2AKLA

Solution structure for phn-a like protein pa0128 from pseudomonas aeruginosa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
116
structure length
116
Chain Sequence
b'MVSTLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATASDDGKVIKDSVGNVLQDGDTITVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMKLKSEFVRKVGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phnA-like protein pa0128
publication title Sequence Specific Resonance Assignment of a Hypothetical Protein PA0128 from Pseudomonas Aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Structural genomics, unknown function
total genus 15
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03831 PhnA PhnA domain
A PF08274 PhnA_Zn_Ribbon PhnA Zinc-Ribbon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2aklA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2aklA02
1X2KA 3M0QA 2KR3A 3GTQI 2LCSA 2D1XA 2KNBB 3HOZI 4A3FI 2PNIA 2KPIA 2FRYA 3QWXX 3RBBB 1H3HA 1QKXA 1HSQA 2PZ1A 4J9BA 1ARKA 1UJYA 1X27A 2F2XA 4NBBA 1YP5A 2L2PA 4OMQA 1OEBA 4CC4B 2LNHB 2E2II 2JXBA 3S15I 3S2DI 4A3JI 4HVWA 2BJOA 1UHFA 1SHFA 2C0IA 3EG2A 5GJVB 1K0XA 1Y1VS 2VUMI 2GBQA 4AFSC 2K79A 3IQLA 1PNJA 1M3BA 4A3CI 1SHGA 1X2QA 1X6GA 2J6OA 1NLOC 2JS2A 3VS1A 4AFQC 4DEXA 4CC3A 5IHKA 2M0YA 1JU5C 1RLYA 3REAB 1UE9A 3GTMI 1U3OA 2J6FA 1K9AA 3H0HA 1TWHI 1ZB9A 4Y52I 4M4ZA 2JR6A 2RN8A 2JA5I 1ZBJA 1Z9ZA 1NEBA 1GCPA 5GJWB 2RQVA 1H8KA 1Y57A 2E5KA 3VMIA 2JT4A 2KEAA 1BU1A 1MV3A 1NM7A 3QWYA 3S14I 2NWMA 1VLAA 2E2HI 2KROA 3VRYA 1U06A 1T0HA 2SEMA 4OMPA 1SPKA 1GCQA 1VYTA 3GKQA 3GTOI 1X43A 2EYZA 2CT4A 5HCKA 4IIMA 2DLPA 1TUDA 1UECA 1USPB 1M3CA 4MH4A 1AWXA 4QTUA 2KT8A 1QWEA 2LQWA 2CH4W 1ZUKA 4NOZA 1M3AA 1TG0A 2GGRA 1N2FA 