;  1AEY A;  4XX2 A;  3EHQ A;  2KT8 A;  3GKQ A;  4F16 A;  2QDL A;  4J9E A;  4Z88 A;  5FLM I;  2EPD A;  3M0Q A;  1I0C A;  3NGP A;  1NLP C;  5C4X I;  1QWE A;  1IO6 A;  2J6F A;  2CUB A;  1TWH I;  1X3W A;  1WXU A;  4J9B A;  2DLP A;  2A36 A;  2DL3 A;  2IIM A;  2KRN A;  1FMK A;  1PNJ A;  2FO0 A;  2LJ1 A;  5I22 A;  2RQT A;  4E6R A;  3EGU A;  3FKI I;  1U5S A;  1QYP A;  1KSW A;  1NEB A;  3I5S A;  1YUA A;  3S1R I;  2RQW A;  1WA7 A;  3GTL I;  2K7A A;  1YWO A;  3VRY A;  3PVQ A;  1MUZ A;  2ESW A;  1SRL A;  2YUQ A;  1TWC I;  4AFZ C;  2JA8 I;  2HCK A;  1ZX6 A;  1RO4 A;  5IHK A;  1MV3 A;  2HDA A;  4A3G I;  2JMA A;  2YU9 I;  3RNJ A;  1CSK A;  3S17 I;  1HJD A;  1CKA A;  1ML8 A;  1Y1V I;  2JA7 I;  2DF6 A;  3PO3 I;  3D6W A;  2LQW A;  4J9G A;  2NVT I;  1AZG B;  4CC2 A;  1RUW A;  4OMQ A;  4HVU A;  1AOJ A;  4A3B I;  2YDL A;  1PHT A;  1Z9Q A;  2JS0 A;  3SEM A;  5FWB A;  3UAT A;  1ZB9 A;  1NM7 A;  2V1Q A;  3I07 A;  2AK5 A;  2PK7 A;  5FW9 A;  3VS5 A;  5IP9 I;  2J6A A;  3S15 I;  2FRW A;  4NB9 A;  2JT4 A;  1K9A A;  1M30 A;  3A98 A;  1AWW A;  2CT3 A;  2KNB B;  4JZ3 A;  1AVZ C;  5CM2 M;  2EQI A;  2J06 A;  2SRC A;  1VLA A;  1YCS B;  2C0T A;  3KFV A;  1NUI A;  2KBT A;  4AFU C;  1S1N A;  3VMG A;  2HEQ A;  2KYB A;  1WI7 A;  1YWP A;  1RLY A;  4GLM A;  4BY7 I;  2AKL A;  2RPN A;  2L0A A;  1Y57 A;  1V1C A;  2PTK A;  3VS3 A;  2J7I A;  1X27 A;  2KPI A;  2D8H A;  4ESR A;  2L3S A;  2P3Y A;  4NBH A;  2KRM A;  3R6N A;  5GJW B;  1G83 A;  2YUN A;  4RTX A;  1Y1V S;  2YT6 A;  1RLQ C;  2CH4 W;  2MIO A;  4JJC A;  4HXJ A;  4ZNX A;  1GBR A;  3S1M I;  3S2H I;  5IHI A;  3HOX I;  2RNA A;  1ABQ A;  1AZE A;  2NVQ I;  3I35 A;  5IP7 I;  2EBP A;  3LUS A;  3HOW I;  2HBW A;  2LZ6 B;  4NBB A;  4CC3 A;  1SRM A;  3THK A;  1UFF A;  2JTE A;  3M4O I;  2BZX A;  1L1O C;  2NWM A;  4LUD A;  1Y1W I;  4HVV A;  3UA6 A;  2PNI A;  3M3Y I;  1GCQ A;  4AG1 C;  2F4M A;  4A3D I;  3S16 I;  1YP5 A;  4J9D A;  1T0H A;  1NG2 A;  2MOX A;  1B3Q A;  4RTV A;  3GTP I;  2DYB A;  1M3C A;  2R93 I;  1PWT A;  2KYM A;  5C4J I;  1BU1 A;  4QTT A;  1UDL A;  2CH4 A;  2A28 A;  2F2X A;  2YUO A;  1DL6 A;  1I50 I;  4A93 I;  4HVW A;  2DBM A;  1UJ0 A;  5IH2 A;  1W1F A;  1M3B A;  2B86 A;  2LJ3 A;  2LCS A;  2DL8 A;  3S1N I;  2K5R A;  3HOY I;  1OPK A;  3H0I A;  2NUZ A;  2GTJ A;  3I9Q A;  3GTK I;  1PRM C;  1ZUK A;  3TSZ A;  3I4N I;  2BZY A;  4RTW A;  1JXM A;  4BBS I;  3SHW A;  2LNH B;  4NBC A;  2CDT A;  4JZ4 A;  3VS2 A;  1TUC A;  2KXD A;  2K79 A;  1K83 I;  4BBR I;  2F2W A;  3CQZ I;  2FPE A;  4X6A I;  1ZUY A;  2GQI A;  2J05 A;  5IXF A;  1T3S A;  2DL5 A;  2B63 I;  2LX7 A;  2DL7 A;  2DA9 A;  2O88 A;  2AZV A;  2DIL A;  1SFO I;  2JR6 A;  2E2J I;  2O9S A;  4EIK A;  1E7O A;  2GTO A;  1ZUU A;  2ENM A;  1BBZ A;  2KGT A;  4A3C I;  3GTM S;  4CC7 A;  4ORZ A;  4NBD A;  2EYY A;  4A3M I;  4Z8A A;  1GL5 A;  1NEG A;  4HCK A;  2ED0 A;  1W70 A;  5GJV B;  1SSH A;  1KJW A;  3C0C A;  4D8K A;  1BB9 A;  2NVX I;  1GCQ C;  3VS6 A;  2AKK A;  2EGC A;  2LMJ A;  4OMN A;  1AWO A;  5FWC A;  2MCN A;  1U06 A;  1X43 A;  3K7A I;  3TVT A;  2EW3 A;  2JA5 I;  3H0F A;  5HCK A;  2SEM A;  1BK2 A;  3S14 I;  2E5K A;  2KEA A;  2ROT A;  1OV3 A;  2FEI A;  1UTI A;  1WLP B;  2RQU A;  3VB9 A;  2EYX A;  4A3E I;  2LJ0 A;  2GNC A;  1PKT A;  3S2D I;  3GTQ I;  2JW4 A;  2FPF A;  3JV3 A;  2JNY A;  1X6G A;  1I07 A;  1OEB A;  2JS2 A;  3ZL7 C;  3QWX X;  3GTO I;  1X2Q A;  1GBQ A;  1X6B A;  1QLY A;  2RBL A;  3FJ5 A;  1JU5 C;  2J6K A;  1GFD A;  3H0H A;  2EYZ A;  1WCM I;  2HSP A;  3VS0 A;  2X3X D;  1QKX A;  2K9G A;  2M51 A;  4NBE A;  3LH5 A;  3VS7 A;  2E2H I;  2AZS A;  4Y7N I;  2LQN A;  3H3V J;  2RQR A;  2DMO A;  1AWX A;  4X1V A;  3M0U A;  1USP B;  4J9H A;  4NBA A;  2JM8 A;  1WDX A;  4Y52 I;  1WW9 A;  3NHN A;  3HOZ I;  2KR3 A;  1SPK A;  4A3J I;  5IHN A;  3VMH A;  1I1J A;  2F2V A;  2D8J A; 
#chains in the Genus database with same CATH topology
