2AKLA

Solution structure for phn-a like protein pa0128 from pseudomonas aeruginosa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
116
structure length
116
Chain Sequence
MVSTLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATASDDGKVIKDSVGNVLQDGDTITVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMKLKSEFVRKVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phnA-like protein pa0128
publication title Sequence Specific Resonance Assignment of a Hypothetical Protein PA0128 from Pseudomonas Aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Structural genomics, unknown function
total genus 15
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03831 PhnA PhnA domain
A PF08274 PhnA_Zn_Ribbon PhnA Zinc-Ribbon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2aklA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2aklA02
5IP7I 1BB9A 1AOJA 3HOWI 1MUZA 1U5SA 3C0CA 3ESWA 2K7AA 3EHQA 3GKQA 1GRIA 2KT1A 2A36A 4AG2C 1NEGA 2YSQA 3REBB 2CDTA 4WCIA 4J9EA 5CM2M 1UJ0A 1VA7A 2HEQA 1QWEA 4CC7A 1N5ZA 2P3YA 5IH2A 1PFTA 1WLPB 1ZLMA 4IIMA 2W10A 3S1RI 4A3KI 4A3DI 2MCNA 4J9DA 1OOTA 3EG1A 4NBDA 4EIKA 2L3PA 2ECZA 2K5RA 2EYYA 1TWGI 2O31A 1NG2A 2DM1A 1X3ZA 3H3VJ 2EQIA 1CSKA 2EBPA 3HOZI 2JS0A 4JJDA 3VS1A 1UJYA 4NBBA 3QWYA 1AWJA 2J7IA 4LN2A 2DBKA 5FW9A 4RTZA 2R7ZI 2B63I 3NGPA 4AFQC 2EKHA 3ULRB 1AEYA 3HOUI 1USPA 2A28A 2EW3A 3TSZA 2D8HA 4Z88A 5IP9I 4A3MI 3GTMI 1SSHA 2JMCA 1T0JA 1K76A 2J6OA 1WXUA 2H8HA 1K0XA 1GBRA 2HCKA 2DRMA 1CKAA 1GBQA 3PO3S 1UG1A 1B3QA 1UUEA 2DNUA 5FWCA 3QWXX 2P4RA 2VWFA 5C3EI 4Z89A 2JA6I 3I4NI 2RQWA 1ARKA 2KYBA 4GLMA 1K1ZA 2GTJA 2JM8A 2F2VA 2M0YA 1HJDA 2K6DA 2KYMA 2GQIA 1QLYA 2FRWA 2JW4A 1AZEA 4JZ3A 1ML8A 2KBTA 1M3CA 3LUSA 2AKKA 4NBCA 3VS5A 1Y1VI 4J9CA 2DJQA 2DE6A 1WDXA 3H0HA 3I4MI 4BBRI 1BK2A 4NB9A 1I07A 4A3BI 2JR6A 1E6GA 2DYBA 3UF4A 1AVZC 3VRYA 1JU5C 4CC2A 3I35A 2E5KA 1HSQA 1AWOA 1X2KA 3CQZI 4F14A 4A93I 2F4MA 2KRMA 2LJ0A 1K83I 2DX1A 2L3QA 2HSPA 3S2DI 3KFVA 5I11A 2NUZA 4E6RA 4QTUA 2YU9I 2OI3A 2YUNA 2B86A 4OMLA 4A3II 4JJBA 2D0NA 3I5RA 3VRZA 4OMMA 4RTWA 1TWFI 2ED1A 2RQRA 2RNAA 2NVTI 1I1JA 2AK5A 4A63B 2YDLA 2ED0A 1KFZA 1I3QI 4DEXA 3CQTA 4K11A 2KGTA 1ZUUA 1ZUKA 2J6AA 4FSSA 4A3EI 1K9AA 4BY1I 3EHRA 3TVTA 1YNZA 1OV3A 2BZ8A 2C0TA 3PVQA 2CSIA 1SHGA 2JMAA 1ZBJA 2F2WA 1MV0B 2AZVA 4A3LI 1M27C 1PRMC 1YN8A 3GTPI 2G6FX 2RPNA 1ABQA 2EVRA 2RQTA 2DL8A 4M4ZA 1WCMI 1TWHI 4ZNXA 2KXCA 2KT8A 5L23A 3NPFA 3RNJA 1Y0MA 3EG2A 3VB9A 1GFDA 5C4JI 1OPLA 1VLAA 5C44I 4RTXA 2DBMA 1U06A 2I0NA 2LZ6B 4J9HA 3VS7A 2VKNA 2LNHB 3RBBB 2ENMA 2PZ1A 2J05A 2L3SA 2NVXI 1VYTA 2OAWA 4OMOA 2DMOA 4QTTA 1OPKA 2VUMI 3O5ZA 1YUAA 2RQUA 2PK7A 2CT4A 1AWXA 4Z8AA 3GBQA 3NMZC 3GTKI 1SRMA 3H0IA 4DEYA 3Q87A 1T3SA 2CT3A 4JZ4A 2JT4A 2K2MA 2FO0A 1UFFA 1Y57A 3S1MI 2HDAA 5C4XI 3UA7A 5IXBA 2LQWA 2RF0A 1RLPC 4D8KA 2NVQI 3A98A 2CH4W 1QWFA 1QCFA 5IHKA 1G2BA 2KRSA 2CSQA 2E2JI 1W70A 3IQLA 4MH4A 2EYWA 2MOXA 1W6XA 1ZB9A 2E2II 2M51A 4JPBW 1JXMA 1NYGA 3PO3I 5HCKA 1TWAI 2YUPA 1TG0A 2JXBA 2LQNA 1PHTA 2JNYA 1MV3A 2JM9A 3HOVI 1UHFA 1RO4A 4NB8A 1GCQC 2JA5I 1PKSA 3VMHA 4A3CI 1S1NA 2DL7A 2BJOA 3RZOI 1H3HA 2DL5A 2HBWA 1X27A 4NBAA 1EFNA 1CKBA 1U3OA 2ROLA 1X3WA 2YUQA 2CUDA 1VYVA 2JS2A 1NM7A 1WX6A 1X69A 1I0CA 1K0SA 2FEIA 3M0UA 3VS2A 2X3XD 1AD5A 3D6WA 1NLPC 2DL3A 3EG0A 2EYXA 3EGUA 3FKII 1ZUYA 3NHNA 3H0FA 1L1OC 2W0ZA 4ESRA 1M30A 5IHIA 2D1XA 3M0RA 1QKWA 2C0OA 3S15I 3JV3A 2L2PA 1GL5A 1JEGA 3M0QA 2DL4A 2KEAA 1KJWA 1TUCA 3HOYI 3U50C 2PTKA 4KRTA 2ABLA 3SHWA 1FMKA 2ROTA 2IIMA 2BTTA 1TWCI 2CREA 2HF1A 2LJ3A 1PKTA 3VS0A 2A37A 2DLPA 2EGAA 5EC7A 2KROA 2GGRA 1RLQC 5GJWB 4D8DA 2F2XA 3HOXI 3R6NA 2AKLA 1PNJA 3H41A 2R92I 1TUDA 2FPDA 2DA9A 4BBSI 4RUGA 2K3BA 1M3AA 2J6FA 1K4US 4QT7A 2YUOA 2F4OA 3M4OI 2NVYI 1WYXA 2ESWA 4J9FA 2C0IA 2FG0A 4HVUA 4RTVA 3EERA 4CC3A 2KE9A 3LH5A 2LX7A 2A08A 2FRYA 2O9VA 1H92A 3GTJI 1PWTA 2RMOA 1PRLC 2DE0X 1WFWA 1X43A 3M0TA 3S1QI 1QKXA 4J9IA 1AZGB 1WXBA 2D8JA 2X3WD 3GCFA 1JQQA 3GTGI 2O2OA 1X2QA 2NWMA 2LMJA 4BXXI 1YWPA 1USPB 2V1RA 1LCKA 1A0NB 1Y1WI 1UHCA 1H8KA 4Y92A 1ABOA 4HVWA 1Z9ZA 4HCKA 2KPIA 4NBEA 3S1NI 1X6GA 3S2HI 3H0GI 1E6HA 1UTIA 2DF6A 2V1QA 1B07A 5FWBA 1LQLA 2AZSA 4Y7NI 1GFCA 1WW9A 2JS4A 4F16A 2VVKA 1Z9QA 3TSWA 3M0PA 4AFSC 4RTTA 1SRLA 1TFIA 1G83A 2O9SA 4OMPA 1I6HI 2RN8A 2EPDA 4HXJA 4LUDA 1YP5A 1ZX6A 2GNCA 1RLYA 1AWWA 1WA7A 4AFZC 2XMFA 1JO8A 5IHNA 4NBFA 1UGVA 1NEBA 1XOVA 2K79A 3GTOI 3VS4A 1J3TA 2GBQA 2KXDA 1RI9A 2K9GA 2LP5A 1M3BA 1GCQA 3GTMS 2DILA 2DE5A 2L0AA 1UE9A 3I9QA 3U23A 1N2FA 1T0HA 1KSWA 1KIKA 3PE0A 1GCPA 1V1CA 2BZYA 2SRCA 1VYUA 4LNPA 1ZB8A 2BZXA 5GJVB 4NBHA 1M8MA 3UATA 1SHFA 2CUBA 2LCSA 1SFOI 2FPEA 3S17I 3K7AI 2FPFA 3VMGA 3VS3A 1SPKA 1YCSB 1BBZA 4NOZA 1YWOA 1OEBA 3SEMA 2LJ1A 4J9BA 4RTYA 3UA6A 2JA7I 2SEMA 4BY7I 4ORZA 1BU1A 2E2HI 3M3YI 4GBQA 4X1VA 1Y1VS 4IIOA 4OMNA 4Y52I 1R9TI 4AG1C 2R93I 3GTLI 3ZL7C 5I22A 2JTEA 2PNIA 4JJCA 3S14I 2MIOA 4R0KA 4XX2A 2OJ2A 2DE7A 3THKA 3PO2I 1W1FA 1IO6A 4A3FI 4HVVA 3I07A 2GTOA 2RBLA 1DL6A 3FJ5A 1ZSGA 1UDLA 4A3JI 1HD3A 1WIEA 1UECA 5IXFA 3VS6A 4OMQA 4NBGA 1X6BA 2J06A 2YT6A 3VMIA 5FLMI 2J6KA 3I5SA 3PVLA 3M0SA 4LE9A 4AFUC 3REAB 2O88A 1NYFA 3S16I 1RUWA 3RZDI 4F17A 1NUIA 2EGCA 1WXTA 1I50I 2DVJA 3GTQI 2JA8I 1WI7A 4CC4B 1QYPA 4J9GA 2EGEA 1T3LA 2QDLA 2KNBB 2DRKA 4RTUA 1NLOC 4LUEA 1FYNA 3EG3A 4X6AI 1SEMA 2EYZA 5ECAA 2RQVA 2KR3A 2CH4A 1E7OA 2KRNA 1JXOA 4A3GI
chains in the Genus database with same CATH superfamily
2YXYA 3RR6A 2JIMA 4IUTA 1AOJA 3IX0A 3X26B 1MUZA 3G4SQ 3EFOA 3ESWA 4V2SA 2FZGB 1EZZB 3C95A 5C6SA 2KT1A 4PKCC 4C8QF 4RVGA 1N8R1 1VQ5A 5CM2M 3GF5A 4M7DG 4FSXA 2P3YA 3KIHA 2CP6A 3S1RI 1WQ7A 4KGVB 4PFPA 1K8AU 2NAPA 2K2VA 5FLXf 3JRZA 1M9SA 4A3KI 4A3DI 3I56Z 3JCMJ 4J9DA 1N27A 1RAIB 1WHKA 4L5GA 4IKFA 3CCE1 2K5RA 2EYYA 1TWGI 1VQ9Z 5KE2A 2ZCFB 4M75A 2RI5A 1M1KR 4GLKA 4MD7A 4JLIA 1CSKA 2VGNA 3HOZI 2JS0A 4JJDA 2IZ4A 3MP1A 2F5KA 3MHXA 3QWYA 3L2RA 3I56A 2DBKA 1V76A 4A4HA 2QRCB 4XU0A 4AFQC 2EQKA 1USPA 2QQRA 4F7UB 5KE3A 2OTLZ 3PMIA 3OMCA 4EMKB 2H8HA 3T9NA 3AT1B 1GBQA 2QRDB 3PO3S 1UG1A 1YJ91 1D1BA 3CCRZ 4QQGA 2QR1B 1UUEA 2X4YA 4ELZC 3CCSA 1VQ4Z 2VC8A 3NH8A 4Z89A 5GAN6 5GAMj 1ARKA 4JS5A 3CME1 2GTJA 2JM8A 5FRMA 1QLYA 5LJ3f 3CCMZ 3IF8A 3LUSA 2E70A 3OYKA 1ZQ1A 3VS5A 2QEXZ 4EMHA 2RHIA 4FYVB 2OOYB 5I2MA 2JR6A 3CD6T 1JU5C 4BDYA 3I35A 3BE3A 2MK5A 4X9DA 1Y7XA 2F4MA 3R6OA 3SB2A 4HCBA 5LL6f 2P28A 4JRQA 2HD0A 3WVEB 5GANd 3ZFJA 1VQNZ 3S2DI 2M1HA 2NUZA 4MDWA 4C8QD 2YUNA 1WHMA 5D6YA 3VRZA 4OMMA 4RTWA 4QVCA 3CPWP 2PMZA 1PCXA 1N6AA 2PM9A 2RQRA 1Q95G 4XAXB 3VJPA 1VQOZ 2YDLA 2DXBA 2KGTA 3SD4A 4JS4A 5D1PA 2J6AA 4FSSA 1ZSZA 5A0DA 1K9AA 1TU0B 2QA41 5IT9b 2JN0A 3PVQA 4S1TA 2JMAA 1ZBJA 2F2WA 2IPOB 3OQ5A 3HHTB 3CCQ1 1MV0B 2NUPA 5L8RE 4EMGA 1M90R 4M7DC 3GTPI 4UC4A 1ABQA 1M90C 2YRCA 3F70A 3S6WA 1S72A 1I5OB 3OYLA 2KXCA 2KY9A 4M7AB 1F1BB 4E7JA 3MKDA 3P8BB 1U1SA 4DA4A 3G711 1PSFA 2XU8A 3VB9A 1KD12 1VLAA 1RL2A 4PL6A 3MEVA 4QW2A 4LDYA 3VS7A 4B6MA 2LNHB 4E7IA 6AT1B 4M78B 4OMOA 2DMOA 1YI2T 2E64A 4QTTA 1OPKA 2VUMI 2V8JA 2OTJ1 1OZ3A 2RQUA 4RKUE 3DB3A 2BE7D 3V8KA 3V7CA 1EIFA 1UGQB 2BKDN 1SRMA 1WHJA 3A8OB 1KK7A 1N8RR 3CCEZ 1VQMQ 3LGLA 1N8RC 1ZH1A 1M1KU 3LW5E 1VQLA 1RLPC 2PVDB 4D8KA 4E30A 3CCJ1 1QWFA 1YBYA 3A98A 4BE2A 2KRSA 3RIRA 5GAOp 1NE8A 3X28B 4PJOG 5GAMg 2O4XB 2O53A 2MOXA 1K9MC 3CCEA 3GNFB 1KQSZ 1ZB9A 2M51A 2EAYA 1JXMA 2YUPA 1PHTA 3ZEHA 1MV3A 2CGHA 3HOVI 1GCQC 2JA5I 3D9XA 3QJ6A 2JUFA 2BJOA 2QTXA 2X4WA 2DL5A 4NBAA 1U3OA 1YJ9Z 4BY6C 1NM7A 3VV0A 2YLCA 3CCVT 3EGXB 5D1OA 3JB9J 1AD5A 1ZA1B 1M902 3CMEZ 4M78G 3ER0A 2LNVA 3NHNA 1TOVA 4NFRA 1Y71A 4ZGDB 4F7UA 1L1OC 1YJ9A 2D1XA 3C4SA 2DERA 1UB4A 4EMKA 1GL5A 1LVKA 1YIT1 4C0DC 2DL4A 1KJWA 2OZKA 4KRTA 1FMKA 4L59A 2HKQB 2F5TX 2ROTA 2EQUA 2HBPA 1W2BZ 2CREA 3CC7T 4QVDA 2LJ3A 1PKTA 1QVGS 2QQAA 4QVZA 1NJIR 2JTFA 5T67A 4X34A 2M9UA 1NJIC 4C0FA 3BG0B 3CCU1 2DYIA 2R5AA 1YHQA 3MO8A 2AKLA 3VUZA 3CPWA 2EGTA 2F69A 2E6NA 3G4ST 3FC3A 2F4OA 1D0ZA 2NVYI 1N8R2 2ESWA 2C0IA 4J9FA 4M7DE 2FG0A 3CCSQ 1NPRA 1VQ81 4CC3A 3X20B 2RH2A 3LH5A 1IHVA 2A08A 1H92A 3PNWC 1FMVA 2EJFA 4LDWA 5FU6B 2QA4Z 1QW1A 3P8HA 1K9M2 3WXMB 5T64A 3GCFA 3KXTA 1JWHC 1JQQA 3GTGI 3HL8A 2LMJA 3CPFA 1YWPA 1Y1WI 1KQSY 1WZOA 3IR7A 3DLLA 5CO7A 4J6WA 2LT1A 4HCKA 2EJ9A 1U8RA 3S2HI 3H0GI 1E6HA 3G71Z 1Q812 2H85A 1PSEA 4NL2A 5LJ5d 2AZSA 