2HEQA 2L0AA 2ED1A 4IIOA 4BBRI 1UTIA 4JJBA 3TSWA 3GBQA 2ROTA 2DA9A 4J9FA 2L3SA 1UG1A 2R7ZI 3RNJA 2JA7I 3O5ZA 2DE0X 1K76A 2X3WD 1X69A 3GCFA 2P3YA 2RMOA 3SEMA 3PO3I 1N5ZA 2GQIA 3VS2A 2MCNA 3I5SA 2JA8I 1RLQC 4RTUA 1VYUA 3GTGI 1AWJA 1KFZA 1BBZA 2DILA 1OV3A 2FO0A 1TFIA 3H3VJ 3U23A 4A63B 1H92A 1NYFA 3PE0A 2KXCA 2B86A 2O88A 1YNZA 3EG1A 4Y7NI 1R9TI 4Z8AA 1BB9A 3S1QI 4EIKA 3NMZC 3VRZA 1PRLC 2JA6I 2FPDA 4F14A 5FW9A 3S16I 2D8HA 4A3KI 2OI3A 1SEMA 2PTKA 2DYBA 4A3MI 1NLPC 1J3TA 2K2MA 2EVRA 1AVZC 1NG2A 1WDXA 4A3LI 2LZ6B 3HOXI 2NVXI 1PHTA 2YUNA 2DRKA 1EFNA 1TUCA 1I50I 2KRSA 1CKAA 1M30A 2FPFA 3M0RA 2LMJA 3H41A 2W10A 1HD3A 1I3QI 3VS7A 2CUBA 1VYVA 4KRTA 4JJDA 2K5RA 3ESWA 2X3XD 2BZXA 4X1VA 1RLPC 4BXXI 2C0OA 1MV0B 2EPDA 3GTMS 4A3II 2CT3A 2RQTA 1SRLA 3VMGA 1AWOA 3I4MI 3REBB 2CDTA 4J9GA 2J06A 2KBTA 2HSPA 4RTXA 3I07A 4NBAA 2L3QA 1JXMA 1YWOA 3ULRB 2F2WA 4OMLA 3HOVI 2JTEA 2FPEA 2HBWA 1VA7A 4BY1I 4ESRA 2F4OA 2BZ8A 2JS4A 3H0FA 1GRIA 1KJWA 3H0IA 2YUPA 3S1RI 3RZOI 2EW3A 1FYNA 1ZX6A 5I11A 5IH2A 2RF0A 4Z88A 2EYXA 4FSSA 1JO8A 2CUDA 3EG3A 3PVLA 4WCIA 4LNPA 2J7IA 2JNYA 2DL5A 4RUGA 2DM1A 3I4NI 3I9QA 3TSZA 4CC2A 4A3DI 1LQLA 1HJDA 2LX7A 1GBRA 4RTVA 3GTJI 1NUIA 3M4OI 2J6AA 1ZB8A 3H0GI 1JQQA 2EGCA 2R92I 4R0KA 1RI9A 3PO3S 2KXDA 1TWFI 1WXTA 1WW9A 4JPBW 3S1NI 1QKWA 1Y0MA 2DRMA 2F2VA 2M51A 2LP5A 2FEIA 4ORZA 4J9HA 4CC7A 5IXFA 4LUEA 1UFFA 2KT1A 1FMKA 1G83A 2EYYA 2DBMA 1AZGB 4F16A 1AWWA 2RBLA 1AEYA 1RO4A 3PVQA 2O2OA 1DL6A 1SSHA 3HOUI 3GTKI 1K0SA 3CQTA 2LJ0A 1YCSB 1WIEA 2YUOA 3EHRA 4A93I 1MUZA 1S1NA 1KIKA 2EBPA 4Z89A 2AZVA 1ABOA 3HOYI 1W70A 2DL8A 1B07A 4E6RA 4J9DA 1WCMI 1WYXA 2ENMA 2O9VA 2SRCA 4JZ4A 1IO6A 2AKLA 2YU9I 1UDLA 4RTYA 2KRMA 2VVKA 1M27C 2IIMA 1OOTA 1W6XA 2AZSA 2CREA 2FRWA 5ECAA 