 3OYK A;  2ABL A;  2R7Z I;  4BDZ A;  4C92 C;  3VKI A;  2QA4 A;  1UHC A;  3HRS A;  4KUD K;  3VS4 A;  4KGX B;  1UGV A;  4E7K A;  3PMI A;  2YRC A;  3TEE A;  4QQ6 A;  1UB4 A;  3GBQ A;  3G4S 1;  4EMK A;  4JJD A;  2I0N A;  1OYX A;  3VUZ A;  1V76 A;  1VQO A;  5KYN A;  2DAQ A;  4DQ2 A;  3JAM f;  1N2F A;  5LJ3 e;  1Y07 A;  1NJI C;  2JJ9 A;  2M0O A;  2Y4Y A;  1K4U S;  3ZEH A;  5GAN 7;  1B07 A;  1S72 Z;  3CC7 1;  2HU9 A;  2K57 A;  1TWG I;  4XTV A;  3VMI A;  3SWN B;  2DE6 A;  3X28 B;  3DB3 A;  2JXB A;  1AWJ A;  3QYH B;  1TG0 A;  2E10 A;  2JS4 A;  2LFU A;  2DRM A;  2LC4 A;  4DA4 A;  1TWA I;  4DEY A;  1RAI B;  4OF1 A;  2E7Z A;  3DLL A;  1YIJ T;  1FMV A;  4F04 B;  2R5M A;  1JXO A;  1C0M A;  3OW2 Z;  2FHD A;  4HGZ A;  5C3E I;  1PFT A;  4MD8 A;  1M3A A;  2NUT A;  4CC4 B;  3G6E Z;  4E2Z A;  3QJY A;  2L2P A;  2PM9 A;  4FU6 A;  4LDV A;  3GNF B;  1VQL Z;  3RMS A;  3VTN A;  2MWP A;  5KE2 A;  1Y96 A;  3REB B;  1N8R C;  2K3R A;  1YJW Q;  1QWF A;  1K1Z A;  4F7U B;  1GCP A;  1VQM Z;  1VQ8 Q;  2O9V A;  2RH2 A;  1M1G A;  2NVY I;  4FW1 A;  3I5R A;  3HHT B;  3CCM 1;  4JLG A;  3CCJ T;  2G6F X;  1KFZ A;  1EZZ B;  4X9C A;  4R0K A;  1X69 A;  5GAO p;  1WHM A;  4DEX A;  1S72 1;  1VYU A;  1VQN Z;  2I2L A;  2ZPI B;  5LJ5 h;  3C4S A;  5IXB A;  2F5T X;  5A0G A;  3J80 b;  1TSF A;  3GTJ I;  1NJI 2;  3OA6 A;  1K73 C;  3M0P A;  4E33 A;  4OML A;  4PJJ A;  3QBY A;  2VKN A;  1ZLM A;  2CP0 A;  1T0J A;  4LE9 A;  1VQM A;  3P8H A;  3TCJ A;  5L23 A;  1XOV A;  3CD6 Q;  4NFR A;  2JA6 I;  2KE9 A;  4DBH A;  1B7T A;  1JRI A;  3NPF A;  3PE0 A;  1V29 B;  2RJE A;  1LJO A;  4C8Q C;  2DXT A;  3SWN C;  1PSE A;  2W0Z A;  4K11 A;  1N9S A;  2NUT B;  4M75 C;  3CCU Z;  2E3H A;  4JRP A;  1KD1 U;  5FU6 B;  4M7D B;  3QZ9 B;  2GTI A;  2VVK A;  5GMK e;  1KD1 R;  2X35 A;  1NPP A;  5I11 A;  2VPX A;  2CRE A;  2O4X B;  2RO0 A;  5GAO n;  4BAC A;  2HMA A;  4ZN1 A;  3J80 f;  4Q5W A;  2OTJ T;  3HRT A;  1N9R A;  5T64 A;  2RD1 A;  5GAM j;  1QW1 A;  3H0G I;  2MAM A;  3UPU A;  1QF8 A;  1H8K A;  2DL4 A;  3D2L A;  2D0N A;  4M7D E;  5GAO l;  2GBQ A;  3I56 Q;  1IB8 A;  4QVC A;  1UE9 A;  2EJ9 A;  2OX7 A;  2W04 A;  2LT4 A;  1Z9Z A;  2RF0 A;  4FM4 B;  2E6N A;  3CCS T;  2RN8 A;  4B6M A;  2CSI A;  4NOZ A;  1KQS P;  4FSS A;  4S1T A;  2PVG B;  3GP8 A;  1RAH B;  1AEY A;  1K9M U;  4XX2 A;  1VQL T;  2KT8 A;  1NLP C;  4NH1 C;  3CD6 Z;  1YJW Z;  1RO0 A;  1X75 C;  1X3W A;  2CUB A;  1M9S A;  3VJP A;  4WTO B;  3I56 A;  1FMK A;  1KRL A;  3LW5 E;  5D1O B;  5D6W A;  1VQK Z;  2Q4Z A;  3OYM A;  5CAI A;  4RG2 A;  1BI1 A;  1WA7 A;  5HY6 A;  1MNE A;  2R57 A;  3CCQ Q;  4RV9 A;  1ACM B;  2JA8 I;  2XK0 A;  1BIB A;  2R58 A;  5D6Y A;  1MV3 A;  3A8M B;  1QVG A;  2YU9 I;  3AHU A;  4EMK B;  3CEY A;  1CKA A;  1Y1V I;  2O01 E;  3CCL Z;  2KI7 B;  4C92 A;  3HKZ A;  1YHQ 1;  4CC2 A;  4E7L A;  2K5F A;  2P28 A;  4OMQ A;  4HVU A;  3WXM B;  4A3B I;  1PHT A;  3UAT A;  3SEM A;  3LWI A;  5DLO A;  1NM7 A;  2RK2 A;  3I07 A;  2AK5 A;  3VS5 A;  5FRN A;  2A0F B;  3OYC A;  4A53 A;  3GOX A;  4NB9 A;  4IUU A;  2JT4 A;  2QQB A;  2K5I A;  3A98 A;  3L42 A;  1AWW A;  4JZ3 A;  1KQ1 A;  2MMP A;  2J06 A;  2SRC A;  3JCM c;  3M56 A;  2C0T A;  1N8R 1;  1NUI A;  3CBP A;  1S1N A;  2KYB A;  2ZPE B;  1YIT T;  2AKL A;  2AT1 B;  2RPN A;  3QZ5 B;  4NOY A;  2PVD B;  1OZ2 A;  5L8R E;  3SDZ A;  1QVF A;  2D8H A;  2KPI A;  2DJZ A;  2VYT A;  2ZGW A;  3R6N A;  5GJW B;  1G83 A;  3PNW C;  4PNO A;  3CPW A;  5CKH A;  2E6Z A;  2HD0 A;  4A4G A;  2M48 A;  3S1M I;  1VQ9 1;  4J6Y A;  2DTO A;  4M7D C;  4FCY A;  4A4E A;  2RPR A;  1K8A 1;  4PJO D;  3DKM A;  1AZE A;  2PVO B;  3I35 A;  3HOW I;  3CCU A;  4J8O A;  1U8R A;  4CC3 A;  2CKK A;  1SRM A;  4LD6 A;  3LYI A;  1XNI A;  5GAM d;  3THK A;  1MND A;  1UFF A;  3CXC P;  2CP6 A;  3JB9 I;  2W03 A;  3C12 A;  3CCQ T;  4HVV A;  1Q82 U;  4JS5 A;  4C8Q F;  3BG1 B;  3M3Y I;  1GCQ A;  3CMA 1;  4IUT A;  4PL6 A;  3OYH A;  2JMO A;  5KYX A;  2EQU A;  2MOX A;  3GTP I;  1YFN A;  2DYB A;  4BY6 B;  1M3C A;  2HQE A;  2R93 I;  1YJ9 T;  4BE2 A;  2A28 A;  3QXE B;  4A93 I;  5C6S A;  4HVW A;  2DBM A;  1JJ2 S;  2EQK A;  1W1F A;  3MP6 A;  4Y91 A;  4XQ3 A;  3NFC A;  1QVP A;  5IT9 E;  3HOY I;  1QVF S;  2NUZ A;  3LWH A;  3I9Q A;  1VQ9 Q;  3L2Z A;  2DEU A;  4F7U G;  5AN9 F;  1B34 A;  3FJP A;  3CXC A;  3I4N I;  2BZY A;  5D6X A;  1JXM A;  3SHW A;  3VS2 A;  2CZ1 B;  4FT4 A;  1D1A A;  5CQX A;  3A8L B;  3GLX A;  2XU8 A;  2L3R A;  4C92 G;  1WQ7 A;  2FPE A;  2QEX Z;  4C0F A;  2DL5 A;  2B63 I;  2LX7 A;  5GMK h;  2DL7 A;  2OTL Q;  4EDU A;  3T4N B;  2DXB A;  2O9S A;  4J7F A;  3CD6 A;  2GTO A;  3I56 1;  1BBZ A;  5KCO A;  4A3C I;  3GTM S;  1LOJ A;  2K4Y A;  3BFM A;  4ORZ A;  4A3M I;  4HCZ A;  1GL5 A;  2ED0 A;  1N27 A;  3JCM g;  1OX8 A;  3F3F C;  1SSH A;  2E4H A;  1BB9 A;  5GAN e;  4MZM A;  1FMW A;  1YJ9 1;  1VQ7 A;  3TVT A;  4RVH A;  2CS7 A;  1N8R 2;  5HCK A;  1VQ9 T;  3S14 I;  1WHG A;  2E5K A;  3NDJ A;  2ROT A;  2FEI A;  1WLP B;  3G7Z A;  4E2X A;  2EYX A;  4ELZ C;  1K73 2;  1I5L A;  4PFZ A;  4TVR A;  1VQP A;  3JV3 A;  3LX7 A;  1Q82 1;  3JCM f;  1X6G A;  3QDF A;  3QWX X;  3GTO