1XJWB 5GAMh 3CCQA 1MMDA 2VVKA 5CCAA 3TSWA 4RTTA 5FROA 3VU3C 2O9SA 4OMPA 4MXUA 3L1AA 2EPDA 4XK8E 3A8LB 1QVPA 4AMCA 3G71A 2OTJZ 3M59A 4RG8A 1B34B 2XMFA 5GAN2 4PJOC 1NEBA 4M7AA 1J3TA 2A7YA 2GBQA 3OS2A 1RI9A 2GFAA 2LP5A 3G6EQ 2AYDA 2LCLA 2CYZB 1NJI2 1X6OA 3LWIA 3I9QA 2JIQA 4CRIA 1N2FA 1QQJA 1U1TA 3FEOA 3MONA 2OTJA 1KIKA 3CCJZ 1YIJ1 1S72Q 4LNPA 1ZB8A 2DPPB 1M8MA 3OYYA 2DEUA 2RJCA 1SHFA 2LCSA 3CC2T 2FPEA 2YWWA 4M78C 4C8QG 2QYZA 3VMGA 3M54A 1SPKA 1VQ71 1YCSB 3VS3A 4IUUA 2MAMA 1OEBA 3JCMc 3OW2S 1YJWZ 3L42A 1G8XA 5AT1B 4D6WA 1RAHB 2M0OA 3P8DA 4IUQA 3ASKA 2GTHA 2JTEA 4E47A 2OX7A 5DY9A 4XX2A 3L2ZA 2DE7A 2O4XA 4OMFB 4HVVA 2VPXA 2DKGA 2GTOA 5GAMe 5FLXE 4C0ZA 3J81b 4FYXB 1VQLQ 1WIEA 2NLUA 3VS6A 4Z02A 1X6BA 1NP6A 2RHZA 3JCMd 1UGRB 2YT6A 3VMIA 3I5SA 3MEWA 4LE9A 4R56A 3M0SA 1W2BS 1LJOA 3S16I 2JVVA 2PVGB 4MDXA 2O01E 3EAEA 1WXTA 3EGXA 2DVJA 3OMGA 2NYSA 3GTQI 1C6VX 2L3RA 4J9GA 2EGEA 5KYUB 4QKUA 2QDLA 5AYFA 3CMA1 4X9CA 3PT9A 1YITA 2WSFE 9ATCB 3OYAA 2RQVA 2WB1A 2LQKA 1E7OA 2KRNA 2EWNA 2DO3A 1AHJB 3H9NA 1G3YA 3HPWA 3C0CA 2K7AA 4II1A 1VQ8Z 3CCUA 3GKQA 1GRIA 2A36A 1BI3A 4J9EA 1UJ0A 1PD0A 1VA7A 2HEQA 4CC7A 4OB1B 1N5ZA 1VQ91 3QZ9B 1ZLMA 4IIMA 2W10A 1VQPZ 1G3WA 3QKJA 2MCNA 3CC2Z 1VQMT 1KD11 1VQK1 4DQ2A 4EIKA 2LC4A 2QI2A 1K73C 1NG2A 4B9WA 2ZAEB 4PJOE 3H3VJ 3VS1A 1YHQQ 4IUVA 1VIFA 1WZNA 1P92A 2RK1A 3PMTA 2YADA 3M4GA 2DXTA 4WTOB 1QCOA 2DTHA 5FW9A 4RTZA 2B63I 3NGPA 3CCR1 2DFUA 3TE5B 3HOUI 1WGSA 2LIYA 4A3MI 3GTMI 1T0JA 2ZPFB 1K76A 2J6OA 1WXUA 1K0XA 2R57A 2HCKA 5A0LA 2PUKB 3I55Z 1M1GA 4C8QC 1CKAA 3CCLA 1C0MA 4JLGA 3SDZA 2DTOA 3MZLB 4M78E 1B3QA 2X4XA 3MPUB 4Y91A 2QEX1 4BI4A 1YIJZ 2VWFA 1YJNA 5C3EI 2H3EB 3I4NI 3HRSA 4FIBA 5GAN3 4GLMA 2X9HA 2QAZA 2HMAA 1ACMB 2M0YA 2F2VA 3J80E 5LJ3j 2K6DA 2FRWA 4XTUA 1AZEA 2DZCA 2W04A 1WPYA 1HK9A 1B34A 3LLRA 1Y1VI 3CCQQ 4A4FA 2E65A 4BACA 2DJQA 4PJJA 1WIIA 3I4MI 4BBRI 2V3VA 1WJ2A 4C92F 1E6GA 2DYBA 5DM7R 1AVZC 1KG1A 3S3OA 1M901 1AWOA 3IFUA 4A93I 4Q5WA 1VQ7A 1K83I 1ZA2B 2KMTA 3KFVA 2L3QA 2HSPA 4QTUA 3OYDA 2I2LA 4OF1A 3CCST 2B86A 4OMLA 4A3II 4KUDK 1K732 2D0NA 3TEEA 4WF2A 1TWFI 2ED1A 2AK5A 5CKEA 4DEXA 3FDRA 3CQTA 1ZUUA 2M48A 1ZUKA 2E1HA 2ZPGB 3EHRA 3TVTA 1YNZA 2H3JA 3CMAZ 4DBHA 5CVIA 2JZ2A 4A3LI 1M27C 3WVDB 5GANf 2EIFA 2DJZA 2DL8A 4M4ZA 3JB9I 1TWHI 2YRDA 2VPZA 1MNDA 4LDUA 3OYIA 5L23A 4BDZA 3EG2A 4FW2A 2Y0SA 3CMAA 1OPLA 1K9M1 2DZ9A 2DBMA 1OX9A 4BY6B 2VKNA 2ENMA 2MPXC 2PZ1A 2R5MA 1VIEA 5KYUA 1VYTA 2K5LA 1HXDA 3CC4Z 4RVHA 3CD61 2CP7A 3QYGB 3OS5A 2CT4A 1Q811 1AWXA 2LT4A 4Z8AA 4A4EA 1VQKZ 3G6ET 1JJ2S 2FYKA 3GTKI 4DEYA 2Q51A 4FT4A 1D1CA 1T3SA 2JT4A 1VQ9A 4C0DB 1UFFA 1Y57A 3S1MI 2HDAA 3QJYA 1MMGA 5C4XI 3UA7A 1S72T 2FVUA 1YITQ 1Q7YR 2RF0A 3OY9A 2JIPA 1KHCA 2WSCE 4MZPA 4C8QE 1Q7YC 2CZ6B 1IHWA 3CBMA 3EGDB 1VQKA 3A8HB 1KD1R 2QQBA 4M77F 3C94A 1W6XA 4C92D 4IUPA 1KD1C 4OB2B 2L8DA 3CCUQ 4E32A 2JXBA 5LJ3g 2OTLA 2MI6A 1BIAA 4NB8A 3BDUA 3QPHA 3O8VA 1S1NA 2K3YA 1NJI1 2DL7A 1KQSP 1VUBA 1EFNA 1CKBA 2ZAEA 1X3WA 1VYVA 2JS2A 2A3LA 3CCRA 2IVWA 4OGCA 3MEAA 2HL5C 3VS2A 2X3XD 1VQ4A 3M56A 3FKII 3V7RA 5C0MA 2KQWA 4J7IA 1QF8A 1VQLT 1QVGZ 1BI1A 4ESRA 2XK0A 5IHIA 4EPCA 3OYMA 3CCMA 1KHIA 2C0OA 3M0RA 3S15I 2QEXA 1X0TA 2ABLA 4HKEA 2IIMA 5I21A 3CBPA 1G5VA 1WJSA 2A37A 5EC7A 3SFMA 2KROA 1RLQC 2BUDA 5GJWB 4PNOA 2V26A 2ATCB 1XNIA 1PNJA 1IGUA 3NH4A 1VQNA 4BBSI 4C5IA 4RUGA 3CCLQ 2K3BA 4M7DA 3J80f 5DLQE 3ME9A 4R55A 4PJOB 4HVUA 1YJNQ 4M75F 2RI2A 1VQOA 1OU9A 5D7UA 2LX7A 1O9SA 2FRYA 1Q7Y2 1I5LA 3GTJI 2RMOA 1PRLC 3NFCA 4DBQA 4NOYA 1X43A 2NUTB 3S1QI 4E2WA 4KH1B 1WXBA 1VQ6Q 3MCAB 2X3WD 2BIVA 3PIOA 1HYOA 2O2OA 1X2QA 4BI8B 5GAOn 1MMNA 3BY7A 1UHCA 2RJDA 3CCV1 1QVFS 5D6XA 2ZPBB 2KPIA 2RHXA 3V7SA 3S1NI 1PC0A 1BKBA 1YHQT 4M77D 2C06A 2WACA 3HP9A 1OYXA 3KUFA 1VQ7Q 4Y7NI 4TNUA 1Z9QA 3OYJA 3QBYA 1G83A 5LJ3h 1I6HI 3QZ5B 2GNCA 1G3TA 1RLYA 2G3RA 3CD6Z 3L2VA 3CC71 1JO8A 1QVGY 5A2Qb 4B9XA 4NBFA 4KGZB 1XOVA 3VS4A 1K9MR 1SG5A 4E33A 2RHYA 4J7FA 1GCQA 3GTMS 2DE5A 2L0AA 5LJ5f 1UE9A 3PTAA 4HH4A 1VQ5Q 1GCPA 2W03A 3OW2Z 1Q81R 1RAGB 2BZXA 1YJW1 3H8ZA 5GJVB 3JAME 2CP3A 2OOXB 2DEQA 2LRQA 3CBOA 1IB8A 1KD1U 3CCQT 1Q81C 3QWUA 3UATA 1SFOI 1MMAA 2MWOA 1KQSA 4N0AC 2HQXA 2DVEA 3CXCS 3QO3A 3VTNA 2LJ1A 4J9BA 3UA6A 5KYWB 3E19A 1FDOA 4BY7I 4HGZA 4XTXA 3MJXA 1Y1VS 4OMNA 4N4HA 1R9TI 3ZL7C 2VUBA 2MIOA 3I56Q 3EGDA 4M75D 4KT0E 3CMEA 1W1FA 3TCJA 3JB9F 1VQ9Q 3I07A 2E6ZA 1SSFA 3H6ZA 3FJ5A 1ZSGA 1UDLA 2P4TA 4A3JI 5CKFA 5IAYA 2EFIA 4GY5A 4OMQA 2DXUA 4NBGA 5LJ3e 5GAN5 1YI2Z 2J6KA 3MP8A 4FW1A 3MEUA 1W2BA 4RVFA 2EGCA 3OSSC 4OB3B 4PJMA 2VB6A 1QYPA 2VPWA 4FM4B 2RB6A 2OTLQ 4RCCA 2YRVA 4J8OA 1K731 1NLOC 1IREB 3LX7A 4X6AI 2GQVA 1SEMA 3GLXA 1D1AA 2KR3A 4A3GI 5IP7I 3EEDA 1BB9A 2E3IA 4MRIA 3CCRQ 3J7AF 8AT1B 1VQP1 3EHQA 1M90U 1VQ4Q 2D6FA 3JCMf 4AG2C 3CC21 5HK3A 4C8QB 2YSQA 1IGQA 2ZZDA 4OVAA 3JCMW 2D9TA 4WCIA 1OX8A 1QWEA 2B8AA 5IH2A 2QA4A 3CCMQ 1WLPB 3OW2Y 2P84A 5I2SA 1N9SA 2QEXQ 5CIUA 3J7A4 1KQ1A 3CCVZ 1OOTA 3V8JA 2V8IA 3HRUA 2ECZA 1YITT 4PJOA 4LDVA 2PUOB 4J5YA 5CAIA 2DM1A 2EQIA 2EBPA 4QQ6A 3AHUA 4O5VA 2BE9B 3EFRA 2NUTA 1H641 4NBBA 1VQNQ 1AWJA 2L5QA 2J7IA 3CCVA 3I551 4LN2A 1N8RU 2L89A 5GAMd 2WAQA 3CCUT 2R7ZI 2EKHA 3ULRB 4KGXB 1AEYA 3OYGA 5J3BA 1W2BY 3TSZA 3CC7Z 3HFNA 4LD6A 2D8HA 4F7UF 1SSHA 4RV9A 1VQOQ 2VPYA 4FYWB 2HSEB 4ATOA 1NZ9A 1K9MU 1GBRA 4M78A 2Y4YA 3S3NA 1FX7A 2R6MA 4ME7A 2DIQA 3JB9D 1VOMA 3G4SZ 2E10A 4ZTFA 3UDCA 3NDJA 2KK4A 5FWCA 3OYCA 3CCJA 2QREB 4ANJA 3RKWA 1Q81U 1K1ZA 2K3XA 4HT8A 1Q86C 3LYIA 4OP0A 2KYMA 2GQIA 4AYBA 2KBTA 2QXFA 4DK1A 2XI9A 2HNIA 3JCMP 5FU7B 1WDXA 5GMKm 3H0HA 1BK2A 2CP5A 4A3BI 1YJWA 2EJGA 3VRYA 2E5KA 1SF9A 1VQM1 3HRTA 4KUIA 1Q822 1X2KA 3CQZI 4F14A 3CCLT 2E5QA 2KRMA 2LJ0A 4NL3A 3NDIA 2K3RA 2DX1A 5I11A 3J81f 3CEYA 1PM3A 4E6RA 2OI3A 3CCEQ 1NJIU 1O75A 4LDXA 1YJNT 5CKDA 4JJBA 3JAMf 3I5RA 4HCZA 4N4IA 1IXDA 2XDPA 1H3ZA 4O6JA 1MGQA 3D2LA 1SIWA 3E1SA 2RNAA 2NVTI 1I1JA 3CPWS 4A63B 1RACB 3M9QA 1KFZA 5KYWA 2JIOA 2MMPA 1I3QI 1RAFB 1VQ6T 4K11A 4BD3A 2E41A 2C0TA 1M2VB 3RMSA 5GANj 4KH0B 2AZVA 2G6FX 2RPNA 5GMKi 2EVRA 2RQTA 1BI2A 1WCMI 2KDSA 1YJ9Q 4CI0C 1VQ7T 3TDHB 2KT8A 4M7AF 4C92C 4ZN3A 1Q7Y1 3NPFA 3RNJA 3CC41 1Y0MA 3GOXA 1Y96B 2RIQA 4PJLA 1VQ8A 5C44I 3QHSA 3CMEQ 1K73R 2I0NA 2LZ6B 1Q862 1K8AC 1JJ2Z 2J05A 2QQSA 2OAWA 1V29B 4L6V5 1VQPA 3O5ZA 3RERA 2E3HA 3E2UA 7AT1B 2PK7A 3L2UA 2E4HA 3CC2A 3GBQA 4XQ3A 3NMZC 1BI0A 4FYYB 5GMKj 2HU9A 3F3PC 1KC81 1JBMA 1TH7A 2FO0A 3QIIA 1VQ5T 1WNLA 4VUBA 2ZGWA 4C8QA 5IXBA 3CCS1 3FLGA 2CH4W 5LL6S 2E2JI 1RABB 2EQMA 1W70A 2EKOA 4Y28E 4M75G 1DJ7B 4MD8A 3FB9A 2JIRA 1TWAI 2P0QA 5D6WA 1TG0A 4PJNA 1M8VA 2LQNA 1UHFA 4HCCA 3SWNC 2LX9A 1PKSA 2M02A 1BCMA 1IZ6A 3RKXA 2RT9A 3RZOI 3I55A 2HBWA 1X27A 1FXXA 3DKMA 2QA4Q 2Y4XA 5KYXB 3I56T 3HKSA 5IT9E 3M0UA 3D6WA 1NLPC 1ZBXA 2CP0A 3VKIA 1YIJA 3EG0A 2EYXA 3EGUA 3RESA 2EQJA 2VV5A 1VQ9T 1ZUYA 2ZPEB 1WQWA 1MHNA 1D0YA 2XDBA 5KYNA 1RQFA 1Y8CA 3VUBA 3H0FA 3G71Q 4PLIA 1IRXA 1QP2A 1QKWA 3GPLA 3JV3A 2L2PA 3NTHA 1JEGA 3M0QA 3M58A 1M1FA 3LH0A 2QGGA 1TUCA 2PTKA 3U50C 4QQDA 3SHWA 2DK3A 3X25B 1D3BB 1QVGP 2BTTA 1N9RA 1K8A2 3OSVA 2XD0A 2E7ZA 5A0GA 2OTLT 3BDLA 1VQMZ 2DLPA 1FWZA 2EGAA 2QLVB 3M55A 3G6E1 4M77C 4M7AD 2OTJQ 2GGRA 4MD9A 1JJ2Y 2HQEA 4OGEA 2K5FA 3CCRT 5CKHA 3F3FC 5GANg 1S721 1M3AA 5GAN7 5KYYB 4N4GA 4QT7A 1K4US 2YUOA 3M4OI 3FRNA 1VQ4T 1VQMA 4RTVA 3CCJQ 2DIGA 2QK0A 4P5NA 1PWTA 5FU7C 3CCMT 1VQ5Z 4LD9K 1QVFZ 1WFWA 4C92E 2JOYA 1W4SA 3M0TA 4J9IA 4EDUA 1AZGB 2QEXT 1FDIA 1R0BG 3HSBA 2I3CA 2QG9B 4BXXI 2QDYB 1LCKA 1A0NB 4Y92A 1ABOA 4HVWA 1S7MA 1YJWQ 3S3MA 4NBEA 1QVFA 5FLXb 2DTIA 4MZTA 1UTIA 2D0QB 2DF6A 2V1QA 1B07A 4IURA 1LQLA 5FWBA 3URGA 5GAOm 1VQNT 1YCYA 3P5JB 1VQL1 3RUXA 1C1AA 3JB9G 4JRPA 4F16A 1K73U 4JUVA 2VXEA 1SRLA 3FIFA 3C12A 2F1LA 2KVQG 3OBYA 1M2VA 3E9FA 3X24B 4HXJA 3EG9B 4LUDA 1VQOT 2FZKB 2JJ9A 3CC4A 2RA2A 4FU6A 1M5Q1 2JTMA 5D1OB 4M75C 1UGVA 1M1KC 3GTOI 2KXDA 5LJ5j 1Y96A 5CQXA 5HY6A 3NTIA 3CCSZ 3GIBA 4HT9A 1KSWA 1NBEB 3CXCZ 1V1CA 2BZYA 2VYTA 2SRCA 1UGPB 4E2FB 3KBGA 4NBHA 4PLLA 2DXCA 3RKYA 2E9HA 4HGYA 3QDFA 2V45A 2DD4A 2XICA 3S17I 4NH1C 1KC8R 1VQ8Q 3K7AI 2CP2A 2HL3A 2LDMA 1BBZA 3OW2P 4NOZA 1KC8C 1YWOA 4E2ZA 2PQWA 3CXCA 2R58A 2JA7I 4ZGJB 1BU1A 3FJPA 4GBQA 4JDSA 4A53A 5HK0A 1KQ2A 4IIOA 3A1PA 4Y52I 2HAXA 4BUGA 3GTLI 5GANh 1VQPQ 1QVFY 2E12A 2QQ9A 1I4K1 2MWPA 4JJCA 3CCET 3CC2Q 1YI21 1UEBA 1YHQ1 