4QT7A 3K7AI 2B63I 2YT6A 3TVTA 2DE6A 3VS4A 1WA7A 3KFVA 4OMNA 2J6KA 2W0ZA 3SHWA 1TWCI 2GNCA 3S2HI 4A3GI 2VKNA 3JV3A 2ESWA 1WXUA 3I35A 3UA7A 2AK5A 4LN2A 3VS5A 4NBCA 2RPNA 5L23A 4ZNXA 1T3LA 3R6NA 1K4US 1GFCA 2DMOA 4J9EA 1ZUUA 1LCKA 2LJ3A 3NHNA 2JMAA 1Z9QA 1CKBA 1UUEA 1K1ZA 2JM8A 2JS0A 3EHQA 2LJ1A 3FKII 2O31A 4NBEA 2L3PA 4RTWA 1KSWA 3M0SA 1A0NB 3LH5A 4AG1C 2DE5A 2JM9A 1E6HA 2RQWA 1USPA 4RTZA 2JW4A 4JJCA 2AKKA 1ZUYA 2P4RA 5EC7A 2GTOA 2GTJA 3VB9A 4BY7I 5FLMI 5IHNA 2EQIA 5C4XI 2D0NA 2ABLA 1AD5A 1PFTA 1TWAI 2I0NA 1WLPB 2HCKA 3NGPA 1UJ0A 1B3QA 1QCFA 1I07A 4AG2C 3M0TA 2K6DA 2A37A 1PKTA 3CQZI 1ZLMA 2H8HA 2E2JI 2EGAA 2DNUA 4NB9A 4AFZC 5C3EI 5I22A 3EGUA 1RUWA 4AFUC 1K83I 2DX1A 2D8JA 1BK2A 2OAWA 5IHIA 2ED0A 2NVQI 1E7OA 3C0CA 2LQNA 3RZDI 1T3SA 1X6BA 4D8KA 2G6FX 3U50C 1WI7A 1YWPA 3VS6A 5FWBA 2HF1A 2J05A 2K7AA 3S1MI 1U5SA 4QTTA 1QYPA 1I6HI 2QDLA 2DL3A 2ECZA 1V1CA 5C4JI 2VWFA 2CH4A 1UGVA 2EYWA 4RTTA 1W1FA 4GBQA 4JZ3A 1TWGI 2DVJA 1GCQC 1QWFA 3FJ5A 2DF6A 4NBGA 2O9SA 1SFOI 3THKA 4X6AI 5FWCA 1Y1VI 2KYBA 2CSIA 1WXBA 1E6GA 4D8DA 1Y1WI 2R93I 2RNAA 2DE7A 2A36A 5IXBA 1CSKA 2FG0A 3GTPI 2MOXA 1YN8A 5IP9I 3I5RA 2NUZA 2RQUA 4LE9A 4XX2A 2EKHA 1WFWA 2V1RA 1UHCA 3GTLI 2CSQA 1T0JA 1WX6A 2MIOA 2KRNA 3NPFA 1X3ZA 3LUSA 2KGTA 4DEYA 3VS3A 2JMCA 3S17I 1JEGA 2V1QA 1GFDA 4GLMA 3VMHA 3M0UA 3UATA 3A98A 2K9GA 4HVVA 1L1OC 4NB8A 2ROLA 3Q87A 1NYGA 2NVTI 4HVUA 1PRMC 2DL4A 4J9IA 2F4MA 1M8MA 2OJ2A 3VS0A 4K11A 2YSQA 2BTTA 2KYMA 3M0PA 2DBKA 3EERA 1I1JA 1YUAA 4HCKA 2BZYA 2RQRA 3PO2I 1I0CA 1G2BA 4OMOA 4A3EI 3HOWI 4LUDA 1OPLA 2C0TA 3UA6A 4HXJA 1ZSGA 4OMMA 3UF4A 2HDAA 4NBFA 3M3YI 2PK7A 1PKSA 5CM2M 3D6WA 2XMFA 1GL5A 4BBSI 1NEGA 5IP7I 4J9CA 2DJQA 2YDLA 3EG0A 1SRMA 2NVYI 1XOVA 2A28A 2DL7A 2A08A 1ML8A 1GBQA 4F17A 1OPKA 3ZL7C 1AZEA 2YUQA 1PWTA 1JXOA 4Y92A 5C44I 4NBHA 2EGEA 2KE9A 1ABQA 1X3WA 4A3BI 4NBDA 1QLYA 1AOJA 2K3BA