I;  2F69 A;  1X2Q A;  3G4S Q;  3CCQ 1;  4IUR A;  2RBL A;  3SB2 A;  3FJ5 A;  1JWH C;  1WHH A;  2DFU A;  2J6K A;  2JVV A;  4DK1 A;  1JBM A;  1D1B A;  1SG5 A;  1KQS A;  2HSP A;  5GAO r;  3NFZ A;  1D3B B;  2HAX A;  3I55 Z;  2DKG A;  2HSE B;  3KBG A;  1QKX A;  1FDO A;  2M51 A;  3LH5 A;  2XD0 A;  2E2H I;  4Y7N I;  3CCE 1;  1AWX A;  3M0U A;  3CD6 T;  4J9H A;  4M78 F;  1WDX A;  3CCQ Z;  1WW9 A;  1NBE B;  5KH6 A;  3JB9 J;  1SPK A;  1DJ7 B;  3G71 Q;  3MZL B;  5IHN A;  3S3N A;  4ATO A;  1F1B B;  2GNC A;  1AT1 B;  2LQ8 A;  2A08 A;  5CKE A;  1YIJ Z;  4OMP A;  3G71 A;  2RK1 A;  4M78 E;  2YXY A;  2EGA A;  4R55 A;  2JMC A;  2KRS A;  1K0X A;  3ULR B;  4F7U A;  2OTL Z;  2ED1 A;  5GAM h;  2P84 A;  4XTX A;  2QDY B;  3CCU 1;  3FC3 A;  5GAN g;  1QVG Z;  3EFR A;  4C0D C;  1Y8C A;  1MMN A;  1G2B A;  1ZH1 A;  4O5V A;  2DRK A;  4FL6 A;  3CCJ 1;  1BCM A;  1HD3 A;  2QAZ A;  1H3H A;  4E47 A;  2QGF B;  1ARK A;  1I3Q I;  5A2Q f;  2ZZD A;  2C0O A;  1LCK A;  4FYV B;  3CC2 Q;  2DK3 A;  3CCL 1;  2W10 A;  4F7U E;  3EFO B;  2V45 A;  2F4O A;  3BW1 A;  3NDI A;  3CC2 A;  3OW2 A;  3CC4 T;  1MV0 B;  5CR2 A;  1JQQ A;  3M59 A;  2K6D A;  3G1J A;  3RER A;  3GCF A;  3CCV 1;  2M02 A;  5CCA A;  4NL3 A;  4LDX A;  4Z89 A;  3UDC A;  3QWY A;  1K8A R;  2FZC B;  4M7A E;  3RBB B;  1NYG A;  1VQK 1;  2GF7 A;  3U23 A;  1A0N B;  2QLV B;  2L5Q A;  5J39 A;  2OOY B;  3ZFJ A;  2XMF A;  1N5Z A;  1K73 1;  3GTG I;  4BXX I;  3MEW A;  1OI1 A;  1X6O A;  1VQ6 Q;  1WIE A;  3PO2 I;  5EG2 A;  2E3I A;  4EPC A;  2DE5 A;  1Q7Y U;  4Y92 A;  4M7A F;  4JS4 A;  2HQH A;  2VXF A;  3OMC A;  2BIV A;  2FG0 A;  4A4H A;  4E30 A;  1OX9 A;  2DVE A;  2X4W A;  1B34 B;  4M77 D;  3CCE T;  1J3T A;  1SIW A;  5T67 A;  1E6G A;  5J26 A;  1X0T A;  1YI2 Z;  5ECA A;  4ME7 A;  2PZ1 A;  1WXB A;  5LJ5 e;  1VQ6 T;  1GRI A;  4OMF B;  3EHR A;  2OZK A;  1G5V A;  2RA2 A;  2L3Q A;  5LJ5 j;  1YCY A;  4DGL A;  1NLO C;  1IGU A;  3CME A;  1K76 A;  1TXQ A;  1ZA2 B;  3D9X A;  2X9H A;  1NP6 A;  1WHK A;  3TDH B;  5KYW B;  2C06 A;  1JJ2 A;  4A3L I;  2VGN A;  3MET A;  3OYA A;  4C92 B;  3KXT A;  1WQW A;  1KC8 C;  4LN2 A;  4OMM A;  1QCO A;  4M78 A;  1UUE A;  2G2K A;  5LJ3 d;  4M77 B;  3C94 A;  1IHV A;  1MHN A;  1VQP Z;  1RAF B;  1ZSZ B;  2NLU A;  2XDD A;  5IN1 A;  1M90 2;  2CT4 A;  5GAM e;  2EJG A;  2RI5 A;  3CME Q;  1YUK A;  4OGE A;  2QQR A;  2VUM I;  1WFW A;  4E7J A;  3X25 B;  1XTD A;  3L2W A;  4NB8 A;  4LNP A;  4RTT A;  4XTW A;  1W2B P;  2NUP B;  3VV0 A;  4B9W A;  3JB9 G;  5GMK j;  3CCE A;  3QJ6 A;  1NYF A;  3VYG A;  1WGS A;  2M0Y A;  5GAN 5;  1I4K 1;  1VA7 A;  2ZAE A;  1YIT A;  1QCF A;  4C8Q E;  1R9T I;  4M7A C;  3MCA B;  1VQK T;  4RTU A;  3I4M I;  2LIY A;  4E2F B;  1VQ7 T;  4RMO A;  1AA6 A;  1X01 A;  4M75 A;  4QKU A;  1YHQ Z;  2QI2 A;  4L59 A;  2QTX A;  2ECZ A;  1RQF A;  3UWN A;  6AT1 B;  2IV2 X;  2K2V A;  1T3L A;  3GTM I;  3JB9 F;  2VPW A;  3FLG A;  4MH4 A;  4OMO A;  1Q7Y 2;  3GKQ A;  4D6W A;  1I0C A;  5C4X I;  3CXC Y;  1M1K 2;  4BD3 A;  1VQ6 Z;  1H64 1;  1UEB A;  1IO6 A;  4M78 B;  1WXU A;  4IUV A;  3EH1 A;  2DL3 A;  2KRN A;  1PNJ A;  2FO0 A;  2RI2 A;  3EGU A;  1QYP A;  1TH7 A;  3C95 A;  3I56 Z;  2M1H A;  3SWN A;  4HCB A;  4M7D D;  5GAN d;  1VIE A;  3AT1 B;  1ZSZ C;  3S3O A;  1MMA A;  3GTL I;  2QA4 T;  3OYN A;  2L89 A;  3PVQ A;  1MUZ A;  1TWC I;  3RR6 A;  1VQ5 T;  1Y71 A;  1MMD A;  4XTZ A;  4LDY A;  2LCC A;  1I5O B;  2JMA A;  4E32 A;  3RNJ A;  4C92 D;  1M2V A;  2DYI A;  4XTY A;  5CKB A;  2DF6 A;  2H3E B;  4J9G A;  4M7A D;  4II1 A;  1Q86 U;  3CCS 1;  2EFI A;  2P0K A;  4KUI A;  2JS0 A;  2XDP A;  3RUX A;  1Q7Y R;  1ZB9 A;  2V1Q A;  2JUB A;  3OYG A;  5FW9 A;  2J6A A;  3JCM P;  3FB9 A;  2QGG A;  4OVA A;  2YAD A;  4EWC A;  2JNG A;  5KCH A;  1YI2 A;  1M30 A;  4IUQ A;  2HKN A;  5GAM f;  1AVZ C;  5CM2 M;  1YCS B;  5LJ5 d;  3EGD B;  3KFV A;  3FQM A;  1BI2 A;  2KBT A;  4DBF A;  5LJ3 j;  4E7H A;  3PT9 A;  1VQ6 1;  1ZHI A;  4GLM A;  3TRE A;  3OW2 S;  2L0A A;  3Q1J A;  2E64 A;  1Y57 A;  3FIF A;  2PTK A;  3VS3 A;  4QVZ A;  3JCM e;  4O6J A;  2PMZ A;  1JJ2 Z;  3FDR A;  1VQN T;  4DOW A;  3NH5 A;  5D7U A;  4HXJ A;  4VUB A;  4C92 F;  2VXE A;  3CCR T;  1GBR A;  1QVF Z;  1M90 R;  3S2H I;  3TU4 K;  5IHI A;  1R0C B;  1VQ4 1;  3I55 Q;  2AHJ B;  5I2M A;  3LUS A;  1P92 A;  1TOV A;  2BKD N;  2HBW A;  1IHW A;  2LZ6 B;  3P5J B;  1HXD A;  2X4Y A;  4DBR A;  1YHQ T;  4UC4 A;  4B9X A;  3CPW S;  3M4O I;  1VQ8 Z;  2BZX A;  3X26 B;  4C0Z A;  4LUD A;  3EED A;  3M53 A;  3UA6 A;  2YRD A;  5FLX