2FB7A 2JMOA 2DETA 3PO2I 3OYFA 4E7HA 1IO6A 4A3FI 4M77E 4XU1A 1QVGA 1EX4A 1DL6A 4YTLA 4A4KA 5M9OA 3E9GA 2RM4A 4C5HA 5CR2A 1W2BP 4HA8A 1Q821 2FZCB 3PVLA 5FLMI 2JNGA 4AFUC 2WSEE 2KI7B 3REAB 1NYFA 4F17A 1NUIA 1TS9A 5KYXA 1YUKA 4F7UG 1I50I 4CC4B 1WI7A 3G6EZ 1TTHB 4MONA 4FCYA 4E7SA 3QG1A 5IT9f 4LUEA 1FYNA 2JUBA 3EG3A 1YJ9T 2EYZA 1M1K2 3KIFA 3J80b 3UT1A 1S72Z 3I55Q 2CH4A 5GMKh 2LQWA 3QDRB 3HOWI 1TUGB 2P0PA 4C5EA 1WJQA 1U5SA 3G6EA 3CMET 4RVDA 1YIJQ 1D3BA 1ZSZC 1NEGA 3REBB 2RHBA 2CDTA 3QXEB 4NS5A 3JCMQ 1JRIA 1PG5B 2GF7A 3RMQA 3NFZA 3CXCY 1PFTA 1OI1A 2VUGA 2PU9B 3MZKB 1RAEB 1OULA 1Q16A 1KC82 5GMKl 3M53A 5KYYA 2MYSA 3EG1A 4NBDA 2RO0A 2L3PA 1WHHA 5GANe 4DOWA 2MF2A 4BB7A 2O31A 1Q861 1AT1B 5CKBA 2RJFA 1X3ZA 3L2WA 1VQLZ 2CZ0B 4M75E 3DLMA 5LJ5g 1UJYA 2VGMA 4E2YA 1RNIA 2Y90A 2K4YA 5A2Qf 2LTOA 2DD5A 3G4S1 2A28A 2EW3A 5LJ3d 2LFUA 1Q7YU 4Z88A 3OYNA 2VF1A 5IP9I 2JMCA 2YHTA 3CD6A 3VYHB 1I8FA 2GTIA 5CQYA 3J81E 2QA4T 5IN1A 4N0AA 2DRMA 5HKCA 2VASA 1RO0A 4ZTJA 2CS7A 5GAN8 3VYGA 1MNEA 3A8GB 3CMAQ 2DNUA 3QWXX 2P4RA 2EYQA 2JA6I 2KAFA 2RQWA 5GMKe 2KYBA 4M7AG 3G71T 5GAMf 3MP6A 2IG0A 3EG9A 3OA6A 3OW2A 4DBRA 1HJDA 1KRLA 1R77A 2JW4A 4JZ3A 1ML8A 1M3CA 4M7DF 2AKKA 4NBCA 1KC8U 4J9CA 4MMKA 2XDDA 2CZ7B 2DE6A 4DQYB 2DAQA 1I07A 4NB9A 4C92B 2OTJT 4PFZA 5J39A 3UF4A 2YLBA 4CC2A 2RHUA 5GAOr 2Z0WA 1HSQA 3CC4Q 3FQQA 1YHQZ 3META 3CPWZ 4J6YA 1VQKQ 2YU9I 4EMKC 4XTWA 4PFOA 3CCJT 4E7ZA 2X4JA 1K8A1 4DBFA 2ZPHB 1I81A 2ED0A 1LOJA 1Y07A 1YI2A 4JRIA 3JCMg 1M4ZA 4E7KA 1XTDA 1R8OB 4A3EI 4BY1I 4BI3A 1OV3A 2BZ8A 1TSFA 3QUIA 4RMOA 2IZ3A 2CSIA 1SHGA 4OB0B 1RO2A 1YJWT 1PRMC 1YN8A 2ZPIB 1Q82R 1UGSB 2RPRA 4ZNXA 5LJ5h 3T4NB 1M2OA 3JCMb 1Q82C 1GFDA 5C4JI 3G1JA 3SWNB 1QP3A 4C92G 3CCQZ 3QYHB 2KI7A 2M6NA 4RTXA 1QXFA 1U06A 4J9HA 4FL6A 3PIPA 3M5AA 3RBBB 2L3SA 2NVXI 2PVOB 3M4YA 4MZMA 1PD1A 1Z01A 2AIRB 2O4HA 3LGFA 1YUAA 2XIDA 2RI3A 2QTVA 5KH6A 1JJ2P 2HKNA 1GXIE 3A5ZB 1AA6A 4ZGEB 2GFUA 3H0IA 1QMCA 3CCL1 4BE0A 2COWA 1B7TA 3Q87A 2CT3A 4JZ4A 8ATCB 2K2MA 4JJNK 3LWHA 4RS4A 1WHLA 4M7DD 1YJN1 3D7SB 2NVQI 1BCOA 2HQHA 1QCFA 5IHKA 1G2BA 2CSQA 2KSSA 4CL1A 3TU4K 1VQ8T 3IQLA 4M77B 4MH4A 2EYWA 1OZ2A 3CPWY 1VQ61 2E2II 4JPBW 3HKZA 4M7AC 1NYGA 3PO3I 5HCKA 3TQ7P 3CC7A 3NH5A 2K5IA 1Q86R 2JNYA 2JM9A 2COYA 1RO4A 3VMHA 4A3CI 5GAN4 1D0XA 4XU2A 4J83A 3JCMV 1H3HA 3RDVA 2K57A 1VQPT 3EH1A 2ROLA 1KQSS 2YUQA 2CUDA 1R0CB 2RK2A 1WX6A 1X69A 1BIBA 1I0CA 3TREA 3G4SA 1YFNA 1K0SA 2V8KA 2FEIA 1LNXA 1Z02A 2DL3A 2GCXA 5LJ5e 2X51A 1WJRA 4XTVA 2FHDA 3INZA 3OYHA 2LVMA 5KCHA 2LCCA 2W0ZA 3JCMh 1M30A 5GAOl 4C5GA 4KULA 3FQMA 4F7UE 3EFOB 2KEAA 4XTYA 3HOYI 2COZA 2A0FB 1TWCI 1X75C 2HF1A 4PK4A 3VS0A 3CD6Q 4D8DA 2CZ1B 2XKOC 2GU2A 1YITZ 2F2XA 3I55T 4XU3A 3HOXI 3R6NA 4C0GA 2Q4ZA 4M77G 3H41A 3A8MB 2R92I 1TUDA 3JAMb 2FPDA 1VQ51 2DA9A 2M16A 2J6FA 5T6BA 3OYEA 1YIJT 4E2XA 1WYXA 4PJOF 3EERA 3CCUZ 4M75B 3GP8A 4F04B 2KE9A 4C92A 2QKDA 5DLOA 2AHJB 2O9VA 1RADB 2DE0X 2RD1A 1QKXA 2XG8D 2OAUA 2D8JA 4XTZA 1M1K1 3G7ZA 4A4GA 3UWNA 4ELYC 3BG1B 3BFMA 2NWMA 4E7LA 1K8AR 1QVFP 4FT2A 1USPB 2V1RA 3QSUA 3PGGA 4BE1A 3I561 3HTRA 3JSCA 1H8KA 2XHCA 1Z9ZA 1Q82U 1TWBA 4AT1B 2QGFB 1ZHIA 1X6GA 4M78F 1D09B 1SKUB 3OB9A 1GFCA 2LEXA 2AT1B 1WW9A 2JS4A 3M0PA 4AFSC 1TFIA 1LPLA 3JCMe 2CKKA 1JJ2A 2RN8A 2FL7A 4KBMB 2HZYA 1YP5A 3NTKA 1ZX6A 3GNGA 1RI0A 4MMLA 1AWWA 3L2QA 5EG2A 1WA7A 4AFZC 4DGLA 2OTL1 4RCBA 1TXQA 4ZN1A 1YI2Q 5IHNA 1RAAB 4A54A 2K79A 3CCLZ 3CMAT 3EH2A 5FRNA 2K9GA 1M3BA 3SWNA 4M7AE 2DILA 3HFOA 5FU6C 1JB0E 3OYBA 3U23A 1T0HA 1YJNZ 1VQ41 3PFSA 3M57A 3PE0A 1XQHA 1P9NA 3JB9H 1VYUA 2IV2X 3ZBDA 2X35A 1X01A 1VQ6Z 2CUBA 3CCM1 3CXCP 3N5BB 2FPFA 1QCNA 1Q86U 2RJEA 3SEMA 5CK9A 1OU8A 3JCMX 4RTYA 2G2KA 2QASA 3CC4T 2SEMA 3OS0A 4ORZA 2E2HI 3M3YI 4X1VA 3DB4A 4EWCA 4AG1C 1VQ6A 2R93I 1ZSZB 1VQKT 4M7DB 4DOVA 5I22A 2PNIA 1VQ7Z 5AN9F 3S14I 1BYMA 3BW1A 1OQKA 4R0KA 3OS1A 4PJOD 3CCVQ 3UPUA 2NUPB 2OJ2A 4M77A 3THKA 1VQN1 5J26A 4TVRA 5GAOq 5KCOA 1Z03A 2RBLA 2P0KA 4JRKA 1HD3A 4RG2A 3V8LA 1UECA 5IXFA 1VQO1 2J06A 2O88A 1RUWA 3RZDI 1FMWA 2VXFA 2JA8I 3OBWA 3Q1JA 4M78D 3CC7Q 4E31A 1T3LA 2KNBB 3EFSA 4J6XA 2DRKA 4RTUA 2LQ8A 1WHGA 5ECAA 5A2QE 1NPPA 4LXCA 1JXOA 1G3SA
chains in the Genus database with same CATH topology
5IP7I 3EEDA 1BB9A 1AOJA 3HOWI 4MRIA 3IX0A 1MUZA 1U5SA 3C0CA 3ESWA 2K7AA 1VQP1 3EHQA 1VQ8Z 4RVDA 3GKQA 1GRIA 2KT1A 2A36A 4AG2C 3CC21 4RVGA 1NEGA 1N8R1 2YSQA 3REBB 2RHBA 2CDTA 4WCIA 4J9EA 5CM2M 1UJ0A 1VA7A 2HEQA 1QWEA 4CC7A 3NFZA 1N5ZA 2P3YA 5IH2A 1VQ91 3KIHA 3CXCY 1PFTA 1WLPB 2VUGA 1ZLMA 4IIMA 2W10A 3S1RI 3OW2Y 1VQPZ 3MZKB 5FLXf 1KC82 3J7A4 4A3KI 4A3DI 3I56Z 2MCNA 3CC2Z 3CCVZ 4J9DA 1OOTA 1KD11 3EG1A 1VQK1 2V8IA 4NBDA 4EIKA 2L3PA 2ECZA 3CCE1 2K5RA 2EYYA 1TWGI 1VQ9Z 2O31A 1NG2A 1Q861 2DM1A 2ZAEB 1X3ZA 4MD7A 1VQLZ 3H3VJ 2EQIA 1CSKA 2EBPA 3HOZI 2JS0A 4JJDA 3VS1A 1UJYA 2IZ4A 4NBBA 4E2YA 1AWJA 3QWYA 2J7IA 2YADA 3I551 1RNIA 4LN2A 2WAQA 2DBKA 5FW9A 4RTZA 2R7ZI 2QRCB 2B63I 3NGPA 5A2Qf 2EKHA 3ULRB 4AFQC 3CCR1 1AEYA 3TE5B 3HOUI 3G4S1 1USPA 1W2BY 2A28A 2EW3A 3CC7Z 2LFUA 3TSZA 2LIYA 2D8HA 2VF1A 5IP9I 4A3MI 3GTMI 2OTLZ 1SSHA 4RV9A 2JMCA 2GTIA 1T0JA 1K76A 4Z88A 2J6OA 1WXUA 2H8HA 1K0XA 1GBRA 2HCKA 2DRMA 3I55Z 1CKAA 1GBQA 2R6MA 1RO0A 2QRDB 3PO3S 1UG1A 1YJ91 3MZLB 1B3QA 3CCRZ 2QR1B 3G4SZ 3NDJA 1UUEA 2DNUA 2QEX1 5FWCA 3QWXX 1VQ4Z 1YIJZ 2P4RA 3NH8A 5C3EI 2VWFA 2JA6I 3I4NI 2RQWA 4Z89A 1ARKA 2KYBA 2QREB 3CME1 4GLMA 1K1ZA 2GTJA 2JM8A 2F2VA 2M0YA 1HJDA 2K6DA 2KYMA 1KRLA 2GQIA 1QLYA 2FRWA 2JW4A 1AZEA 4JZ3A 2W04A 3CCMZ 3IF8A 1ML8A 4AYBA 2KBTA 1M3CA 3LUSA 4DK1A 4NBCA 2AKKA 3VS5A 1Y1VI 4J9CA 2QEXZ 2DJQA 2DE6A 4DQYB 1WDXA 1WIIA 3H0HA 3I4MI 4BBRI 1BK2A 4NB9A 2OOYB 1I07A 4A3BI 2JR6A 1E6GA 2DYBA 3UF4A 1AVZC 3VRYA 1JU5C 4CC2A 3I35A 1M901 2E5KA 1VQM1 1HSQA 1Q822 3IFUA 3CQZI 1X2KA 4F14A 1AWOA 4A93I 2F4MA 5LL6f 3FQQA 2P28A 1YHQZ 2KRMA 3CPWZ 2LJ0A 1K83I 3NDIA 1VQNZ 2K3RA 2DX1A 2HSPA 3S2DI 2L3QA 3KFVA 3J81f 2NUZA 4E6RA 4QTUA 2YU9I 2OI3A 2YUNA 2B86A 4OMLA 4A3II 4JJBA 1K732 3JAMf 2D0NA 3I5RA 3VRZA 4OMMA 4RTWA 1TWFI 1K8A1 2ED1A 2PMZA 2PM9A 2RQRA 2RNAA 2NVTI 1I1JA 2AK5A 4A63B 1VQOZ 2YDLA 2ED0A 1KFZA 1I3QI 4DEXA 3CQTA 4K11A 2KGTA 1ZUUA 2M48A 5D1PA 1ZUKA 2J6AA 4FSSA 4A3EI 1K9AA 4BY1I 3EHRA 2QA41 5IT9b 1OV3A 1YNZA 2BZ8A 3TVTA 2C0TA 3PVQA 2IZ3A 3CMAZ 4S1TA 1SHGA 2CSIA 1ZBJA 2JMAA 2F2WA 1RO2A 3CCQ1 1MV0B 2AZVA 4A3LI 1M27C 1PRMC 1YN8A 3GTPI 2G6FX 2RPNA 1ABQA 2EVRA 2RQTA 2DL8A 4M4ZA 1WCMI 1TWHI 2RPRA 2KXCA 4ZNXA 3T4NB 3TDHB 2KT8A 1Q7Y1 5L23A 3NPFA 3RNJA 3G711 3CC41 1Y0MA 3EG2A 3VB9A 1KD12 5C4JI 1GFDA 2Y0SA 2RIQA 3CCQZ 1OPLA 1VLAA 1K9M1 2M6NA 5C44I 4RTXA 2DBMA 1U06A 2I0NA 2LZ6B 1Q862 4J9HA 3VS7A 2VKNA 1JJ2Z 2LNHB 3RBBB 2ENMA 2PZ1A 2J05A 2L3SA 2NVXI 1VYTA 2OAWA 4OMOA 2DMOA 3CC4Z 1Z01A 4QTTA 2O4HA 2V8JA 2VUMI 2OTJ1 4RVHA 1YUAA 3CD61 1OPKA 2RQUA 3O5ZA 2PK7A 2CT4A 1Q811 1AWXA 4Z8AA 1VQKZ 3GBQA 3NMZC 3GTKI 1SRMA 3H0IA 4DEYA 2Q51A 3CCL1 3CCEZ 3Q87A 2HU9A 1T3SA 2CT3A 3F3PC 1KC81 2JT4A 2K2MA 4JZ4A 2FO0A 1UFFA 1Y57A 3S1MI 2HDAA 1ZH1A 5C4XI 3UA7A 4RS4A 5IXBA 3CCS1 1YJN1 2LQWA 2RF0A 1RLPC 4D8KA 2NVQI 4E30A 3CCJ1 1QWFA 2CH4W 3A98A 1QCFA 5IHKA 1G2BA 2KRSA 2CSQA 2E2JI 4CL1A 1W70A 3IQLA 4MH4A 2EYWA 2O53A 1W6XA 2MOXA 3CPWY 1VQ61 1KQSZ 1ZB9A 4MD8A 2E2II 2M51A 4JPBW 3HKZA 1JXMA 1NYGA 3PO3I 5HCKA 1TWAI 4E32A 2YUPA 1TG0A 3NH5A 2JXBA 2LQNA 2JNYA 1PHTA 1MV3A 2JM9A 3HOVI 1UHFA 1RO4A 4NB8A 1GCQC 2JA5I 1PKSA 3VMHA 4A3CI 3D9XA 1NJI1 1S1NA 2RT9A 2DL7A 2BJOA 3RZOI 1H3HA 2DL5A 2HBWA 1X27A 4NBAA 1EFNA 1YJ9Z 1CKBA 1U3OA 2ROLA 1X3WA 2YUQA 2CUDA 1VYVA 2JS2A 1NM7A 1WX6A 1X69A 5D1OA 1I0CA 1K0SA 2V8KA 2FEIA 3M0UA 3VS2A 2X3XD 1Z02A 3D6WA 1AD5A 1NLPC 2DL3A 3EG0A 2EYXA 3EGUA 3FKII 1M902 3CMEZ 1ZUYA 3NHNA 1QF8A 4NFRA 1RQFA 3H0FA 1QVGZ 1L1OC 2W0ZA 4ESRA 1M30A 5IHIA 2D1XA 3M0RA 1QKWA 2C0OA 3S15I 3JV3A 3FQMA 2L2PA 1GL5A 1YIT1 1JEGA 3M0QA 2DL4A 2KEAA 1X0TA 1KJWA 2OZKA 1TUCA 3HOYI 3U50C 2PTKA 4KRTA 2ABLA 3SHWA 1FMKA 2ROTA 2IIMA 2BTTA 1K8A2 1TWCI 1W2BZ 2CREA 2HF1A 2LJ3A 1PKTA 3VS0A 1VQMZ 2A37A 2DLPA 2EGAA 2QLVB 5EC7A 3G6E1 2KROA 5T67A 2GGRA 1RLQC 3BG0B 4MD9A 3CCU1 5GJWB 4D8DA 1JJ2Y 2GU2A 1YITZ 2F2XA 3HOXI 3R6NA 2Q4ZA 2AKLA 1PNJA 3H41A 2EGTA 2R92I 3NH4A 1TUDA 3JAMb 2FPDA 1VQ51 2DA9A 4BBSI 3F3FC 4RUGA 2K3BA 1S721 1M3AA 2J6FA 1K4US 5T6BA 4QT7A 2YUOA 2F4OA 3M4OI 3J80f 4E2XA 2NVYI 1WYXA 1N8R2 2ESWA 2C0IA 4J9FA 