chains in the Genus database with same CATH superfamily
4LXCA 5LJ3d 2KR3A 3S3MA 2O4XA 4IUTA 2GTHA 4PJNA 5FU7C 3BE3A 3X26B 3MZKB 3QWXX 5KYYA 5I2SA 1KD1U 1YI2A 3L1AA 1M90R 3CXCS 1XQHA 4C92G 1M1KR 3OW2P 2H85A 1YHQT 4J6XA 2OTLA 5T64A 1VQOT 1VQ9Z 2BJOA 1UHFA 1WHGA 1SHFA 2C0IA 3EG2A 2QQRA 2VUMI 1XTDA 3TEEA 2K57A 3OW2Z 4A3CI 1SHGA 2JS2A 1BIAA 3CMET 2EQUA 2X51A 1R0CB 2DETA 1S7MA 1RLYA 1Z01A 2K4YA 4C92C 1K9AA 2RA2A 3H0HA 3MHXA 3HPWA 2RHUA 4Y91A 2QEX1 1YJNA 1Z9ZA 5GJWB 5J3BA 1S72T 3QXEB 2DERA 2V8JA 2Q4ZA 2HQEA 1YIJZ 1BU1A 1MV3A 1NM7A 1LOJA 3QWYA 2NWMA 4M77E 2E2HI 3IR7A 1KK7A 5CVIA 1T0HA 4OMPA 1VYTA 3GKQA 4E32A 2CT4A 3NTHA 1M902 4E7KA 3PGGA 2NUPA 1TUDA 1UECA 1M3CA 4N4HA 1AWXA 4NH1C 1QWEA 3P8BB 3CMAA 2CH4W 2QDYB 3MP1A 4QKUA 4L5GA 2GGRA 2HEQA 2L0AA 1SG5A 3F3FC 2R6MA 4JUVA 5CR2A 4DQYB 1BCOA 2E70A 1YI2Z 4MD8A 2R7ZI 4J6WA 3RNJA 5CAIA 4F04B 3PTAA 1Q7YU 1NJI1 2HL5C 4D6WA 3OB9A 1I5OB 5A2QE 1X6OA 1N5ZA 2VXEA 2OTLZ 3VV0A 3DLLA 1RLQC 3GTGI 1VYUA 1KFZA 2DILA 1OV3A 5D1PA 4J7IA 4M7DB 1M5Q1 1WPYA 1NYFA 1VQLA 5KCHA 2KXCA 1X75C 4N0AA 1ZSZB 1R9TI 3S1QI 1AA6A 1KQSY 1U8RA 5FW9A 3IF8A 4E2XA 1EZZB 4C0DB 3OS0A 3OYAA 3JB9G 2XDDA 1K73U 2EIFA 5CCAA 2CZ1B 3TE5B 4C0FA 2DYBA 4M75D 3QJYA 2EVRA 4A3LI 3LGLA 4A4HA 3HOXI 4M7AD 1PHTA 1ZA1B 4M78G 5KYUA 4XTXA 1TUCA 4AMCA 2KRSA 1YJNZ 5KYNA 1VQMT 3OSSC 2F1LA 2RPRA 4IUQA 4NOYA 3BFMA 2X4WA 1BKBA 2CUBA 1VQNT 2NUPB 5CQXA 3MP8A 4E7IA 3CMAZ 4BXXI 1QVFY 3LX7A 1UGPB 3A8GB 4N4GA 4XU2A 3GTMS 2HKNA 2RQTA 3G6EQ 1TUGB 2E64A 5KH6A 3CC2T 3I4MI 4C8QA 3OW2S 3G71Q 2QI2A 5GAN5 4RTXA 1OX9A 2IVWA 2L3QA 5KYWA 3AHUA 4OMLA 1YI2Q 1VA7A 