E;  4BI4 A;  2PNI A;  1Q7Y C;  1WHL A;  4E7Z A;  1YP5 A;  4BB7 A;  3M9Q A;  3CCE Z;  1WJS A;  4X9D A;  4CRI A;  1M1K U;  1NJI 1;  3M58 A;  2F2X A;  2YUO A;  1KHI A;  3QSU A;  1DL6 A;  1BI0 A;  2OOX B;  3G71 T;  3F3P C;  1UJ0 A;  4F7U F;  5IH2 A;  4HKE A;  1R8O B;  3JCM W;  4OP0 A;  4MD9 A;  1VQN 1;  3GTK I;  1VQ9 A;  1ZUK A;  3TSZ A;  3ZBD A;  2OTJ Q;  5FLX b;  1K73 R;  1I81 A;  1W2B S;  2Q51 A;  3EGX A;  3JRZ A;  4JZ4 A;  4FYY B;  3BDL A;  1KD1 1;  2KXD A;  2GFA A;  4N4H A;  3VYH B;  1K83 I;  4C8Q D;  4X6A I;  3QHS A;  1ZUY A;  3CMA Q;  3ME9 A;  1OQK A;  2FZK B;  2GQI A;  3V7S A;  2DA9 A;  2O88 A;  1FWZ A;  1PCX A;  1AHJ B;  3EFO A;  4EIK A;  4PJO A;  3HL8 A;  2KGT A;  5CVI A;  4M78 D;  1D0Y A;  1QCN A;  2FL7 A;  1VQ8 1;  2LNV A;  1WJQ A;  1D0Z A;  3CCV Z;  5GAN f;  3OS1 A;  3C0C A;  5LJ5 f;  2VF1 A;  1TUG B;  3CC4 1;  1KC8 U;  4FW2 A;  3JCM h;  1AWO A;  1U06 A;  2V8I A;  3GPL A;  1TTH B;  3K7A I;  5KYY B;  1Q16 A;  1BK2 A;  2RI3 A;  5GAN 3;  1VIF A;  3RKY A;  2GFU A;  2JUF A;  4A3E I;  2LJ0 A;  3GTQ I;  4DOV A;  5LL6 f;  3CCU T;  4M7A A;  2XI9 A;  3IR7 A;  2HL5 C;  4M77 G;  1VQ7 Q;  4OB1 B;  1I07 A;  4J6W A;  3ZL7 C;  1X6B A;  4OGC A;  1QVG S;  2QRD B;  1Q81 1;  1JU5 C;  4M75 F;  2OTL T;  3H0H A;  2KAF A;  3T9N A;  1YI2 1;  2LRQ A;  2CP3 A;  2DEQ A;  3CCJ Q;  2X3X D;  1QP3 A;  2LQN A;  2AZS A;  3H3V J;  4X1V A;  2LX9 A;  2RHY A;  4PFO A;  3JCM J;  1G3Y A;  2RM4 A;  3NHN A;  4V2S A;  1Q86 1;  1VQ6 A;  3E1S A;  2CGH A;  1M90 C;  1YJ9 A;  2F2V A;  2D8J A;  2DXC A;  5LJ3 h;  4XU3 A;  1K8A 2;  3HOU I;  2H85 A;  4JJN K;  2D1X A;  4J9F A;  4LXC A;  4N4G A;  4QTU A;  4M78 C;  4HH4 A;  2BUD A;  1K0S A;  4M77 A;  2V26 A;  1YIT Z;  3RDV A;  3BG0 B;  1K9M 1;  1VQ5 Z;  1UG1 A;  1VQO T;  4NBF A;  2ROL A;  2RIQ A;  4EMK C;  1VQP 1;  2AIR B;  2E41 A;  2KQW A;  1GXI E;  3CXC S;  4HCC A;  4A63 B;  1KG1 A;  4RVF A;  3JCM V;  2YUP A;  3JB9 D;  4J83 A;  2DVJ A;  2IZ4 A;  4BY6 C;  2QQA A;  2KDS A;  4A54 A;  3RZD I;  2P4T A;  5AT1 B;  3UA7 A;  1M1K 1;  3QO3 A;  1VQL A;  5KE3 A;  4EMG A;  2A37 A;  2MK5 A;  2EYW A;  4C5I A;  1PSF A;  3VUB A;  2DM1 A;  4HT8 A;  1VQ4 Q;  3EAE A;  3EG0 A;  3S1Q I;  3PO3 S;  1BCO A;  2JZ2 A;  1W6X A;  1VQO Z;  3NTI A;  4PKC C;  4NBG A;  4GLK A;  2V1R A;  2VWF A;  2BZ8 A;  2XID A;  4PJN A;  3CPF A;  1VQM 1;  2EJF A;  2QQS A;  4A3K I;  4N0A A;  4OB0 B;  1Q81 U;  2YSQ A;  2AYD A;  2IG0 A;  3KIF A;  4PJM A;  5GMK l;  2F1L A;  3V8K A;  1PC0 A;  1UGS B;  2L3P A;  3S6W A;  3G4S A;  1UJY A;  1ZB8 A;  1QMC A;  3CCR Z;  2LVM A;  1VQO 1;  1SHG A;  1VYT A;  2LCL A;  2P4R A;  4RTZ A;  4A3I I;  2RT9 A;  4PK4 A;  4F14 A;  5GAO m;  2V3V A;  2XIC A;  1OPL A;  2C0I A;  4PJO B;  3EG9 B;  4M7D G;  2K2M A;  3J81 E;  2QKD A;  3CD6 1;  1QVG P;  3OQ5 A;  4M77 F;  2ZPG B;  1KD1 C;  2BJO A;  4AFS C;  4F17 A;  1TWF I;  3EG2 A;  3LLR A;  3A8G B;  1AD5 A;  2CYZ B;  1Q81 C;  2O53 A;  2D0Q B;  3CC7 Z;  3CCV A;  1BI3 A;  2HKQ B;  4KBM B;  1Q95 G;  3EG1 A;  1JO8 A;  2JIP A;  5EC7 A;  1IRE B;  1VQ7 1;  2RJD A;  4RCC A;  4L5G A;  2E2I I;  2WSC E;  1WZN A;  3J81 b;  1SHF A;  2R6M A;  1D3B A;  1PKS A;  2OI3 A;  3CQT A;  1OU8 A;  4DBQ A;  2BE9 B;  2GGR A;  2DTH A;  2JIM A;  3VS1 A;  4C92 E;  1XJW B;  1K9M 2;  3CCQ A;  2DZC A;  1D09 B;  1HSQ A;  1LVK A;  1E6H A;  4FYW B;  4JDS A;  3CCL T;  3CCM Q;  3FRN A;  3H41 A;  4J9C A;  4LDW A;  1P9N A;  3EER A;  2OTL A;  3JB9 H;  4WCI A;  4DQY B;  3E9F A;  4BUG A;  1GFC A;  2JIQ A;  4RTY A;  1UHF A;  3R6O A;  3JCM Q;  3IQL A;  1TWB A;  2QEX 1;  4ZN3 A;  1PD0 A;  1WJR A;  1Q86 R;  1VQ5 1;  3I55 T;  3EG9 A;  1WYX A;  2VPZ A;  2FPD A;  1U3O A;  2LT1 A;  2RMO A;  2QK0 A;  1W2B Y;  4PLL A;  2O2O A;  3Q87 A;  1M2O A;  1UEC A;  1Y96 B;  2E12 A;  3QPH A;  4RCB A;  3HKS A;  2NUP A;  4N0A C;  5CIU A;  4XK8 E;  3CCR 1;  1TS9 A;  1UGP B;  4Z02 A;  2CUD A;  1FYN A;  1NE8 A;  2Y0S A;  2ZCF B;  3LGL A;  2QXF A;  1KIK A;  4KRT A;  3U50 C;  2M9U A;  3D7S B;  4F16 A;  4J9E A;  2EAY A;  4Z88 A;  5FLM I;  2DO3 A;  3M0Q A;  3LH0 A;  3IX0 A;  3L2U A;  1QVF Y;  1RAA B;  3PIP A;  2J6F A;  1YIJ Q;  2JTM A;  2IIM A;  4BE1 A;  2LJ1 A;  5I22 A;  2JOY A;  4E6R A;  3G6E 1;  4KT0 E;  3M5A A;  1KSW A;  2IPO B;  3OY9 A;  1YJW T;  1YHQ Q;  1YIT 1;  3I5S A;  2E5Q A;  3JCM b;  2E65 A;  2MYS A;  2OTJ 1;  5GAN j;  4MON A;  2K7A A;  1YWO A;  3VRY A;  2ESW A;  1SRL A;  3OYE A;  1VQO Q;  3OB9 A;  1ZX6 A;  1RO4 A;  2RHB A;  2XHC A;  1VQ4 Z;  4PJL A;  5CKF A;  2YHT A;  3RIR