2FG0A 4HVUA 4RTVA 3EERA 3CCUZ 1VQ81 4CC3A 2KE9A 2QKDA 3LH5A 2LX7A 2A08A 2FRYA 1Q7Y2 2O9VA 3GTJI 1H92A 1PWTA 1VQ5Z 1PRLC 2RMOA 1QVFZ 2DE0X 1WFWA 1X43A 3M0TA 3S1QI 1QKXA 4E2WA 1AZGB 4J9IA 2QA4Z 1WXBA 1K9M2 2D8JA 1M1K1 2X3WD 5T64A 3GCFA 1JWHC 1JQQA 3BG1B 3GTGI 2O2OA 1X2QA 2I3CA 2LMJA 4BXXI 2NWMA 1YWPA 1USPB 2V1RA 1LCKA 1A0NB 1Y1WI 3I561 1KQSY 1H8KA 3CCV1 1UHCA 4Y92A 1ABOA 4HVWA 1Z9ZA 1S7MA 4HCKA 2KPIA 4NBEA 3S1NI 5FLXb 1X6GA 3S2HI 3H0GI 1E6HA 3G71Z 1Q812 1UTIA 2H85A 2DF6A 2V1QA 1B07A 5FWBA 1LQLA 2AZSA 4Y7NI 3P5JB 4TNUA 1VQL1 1GFCA 1WW9A 2JS4A 4F16A 2VVKA 1Z9QA 3TSWA 3M0PA 4AFSC 4RTTA 1SRLA 1TFIA 1G83A 2O9SA 4OMPA 4MXUA 1I6HI 2RN8A 2EPDA 4HXJA 4LUDA 1YP5A 1ZX6A 2GNCA 1RLYA 2OTJZ 1AWWA 3CD6Z 3CC71 1WA7A 4AFZC 4DGLA 2OTL1 2XMFA 1JO8A 1QVGY 5D1OB 5IHNA 5A2Qb 4NBFA 1UGVA 1NEBA 1XOVA 2K79A 3GTOI 3VS4A 1J3TA 2GBQA 3CCLZ 2KXDA 1RI9A 4E33A 2K9GA 2LP5A 1M3BA 1GCQA 3GTMS 2DILA 2DE5A 2L0AA 1NJI2 1UE9A 3I9QA 3U23A 1N2FA 4HH4A 3CCSZ 1T0HA 1YJNZ 3MONA 1KSWA 1VQ41 3CCJZ 1YIJ1 1KIKA 3CXCZ 3PE0A 1GCPA 1V1CA 2BZYA 1P9NA 2SRCA 2W03A 3OW2Z 1VYUA 4LNPA 1ZB8A 1YJW1 2BZXA 5GJVB 4NBHA 1M8MA 2OOXB 3QWUA 1VQ6Z 1SHFA 2CUBA 2E9HA 4HGYA 1SFOI 2LCSA 3UATA 2FPEA 3CCM1 3S17I 4NH1C 3K7AI 2FPFA 3VMGA 3VS3A 1SPKA 1VQ71 1YCSB 1BBZA 4NOZA 1YWOA 1OEBA 3SEMA 3VTNA 4E2ZA 2LJ1A 4J9BA 4RTYA 3UA6A 2G2KA 2JA7I 2SEMA 1YJWZ 4BY7I 4ORZA 4HGZA 2E2HI 1BU1A 3M3YI 4GBQA 4X1VA 1Y1VS 4IIOA 4OMNA 4Y52I 4EWCA 1R9TI 4AG1C 2R93I 3GTLI 1QVFY 3ZL7C 5I22A 2GTHA 1VQ7Z 2JTEA 2PNIA 5AN9F 3S14I 4JJCA 2MIOA 4R0KA 4XX2A 1YI21 1YHQ1 2JMOA 2OJ2A 2DE7A 3THKA 3PO2I 1VQN1 1W1FA 1IO6A 5I11A 4A3FI 4HVVA 3I07A 2GTOA 1Z03A 2RBLA 1DL6A 3FJ5A 1ZSGA 1UDLA 4A3JI 1HD3A 3J81b 1WIEA 1UECA 5IXFA 3VS6A 4OMQA 4NBGA 1NP6A 1VQO1 1YI2Z 1X6BA 1Q821 2J06A 3VMIA 5FLMI 2J6KA 2YT6A 3I5SA 3M0SA 3PVLA 4LE9A 4AFUC 2KI7B 3REAB 2O88A 1NYFA 3S16I 1RUWA 3RZDI 4F17A 1NUIA 4RVFA 2EGCA 1YUKA 1WXTA 1I50I 2DVJA 3GTQI 2JA8I 3G6EZ 1WI7A 4CC4B 4MONA 1QYPA 4J9GA 2EGEA 4E31A 1T3LA 2QDLA 2KNBB 3CMA1 2DRKA 4RTUA 5IT9f 1K731 1NLOC 1FYNA 2JUBA 3EG3A 4LUEA 4X6AI 1SEMA 2EYZA 1M1K2 3KIFA 3J80b 1S72Z 5ECAA 2RQVA 2KR3A 2CH4A 2WB1A 1E7OA 2KRNA 1JXOA 4A3GI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 I;  1BB9 A;  1AOJ A;  3HOW I;  1MUZ A;  1U5S A;  3C0C A;  3ESW A;  2K7A A;  3EHQ A;  3GKQ A;  1GRI A;  2KT1 A;  2A36 A;  4AG2 C;  1NEG A;  2YSQ A;  3REB B;  2CDT A;  4WCI A;  4J9E A;  5CM2 M;  1UJ0 A;  1VA7 A;  2HEQ A;  1QWE A;  4CC7 A;  1N5Z A;  2P3Y A;  5IH2 A;  1PFT A;  1WLP B;  1ZLM A;  4IIM A;  2W10 A;  3S1R I;  4A3K I;  4A3D I;  2MCN A;  4J9D A;  1OOT A;  3EG1 A;  4NBD A;  4EIK A;  2L3P A;  2ECZ A;  2K5R A;  2EYY A;  1TWG I;  2O31 A;  1NG2 A;  2DM1 A;  1X3Z A;  3H3V J;  2EQI A;  1CSK A;  2EBP A;  3HOZ I;  2JS0 A;  4JJD A;  3VS1 A;  1UJY A;  4NBB A;  3QWY A;  1AWJ A;  2J7I A;  4LN2 A;  2DBK A;  5FW9 A;  4RTZ A;  2R7Z I;  2B63 I;  3NGP A;  4AFQ C;  2EKH A;  3ULR B;  1AEY A;  3HOU I;  1USP A;  2A28 A;  2EW3 A;  3TSZ A;  2D8H A;  4Z88 A;  5IP9 I;  4A3M I;  3GTM I;  1SSH A;  2JMC A;  1T0J A;  1K76 A;  2J6O A;  1WXU A;  2H8H A;  1K0X A;  1GBR A;  2HCK A;  2DRM A;  1CKA A;  1GBQ A;  3PO3 S;  1UG1 A;  1B3Q A;  1UUE A;  2DNU A;  5FWC A;  3QWX X;  2P4R A;  2VWF A;  5C3E I;  4Z89 A;  2JA6 I;  3I4N I;  2RQW A;  1ARK A;  2KYB A;  4GLM A;  1K1Z A;  2GTJ A;  2JM8 A;  2F2V A;  2M0Y A;  1HJD A;  2K6D A;  2KYM A;  2GQI A;  1QLY A;  2FRW A;  2JW4 A;  1AZE A;  4JZ3 A;  1ML8 A;  2KBT A;  1M3C A;  3LUS A;  2AKK A;  4NBC A;  3VS5 A;  1Y1V I;  4J9C A;  2DJQ A;  2DE6 A;  1WDX A;  3H0H A;  3I4M I;  4BBR I;  1BK2 A;  4NB9 A;  1I07 A;  4A3B I;  2JR6 A;  1E6G A;  2DYB A;  3UF4 A;  1AVZ C;  3VRY A;  1JU5 C;  4CC2 A;  3I35 A;  2E5K A;  1HSQ A;  1AWO A;  1X2K A;  3CQZ I;  4F14 A;  4A93 I;  2F4M A;  2KRM A;  2LJ0 A;  1K83 I;  2DX1 A;  2L3Q A;  2HSP A;  3S2D I;  3KFV A;  5I11 A;  2NUZ A;  4E6R A;  4QTU A;  2YU9 I;  2OI3 A;  2YUN A;  2B86 A;  4OML A;  4A3I I;  4JJB A;  2D0N A;  3I5R A;  3VRZ A;  4OMM A;  4RTW A;  1TWF I;  2ED1 A;  2RQR A;  2RNA A;  2NVT I;  1I1J A;  2AK5 A;  4A63 B;  2YDL A;  2ED0 A;  1KFZ A;  1I3Q I;  4DEX A;  3CQT A;  4K11 A;  2KGT A;  1ZUU A;  1ZUK A;  2J6A A;  4FSS A;  4A3E I;  1K9A A;  4BY1 I;  3EHR A;  3TVT A;  1YNZ A;  1OV3 A;  2BZ8 A;  2C0T A;  3PVQ A;  2CSI A;  1SHG A;  2JMA A;  1ZBJ A;  2F2W A;  1MV0 B;  2AZV A;  4A3L I;  1M27 C;  1PRM C;  1YN8 A;  3GTP I;  2G6F X;  2RPN A;  1ABQ A;  2EVR A;  2RQT A;  2DL8 A;  4M4Z A;  1WCM I;  1TWH I;  4ZNX A;  2KXC A;  2KT8 A;  5L23 A;  3NPF A;  3RNJ A;  1Y0M A;  3EG2 A;  3VB9 A;  1GFD A;  5C4J I;  1OPL A;  1VLA A;  5C44 I;  4RTX A;  2DBM A;  1U06 A;  2I0N A;  2LZ6 B;  4J9H A;  3VS7 A;  2VKN A;  2LNH B;  3RBB B;  2ENM A;  2PZ1 A;  2J05 A;  2L3S A;  2NVX I;  1VYT A;  2OAW A;  4OMO A;  2DMO A;  4QTT A;  1OPK A;  2VUM I;  3O5Z A;  1YUA A;  2RQU A;  2PK7 A;  2CT4 A;  1AWX A;  4Z8A A;  3GBQ A;  3NMZ C;  3GTK I;  1SRM A;  3H0I A;  4DEY A;  3Q87 A;  1T3S A;  2CT3 A;  4JZ4 A;  2JT4 A;  2K2M A;  2FO0 A;  1UFF A;  1Y57 A;  3S1M I;  2HDA A;  5C4X I;  3UA7 A;  5IXB A;  2LQW A;  2RF0 A;  1RLP C;  4D8K A;  2NVQ I;  3A98 A;  2CH4 W;  1QWF A;  1QCF A;  5IHK A;  1G2B A;  2KRS A;  2CSQ A;  2E2J I;  1W70 A;  3IQL A;  4MH4 A;  2EYW A;  2MOX A;  1W6X A;  1ZB9 A;  2E2I I;  2M51 A;  4JPB W;  1JXM A;  1NYG A;  3PO3 I;  5HCK A;  1TWA I;  2YUP A;  1TG0 A;  2JXB A;  2LQN A;  1PHT A;  2JNY A;  1MV3 A;  2JM9 A;  3HOV I;  1UHF A;  1RO4 A;  4NB8 A;  1GCQ C;  2JA5 I;  1PKS A;  3VMH A;  4A3C I;  1S1N A;  2DL7 A;  2BJO A;  3RZO I;  1H3H A;  2DL5 A;  2HBW A;  1X27 A;  4NBA A;  1EFN A;  1CKB A;  1U3O A;  2ROL A;  1X3W A;  2YUQ A;  2CUD A;  1VYV A;  2JS2 A;  1NM7 A;  1WX6 A;  1X69 A;  1I0C A;  1K0S A;  2FEI A;  3M0U A;  3VS2 A;  2X3X D;  1AD5 A;  3D6W A;  1NLP C;  2DL3 A;  3EG0 A;  2EYX A;  3EGU A;  3FKI I;  1ZUY A;  3NHN A;  3H0F A;  1L1O C;  2W0Z A;  4ESR A;  1M30 A;  5IHI A;  2D1X A;  3M0R A;  1QKW A;  2C0O A;  3S15 I;  3JV3 A;  2L2P A;  1GL5 A;  1JEG A;  3M0Q A;  2DL4 A;  2KEA A;  1KJW A;  1TUC A;  3HOY I;  3U50 C;  2PTK A;  4KRT A;  2ABL A;  3SHW A;  1FMK A;  2ROT A;  2IIM A;  2BTT A;  1TWC I;  2CRE A;  2HF1 A;  2LJ3 A;  1PKT A;  3VS0 A;  2A37 A;  2DLP A;  2EGA A;  5EC7 A;  2KRO A;  2GGR A;  1RLQ C;  5GJW B;  4D8D A;  2F2X A;  3HOX I;  3R6N A;  2AKL A;  1PNJ A;  3H41 A;  2R92 I;  1TUD A;  2FPD A;  2DA9 A;  4BBS I;  4RUG A;  2K3B A;  1M3A A;  2J6F A;  1K4U S;  4QT7 A;  2YUO A;  2F4O A;  3M4O I;  2NVY I;  1WYX A;  2ESW A;  4J9F A;  2C0I A;  2FG0 A;  4HVU A;  4RTV A;  3EER A;  4CC3 A;  2KE9 A;  3LH5 A;  2LX7 A;  2A08 A;  2FRY A;  2O9V A;  1H92 A;  3GTJ I;  1PWT A;  2RMO A;  1PRL C;  2DE0 X;  1WFW A;  1X43 A;  3M0T A;  3S1Q I;  1QKX A;  4J9I A;  1AZG B;  1WXB A;  2D8J A;  2X3W D;  3GCF A;  1JQQ A;  3GTG I;  2O2O A;  1X2Q A;  2NWM A;  2LMJ A;  4BXX I;  1YWP A;  1USP B;  2V1R A;  1LCK A;  1A0N B;  1Y1W I;  1UHC A;  1H8K A;  4Y92 A;  1ABO A;  4HVW A;  1Z9Z A;  4HCK A;  2KPI A;  4NBE A;  3S1N I;  1X6G A;  3S2H I;  3H0G I;  1E6H A;  1UTI A;  2DF6 A;  2V1Q A;  1B07 A;  5FWB A;  1LQL A;  2AZS A;  4Y7N I;  1GFC A;  1WW9 A;  2JS4 A;  4F16 A;  2VVK A;  1Z9Q A;  3TSW A;  3M0P A;  4AFS C;  4RTT A;  1SRL A;  1TFI A;  1G83 A;  2O9S A;  4OMP A;  1I6H I;  2RN8 A;  2EPD A;  4HXJ A;  4LUD A;  1YP5 A;  1ZX6 A;  2GNC A;  1RLY A;  1AWW A;  1WA7 A;  4AFZ C;  2XMF A;  1JO8 A;  5IHN A;  4NBF A;  1UGV A;  1NEB A;  1XOV A;  2K79 A;  3GTO I;  3VS4 A;  1J3T A;  2GBQ A;  2KXD A;  1RI9 A;  2K9G A;  2LP5 A;  1M3B A;  1GCQ A;  3GTM S;  2DIL A;  2DE5 A;  2L0A A;  1UE9 A;  3I9Q A;  3U23 A;  1N2F A;  1T0H A;  1KSW A;  1KIK A;  3PE0 A;  1GCP A;  1V1C A;  2BZY A;  2SRC A;  1VYU A;  4LNP A;  1ZB8 A;  2BZX A;  5GJV B;  4NBH A;  1M8M A;  3UAT A;  1SHF A;  2CUB A;  2LCS A;  1SFO I;  2FPE A;  3S17 I;  3K7A I;  2FPF A;  3VMG A;  3VS3 A;  1SPK A;  1YCS B;  1BBZ A;  4NOZ A;  1YWO A;  1OEB A;  3SEM A;  2LJ1 A;  4J9B A;  4RTY A;  3UA6 A;  2JA7 I;  2SEM A;  4BY7 I;  4ORZ A;  1BU1 A;  2E2H I;  3M3Y I;  4GBQ A;  4X1V A;  1Y1V S;  4IIO A;  4OMN A;  4Y52 I;  1R9T I;  4AG1 C;  2R93 I;  3GTL I;  3ZL7 C;  5I22 A;  2JTE A;  2PNI A;  4JJC A;  3S14 I;  2MIO A;  4R0K A;  4XX2 A;  2OJ2 A;  2DE7 A;  3THK A;  3PO2 I;  1W1F A;  1IO6 A;  4A3F I;  4HVV A;  3I07 A;  2GTO A;  2RBL A;  1DL6 A;  3FJ5 A;  1ZSG A;  1UDL A;  4A3J I;  1HD3 A;  1WIE A;  1UEC A;  5IXF A;  3VS6 A;  4OMQ A;  4NBG A;  1X6B A;  2J06 A;  2YT6 A;  3VMI A;  5FLM I;  2J6K A;  3I5S A;  3PVL A;  3M0S A;  4LE9 A;  4AFU C;  3REA B;  2O88 A;  1NYF A;  3S16 I;  1RUW A;  3RZD I;  4F17 A;  1NUI A;  2EGC A;  1WXT A;  1I50 I;  2DVJ A;  3GTQ I;  2JA8 I;  1WI7 A;  4CC4 B;  1QYP A;  4J9G A;  2EGE A;  1T3L A;  2QDL A;  2KNB B;  2DRK A;  4RTU A;  1NLO C;  4LUE A;  1FYN A;  3EG3 A;  4X6A I;  1SEM A;  2EYZ A;  5ECA A;  2RQV A;  2KR3 A;  2CH4 A;  1E7O A;  2KRN A;  1JXO A;  4A3G I; 