4ESRA 2F4OA 2JS4A 3H0FA 1GRIA 1KJWA 3H0IA 4E7ZA 5GANj 2VUGA 3S1RI 3UT1A 4MMLA 1BYMA 1ZX6A 5IH2A 1VQLZ 4J5YA 2EYXA 4FSSA 1JO8A 3SWNA 3PVLA 1RL2A 4LNPA 2J7IA 1KQ1A 2LEXA 2DL5A 1HK9A 1UB4A 1VIFA 3EH2A 2WSEE 4C5EA 2DEQA 4E7HA 3TSZA 2O01E 2YXYA 4CC2A 3CCUZ 3EAEA 8AT1B 4M77F 1OU9A 4C92A 1JJ2Y 5M9OA 3OYFA 1YJWA 4EMKC 1JJ2A 3L2ZA 3OYDA 4VUBA 1NUIA 2RM4A 2PQWA 2QTXA 2A7YA 4ATOA 4R0KA 4HKEA 3L2UA 3CPWA 1WW9A 2PVGB 4LDVA 3FQMA 1R0BG 1Y0MA 1Q822 2GF7A 1ZBXA 4B6MA 2VPZA 4ORZA 4LUEA 1YJNQ 2KT1A 1PM3A 3L42A 1AEYA 1AWWA 3MCAB 2RBLA 4PJMA 1JB0E 4OB3B 3HOUI 1Q86R 3NFZA 3CQTA 1WHJA 1UEBA 2LJ0A 1Q81R 2FYKA 3EHRA 5HY6A 4A93I 3M58A 3H6ZA 1S1NA 1KIKA 2E1HA 4J83A 4C8QB 1Y96A 2AZVA 3CMAQ 1IRXA 2PU9B 3CD6A 3HOYI 3MEAA 1W70A 1B07A 1VQK1 1WYXA 2ENMA 1MMGA 4JZ4A 2QAZA 2YU9I 1UDLA 2R5AA 4RTYA 2KRMA 4DBHA 5LJ5j 3OYNA 5KYWB 1KG1A 2IV2X 4QT7A 3JRZA 2V45A 2JTMA 2V8IA 2J6KA 3SHWA 1TWCI 2GNCA 4PFPA 3CBPA 2LDMA 4TVRA 1WXUA 3I35A 3CCMQ 1WIIA 1YFNA 1WJ2A 3CCE1 4BE1A 2L89A 3OYHA 1JJ2P 3H8ZA 1RAHB 1VQ6A 5L23A 3X25B 1R8OB 2E3IA 1JRIA 1AHJB 1VQLQ 1YIT1 3CCLA 2D9TA 5L8RE 1WQWA 4XTZA 3CPWP 2JMAA 4C92B 2AIRB 1YJWZ 4QVCA 5GMKi 2IG0A 2QEXT 2ZPEB 2L3PA 3CCUQ 1Q862 4ZGEB 2E10A 1Q812 2WACA 3FDRA 2HMAA 2LC4A 4LDYA 2WAQA 4ELYC 2DE5A 1QW1A 1TS9A 7AT1B 1USPA 2K3XA 1C0MA 2JW4A 4JJCA 2M16A 1F1BB 1I81A 1O9SA 3OS5A 2GTJA 5FLMI 1VOMA 2BIVA 1OZ3A 1WLPB 4MDWA 4RVGA 1UJ0A 5LJ5e 1MMAA 2ZAEB 1I07A 4AG2C 1VQ8A 5GAOp 1PKTA 1FDOA 1SF9A 4AYBA 2ZZDA 5I2MA 3VJPA 3WVEB 5LL6f 4M78A 3PNWC 3CC7Q 5I22A 1EX4A 1K83I 2D8JA 1BK2A 2DIQA 4RMOA 2QASA 2ED0A 3TCJA 3C0CA 2A3LA 3RZDI 3QDRB 2JOYA 4MD9A 2R5MA 2HF1A 4E30A 3S1MI 1QYPA 1I6HI 2QDLA 2MPXC 3CCQ1 1K732 2QA41 3KIFA 3JCMX 1UGVA 4OB1B 4RTTA 1VQ71 4M7AE 3HKSA 4JZ3A 