A;  3S3M A;  1Z01 A;  1CSK A;  2JA7 I;  3D6W A;  4MZP A;  3V7R A;  3IFU A;  2M6N A;  5C0M A;  3CXC Z;  1S72 Q;  2JIO A;  4NL2 A;  2I3C A;  5FWB A;  2D6F A;  4M78 G;  1PD1 A;  1UGR B;  2EQJ A;  1KQS Z;  2DD5 A;  2PK7 A;  4M75 D;  3S15 I;  1LNX A;  1O75 A;  2QYZ A;  4MML A;  3EGX B;  5HK3 A;  2KNB B;  3GNG A;  2JIR A;  4XAX B;  3G6E Q;  2QEX T;  3OS0 A;  1VLA A;  2IZ3 A;  1YIT Q;  2XG8 D;  3PMT A;  4PJO E;  1YWP A;  1YJW 1;  4BY7 I;  3J80 E;  3QWU A;  5D1P A;  1V1C A;  8ATC B;  4KGZ B;  1NZ9 A;  4RVD A;  4M7A G;  2L3S A;  2P3Y A;  4NBH A;  2QA4 1;  4JRK A;  4C8Q A;  3MEA A;  1BKB A;  2YT6 A;  2MIO A;  1RO2 A;  1K73 U;  3QKJ A;  2RNA A;  2NVQ I;  1YI2 Q;  4XU2 A;  4JLI A;  2EIF A;  4AT1 B;  4NBB A;  3WVD B;  2KK4 A;  3EGD A;  4ZTF A;  2JTE A;  1L1O C;  2NWM A;  1QVG Y;  2OAU A;  1Y1W I;  4YTL A;  1M1K C;  1BYM A;  3ASK A;  4M7A B;  4KUL A;  1RNI A;  2Y4X A;  3CC4 Z;  2FZG B;  2OTL 1;  3PIO A;  4AG1 C;  2F4M A;  4J9D A;  3S16 I;  2GQV A;  1B3Q A;  4RTV A;  1NJI U;  3P8D A;  4R56 A;  3OS2 A;  2CH4 A;  4QTT A;  1UDL A;  3P8B B;  3CC2 T;  1I50 I;  3A8O B;  3PTA A;  3MHX A;  4MMK A;  2B86 A;  2WSE E;  3CC4 Q;  2DET A;  2K5R A;  3H0I A;  2DPP B;  4FT2 A;  1KC8 2;  2GTJ A;  5A2Q b;  5A0L A;  4M77 C;  1PRM C;  4CL1 A;  3OYD A;  4BBS I;  4L6V 5;  3GF5 A;  1YJN Q;  4NBC A;  2CDT A;  2M16 A;  1TUC A;  2LQK A;  1VQ7 Z;  1VQ4 T;  3F70 A;  5M9O A;  1QQJ A;  3BY7 A;  1G3T A;  1KD1 2;  2DIL A;  3NTK A;  4ZGD B;  1SFO I;  2JR6 A;  4AMC A;  1JJ2 Y;  1E7O A;  2K5L A;  1WPY A;  4E31 A;  1RAE B;  8AT1 B;  4NBD A;  5A2Q E;  2EYY A;  3INZ A;  3OBY A;  2QR1 B;  1YJN A;  4HCK A;  3TQ7 P;  1W70 A;  1FDI A;  5GJV B;  2MI6 A;  3JCM d;  2DXU A;  3HRU A;  3CCV Q;  1KJW A;  5LJ3 f;  2NVX I;  1HYO A;  1GCQ C;  2WAQ A;  3VS6 A;  4E2W A;  2EGC A;  4M77 E;  2MCN A;  1X43 A;  5IT9 b;  1K8A U;  3H0F A;  2YRV A;  3A8H B;  3JAM b;  1VQP T;  1OV3 A;  1VQN A;  2RQU A;  3LGF A;  3VB9 A;  3CCE Q;  5LJ5 g;  4C8Q G;  1PKT A;  3S2D I;  2F5K A;  5FU7 C;  3M57 A;  2FPF A;  3L2R A;  2JNY A;  4M7D A;  3OW2 Y;  3L2Q A;  1OEB A;  2GCX A;  1KHC A;  5FRO A;  3CPW P;  3EFS A;  3CCS A;  1BIA A;  2KY9 A;  4QW2 A;  1OUL A;  2QAS A;  3OBW A;  2KMT A;  1QVF P;  1Q7Y 1;  1ZSZ A;  2OTJ Z;  1QP2 A;  4RG8 A;  2WSF E;  1WCM I;  1IRX A;  2H3J A;  4OB3 B;  3VS0 A;  2E70 A;  3EH2 A;  5GAN 8;  2YLB A;  2VB6 A;  2DMO A;  3HFO A;  4RVG A;  1USP B;  3QII A;  4NBA A;  1WII A;  1WNL A;  1G3W A;  2JM8 A;  3RKX A;  1VQ8 A;  2K3X A;  4CI0 C;  4FSX A;  1YJW A;  3DB4 A;  5A0D A;  1YJN T;  3VMH A;  1ZBX A;  1I1J A;  2LP5 A;  2DE7 A;  3CCS Z;  5J3B A;  1N8R U;  1VYV A;  4JPB W;  5D1O A;  1FXX A;  2RQV A;  3PVL A;  2VC8 A;  1X2K A;  2LTO A;  3M4Y A;  4QT7 A;  1SEM A;  2HL3 A;  1YBY A;  2COW A;  5GAM g;  2X3W D;  4D8D A;  2KT1 A;  5LL6 S;  1W2B A;  4TNU A;  1PRL C;  4A4K A;  2Z0W A;  2DER A;  1Y0M A;  3NH4 A;  2GU2 A;  1LPL A;  5DY9 A;  2O31 A;  1H3Z A;  1TFI A;  1YN8 A;  3M0S A;  2QEX Q;  1R0B G;  4BI3 A;  5KYX B;  3OYI A;  4BDY A;  3HP9 A;  2BE7 D;  3CCM A;  2DX1 A;  3MP1 A;  1IXD A;  3HTR A;  2V8J A;  4LUE A;  3OSS C;  1YJN Z;  3NMZ C;  4PJO C;  1WXT A;  5KYU B;  4C0G A;  2E9H A;  1S72 A;  1FX7 A;  3M0R A;  1YNZ A;  1VQ9 Z;  3MKD A;  4PLI A;  4RS4 A;  1I6H I;  4RKU E;  1HK9 A;  3PGG A;  1JEG A;  2ZAE B;  1RLP C;  1RI9 A;  2FB7 A;  5IAY A;  1Z03 A;  1VUB A;  1N8R R;  2EKH A;  4GBQ A;  3QG1 A;  4P5N A;  2RHI A;  3E19 A;  2KXC A;  3CCM Z;  3BE3 A;  2V8K A;  2OAW A;  3HOV I;  1OZ3 A;  2QA4 Q;  2ATC B;  1PM3 A;  4IIO A;  4AFQ C;  1YHQ A;  4M75 B;  3M0T A;  2R92 I;  2EVR A;  1M8M A;  1UGQ B;  1M90 1;  4C8Q B;  3VRZ A;  3O5Z A;  3CPW Z;  2K3Y A;  3RMQ A;  3RZO I;  3IF8 A;  4A3F I;  1YI2 T;  5C44 I;  4QQG A;  2KRO A;  2RB6 A;  1ABO A;  2QRE B;  4C5G A;  1SF9 A;  4IIM A;  1VQL 1;  2A7Y A;  4RUG A;  4J9I A;  1ZBJ A;  9ATC B;  1NJI R;  1ZSG A;  3CCL A;  2YLC A;  1G8X A;  1M4Z A;  3J81 f;  2D9T A;  1QKW A;  3REA B;  2PUK B;  1YJN 1;  3A5Z B;  3TSW A;  2DJQ A;  2ZPB B;  4MD7 A;  1KQ2 A;  3CC4 A;  2XKO C;  2EGE A;  2FRY A;  1S7M A;  1X3Z A;  2HBP A;  3KIH A;  2EQM A;  4EMH A;  4PJO F;  3G4S T;  1KC8 R;  2RJF A;  2WB1 A;  2MWO A;  1W2B Z;  2HF1 A;  2JN0 A;  2RJC A;  3JAM E;  1LQL A;  2DBK A;  1M27 C;  4QQD A;  1K8A C;  1W4S A;  2DNU A;  2COY A;  3CCR Q;  3KUF A;  4JJB A;  2OJ2 A;  4LD9 K;  2X4J A;  3CBM A;  4AG2 C;  5AYF A;  3CME Z;  1VQL Q;  1YJ9 Z;  1Y7X A;  1VQP Q;  4M4Z A;  4OB2 B;  2XDB A;  3UF4 A;  1I8F A;  3O8V A;  4M7D F;  3CCL