#chains in the Genus database with same CATH topology
 2YXY A;  3RR6 A;  2JIM A;  4IUT A;  1AOJ A;  3IX0 A;  3X26 B;  1MUZ A;  3G4S Q;  3EFO A;  3ESW A;  4V2S A;  2FZG B;  1EZZ B;  3C95 A;  5C6S A;  2KT1 A;  4PKC C;  4C8Q F;  4RVG A;  1N8R 1;  1VQ5 A;  5CM2 M;  3GF5 A;  4M7D G;  4FSX A;  2P3Y A;  3KIH A;  2CP6 A;  3S1R I;  1WQ7 A;  4KGV B;  4PFP A;  1K8A U;  2NAP A;  2K2V A;  5FLX f;  3JRZ A;  1M9S A;  4A3K I;  4A3D I;  3I56 Z;  3JCM J;  4J9D A;  1N27 A;  1RAI B;  1WHK A;  4L5G A;  4IKF A;  3CCE 1;  2K5R A;  2EYY A;  1TWG I;  1VQ9 Z;  5KE2 A;  2ZCF B;  4M75 A;  2RI5 A;  1M1K R;  4GLK A;  4MD7 A;  4JLI A;  1CSK A;  2VGN A;  3HOZ I;  2JS0 A;  4JJD A;  2IZ4 A;  3MP1 A;  2F5K A;  3MHX A;  3QWY A;  3L2R A;  3I56 A;  2DBK A;  1V76 A;  4A4H A;  2QRC B;  4XU0 A;  4AFQ C;  2EQK A;  1USP A;  2QQR A;  4F7U B;  5KE3 A;  2OTL Z;  3PMI A;  3OMC A;  4EMK B;  2H8H A;  3T9N A;  3AT1 B;  1GBQ A;  2QRD B;  3PO3 S;  1UG1 A;  1YJ9 1;  1D1B A;  3CCR Z;  4QQG A;  2QR1 B;  1UUE A;  2X4Y A;  4ELZ C;  3CCS A;  1VQ4 Z;  2VC8 A;  3NH8 A;  4Z89 A;  5GAN 6;  5GAM j;  1ARK A;  4JS5 A;  3CME 1;  2GTJ A;  2JM8 A;  5FRM A;  1QLY A;  5LJ3 f;  3CCM Z;  3IF8 A;  3LUS A;  2E70 A;  3OYK A;  1ZQ1 A;  3VS5 A;  2QEX Z;  4EMH A;  2RHI A;  4FYV B;  2OOY B;  5I2M A;  2JR6 A;  3CD6 T;  1JU5 C;  4BDY A;  3I35 A;  3BE3 A;  2MK5 A;  4X9D A;  1Y7X A;  2F4M A;  3R6O A;  3SB2 A;  4HCB A;  5LL6 f;  2P28 A;  4JRQ A;  2HD0 A;  3WVE B;  5GAN d;  3ZFJ A;  1VQN Z;  3S2D I;  2M1H A;  2NUZ A;  4MDW A;  4C8Q D;  2YUN A;  1WHM A;  5D6Y A;  3VRZ A;  4OMM A;  4RTW A;  4QVC A;  3CPW P;  2PMZ A;  1PCX A;  1N6A A;  2PM9 A;  2RQR A;  1Q95 G;  4XAX B;  3VJP A;  1VQO Z;  2YDL A;  2DXB A;  2KGT A;  3SD4 A;  4JS4 A;  5D1P A;  2J6A A;  4FSS A;  1ZSZ A;  5A0D A;  1K9A A;  1TU0 B;  2QA4 1;  5IT9 b;  2JN0 A;  3PVQ A;  4S1T A;  2JMA A;  1ZBJ A;  2F2W A;  2IPO B;  3OQ5 A;  3HHT B;  3CCQ 1;  1MV0 B;  2NUP A;  5L8R E;  4EMG A;  1M90 R;  4M7D C;  3GTP I;  4UC4 A;  1ABQ A;  1M90 C;  2YRC A;  3F70 A;  3S6W A;  1S72 A;  1I5O B;  3OYL A;  2KXC A;  2KY9 A;  4M7A B;  1F1B B;  4E7J A;  3MKD A;  3P8B B;  1U1S A;  4DA4 A;  3G71 1;  1PSF A;  2XU8 A;  3VB9 A;  1KD1 2;  1VLA A;  1RL2 A;  4PL6 A;  3MEV A;  4QW2 A;  4LDY A;  3VS7 A;  4B6M A;  2LNH B;  4E7I A;  6AT1 B;  4M78 B;  4OMO A;  2DMO A;  1YI2 T;  2E64 A;  4QTT A;  1OPK A;  2VUM I;  2V8J A;  2OTJ 1;  1OZ3 A;  2RQU A;  4RKU E;  3DB3 A;  2BE7 D;  3V8K A;  3V7C A;  1EIF A;  1UGQ B;  2BKD N;  1SRM A;  1WHJ A;  3A8O B;  1KK7 A;  1N8R R;  3CCE Z;  1VQM Q;  3LGL A;  1N8R C;  1ZH1 A;  1M1K U;  3LW5 E;  1VQL A;  1RLP C;  2PVD B;  4D8K A;  4E30 A;  3CCJ 1;  1QWF A;  1YBY A;  3A98 A;  4BE2 A;  2KRS A;  3RIR A;  5GAO p;  1NE8 A;  3X28 B;  4PJO G;  5GAM g;  2O4X B;  2O53 A;  2MOX A;  1K9M C;  3CCE A;  3GNF B;  1KQS Z;  1ZB9 A;  2M51 A;  2EAY A;  1JXM A;  2YUP A;  1PHT A;  3ZEH A;  1MV3 A;  2CGH A;  3HOV I;  1GCQ C;  2JA5 I;  3D9X A;  3QJ6 A;  2JUF A;  2BJO A;  2QTX A;  2X4W A;  2DL5 A;  4NBA A;  1U3O A;  1YJ9 Z;  4BY6 C;  1NM7 A;  3VV0 A;  2YLC A;  3CCV T;  3EGX B;  5D1O A;  3JB9 J;  1AD5 A;  1ZA1 B;  1M90 2;  3CME Z;  4M78 G;  3ER0 A;  2LNV A;  3NHN A;  1TOV A;  4NFR A;  1Y71 A;  4ZGD B;  4F7U A;  1L1O C;  1YJ9 A;  2D1X A;  3C4S A;  2DER A;  1UB4 A;  4EMK A;  1GL5 A;  1LVK A;  1YIT 1;  4C0D C;  2DL4 A;  1KJW A;  2OZK A;  4KRT A;  1FMK A;  4L59 A;  2HKQ B;  2F5T X;  2ROT A;  2EQU A;  2HBP A;  1W2B Z;  2CRE A;  3CC7 T;  4QVD A;  2LJ3 A;  1PKT A;  1QVG S;  2QQA A;  4QVZ A;  1NJI R;  2JTF A;  5T67 A;  4X34 A;  2M9U A;  1NJI C;  4C0F A;  3BG0 B;  3CCU 1;  2DYI A;  2R5A A;  1YHQ A;  3MO8 A;  2AKL A;  3VUZ A;  3CPW A;  2EGT A;  2F69 A;  2E6N A;  3G4S T;  3FC3 A;  2F4O A;  1D0Z A;  2NVY I;  1N8R 2;  2ESW A;  2C0I A;  4J9F A;  4M7D E;  2FG0 A;  3CCS Q;  1NPR A;  1VQ8 1;  4CC3 A;  3X20 B;  2RH2 A;  3LH5 A;  1IHV A;  2A08 A;  1H92 A;  3PNW C;  1FMV A;  2EJF A;  4LDW A;  5FU6 B;  2QA4 Z;  1QW1 A;  3P8H A;  1K9M 2;  3WXM B;  5T64 A;  3GCF A;  3KXT A;  1JWH C;  1JQQ A;  3GTG I;  3HL8 A;  2LMJ A;  3CPF A;  1YWP A;  1Y1W I;  1KQS Y;  1WZO A;  3IR7 A;  3DLL A;  5CO7 A;  4J6W A;  2LT1 A;  4HCK A;  2EJ9 A;  1U8R A;  3S2H I;  3H0G I;  1E6H A;  3G71 Z;  1Q81 2;  2H85 A;  1PSE A;  4NL2 A;  5LJ5 d;  2AZS A;  1XJW B;  5GAM h;  3CCQ A;  1MMD A;  2VVK A;  5CCA A;  3TSW A;  4RTT A;  5FRO A;  3VU3 C;  2O9S A;  4OMP A;  4MXU A;  3L1A A;  2EPD A;  4XK8 E;  3A8L B;  1QVP A;  4AMC A;  3G71 A;  2OTJ Z;  3M59 A;  4RG8 A;  1B34 B;  2XMF A;  5GAN 2;  4PJO C;  1NEB A;  4M7A A;  1J3T A;  2A7Y A;  2GBQ A;  3OS2 A;  1RI9 A;  2GFA A;  2LP5 A;  3G6E Q;  2AYD A;  2LCL A;  2CYZ B;  1NJI 2;  1X6O A;  3LWI A;  3I9Q A;  2JIQ A;  4CRI A;  1N2F A;  1QQJ A;  1U1T A;  3FEO A;  3MON A;  2OTJ A;  1KIK A;  3CCJ Z;  1YIJ 1;  1S72 Q;  4LNP A;  1ZB8 A;  2DPP B;  1M8M A;  3OYY A;  2DEU A;  2RJC A;  1SHF A;  2LCS A;  3CC2 T;  2FPE A;  2YWW A;  4M78 C;  4C8Q G;  2QYZ A;  3VMG A;  3M54 A;  1SPK A;  1VQ7 1;  1YCS B;  3VS3 A;  4IUU A;  2MAM A;  1OEB A;  3JCM c;  3OW2 S;  1YJW Z;  3L42 A;  1G8X A;  5AT1 B;  4D6W A;  1RAH B;  2M0O A;  3P8D A;  4IUQ A;  3ASK A;  2GTH A;  2JTE A;  4E47 A;  2OX7 A;  5DY9 A;  4XX2 A;  3L2Z A;  2DE7 A;  2O4X A;  4OMF B;  4HVV A;  2VPX A;  2DKG A;  2GTO A;  5GAM e;  5FLX E;  4C0Z A;  3J81 b;  4FYX B;  1VQL Q;  1WIE A;  2NLU A;  3VS6 A;  4Z02 A;  1X6B A;  1NP6 A;  2RHZ A;  3JCM d;  1UGR B;  2YT6 A;  3VMI A;  3I5S A;  3MEW A;  4LE9 A;  4R56 A;  3M0S A;  1W2B S;  1LJO A;  3S16 I;  2JVV A;  2PVG B;  4MDX A;  2O01 E;  3EAE A;  1WXT A;  3EGX A;  2DVJ A;  3OMG A;  2NYS A;  3GTQ I;  1C6V X;  2L3R A;  4J9G A;  2EGE A;  5KYU B;  4QKU A;  2QDL A;  5AYF A;  3CMA 1;  4X9C A;  3PT9 A;  1YIT A;  2WSF E;  9ATC B;  3OYA A;  2RQV A;  2WB1 A;  2LQK A;  1E7O A;  2KRN A;  2EWN A;  2DO3 A;  1AHJ B;  3H9N A;  1G3Y A;  3HPW A;  3C0C A;  2K7A A;  4II1 A;  1VQ8 Z;  3CCU A;  3GKQ A;  1GRI A;  2A36 A;  1BI3 A;  4J9E A;  1UJ0 A;  1PD0 A;  1VA7 A;  2HEQ A;  4CC7 A;  4OB1 B;  1N5Z A;  1VQ9 1;  3QZ9 B;  1ZLM A;  4IIM A;  2W10 A;  1VQP Z;  1G3W A;  3QKJ A;  2MCN A;  3CC2 Z;  1VQM T;  1KD1 1;  1VQK 1;  4DQ2 A;  4EIK A;  2LC4 A;  2QI2 A;  1K73 C;  1NG2 A;  4B9W A;  2ZAE B;  4PJO E;  3H3V J;  3VS1 A;  1YHQ Q;  4IUV A;  1VIF A;  1WZN A;  1P92 A;  2RK1 A;  3PMT A;  2YAD A;  3M4G A;  2DXT A;  4WTO B;  1QCO A;  2DTH A;  5FW9 A;  4RTZ A;  2B63 I;  3NGP A;  3CCR 1;  2DFU A;  3TE5 B;  3HOU I;  1WGS A;  2LIY A;  4A3M I;  3GTM I;  1T0J A;  2ZPF B;  1K76 A;  2J6O A;  1WXU A;  1K0X A;  2R57 A;  2HCK A;  5A0L A;  2PUK B;  3I55 Z;  1M1G A;  4C8Q C;  1CKA A;  3CCL A;  1C0M A;  4JLG A;  3SDZ A;  2DTO A;  3MZL B;  4M78 E;  1B3Q A;  2X4X A;  3MPU B;  4Y91 A;  2QEX 1;  4BI4 A;  1YIJ Z;  2VWF A;  1YJN A;  5C3E I;  2H3E B;  3I4N I;  3HRS A;  4FIB A;  5GAN 3;  4GLM A;  2X9H A;  2QAZ A;  2HMA A;  1ACM B;  2M0Y A;  2F2V A;  3J80 E;  5LJ3 j;  2K6D A;  2FRW A;  4XTU A;  1AZE A;  2DZC A;  2W04 A;  1WPY A;  1HK9 A;  1B34 A;  3LLR A;  1Y1V I;  3CCQ Q;  4A4F A;  2E65 A;  4BAC A;  2DJQ A;  4PJJ A;  1WII A;  3I4M I;  4BBR I;  2V3V A;  1WJ2 A;  4C92 F;  1E6G A;  2DYB A;  5DM7 R;  1AVZ C;  1KG1 A;  3S3O A;  1M90 1;  1AWO A;  3IFU A;  4A93 I;  4Q5W A;  1VQ7 A;  1K83 I;  1ZA2 B;  2KMT A;  3KFV A;  2L3Q A;  2HSP A;  4QTU A;  3OYD A;  2I2L A;  4OF1 A;  3CCS T;  2B86 A;  4OML A;  4A3I I;  4KUD K;  1K73 2;  2D0N A;  3TEE A;  4WF2 A;  1TWF I;  2ED1 A;  2AK5 A;  5CKE A;  4DEX A;  3FDR A;  3CQT A;  1ZUU A;  2M48 A;  1ZUK A;  2E1H A;  2ZPG B;  3EHR A;  3TVT A;  1YNZ A;  