3FQQA 1GCQC 4PK4A 1QWFA 1HYOA 2EQKA 2CGHA 4RS4A 1FMWA 1QXFA 1OULA 1M1FA 1QVGZ 1IGQA 2R93I 3JCMQ 1G5VA 5IXBA 3EEDA 2E41A 5IP9I 2NUZA 2RQUA 2E9HA 3CCR1 5A0DA 2DZ9A 4LD9K 1UHCA 5KE3A 2CSQA 3FB9A 2D0QB 2GU2A 1WJSA 4BUGA 2KRNA 1X3ZA 3V7SA 3L2VA 1GFDA 5GAMe 1RO0A 1K8AR 3CXCY 3G4SA 1VQ4A 4R56A 3JAME 3CXCA 3QPHA 2YRDA 1M8MA 4FYVB 2YSQA 4PLLA 4OB0B 1N8R2 4MRIA 2CZ0B 2DTHA 4M78B 3T4NB 3PO2I 1I0CA 1XNIA 3HOWI 4BACA 3RIRA 1OPLA 3URGA 1BIBA 4OMMA 3UF4A 4OGCA 4F7UE 4NBFA 2PK7A 1LNXA 5CKHA 2MWOA 2IPOB 4J9CA 4FIBA 3LH0A 1YJ91 1GXIE 3EG0A 1SRMA 4ELZC 1KC8R 2DL7A 1VQ51 2YUQA 1G3SA 1PWTA 4M77D 2FB7A 2JN0A 2EGEA 4JRPA 1M9SA 3J81f 2EAYA 4DBQA 4A3BI 4NBDA 1QLYA 1ZHIA 1NJIU 1X2KA 2F5KA 3HRSA 4PJOD 3GTQI 1K8A2 2MWPA 2D1XA 3RR6A 4EMKB 4BE2A 3RMQA 4RVHA 3CCS1 2X4JA 1K9M2 3RBBB 3CXCP 3OMCA 2V3VA 1D3BA 3CC41 4KH1B 2OOYB 4J9BA 1UJYA 1N9RA 4NBBA 1WJRA 1VQP1 5HK0A 2L2PA 1M1KU 2DXCA 2CYZB 4C0DC 1M8VA 3G4SZ 3OYKA 2O4HA 1K0XA 2GBQA 1PNJA 3TU4K 1X6GA 1X2QA 4E2YA 3EH1A 4DEXA 4CC3A 2M0YA 1VQKT 1Y71A 3REAB 1M90C 4M7AF 4A4GA 1M1KC 1QVGS 1ZB9A 4M4ZA 2Q51A 3CCJ1 2QRDB 3CCET 2CP7A 4X9CA 2JT4A 1YCYA 5LJ3j 2KROA 4C0GA 2EQJA 1SPKA 1GCQA 1X43A 1YITT 2EYZA 1VQOQ 2OTJA 3OYYA 2P84A 2VGMA 4IIMA 2DLPA 4MH4A 4M75A 4BY6C 1ZUKA 4L6V5 4FYYB 4NOZA 1M3AA 3CMEQ 2PUOB 2ED1A 3QO3A 1G3TA 1SSFA 1D3BB 3MONA 4JJBA 3DKMA 4IUUA 3MJXA 4HA8A 1RABB 4J9FA 4N0AC 2DXTA 2L3SA 4KGZB 2HAXA 3OW2Y 4GY5A 3RERA 3RKYA 4ZN3A 2W03A 3GCFA 2P3YA 2RMOA 3VS2A 3PO3I 2GQIA 3UDCA 1YUKA 2MCNA 2JA8I 4V2SA 2LQKA 1TFIA 2Z0WA 3H3VJ 4F7UF 3L2WA 1H92A 4EWCA 3OYEA 1BB9A 1W4SA 2KVQG 3M54A 3S16I 3C94A 1TXQA 5D1OA 3P5JB 1G3WA 2CS7A 3FJPA 5LJ3e 3M53A 3LWHA 4FL6A 2K2MA 4E2ZA 4IURA 1AVZC 1FX7A 4NFRA 5LL6S 4LDXA 3G6EA 3CCQT 2YUNA 2QA4T 