Q;  1N6A A;  2CSQ A;  4M75 E;  2JM9 A;  1YIJ 1;  2EWN A;  1M5Q 1;  4C5E A;  2X51 A;  1OOT A;  2BTT A;  5I21 A;  4MXU A;  2HQX A;  1TU0 B;  4BY1 I;  5DLQ E;  3OYB A;  3CME 1;  3MPU B;  5GAO q;  3VU3 C;  4E2Y A;  1WX6 A;  3MEV A;  1EFN A;  2DE0 X;  2H8H A;  3EG3 A;  3J7A F;  1USP A;  2HZY A;  2P0P A;  5CO7 A;  5GAN 2;  1RAB B;  2CZ0 B;  1RAC B;  3OYJ A;  2VPY A;  4MZT A;  2PQW A;  1TUD A;  1YJ9 Q;  1VQK Q;  3OYY A;  3OSV A;  1K9M R;  1CKB A;  2COZ A;  1Q82 2;  2G3R A;  3V8J A;  3ESW A;  3A1P A;  5CQY A;  1H92 A;  2J6O A;  2K3B A;  3MZK B;  1MMG A;  3EHQ A;  3CCM T;  2QDL A;  4XTU A;  1RL2 A;  1U1T A;  2EPD A;  3NGP A;  1QWE A;  4PFP A;  1TWH I;  4J9B A;  2DLP A;  2A36 A;  2FYK A;  3OW2 P;  2RQT A;  3OS5 A;  1Q81 R;  3FKI I;  2QA4 Z;  1U5S A;  1NEB A;  1EIF A;  2E1H A;  2O4X A;  4KH0 B;  4XU0 A;  4FIB A;  7AT1 B;  1YUA A;  4AYB A;  3J7A 4;  3S1R I;  2QEX A;  2RQW A;  1VQ5 A;  3QYG B;  1Q86 2;  3MP8 A;  1D0X A;  2CP7 A;  1ZQ1 A;  2ZPH B;  3E9G A;  2YUQ A;  2DD4 A;  3ER0 A;  2QG9 B;  4AFZ C;  2VAS A;  2HCK A;  2KVQ G;  4KGV B;  4A4F A;  5IHK A;  1WZO A;  4JUV A;  2HDA A;  1JJ2 P;  4A3G I;  2LDM A;  3X20 B;  3V8L A;  3OYF A;  3S17 I;  1HJD A;  2RHU A;  4N4I A;  1ML8 A;  2DZ9 A;  3PO3 I;  2LQW A;  3JCM X;  3OMG A;  5T6B A;  4LDU A;  1VQ4 A;  1Q82 R;  2NVT I;  1AZG B;  5GMK m;  1RUW A;  4KH1 B;  2DTI A;  1JB0 E;  1AOJ A;  3CBO A;  5LJ3 g;  3DLM A;  2YDL A;  2X4X A;  1Z9Q A;  2QQ9 A;  3L2V A;  3NH8 A;  3HFN A;  4JRQ A;  4PJO G;  5DM7 R;  2QTV A;  3CCU Q;  3CMA T;  4BI8 B;  5IP9 I;  2FRW A;  1K9A A;  3CMA A;  2CT3 A;  1C6V X;  3X24 B;  4ELY C;  1M90 U;  1Z02 A;  3G6E A;  2EQI A;  3I55 1;  1EX4 A;  3CME T;  4AFU C;  3G6E T;  3VMG A;  4XU1 A;  2HEQ A;  1WI7 A;  1RLY A;  2OTJ A;  2P0Q A;  3CCS Q;  5GAN h;  1ZA1 B;  2J7I A;  2FVU A;  2HNI A;  1X27 A;  4ESR A;  5KYU A;  3CC7 Q;  2KRM A;  3CC2 Z;  2YUN A;  4RTX A;  1Y1V S;  3BDU A;  1RLQ C;  2CH4 W;  2VV5 A;  2EYQ A;  3HPW A;  4HA8 A;  4JJC A;  4HGY A;  4ZNX A;  3SD4 A;  3JSC A;  5KYY A;  1VQN Q;  3HOX I;  4ZGJ B;  1ABQ A;  3CMA Z;  4J6X A;  3WVE B;  3NTH A;  2PUO B;  4M75 G;  4E7I A;  1D1C A;  5IP7 I;  2EBP A;  1KQS Y;  1XQH A;  5CKD A;  2QRC B;  5I2S A;  1KQS S;  3CCJ A;  2RHX A;  3RES A;  3QDR B;  4J5Y A;  1VQM Q;  2R5A A;  3I56 T;  1M1K R;  4JRI A;  2JTF A;  5FRM A;  3CC7 A;  3M4G A;  1SSF A;  2IVW A;  1Q86 C;  1VQ8 T;  3FQQ A;  4A3D I;  1RAG B;  1T0H A;  1NG2 A;  5GAN 6;  4NS5 A;  1RI0 A;  5CK9 A;  3G71 Z;  1YIJ A;  5HK0 A;  4HT9 A;  2NAP A;  1PWT A;  1Q82 C;  2KYM A;  5C4J I;  1BU1 A;  1KC8 1;  5IT9 f;  4C5H A;  1IZ6 A;  1U1S A;  5GMK i;  5FU6 C;  1IGQ A;  2WAC A;  1M3B A;  2LJ3 A;  4GY5 A;  2B8A A;  4MRI A;  3PFS A;  2LCS A;  1M8V A;  2DL8 A;  3S1N I;  1VQK A;  2KSS A;  1OPK A;  2RHZ A;  1KK7 A;  4E7S A;  4X34 A;  4QVD A;  4J7I A;  4RTW A;  4ZTJ A;  3CCR A;  4WF2 A;  2CZ6 B;  2YWW A;  2DIG A;  2CP2 A;  1PG5 B;  3G4S Z;  2LNH B;  2K79 A;  2Y90 A;  4BBR I;  1R77 A;  2F2W A;  3CQZ I;  4ZGE B;  3TE5 B;  4ANJ A;  3QUI A;  3H8Z A;  1Q81 2;  3H9N A;  2J05 A;  2MPX C;  2NYS A;  5IXF A;  1T3S A;  4Y28 E;  2AZV A;  3UT1 A;  2E2J I;  2VUB A;  2O4H A;  1ZUU A;  2ENM A;  5FLX f;  1OU9 A;  1M1F A;  3CC7 T;  3MON A;  4CC7 A;  2VUG A;  1VQ5 Q;  4Z8A A;  3OYL A;  1NEG A;  4IUP A;  5KYW A;  4D8K A;  2ZPF B;  2AKK A;  2LMJ A;  4OMN A;  5FU7 B;  5FWC A;  2EW3 A;  2JA5 I;  3CCV T;  2SEM A;  3E2U A;  1M2V B;  3SFM A;  1WJ2 A;  3G71 1;  3RKW A;  2KEA A;  4IKF A;  1K9M C;  2CZ7 B;  1UTI A;  1VQM T;  3FEO A;  5GAN 4;  3HSB A;  2JW4 A;  4MDW A;  3GIB A;  1O9S A;  4C0D B;  1QXF A;  3CCJ Z;  3H6Z A;  2JS2 A;  4BE0 A;  3MEU A;  3N5B B;  1RAD B;  1G3S A;  3M55 A;  3MO8 A;  1MGQ A;  1GBQ A;  2EGT A;  2A3L A;  2LEX A;  1VOM A;  1QLY A;  2DIQ A;  3MJX A;  4FYX B;  4MDX A;  1GFD A;  2EYZ A;  1SKU B;  2L8D A;  2MF2 A;  3L1A A;  5HKC A;  1NPR A;  2EKO A;  2K9G A;  3V7C A;  4NBE A;  3M54 A;  3VS7 A;  2RQR A;  1C1A A;  2CP5 A;  3I55 A;  3CC2 1;  2VGM A;  3CPW Y;  4Y52 I;  2PU9 B;  1S72 T;  3HOZ I;  2KR3 A;  3URG A;  2GTH A;  4A3J I;  1WHJ A;  2KI7 A; 
#chains in the Genus database with same CATH homology