2H3J A;  3CMA Z;  4DBH A;  5CVI A;  2JZ2 A;  4A3L I;  1M27 C;  3WVD B;  5GAN f;  2EIF A;  2DJZ A;  2DL8 A;  4M4Z A;  3JB9 I;  1TWH I;  2YRD A;  2VPZ A;  1MND A;  4LDU A;  3OYI A;  5L23 A;  4BDZ A;  3EG2 A;  4FW2 A;  2Y0S A;  3CMA A;  1OPL A;  1K9M 1;  2DZ9 A;  2DBM A;  1OX9 A;  4BY6 B;  2VKN A;  2ENM A;  2MPX C;  2PZ1 A;  2R5M A;  1VIE A;  5KYU A;  1VYT A;  2K5L A;  1HXD A;  3CC4 Z;  4RVH A;  3CD6 1;  2CP7 A;  3QYG B;  3OS5 A;  2CT4 A;  1Q81 1;  1AWX A;  2LT4 A;  4Z8A A;  4A4E A;  1VQK Z;  3G6E T;  1JJ2 S;  2FYK A;  3GTK I;  4DEY A;  2Q51 A;  4FT4 A;  1D1C A;  1T3S A;  2JT4 A;  1VQ9 A;  4C0D B;  1UFF A;  1Y57 A;  3S1M I;  2HDA A;  3QJY A;  1MMG A;  5C4X I;  3UA7 A;  1S72 T;  2FVU A;  1YIT Q;  1Q7Y R;  2RF0 A;  3OY9 A;  2JIP A;  1KHC A;  2WSC E;  4MZP A;  4C8Q E;  1Q7Y C;  2CZ6 B;  1IHW A;  3CBM A;  3EGD B;  1VQK A;  3A8H B;  1KD1 R;  2QQB A;  4M77 F;  3C94 A;  1W6X A;  4C92 D;  4IUP A;  1KD1 C;  4OB2 B;  2L8D A;  3CCU Q;  4E32 A;  2JXB A;  5LJ3 g;  2OTL A;  2MI6 A;  1BIA A;  4NB8 A;  3BDU A;  3QPH A;  3O8V A;  1S1N A;  2K3Y A;  1NJI 1;  2DL7 A;  1KQS P;  1VUB A;  1EFN A;  1CKB A;  2ZAE A;  1X3W A;  1VYV A;  2JS2 A;  2A3L A;  3CCR A;  2IVW A;  4OGC A;  3MEA A;  2HL5 C;  3VS2 A;  2X3X D;  1VQ4 A;  3M56 A;  3FKI I;  3V7R A;  5C0M A;  2KQW A;  4J7I A;  1QF8 A;  1VQL T;  1QVG Z;  1BI1 A;  4ESR A;  2XK0 A;  5IHI A;  4EPC A;  3OYM A;  3CCM A;  1KHI A;  2C0O A;  3M0R A;  3S15 I;  2QEX A;  1X0T A;  2ABL A;  4HKE A;  2IIM A;  5I21 A;  3CBP A;  1G5V A;  1WJS A;  2A37 A;  5EC7 A;  3SFM A;  2KRO A;  1RLQ C;  2BUD A;  5GJW B;  4PNO A;  2V26 A;  2ATC B;  1XNI A;  1PNJ A;  1IGU A;  3NH4 A;  1VQN A;  4BBS I;  4C5I A;  4RUG A;  3CCL Q;  2K3B A;  4M7D A;  3J80 f;  5DLQ E;  3ME9 A;  4R55 A;  4PJO B;  4HVU A;  1YJN Q;  4M75 F;  2RI2 A;  1VQO A;  1OU9 A;  5D7U A;  2LX7 A;  1O9S A;  2FRY A;  1Q7Y 2;  1I5L A;  3GTJ I;  2RMO A;  1PRL C;  3NFC A;  4DBQ A;  4NOY A;  1X43 A;  2NUT B;  3S1Q I;  4E2W A;  4KH1 B;  1WXB A;  1VQ6 Q;  3MCA B;  2X3W D;  2BIV A;  3PIO A;  1HYO A;  2O2O A;  1X2Q A;  4BI8 B;  5GAO n;  1MMN A;  3BY7 A;  1UHC A;  2RJD A;  3CCV 1;  1QVF S;  5D6X A;  2ZPB B;  2KPI A;  2RHX A;  3V7S A;  3S1N I;  1PC0 A;  1BKB A;  1YHQ T;  4M77 D;  2C06 A;  2WAC A;  3HP9 A;  1OYX A;  3KUF A;  1VQ7 Q;  4Y7N I;  4TNU A;  1Z9Q A;  3OYJ A;  3QBY A;  1G83 A;  5LJ3 h;  1I6H I;  3QZ5 B;  2GNC A;  1G3T A;  1RLY A;  2G3R A;  3CD6 Z;  3L2V A;  3CC7 1;  1JO8 A;  1QVG Y;  5A2Q b;  4B9X A;  4NBF A;  4KGZ B;  1XOV A;  3VS4 A;  1K9M R;  1SG5 A;  4E33 A;  2RHY A;  4J7F A;  1GCQ A;  3GTM S;  2DE5 A;  2L0A A;  5LJ5 f;  1UE9 A;  3PTA A;  4HH4 A;  1VQ5 Q;  1GCP A;  2W03 A;  3OW2 Z;  1Q81 R;  1RAG B;  2BZX A;  1YJW 1;  3H8Z A;  5GJV B;  3JAM E;  2CP3 A;  2OOX B;  2DEQ A;  2LRQ A;  3CBO A;  1IB8 A;  1KD1 U;  3CCQ T;  1Q81 C;  3QWU A;  3UAT A;  1SFO I;  1MMA A;  2MWO A;  1KQS A;  4N0A C;  2HQX A;  2DVE A;  3CXC S;  3QO3 A;  3VTN A;  2LJ1 A;  4J9B A;  3UA6 A;  5KYW B;  3E19 A;  1FDO A;  4BY7 I;  4HGZ A;  4XTX A;  3MJX A;  1Y1V S;  4OMN A;  4N4H A;  1R9T I;  3ZL7 C;  2VUB A;  2MIO A;  3I56 Q;  3EGD A;  4M75 D;  4KT0 E;  3CME A;  1W1F A;  3TCJ A;  3JB9 F;  1VQ9 Q;  3I07 A;  2E6Z A;  1SSF A;  3H6Z A;  3FJ5 A;  1ZSG A;  1UDL A;  2P4T A;  4A3J I;  5CKF A;  5IAY A;  2EFI A;  4GY5 A;  4OMQ A;  2DXU A;  4NBG A;  5LJ3 e;  5GAN 5;  1YI2 Z;  2J6K A;  3MP8 A;  4FW1 A;  3MEU A;  1W2B A;  4RVF A;  2EGC A;  3OSS C;  4OB3 B;  4PJM A;  2VB6 A;  1QYP A;  2VPW A;  4FM4 B;  2RB6 A;  2OTL Q;  4RCC A;  2YRV A;  4J8O A;  1K73 1;  1NLO C;  1IRE B;  3LX7 A;  4X6A I;  2GQV A;  1SEM A;  3GLX A;  1D1A A;  2KR3 A;  4A3G I;  5IP7 I;  3EED A;  1BB9 A;  2E3I A;  4MRI A;  3CCR Q;  3J7A F;  8AT1 B;  1VQP 1;  3EHQ A;  1M90 U;  1VQ4 Q;  2D6F A;  3JCM f;  4AG2 C;  3CC2 1;  5HK3 A;  4C8Q B;  2YSQ A;  1IGQ A;  2ZZD A;  4OVA A;  3JCM W;  2D9T A;  4WCI A;  1OX8 A;  1QWE A;  2B8A A;  5IH2 A;  2QA4 A;  3CCM Q;  1WLP B;  3OW2 Y;  2P84 A;  5I2S A;  1N9S A;  2QEX Q;  5CIU A;  3J7A 4;  1KQ1 A;  3CCV Z;  1OOT A;  3V8J A;  2V8I A;  3HRU A;  2ECZ A;  1YIT T;  4PJO A;  4LDV A;  2PUO B;  4J5Y A;  5CAI A;  2DM1 A;  2EQI A;  2EBP A;  4QQ6 A;  3AHU A;  4O5V A;  2BE9 B;  3EFR A;  2NUT A;  1H64 1;  4NBB A;  1VQN Q;  1AWJ A;  2L5Q A;  2J7I A;  3CCV A;  3I55 1;  4LN2 A;  1N8R U;  2L89 A;  5GAM d;  2WAQ A;  3CCU T;  2R7Z I;  2EKH A;  3ULR B;  4KGX B;  1AEY A;  3OYG A;  5J3B A;  1W2B Y;  3TSZ A;  3CC7 Z;  3HFN A;  4LD6 A;  2D8H A;  4F7U F;  1SSH A;  4RV9 A;  1VQO Q;  2VPY A;  4FYW B;  2HSE B;  4ATO A;  1NZ9 A;  1K9M U;  1GBR A;  4M78 A;  2Y4Y A;  3S3N A;  1FX7 A;  2R6M A;  4ME7 A;  2DIQ A;  3JB9 D;  1VOM A;  3G4S Z;  2E10 A;  4ZTF A;  3UDC A;  3NDJ A;  2KK4 A;  5FWC A;  3OYC A;  3CCJ A;  2QRE B;  4ANJ A;  3RKW A;  1Q81 U;  1K1Z A;  2K3X A;  4HT8 A;  1Q86 C;  3LYI A;  4OP0 A;  2KYM A;  2GQI A;  4AYB A;  2KBT A;  2QXF A;  4DK1 A;  2XI9 A;  2HNI A;  3JCM P;  5FU7 B;  1WDX A;  5GMK m;  3H0H A;  1BK2 A;  2CP5 A;  4A3B I;  1YJW A;  2EJG A;  3VRY A;  2E5K A;  1SF9 A;  1VQM 1;  3HRT A;  4KUI A;  1Q82 2;  1X2K A;  3CQZ I;  4F14 A;  3CCL T;  2E5Q A;  2KRM A;  2LJ0 A;  4NL3 A;  3NDI A;  2K3R A;  2DX1 A;  5I11 A;  3J81 f;  3CEY A;  1PM3 A;  4E6R A;  2OI3 A;  3CCE Q;  1NJI U;  1O75 A;  4LDX A;  1YJN T;  5CKD A;  4JJB A;  3JAM f;  3I5R A;  4HCZ A;  4N4I A;  1IXD A;  2XDP A;  1H3Z A;  4O6J A;  1MGQ A;  3D2L A;  1SIW A;  3E1S A;  2RNA A;  2NVT I;  1I1J A;  3CPW S;  4A63 B;  1RAC B;  3M9Q A;  1KFZ A;  5KYW A;  2JIO A;  2MMP A;  1I3Q I;  1RAF B;  1VQ6 T;  4K11 A;  4BD3 A;  2E41 A;  2C0T A;  1M2V B;  3RMS A;  5GAN j;  4KH0 B;  2AZV A;  2G6F X;  2RPN A;  5GMK i;  2EVR A;  2RQT A;  1BI2 A;  1WCM I;  2KDS A;  1YJ9 Q;  4CI0 C;  1VQ7 T;  3TDH B;  2KT8 A;  4M7A F;  4C92 C;  4ZN3 A;  1Q7Y 1;  3NPF A;  3RNJ A;  3CC4 1;  1Y0M A;  3GOX A;  1Y96 B;  2RIQ A;  4PJL A;  1VQ8 A;  5C44 I;  3QHS A;  3CME Q;  1K73 R;  2I0N A;  2LZ6 B;  1Q86 2;  1K8A C;  1JJ2 Z;  2J05 A;  2QQS A;  2OAW A;  1V29 B;  4L6V 5;  1VQP A;  3O5Z A;  3RER A;  2E3H A;  3E2U A;  7AT1 B;  2PK7 A;  3L2U A;  2E4H A;  3CC2 A;  3GBQ A;  4XQ3 A;  3NMZ C;  1BI0 A;  4FYY B;  5GMK j;  2HU9 A;  3F3P C;  1KC8 1;  1JBM A;  1TH7 A;  2FO0 A;  3QII A;  1VQ5 T;  1WNL A;  4VUB A;  2ZGW A;  4C8Q A;  5IXB A;  3CCS 1;  3FLG A;  2CH4 W;  5LL6 S;  2E2J I;  1RAB B;  2EQM A;  1W70 A;  2EKO A;  4Y28 E;  4M75 G;  1DJ7 B;  4MD8 A;  3FB9 A;  2JIR A;  1TWA I;  2P0Q A;  5D6W A;  1TG0 A;  4PJN A;  1M8V A;  2LQN A;  1UHF A;  4HCC A;  3SWN C;  2LX9 A;  1PKS A;  2M02 A;  1BCM A;  1IZ6 A;  3RKX A;  2RT9 A;  3RZO I;  3I55 A;  2HBW A;  1X27 A;  1FXX A;  3DKM A;  2QA4 Q;  2Y4X A;  5KYX B;  3I56 T;  3HKS A;  5IT9 E;  3M0U A;  3D6W A;  1NLP C;  1ZBX A;  2CP0 A;  3VKI A;  1YIJ A;  3EG0 A;  2EYX A;  3EGU A;  3RES A;  2EQJ A;  2VV5 A;  1VQ9 T;  1ZUY A;  2ZPE B;  1WQW A;  1MHN A;  1D0Y A;  2XDB A;  5KYN A;  1RQF A;  1Y8C A;  3VUB A;  3H0F A;  3G71 Q;  4PLI A;  1IRX A;  1QP2 A;  1QKW A;  3GPL A;  3JV3 A;  2L2P A;  3NTH A;  1JEG A;  3M0Q A;  3M58 A;  1M1F A;  3LH0 A;  2QGG A;  1TUC A;  2PTK A;  3U50 C;  4QQD A;  3SHW A;  2DK3 A;  3X25 B;  1D3B B;  1QVG P;  2BTT A;  1N9R A;  1K8A 2;  3OSV A;  2XD0 A;  2E7Z A;  5A0G A;  2OTL T;  3BDL A;  1VQM Z;  2DLP A;  1FWZ A;  2EGA A;  2QLV B;  3M55 A;  3G6E 1;  4M77 C;  4M7A D;  2OTJ Q;  2GGR A;  4MD9 A;  1JJ2 Y;  2HQE A;  4OGE A;  2K5F A;  3CCR T;  5CKH A;  3F3F C;  5GAN g;  1S72 1;  1M3A A;  5GAN 7;  5KYY B;  4N4G A;  4QT7 A;  1K4U S;  2YUO A;  3M4O I;  3FRN A;  1VQ4 T;  1VQM A;  4RTV A;  3CCJ Q;  2DIG A;  2QK0 A;  4P5N A;  1PWT A;  5FU7 C;  3CCM T;  1VQ5 Z;  4LD9 K;  1QVF Z;  1WFW A;  4C92 E;  2JOY A;  1W4S A;  3M0T A;  4J9I A;  4EDU A;  1AZG B;  2QEX T;  1FDI A;  1R0B G;  3HSB A;  2I3C A;  2QG9 B;  4BXX I;  2QDY B;  1LCK A;  1A0N B;  4Y92 A;  1ABO A;  4HVW A;  1S7M A;  1YJW Q;  3S3M A;  4NBE A;  1QVF A;  5FLX b;  2DTI A;  4MZT A;  1UTI A;  2D0Q B;  2DF6 A;  2V1Q A;  1B07 A;  4IUR A;  1LQL A;  5FWB A;  3URG A;  5GAO m;  1VQN T;  1YCY A;  3P5J B;  1VQL 1;  3RUX A;  1C1A A;  3JB9 G;  4JRP A;  4F16 A;  1K73 U;  4JUV A;  2VXE A;  1SRL A;  3FIF A;  3C12 A;  2F1L A;  2KVQ G;  3OBY A;  1M2V A;  3E9F A;  3X24 B;  4HXJ A;  3EG9 B;  4LUD A;  1VQO T;  2FZK B;  2JJ9 A;  3CC4 A;  2RA2 A;  4FU6 A;  1M5Q 1;  2JTM A;  5D1O B;  4M75 C;  1UGV A;  1M1K C;  3GTO I;  2KXD A;  5LJ5 j;  1Y96 A;  5CQX A;  5HY6 A;  3NTI A;  3CCS Z;  3GIB A;  4HT9 A;  1KSW A;  1NBE B;  3CXC Z;  1V1C A;  2BZY A;  2VYT A;  2SRC A;  1UGP B;  4E2F B;  3KBG A;  4NBH A;  4PLL A;  2DXC A;  3RKY A;  2E9H A;  4HGY A;  3QDF A;  2V45 A;  2DD4 A;  2XIC A;  3S17 I;  4NH1 C;  1KC8 R;  1VQ8 Q;  3K7A I;  2CP2 A;  2HL3 A;  2LDM A;  1BBZ A;  3OW2 P;  4NOZ A;  1KC8 C;  1YWO A;  4E2Z A;  2PQW A;  3CXC A;  2R58 A;  2JA7 I;  4ZGJ B;  1BU1 A;  3FJP A;  4GBQ A;  4JDS A;  4A53 A;  5HK0 A;  1KQ2 A;  4IIO A;  3A1P A;  4Y52 I;  2HAX A;  4BUG A;  3GTL I;  5GAN h;  1VQP Q;  1QVF Y;  2E12 A;  2QQ9 A;  1I4K 1;  2MWP A;  4JJC A;  3CCE T;  3CC2 Q;  1YI2 1;  1UEB A;  1YHQ 1;  2FB7 A;  2JMO A;  2DET A;  3PO2 I;  3OYF A;  4E7H A;  1IO6 A;  4A3F I;  4M77 E;  4XU1 A;  1QVG A;  1EX4 A;  1DL6 A;  4YTL A;  4A4K A;  5M9O A;  3E9G A;  2RM4 A;  4C5H A;  5CR2 A;  1W2B P;  4HA8 A;  1Q82 1;  2FZC B;  3PVL A;  5FLM I;  2JNG A;  4AFU C;  2WSE E;  2KI7 B;  3REA B;  1NYF A;  4F17 A;  1NUI A;  1TS9 A;  5KYX A;  1YUK A;  4F7U G;  1I50 I;  4CC4 B;  1WI7 A;  3G6E Z;  1TTH B;  4MON A;  4FCY A;  4E7S A;  3QG1 A;  5IT9 f;  4LUE A;  1FYN A;  2JUB A;  3EG3 A;  1YJ9 T;  2EYZ A;  1M1K 2;  3KIF A;  3J80 b;  3UT1 A;  1S72 Z;  3I55 Q;  2CH4 A;  5GMK h;  2LQW A;  3QDR B;  3HOW I;  1TUG B;  2P0P A;  4C5E A;  1WJQ A;  1U5S A;  3G6E A;  3CME T;  4RVD A;  1YIJ Q;  1D3B A;  1ZSZ C;  1NEG A;  3REB B;  2RHB A;  2CDT A;  3QXE B;  4NS5 A;  3JCM Q;  1JRI A;  1PG5 B;  2GF7 A;  3RMQ A;  3NFZ A;  3CXC Y;  1PFT A;  1OI1 A;  2VUG A;  2PU9 B;  3MZK B;  1RAE B;  1OUL A;  1Q16 A;  1KC8 2;  5GMK l;  3M53 A;  5KYY A;  2MYS A;  3EG1 A;  4NBD A;  2RO0 A;  2L3P A;  1WHH A;  5GAN e;  4DOW A;  2MF2 A;  4BB7 A;  2O31 A;  1Q86 1;  1AT1 B;  5CKB A;  2RJF A;  1X3Z A;  3L2W A;  1VQL Z;  2CZ0 B;  4M75 E;  3DLM A;  5LJ5 g;  1UJY A;  2VGM A;  4E2Y A;  1RNI A;  2Y90 A;  2K4Y A;  5A2Q f;  2LTO A;  2DD5 A;  3G4S 1;  2A28 A;  2EW3 A;  5LJ3 d;  2LFU A;  1Q7Y U;  4Z88 A;  3OYN A;  2VF1 A;  5IP9 I;  2JMC A;  2YHT A;  3CD6 A;  3VYH B;  1I8F A;  2GTI A;  5CQY A;  3J81 E;  2QA4 T;  5IN1 A;  4N0A A;  2DRM A;  5HKC A;  2VAS A;  1RO0 A;  4ZTJ A;  2CS7 A;  5GAN 8;  3VYG A;  1MNE A;  3A8G B;  3CMA Q;  2DNU A;  3QWX X;  2P4R A;  2EYQ A;  2JA6 I;  2KAF A;  2RQW A;  5GMK e;  2KYB A;  4M7A G;  3G71 T;  5GAM f;  3MP6 A;  2IG0 A;  3EG9 A;  3OA6 A;  3OW2 A;  4DBR A;  1HJD A;  1KRL A;  1R77 A;  2JW4 A;  4JZ3 A;  1ML8 A;  1M3C A;  4M7D F;  2AKK A;  4NBC A;  1KC8 U;  4J9C A;  4MMK A;  2XDD A;  2CZ7 B;  2DE6 A;  4DQY B;  2DAQ A;  1I07 A;  4NB9 A;  4C92 B;  2OTJ T;  4PFZ A;  5J39 A;  3UF4 A;  2YLB A;  4CC2 A;  2RHU A;  5GAO r;  2Z0W A;  1HSQ A;  3CC4 Q;  3FQQ A;  1YHQ Z;  3MET A;  3CPW Z;  4J6Y A;  1VQK Q;  2YU9 I;  4EMK C;  4XTW A;  4PFO A;  3CCJ T;  4E7Z A;  2X4J A;  1K8A 1;  4DBF A;  2ZPH B;  1I81 A;  2ED0 A;  1LOJ A;  1Y07 A;  1YI2 A;  4JRI A;  3JCM g;  1M4Z A;  4E7K A;  1XTD A;  1R8O B;  4A3E I;  4BY1 I;  4BI3 A;  1OV3 A;  2BZ8 A;  1TSF A;  3QUI A;  4RMO A;  2IZ3 A;  2CSI A;  1SHG A;  4OB0 B;  1RO2 A;  1YJW T;  1PRM C;  1YN8 A;  2ZPI B;  1Q82 R;  1UGS B;  2RPR A;  4ZNX A;  5LJ5 h;  3T4N B;  1M2O A;  3JCM b;  1Q82 C;  1GFD A;  5C4J I;  3G1J A;  3SWN B;  1QP3 A;  4C92 G;  3CCQ Z;  3QYH B;  2KI7 A;  2M6N A;  4RTX A;  1QXF A;  1U06 A;  4J9H A;  4FL6 A;  3PIP A;  3M5A A;  3RBB B;  2L3S A;  2NVX I;  2PVO B;  3M4Y A;  4MZM A;  1PD1 A;  1Z01 A;  2AIR B;  2O4H A;  3LGF A;  1YUA A;  2XID A;  2RI3 A;  2QTV A;  5KH6 A;  1JJ2 P;  2HKN A;  1GXI E;  3A5Z B;  1AA6 A;  4ZGE B;  2GFU A;  3H0I A;  1QMC A;  3CCL 1;  4BE0 A;  2COW A;  1B7T A;  3Q87 A;  2CT3 A;  4JZ4 A;  8ATC B;  2K2M A;  4JJN K;  3LWH A;  4RS4 A;  1WHL A;  4M7D D;  1YJN 1;  3D7S B;  2NVQ I;  1BCO A;  2HQH A;  1QCF A;  5IHK A;  1G2B A;  2CSQ A;  2KSS A;  4CL1 A;  3TU4 K;  1VQ8 T;  3IQL A;  4M77 B;  4MH4 A;  2EYW A;  1OZ2 A;  3CPW Y;  1VQ6 1;  2E2I I;  4JPB W;  3HKZ A;  4M7A C;  1NYG A;  3PO3 I;  5HCK A;  3TQ7 P;  3CC7 A;  3NH5 A;  2K5I A;  1Q86 R;  2JNY A;  2JM9 A;  2COY A;  1RO4 A;  3VMH A;  4A3C I;  5GAN 4;  1D0X A;  4XU2 A;  4J83 A;  3JCM V;  1H3H A;  3RDV A;  2K57 A;  1VQP T;  3EH1 A;  2ROL A;  1KQS S;  2YUQ A;  2CUD A;  1R0C B;  2RK2 A;  1WX6 A;  1X69 A;  1BIB A;  1I0C A;  3TRE A;  3G4S A;  1YFN A;  1K0S A;  2V8K A;  2FEI A;  1LNX A;  1Z02 A;  2DL3 A;  2GCX A;  5LJ5 e;  2X51 A;  1WJR A;  4XTV A;  2FHD A;  3INZ A;  3OYH A;  2LVM A;  5KCH A;  2LCC A;  2W0Z A;  3JCM h;  1M30 A;  5GAO l;  4C5G A;  4KUL A;  3FQM A;  4F7U E;  3EFO B;  2KEA A;  4XTY A;  3HOY I;  2COZ A;  2A0F B;  1TWC I;  1X75 C;  2HF1 A;  4PK4 A;  3VS0 A;  3CD6 Q;  4D8D A;  2CZ1 B;  2XKO C;  2GU2 A;  1YIT Z;  2F2X A;  3I55 T;  4XU3 A;  3HOX I;  3R6N A;  4C0G A;  2Q4Z A;  4M77 G;  3H41 A;  3A8M B;  2R92 I;  1TUD A;  3JAM b;  2FPD A;  1VQ5 1;  2DA9 A;  2M16 A;  2J6F A;  5T6B A;  3OYE A;  1YIJ T;  4E2X A;  1WYX A;  4PJO F;  3EER A;  3CCU Z;  4M75 B;  3GP8 A;  4F04 B;  2KE9 A;  4C92 A;  2QKD A;  5DLO A;  2AHJ B;  2O9V A;  1RAD B;  2DE0 X;  2RD1 A;  1QKX A;  2XG8 D;  2OAU A;  2D8J A;  4XTZ A;  1M1K 1;  3G7Z A;  4A4G A;  3UWN A;  4ELY C;  3BG1 B;  3BFM A;  2NWM A;  4E7L A;  1K8A R;  1QVF P;  4FT2 A;  1USP B;  2V1R A;  3QSU A;  3PGG A;  4BE1 A;  3I56 1;  3HTR A;  3JSC A;  1H8K A;  2XHC A;  1Z9Z A;  1Q82 U;  1TWB A;  4AT1 B;  2QGF B;  1ZHI A;  1X6G A;  4M78 F;  1D09 B;  1SKU B;  3OB9 A;  1GFC A;  2LEX A;  2AT1 B;  1WW9 A;  2JS4 A;  3M0P A;  4AFS C;  1TFI A;  1LPL A;  3JCM e;  2CKK A;  1JJ2 A;  2RN8 A;  2FL7 A;  4KBM B;  2HZY A;  1YP5 A;  3NTK A;  1ZX6 A;  3GNG A;  1RI0 A;  4MML A;  1AWW A;  3L2Q A;  5EG2 A;  1WA7 A;  4AFZ C;  4DGL A;  2OTL 1;  4RCB A;  1TXQ A;  4ZN1 A;  1YI2 Q;  5IHN A;  1RAA B;  4A54 A;  2K79 A;  3CCL Z;  3CMA T;  3EH2 A;  5FRN A;  2K9G A;  1M3B A;  3SWN A;  4M7A E;  2DIL A;  3HFO A;  5FU6 C;  1JB0 E;  3OYB A;  3U23 A;  1T0H A;  1YJN Z;  1VQ4 1;  3PFS A;  3M57 A;  3PE0 A;  1XQH A;  1P9N A;  3JB9 H;  1VYU A;  2IV2 X;  3ZBD A;  2X35 A;  1X01 A;  1VQ6 Z;  2CUB A;  3CCM 1;  3CXC P;  3N5B B;  2FPF A;  1QCN A;  1Q86 U;  2RJE A;  3SEM A;  5CK9 A;  1OU8 A;  3JCM X;  4RTY A;  2G2K A;  2QAS A;  3CC4 T;  2SEM A;  3OS0 A;  4ORZ A;  2E2H I;  3M3Y I;  4X1V A;  3DB4 A;  4EWC A;  4AG1 C;  1VQ6 A;  2R93 I;  1ZSZ B;  1VQK T;  4M7D B;  4DOV A;  5I22 A;  2PNI A;  1VQ7 Z;  5AN9 F;  3S14 I;  1BYM A;  3BW1 A;  1OQK A;  4R0K A;  3OS1 A;  4PJO D;  3CCV Q;  3UPU A;  2NUP B;  2OJ2 A;  4M77 A;  3THK A;  1VQN 1;  5J26 A;  4TVR A;  5GAO q;  5KCO A;  1Z03 A;  2RBL A;  2P0K A;  4JRK A;  1HD3 A;  4RG2 A;  3V8L A;  1UEC A;  5IXF A;  1VQO 1;  2J06 A;  2O88 A;  1RUW A;  3RZD I;  1FMW A;  2VXF A;  2JA8 I;  3OBW A;  3Q1J A;  4M78 D;  3CC7 Q;  4E31 A;  1T3L A;  2KNB B;  3EFS A;  4J6X A;  2DRK A;  4RTU A;  2LQ8 A;  1WHG A;  5ECA A;  5A2Q E;  1NPP A;  4LXC A;  1JXO A;  1G3S A; 
#chains in the Genus database with same CATH homology