 2DE7 A;  2ABL A;  3CCS Z;  2R7Z I;  2A08 A;  1K8A 2;  3HOU I;  2H85 A;  2D1X A;  1UHC A;  1VYV A;  4J9F A;  4JPB W;  3VS4 A;  1YIJ Z;  4OMP A;  1UGV A;  5D1O A;  2RQV A;  4QTU A;  3PVL A;  4HH4 A;  1X2K A;  4QT7 A;  1K0S A;  1SEM A;  1YIT Z;  3BG0 B;  1K9M 1;  1VQ5 Z;  1UG1 A;  2EGA A;  4NBF A;  2JMC A;  2KRS A;  2RIQ A;  3G4S 1;  2ROL A;  2X3W D;  3GBQ A;  1VQP 1;  4D8D A;  1K0X A;  3ULR B;  4JJD A;  2I0N A;  2KT1 A;  2OTL Z;  2ED1 A;  4A63 B;  4TNU A;  3CCU 1;  1PRL C;  4RVF A;  1QVG Z;  2YUP A;  3JAM f;  1Y0M A;  3NH4 A;  1N2F A;  1G2B A;  1ZH1 A;  2IZ4 A;  2DVJ A;  2GU2 A;  2DRK A;  2O31 A;  3CCJ 1;  1TFI A;  1HD3 A;  1YN8 A;  3M0S A;  1H3H A;  1K4U S;  3RZD I;  3UA7 A;  1ARK A;  1M1K 1;  1S72 Z;  1I3Q I;  5A2Q f;  1B07 A;  3CC7 1;  2DX1 A;  2HU9 A;  1TWG I;  1LCK A;  2V8J A;  2C0O A;  4LUE A;  2A37 A;  3VMI A;  3CCL 1;  1YJN Z;  2DE6 A;  2EYW A;  3NMZ C;  1WXT A;  2JXB A;  1AWJ A;  2LP5 A;  2E9H A;  2W10 A;  1TG0 A;  2JS4 A;  2F4O A;  3M0R A;  2LFU A;  2DRM A;  2DM1 A;  3NDI A;  1VQ9 Z;  1YNZ A;  1TWA I;  4DEY A;  1MV0 B;  3EG0 A;  3S1Q I;  1JQQ A;  3PO3 S;  4RS4 A;  2K6D A;  3GCF A;  3CCV 1;  1I6H I;  1W6X A;  1JXO A;  1VQO Z;  3OW2 Z;  1JEG A;  2ZAE B;  4NBG A;  4HGZ A;  1RI9 A;  1RLP C;  2V1R A;  5C3E I;  1PFT A;  4MD8 A;  1M3A A;  2BZ8 A;  2VWF A;  3QWY A;  4CC4 B;  3G6E Z;  1VQM 1;  4E2Z A;  1Z03 A;  3RBB B;  2EKH A;  1NYG A;  4A3K I;  1VQK 1;  3U23 A;  4GBQ A;  2L2P A;  2QLV B;  2YSQ A;  2PM9 A;  1A0N B;  3KIF A;  2KXC A;  3CCM Z;  1VQL Z;  2V8K A;  2OOY B;  2OAW A;  3HOV I;  2XMF A;  1N5Z A;  2L3P A;  1K73 1;  3GTG I;  4IIO A;  3VTN A;  1UJY A;  1ZB8 A;  4BXX I;  4AFQ C;  3CCR Z;  3REB B;  2K3R A;  1VQO 1;  1SHG A;  3M0T A;  1VYT A;  1WIE A;  3PO2 I;  1QWF A;  2R92 I;  2DE5 A;  1K1Z A;  1M8M A;  2EVR A;  2P4R A;  4RTZ A;  1M90 1;  4Y92 A;  4A3I I;  3VRZ A;  2RT9 A;  3CPW Z;  1VQM Z;  1GCP A;  3O5Z A;  3RZO I;  4F14 A;  3IF8 A;  2O9V A;  2FG0 A;  4A3F I;  4E30 A;  5C44 I;  2KRO A;  1OPL A;  2NVY I;  2C0I A;  1ABO A;  2QRE B;  3I5R A;  4IIM A;  2K2M A;  3CCM 1;  1VQL 1;  4RUG A;  2QKD A;  4J9I A;  2G6F X;  1J3T A;  1KFZ A;  3CD6 1;  1ZBJ A;  5T67 A;  1E6G A;  1ZSG A;  1X0T A;  1YI2 Z;  1X69 A;  4R0K A;  5ECA A;  4DEX A;  2PZ1 A;  1WXB A;  1S72 1;  1VYU A;  1GRI A;  3J81 f;  2BJO A;  1VQN Z;  2OZK A;  3EHR A;  4AFS C;  1TWF I;  3EG2 A;  4F17 A;  1QKW A;  5IXB A;  3REA B;  1YJN 1;  3J80 b;  1AD5 A;  2L3Q A;  3GTJ I;  1NJI 2;  2O53 A;  2DJQ A;  3TSW A;  3M0P A;  4DGL A;  3CC7 Z;  4MD7 A;  4E33 A;  1NLO C;  4OML A;  1K76 A;  2VKN A;  1ZLM A;  3EG1 A;  1JO8 A;  2EGE A;  5EC7 A;  3D9X A;  1VQ7 1;  2FRY A;  1NP6 A;  1S7M A;  1X3Z A;  1T0J A;  3TDH B;  4LE9 A;  2E2I I;  3KIH A;  5L23 A;  1XOV A;  4A3L I;  4NFR A;  2JA6 I;  3J81 b;  2KE9 A;  1SHF A;  2WB1 A;  2R6M A;  1W2B Z;  2HF1 A;  1PKS A;  2OI3 A;  3NPF A;  3PE0 A;  4LN2 A;  4OMM A;  3CQT A;  1UUE A;  1LQL A;  2G2K A;  2DBK A;  1M27 C;  1VQP Z;  2GGR A;  2W0Z A;  4K11 A;  1M90 2;  2CT4 A;  3VS1 A;  2DNU A;  1YUK A;  1K9M 2;  3CCU Z;  4JJB A;  2OJ2 A;  2VUM I;  4AG2 C;  1HSQ A;  1WFW A;  1E6H A;  3CME Z;  2GTI A;  2VVK A;  3H41 A;  4NB8 A;  1YJ9 Z;  4J9C A;  4LNP A;  4RTT A;  4M4Z A;  1P9N A;  3EER A;  5I11 A;  4WCI A;  3UF4 A;  2CRE A;  4DQY B;  2CSQ A;  1GFC A;  4RTY A;  3J80 f;  1UHF A;  1NYF A;  2M0Y A;  2JM9 A;  3IQL A;  1YIJ 1;  1VA7 A;  1OOT A;  2BTT A;  2QEX 1;  1QCF A;  4MXU A;  1R9T I;  5T64 A;  4BY1 I;  1VQ5 1;  3H0G I;  1WYX A;  1QF8 A;  2FPD A;  3CME 1;  1H8K A;  1U3O A;  2DL4 A;  4E2Y A;  2D0N A;  4RTU A;  3I4M I;  1WX6 A;  2RMO A;  1W2B Y;  1EFN A;  2LIY A;  2DE0 X;  2H8H A;  2GBQ A;  3EG3 A;  1USP A;  2O2O A;  3Q87 A;  1TUD A;  1UEC A;  1YHQ Z;  1UE9 A;  4Z89 A;  2ECZ A;  2W04 A;  1RQF A;  1CKB A;  1Z9Z A;  3CCR 1;  2RF0 A;  1Q82 2;  2RN8 A;  2CUD A;  1FYN A;  2Y0S A;  2CSI A;  1T3L A;  3GTM I;  3ESW A;  4NOZ A;  1H92 A;  2J6O A;  4KRT A;  1KIK A;  4FSS A;  4MH4 A;  4S1T A;  3MZK B;  2K3B A;  3U50 C;  4OMO A;  1AEY A;  4XX2 A;  3EHQ A;  1Q7Y 2;  2KT8 A;  3GKQ A;  4F16 A;  2QDL A;  4J9E A;  4Z88 A;  5FLM I;  2EPD A;  3M0Q A;  1I0C A;  3NGP A;  1NLP C;  3IX0 A;  5C4X I;  3CXC Y;  1M1K 2;  4NH1 C;  1QVF Y;  3CD6 Z;  1QWE A;  1YJW Z;  1VQ6 Z;  1IO6 A;  2J6F A;  1RO0 A;  2CUB A;  1TWH I;  1X3W A;  1WXU A;  4J9B A;  2DLP A;  2A36 A;  2DL3 A;  2IIM A;  2KRN A;  1FMK A;  1PNJ A;  2FO0 A;  2LJ1 A;  5I22 A;  2RQT A;  1KRL A;  4E6R A;  5D1O B;  3G6E 1;  3EGU A;  3FKI I;  2QA4 Z;  1U5S A;  1QYP A;  1KSW A;  1NEB A;  1YIT 1;  3I5S A;  1YUA A;  4AYB A;  1VQK Z;  2Q4Z A;  3I56 Z;  3S1R I;  3J7A 4;  2RQW A;  1WA7 A;  2OTJ 1;  3GTL I;  1Q86 2;  4MON A;  2K7A A;  1YWO A;  3VRY A;  4RV9 A;  3PVQ A;  1MUZ A;  2ESW A;  1SRL A;  2YUQ A;  1TWC I;  4AFZ C;  2JA8 I;  2HCK A;  1ZX6 A;  1RO4 A;  2RHB A;  1MV3 A;  5IHK A;  2HDA