 5IP7 I;  3EED A;  1BB9 A;  1AOJ A;  3HOW I;  4MRI A;  3IX0 A;  1MUZ A;  1U5S A;  3C0C A;  3ESW A;  2K7A A;  1VQP 1;  3EHQ A;  1VQ8 Z;  4RVD A;  3GKQ A;  1GRI A;  2KT1 A;  2A36 A;  4AG2 C;  3CC2 1;  4RVG A;  1NEG A;  1N8R 1;  2YSQ A;  3REB B;  2RHB A;  2CDT A;  4WCI A;  4J9E A;  5CM2 M;  1UJ0 A;  1VA7 A;  2HEQ A;  1QWE A;  4CC7 A;  3NFZ A;  1N5Z A;  2P3Y A;  5IH2 A;  1VQ9 1;  3KIH A;  3CXC Y;  1PFT A;  1WLP B;  2VUG A;  1ZLM A;  4IIM A;  2W10 A;  3S1R I;  3OW2 Y;  1VQP Z;  3MZK B;  5FLX f;  1KC8 2;  3J7A 4;  4A3K I;  4A3D I;  3I56 Z;  2MCN A;  3CC2 Z;  3CCV Z;  4J9D A;  1OOT A;  1KD1 1;  3EG1 A;  1VQK 1;  2V8I A;  4NBD A;  4EIK A;  2L3P A;  2ECZ A;  3CCE 1;  2K5R A;  2EYY A;  1TWG I;  1VQ9 Z;  2O31 A;  1NG2 A;  1Q86 1;  2DM1 A;  2ZAE B;  1X3Z A;  4MD7 A;  1VQL Z;  3H3V J;  2EQI A;  1CSK A;  2EBP A;  3HOZ I;  2JS0 A;  4JJD A;  3VS1 A;  1UJY A;  2IZ4 A;  4NBB A;  4E2Y A;  1AWJ A;  3QWY A;  2J7I A;  2YAD A;  3I55 1;  1RNI A;  4LN2 A;  2WAQ A;  2DBK A;  5FW9 A;  4RTZ A;  2R7Z I;  2QRC B;  2B63 I;  3NGP A;  5A2Q f;  2EKH A;  3ULR B;  4AFQ C;  3CCR 1;  1AEY A;  3TE5 B;  3HOU I;  3G4S 1;  1USP A;  1W2B Y;  2A28 A;  2EW3 A;  3CC7 Z;  2LFU A;  3TSZ A;  2LIY A;  2D8H A;  2VF1 A;  5IP9 I;  4A3M I;  3GTM I;  2OTL Z;  1SSH A;  4RV9 A;  2JMC A;  2GTI A;  1T0J A;  1K76 A;  4Z88 A;  2J6O A;  1WXU A;  2H8H A;  1K0X A;  1GBR A;  2HCK A;  2DRM A;  3I55 Z;  1CKA A;  1GBQ A;  2R6M A;  1RO0 A;  2QRD B;  3PO3 S;  1UG1 A;  1YJ9 1;  3MZL B;  1B3Q A;  3CCR Z;  2QR1 B;  3G4S Z;  3NDJ A;  1UUE A;  2DNU A;  2QEX 1;  5FWC A;  3QWX X;  1VQ4 Z;  1YIJ Z;  2P4R A;  3NH8 A;  5C3E I;  2VWF A;  2JA6 I;  3I4N I;  2RQW A;  4Z89 A;  1ARK A;  2KYB A;  2QRE B;  3CME 1;  4GLM A;  1K1Z A;  2GTJ A;  2JM8 A;  2F2V A;  2M0Y A;  1HJD A;  2K6D A;  2KYM A;  1KRL A;  2GQI A;  1QLY A;  2FRW A;  2JW4 A;  1AZE A;  4JZ3 A;  2W04 A;  3CCM Z;  3IF8 A;  1ML8 A;  4AYB A;  2KBT A;  1M3C A;  3LUS A;  4DK1 A;  4NBC A;  2AKK A;  3VS5 A;  1Y1V I;  4J9C A;  2QEX Z;  2DJQ A;  2DE6 A;  4DQY B;  1WDX A;  1WII A;  3H0H A;  3I4M I;  4BBR I;  1BK2 A;  4NB9 A;  2OOY B;  1I07 A;  4A3B I;  2JR6 A;  1E6G A;  2DYB A;  3UF4 A;  1AVZ C;  3VRY A;  1JU5 C;  4CC2 A;  3I35 A;  1M90 1;  2E5K A;  1VQM 1;  1HSQ A;  1Q82 2;  3IFU A;  3CQZ I;  1X2K A;  4F14 A;  1AWO A;  4A93 I;  2F4M A;  5LL6 f;  3FQQ A;  2P28 A;  1YHQ Z;  2KRM A;  3CPW Z;  2LJ0 A;  1K83 I;  3NDI A;  1VQN Z;  2K3R A;  2DX1 A;  2HSP A;  3S2D I;  2L3Q A;  3KFV A;  3J81 f;  2NUZ A;  4E6R A;  4QTU A;  2YU9 I;  2OI3 A;  2YUN A;  2B86 A;  4OML A;  4A3I I;  4JJB A;  1K73 2;  3JAM f;  2D0N A;  3I5R A;  3VRZ A;  4OMM A;  4RTW A;  1TWF I;  1K8A 1;  2ED1 A;  2PMZ A;  2PM9 A;  2RQR A;  2RNA A;  2NVT I;  1I1J A;  2AK5 A;  4A63 B;  1VQO Z;  2YDL A;  2ED0 A;  1KFZ A;  1I3Q I;  4DEX A;  3CQT A;  4K11 A;  2KGT A;  1ZUU A;  2M48 A;  5D1P A;  1ZUK A;  2J6A A;  4FSS A;  4A3E I;  1K9A A;  4BY1 I;  3EHR A;  2QA4 1;  5IT9 b;  1OV3 A;  1YNZ A;  2BZ8 A;  3TVT A;  2C0T A;  3PVQ A;  2IZ3 A;  3CMA Z;  4S1T A;  1SHG A;  2CSI A;  1ZBJ A;  2JMA A;  2F2W A;  1RO2 A;  3CCQ 1;  1MV0 B;  2AZV A;  4A3L I;  1M27 C;  1PRM C;  1YN8 A;  3GTP I;  2G6F X;  2RPN A;  1ABQ A;  2EVR A;  2RQT A;  2DL8 A;  4M4Z A;  1WCM I;  1TWH I;  2RPR A;  2KXC A;  4ZNX A;  3T4N B;  3TDH B;  2KT8 A;  1Q7Y 1;  5L23 A;  3NPF A;  3RNJ A;  3G71 1;  3CC4 1;  1Y0M A;  3EG2 A;  3VB9 A;  1KD1 2;  5C4J I;  1GFD A;  2Y0S A;  2RIQ A;  3CCQ Z;  1OPL A;  1VLA A;  1K9M 1;  2M6N A;  5C44 I;  4RTX A;  2DBM A;  1U06 A;  2I0N A;  2LZ6 B;  1Q86 2;  4J9H A;  3VS7 A;  2VKN A;  1JJ2 Z;  2LNH B;  3RBB B;  2ENM A;  2PZ1 A;  2J05 A;  2L3S A;  2NVX I;  1VYT A;  2OAW A;  4OMO A;  2DMO A;  3CC4 Z;  1Z01 A;  4QTT A;  2O4H A;  2V8J A;  2VUM I;  2OTJ 1;  4RVH A;  1YUA A;  3CD6 1;  1OPK A;  2RQU A;  3O5Z A;  2PK7 A;  2CT4 A;  1Q81 1;  1AWX A;  4Z8A A;  1VQK Z;  3GBQ A;  3NMZ C;  3GTK I;  1SRM A;  3H0I A;  4DEY A;  2Q51 A;  3CCL 1;  3CCE Z;  3Q87 A;  2HU9 A;  1T3S A;  2CT3 A;  3F3P C;  1KC8 1;  2JT4 A;  2K2M A;  4JZ4 A;  2FO0 A;  1UFF A;  1Y57 A;  3S1M I;  2HDA A;  1ZH1 A;  5C4X I;  3UA7 A;  4RS4 A;  5IXB A;  3CCS 1;  1YJN 1;  2LQW A;  2RF0 A;  1RLP C;  4D8K A;  2NVQ I;  4E30 A;  3CCJ 1;  1QWF A;  2CH4 W;  3A98 A;  1QCF A;  5IHK A;  1G2B A;  2KRS A;  2CSQ A;  2E2J I;  4CL1 A;  1W70 A;  3IQL A;  4MH4 A;  2EYW A;  2O53 A;  1W6X A;  2MOX A;  3CPW Y;  1VQ6 1;  1KQS Z;  1ZB9 A;  4MD8 A;  2E2I I;  2M51 A;  4JPB W;  3HKZ A;  1JXM A;  1NYG A;  3PO3 I;  5HCK A;  1TWA I;  4E32 A;  2YUP A;  1TG0 A;  3NH5 A;  2JXB A;  2LQN A;  2JNY A;  1PHT A;  1MV3 A;  2JM9 A;  3HOV I;  1UHF A;  1RO4 A;  4NB8 A;  1GCQ C;  2JA5 I;  1PKS A;  3VMH A;  4A3C I;  3D9X A;  1NJI 1;  1S1N A;  2RT9 A;  2DL7 A;  2BJO A;  3RZO I;  1H3H A;  2DL5 A;  2HBW A;  1X27 A;  4NBA A;  1EFN A;  1YJ9 Z;  1CKB A;  1U3O A;  2ROL A;  1X3W A;  2YUQ A;  2CUD A;  1VYV A;  2JS2 A;  1NM7 A;  1WX6 A;  1X69 A;  5D1O A;  1I0C A;  1K0S A;  2V8K A;  2FEI A;  3M0U A;  3VS2 A;  2X3X D;  1Z02 A;  3D6W A;  1AD5 A;  1NLP C;  2DL3 A;  3EG0 A;  2EYX A;  3EGU A;  3FKI I;  1M90 2;  3CME Z;  1ZUY A;  3NHN A;  1QF8 A;  4NFR A;  1RQF A;  3H0F A;  1QVG Z;  1L1O C;  2W0Z A;  4ESR A;  1M30 A;  5IHI A;  2D1X A;  3M0R A;  1QKW A;  2C0O A;  3S15 I;  3JV3 A;  3FQM A;  2L2P A;  1GL5 A;  1YIT 1;  1JEG A;  3M0Q A;  2DL4 A;  2KEA A;  1X0T A;  1KJW A;  2OZK A;  1TUC A;  3HOY I;  3U50 C;  2PTK A;  4KRT A;  2ABL A;  3SHW A;  1FMK A;  2ROT A;  2IIM A;  2BTT A;  1K8A 2;  1TWC I;  1W2B Z;  2CRE A;  2HF1 A;  2LJ3 A;  1PKT A;  3VS0 A;  1VQM Z;  2A37 A;  2DLP A;  2EGA A;  2QLV B;  5EC7 A;  3G6E 1;  2KRO A;  5T67 A;  2GGR A;  1RLQ C;  3BG0 B;  4MD9 A;  3CCU 1;  5GJW B;  4D8D A;  1JJ2 Y;  2GU2 A;  1YIT Z;  2F2X A;  3HOX I;  3R6N A;  2Q4Z A;  2AKL A;  1PNJ A;  3H41 A;  2EGT A;  2R92 I;  3NH4 A;  1TUD A;  3JAM b;  2FPD A;  1VQ5 1;  2DA9 A;  4BBS I;  3F3F C;  4RUG A;  2K3B A;  1S72 1;  1M3A A;  2J6F A;  1K4U S;  5T6B A;  4QT7 A;  2YUO A;  2F4O A;  3M4O I;  3J80 f;  4E2X A;  2NVY I;  1WYX A;  1N8R 2;  2ESW A;  2C0I A;  4J9F A;  2FG0 A;  4HVU A;  4RTV A;  3EER A;  3CCU Z;  1VQ8 1;  4CC3 A;  2KE9 A;  2QKD A;  3LH5 A;  2LX7 A;  2A08 A;  2FRY A;  1Q7Y 2;  2O9V A;  3GTJ I;  1H92 A;  1PWT A;  1VQ5 Z;  1PRL C;  2RMO A;  1QVF Z;  2DE0 X;  1WFW A;  1X43 A;  3M0T A;  3S1Q I;  1QKX A;  4E2W A;  1AZG B;  4J9I A;  2QA4 Z;  1WXB A;  1K9M 2;  2D8J A;  1M1K 1;  2X3W D;  5T64 A;  3GCF A;  1JWH C;  1JQQ A;  3BG1 B;  3GTG I;  2O2O A;  1X2Q A;  2I3C A;  2LMJ A;  4BXX I;  2NWM A;  1YWP A;  1USP B;  2V1R A;  1LCK A;  1A0N B;  1Y1W I;  3I56 1;  1KQS Y;  1H8K A;  3CCV 1;  1UHC A;  4Y92 A;  1ABO A;  4HVW A;  1Z9Z A;  1S7M A;  4HCK A;  2KPI A;  4NBE A;  3S1N I;  5FLX b;  1X6G A;  3S2H I;  3H0G I;  1E6H A;  3G71 Z;  1Q81 2;  1UTI A;  2H85 A;  2DF6 A;  2V1Q A;  1B07 A;  5FWB A;  1LQL A;  2AZS A;  4Y7N I;  3P5J B;  4TNU A;  1VQL 1;  1GFC A;  1WW9 A;  2JS4 A;  4F16 A;  2VVK A;  1Z9Q A;  3TSW A;  3M0P A;  4AFS C;  4RTT A;  1SRL A;  1TFI A;  1G83 A;  2O9S A;  4OMP A;  4MXU A;  1I6H I;  2RN8 A;  2EPD A;  4HXJ A;  4LUD A;  1YP5 A;  1ZX6 A;  2GNC A;  1RLY A;  2OTJ Z;  1AWW A;  3CD6 Z;  3CC7 1;  1WA7 A;  4AFZ C;  4DGL A;  2OTL 1;  2XMF A;  1JO8 A;  1QVG Y;  5D1O B;  5IHN A;  5A2Q b;  4NBF A;  1UGV A;  1NEB A;  1XOV A;  2K79 A;  3GTO I;  3VS4 A;  1J3T A;  2GBQ A;  3CCL Z;  2KXD A;  1RI9 A;  4E33 A;  2K9G A;  2LP5 A;  1M3B A;  1GCQ A;  3GTM S;  2DIL A;  2DE5 A;  2L0A A;  1NJI 2;  1UE9 A;  3I9Q A;  3U23 A;  1N2F A;  4HH4 A;  3CCS Z;  1T0H A;  1YJN Z;  3MON A;  1KSW A;  1VQ4 1;  3CCJ Z;  1YIJ 1;  1KIK A;  3CXC Z;  3PE0 A;  1GCP A;  1V1C A;  2BZY A;  1P9N A;  2SRC A;  2W03 A;  3OW2 Z;  1VYU A;  4LNP A;  1ZB8 A;  1YJW 1;  2BZX A;  5GJV B;  4NBH A;  1M8M A;  2OOX B;  3QWU A;  1VQ6 Z;  1SHF A;  2CUB A;  2E9H A;  4HGY A;  1SFO I;  2LCS A;  3UAT A;  2FPE A;  3CCM 1;  3S17 I;  4NH1 C;  3K7A I;  2FPF A;  3VMG A;  3VS3 A;  1SPK A;  1VQ7 1;  1YCS B;  1BBZ A;  4NOZ A;  1YWO A;  1OEB A;  3SEM A;  3VTN A;  4E2Z A;  2LJ1 A;  4J9B A;  4RTY A;  3UA6 A;  2G2K A;  2JA7 I;  2SEM A;  1YJW Z;  4BY7 I;  4ORZ A;  4HGZ A;  2E2H I;  1BU1 A;  3M3Y I;  4GBQ A;  4X1V A;  1Y1V S;  4IIO A;  4OMN A;  4Y52 I;  4EWC A;  1R9T I;  4AG1 C;  2R93 I;  3GTL I;  1QVF Y;  3ZL7 C;  5I22 A;  2GTH A;  1VQ7 Z;  2JTE A;  2PNI A;  5AN9 F;  3S14 I;  4JJC A;  2MIO A;  4R0K A;  4XX2 A;  1YI2 1;  1YHQ 1;  2JMO A;  2OJ2 A;  2DE7 A;  3THK A;  3PO2 I;  1VQN 1;  1W1F A;  1IO6 A;  5I11 A;  4A3F I;  4HVV A;  3I07 A;  2GTO A;  1Z03 A;  2RBL A;  1DL6 A;  3FJ5 A;  1ZSG A;  1UDL A;  4A3J I;  1HD3 A;  3J81 b;  1WIE A;  1UEC A;  5IXF A;  3VS6 A;  4OMQ A;  4NBG A;  1NP6 A;  1VQO 1;  1YI2 Z;  1X6B A;  1Q82 1;  2J06 A;  3VMI A;  5FLM I;  2J6K A;  2YT6 A;  3I5S A;  3M0S A;  3PVL A;  4LE9 A;  4AFU C;  2KI7 B;  3REA B;  2O88 A;  1NYF A;  3S16 I;  1RUW A;  3RZD I;  4F17 A;  1NUI A;  4RVF A;  2EGC A;  1YUK A;  1WXT A;  1I50 I;  2DVJ A;  3GTQ I;  2JA8 I;  3G6E Z;  1WI7 A;  4CC4 B;  4MON A;  1QYP A;  4J9G A;  2EGE A;  4E31 A;  1T3L A;  2QDL A;  2KNB B;  3CMA 1;  2DRK A;  4RTU A;  5IT9 f;  1K73 1;  1NLO C;  1FYN A;  2JUB A;  3EG3 A;  4LUE A;  4X6A I;  1SEM A;  2EYZ A;  1M1K 2;  3KIF A;  3J80 b;  1S72 Z;  5ECA A;  2RQV A;  2KR3 A;  2CH4 A;  2WB1 A;  1E7O A;  2KRN A;  1JXO A;  4A3G I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...