A;  4A3G I;  1VQ4 Z;  2JMA A;  2YU9 I;  4E32 A;  3RNJ A;  1Z01 A;  1CSK A;  3S17 I;  1HJD A;  1CKA A;  1ML8 A;  1Y1V I;  2JA7 I;  2DF6 A;  3PO3 I;  3D6W A;  3CCL Z;  2LQW A;  4J9G A;  2KI7 B;  5T6B A;  2NVT I;  1AZG B;  3HKZ A;  1YHQ 1;  4CC2 A;  1RUW A;  3IFU A;  2M6N A;  2P28 A;  3CXC Z;  4OMQ A;  4HVU A;  3CCS 1;  1AOJ A;  4A3B I;  2YDL A;  1PHT A;  1Z9Q A;  2JS0 A;  2I3C A;  5FWB A;  3SEM A;  3UAT A;  1ZB9 A;  1NM7 A;  3NH8 A;  2V1Q A;  3I07 A;  1KQS Z;  2AK5 A;  2JUB A;  2PK7 A;  5FW9 A;  3VS5 A;  5IP9 I;  2J6A A;  3S15 I;  2FRW A;  4NB9 A;  2JT4 A;  2YAD A;  4EWC A;  1K9A A;  1M30 A;  3A98 A;  1AWW A;  2CT3 A;  2KNB B;  4JZ3 A;  1Z02 A;  1AVZ C;  5CM2 M;  2EQI A;  2J06 A;  2SRC A;  1VLA A;  2IZ3 A;  1YCS B;  2C0T A;  3I55 1;  1N8R 1;  3KFV A;  3FQM A;  1NUI A;  2KBT A;  4AFU C;  1S1N A;  3VMG A;  2HEQ A;  2KYB A;  1WI7 A;  1RLY A;  1YWP A;  1YJW 1;  1VQ6 1;  4BY7 I;  4GLM A;  2AKL A;  2RPN A;  2L0A A;  3QWU A;  5D1P A;  1Y57 A;  1V1C A;  2PTK A;  3VS3 A;  2J7I A;  4RVD A;  2PMZ A;  1JJ2 Z;  2KPI A;  1X27 A;  2D8H A;  4ESR A;  2L3S A;  2P3Y A;  4NBH A;  2QA4 1;  2KRM A;  3R6N A;  5GJW B;  3NH5 A;  1G83 A;  3CC2 Z;  2YUN A;  4RTX A;  1Y1V S;  2YT6 A;  1RLQ C;  2CH4 W;  1RO2 A;  2MIO A;  4HXJ A;  4JJC A;  4ZNX A;  1GBR A;  4HGY A;  1QVF Z;  2M48 A;  3S1M I;  3S2H I;  1VQ9 1;  5IHI A;  3HOX I;  2RNA A;  2RPR A;  1ABQ A;  3CMA Z;  1K8A 1;  1AZE A;  2NVQ I;  1VQ4 1;  3I35 A;  5IP7 I;  2EBP A;  3LUS A;  1KQS Y;  3HOW I;  2HBW A;  2LZ6 B;  3P5J B;  4NBB A;  4CC3 A;  1SRM A;  2QRC B;  3THK A;  1UFF A;  2JTE A;  3M4O I;  1VQ8 Z;  2BZX A;  1L1O C;  2NWM A;  2W03 A;  1QVG Y;  4LUD A;  3EED A;  1Y1W I;  4HVV A;  3UA6 A;  1RNI A;  3BG1 B;  2PNI A;  3M3Y I;  1GCQ A;  3CC4 Z;  3CMA 1;  2OTL 1;  2JMO A;  4AG1 C;  2F4M A;  3FQQ A;  4A3D I;  3S16 I;  1YP5 A;  4J9D A;  1T0H A;  1NG2 A;  2MOX A;  1B3Q A;  4RTV A;  3GTP I;  2DYB A;  3CCE Z;  3G71 Z;  1M3C A;  2R93 I;  1PWT A;  2KYM A;  5C4J I;  1BU1 A;  4QTT A;  1UDL A;  2CH4 A;  1NJI 1;  2A28 A;  2F2X A;  2YUO A;  1KC8 1;  5IT9 f;  1DL6 A;  1I50 I;  4A93 I;  4HVW A;  2OOX B;  2DBM A;  3F3P C;  1UJ0 A;  5IH2 A;  1W1F A;  1M3B A;  2B86 A;  2LJ3 A;  4MRI A;  2LCS A;  2DL8 A;  3S1N I;  4MD9 A;  2K5R A;  3HOY I;  1OPK A;  3H0I A;  2NUZ A;  1KC8 2;  2GTJ A;  3I9Q A;  1VQN 1;  5A2Q b;  3GTK I;  1PRM C;  4CL1 A;  1ZUK A;  5AN9 F;  3TSZ A;  3I4N I;  2BZY A;  5FLX b;  1JXM A;  4RTW A;  4BBS I;  2Q51 A;  3SHW A;  3G4S Z;  2LNH B;  4NBC A;  2CDT A;  4JZ4 A;  3VS2 A;  1TUC A;  1KD1 1;  2KXD A;  2K79 A;  1VQ7 Z;  1K83 I;  4BBR I;  2F2W A;  3CQZ I;  3TE5 B;  2FPE A;  2QEX Z;  4X6A I;  1ZUY A;  2GQI A;  1Q81 2;  2J05 A;  5IXF A;  1T3S A;  2DL5 A;  2B63 I;  2LX7 A;  2DL7 A;  2DA9 A;  2O88 A;  2AZV A;  1KD1 2;  2DIL A;  1SFO I;  2JR6 A;  3T4N B;  2E2J I;  2O9S A;  1JJ2 Y;  2O4H A;  4EIK A;  1E7O A;  2GTO A;  3I56 1;  1ZUU A;  2ENM A;  1BBZ A;  5FLX f;  2KGT A;  4A3C I;  3GTM S;  3MON A;  4E31 A;  4CC7 A;  2VUG A;  4ORZ A;  4NBD A;  2EYY A;  4A3M I;  4Z8A A;  1VQ8 1;  2QR1 B;  1NEG A;  4HCK A;  2ED0 A;  1W70 A;  1GL5 A;  5GJV B;  3CCV Z;  3F3F C;  1KJW A;  1SSH A;  3C0C A;  1BB9 A;  4D8K A;  2NVX I;  1GCQ C;  2VF1 A;  2WAQ A;  3VS6 A;  4E2W A;  3CC4 1;  2AKK A;  2EGC A;  2LMJ A;  4OMN A;  1AWO A;  5FWC A;  1YJ9 1;  1U06 A;  2V8I A;  2MCN A;  1X43 A;  3K7A I;  5IT9 b;  2EW3 A;  2JA5 I;  3TVT A;  4RVH A;  3H0F A;  1N8R 2;  5HCK A;  2SEM A;  1BK2 A;  3S14 I;  3G71 1;  2E5K A;  2KEA A;  3NDJ A;  2ROT A;  3JAM b;  1OV3 A;  2FEI A;  1UTI A;  1WLP B;  2RQU A;  3VB9 A;  4E2X A;  2EYX A;  4A3E I;  2LJ0 A;  1K73 2;  1PKT A;  3S2D I;  3GTQ I;  2GNC A;  5LL6 f;  2JW4 A;  2FPF A;  3JV3 A;  1Q82 1;  3CCJ Z;  2JNY A;  3OW2 Y;  1X6G A;  1I07 A;  1OEB A;  2JS2 A;  3ZL7 C;  3QWX X;  3GTO I;  1X2Q A;  1GBQ A;  2EGT A;  3CCQ 1;  1X6B A;  1QLY A;  2RBL A;  2QRD B;  1Q81 1;  1Q7Y 1;  1JWH C;  2OTJ Z;  1JU5 C;  3FJ5 A;  2J6K A;  1GFD A;  3H0H A;  4DK1 A;  2EYZ A;  1WCM I;  2HSP A;  3NFZ A;  1YI2 1;  3VS0 A;  3I55 Z;  2X3X D;  1QKX A;  2K9G A;  2M51 A;  4NBE A;  3LH5 A;  3VS7 A;  2E2H I;  2AZS A;  4Y7N I;  2LQN A;  3CCE 1;  3H3V J;  2RQR A;  2DMO A;  4RVG A;  1AWX A;  3M0U A;  4X1V A;  1USP B;  4J9H A;  4NBA A;  3CC2 1;  1WII A;  2JM8 A;  1WDX A;  3CPW Y;  3CCQ Z;  4Y52 I;  1WW9 A;  3NHN A;  3HOZ I;  2KR3 A;  1SPK A;  1Q86 1;  2GTH A;  4A3J I;  3MZL B;  5IHN A;  3VMH A;  1I1J A;  2F2V A;  2D8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...