2WSFE 1I50I 3LWIA 4N4IA 3X24B 3G71A 1VQ91 1VQ7T 3M0RA 1WHHA 4C8QC 2W10A 1M2OA 2QRCB 2OTJZ 1B34A 5AT1B 3RKXA 2K2VA 2QR1B 2XDPA 1IREB 4JJDA 1D09B 3ESWA 2X3XD 4M7DF 3NTKA 2BZXA 1WHMA 4XTUA 1RLPC 1IB8A 1MV0B 2QGGA 4C5HA 2CT3A 3OSVA 3CCRT 4A53A 5I21A 4HH4A 4J9GA 5CKDA 1WZOA 2HSPA 1WHKA 3ZEHA 2QYZA 3SWNC 4DBRA 2QGFB 1YIJ1 2F2WA 1YBYA 4RKUE 2JTEA 2FL7A 1VQMQ 3UPUA 1IGUA 2YUPA 3RZOI 3CCVZ 3QZ5B 4ZGJB 1FYNA 3HP9A 4JRQA 5I11A 4M77G 3JCMh 5IAYA 1VQNQ 4JLIA 2JNYA 3I56A 2JIQA 2DM1A 1QCNA 3GOXA 5D1OB 3OS1A 2ZCFB 4A3DI 1YI21 1PSEA 3I55A 1HJDA 1GBRA 2B8AA 3MPUB 3GTJI 1YJ9T 2J6AA 4ZTJA 1ZB8A 3H0GI 3G6EZ 1JQQA 2CP2A 2GFAA 2OTL1 2R92I 4PJOE 1VQ5T 4C5GA 3GLXA 1MMDA 3MEUA 4MXUA 3G71Z 2DRMA 2O4XB 2F2VA 2M51A 4KGVB 4LD6A 4CC7A 2XKOC 2DBMA 5KYYB 2JZ2A 1B34B 2MYSA 5J39A 3PVQA 2O2OA 1SSHA 3GTKI 1WIEA 2OTJQ 4KBMB 5GAN6 1MUZA 3CCMA 3CCST 4Z89A 5DY9A 3CC4T 2EYQA 2OAUA 4JJNK 2DL8A 4PJLA 4A54A 4MDXA 1ACMB 1WZNA 4QQDA 4J9DA 1YJN1 5CQYA 2XDBA 1VQPT 2P0QA 2JNGA 2CREA 2AZSA 1M901 5ECAA 2LVMA 2YT6A 3VS4A 1D0YA 3KFVA 4OMNA 4OGEA 1M1K1 3KIHA 3H9NA 3LW5E 1Q86C 3CCUA 1I4K1 4DGLA 1NZ9A 1Q81C 3OBWA 2RJFA 3GF5A 2JMOA 4XU1A 3CMA1 3CCVQ 2JIPA 3I56Z 4OMFB 3R6NA 1GFCA 4MD7A 2DMOA 5A2Qb 1ZUUA 2LJ3A 2MAMA 3NHNA 6AT1B 1Z9QA 1CKBA 1Y07A 3I55Z 3QBYA 1UUEA 2JS0A 2JM8A 4X9DA 2RHZA 2O31A 4XU0A 4NBEA 3CCJT 2LIYA 1KSWA 1A0NB 4DK1A 3JCMf 3RUXA 2RHXA 3CC7A 3O8VA 1RQFA 5GAMf 3F70A 1VQL1 4M78C 5EC7A 3HTRA 1Q82R 4RVFA 4PKCC 2VGNA 5GMKh 2HL3A 1P9NA 1TWAI 1KD1R 1QCFA 3X20B 4E2FB 3JCMc 4E2WA 3CCU1 4PFZA 1MGQA 4BY6B 2A37A 3CCMZ 2DTOA 2RK1A 2E2JI 3NH4A 1G3YA 2X4YA 1Z03A 2QQSA 2QREB 2R58A 4J7FA 4AFUC 2LT4A 5C0MA 2EJFA 1E7OA 2QEXQ 3VUZA 3M56A 2CP3A 3E2UA 1UGQB 2J05A 1U5SA 4QTTA 1LVKA 2DL3A 2D6FA 3F3PC 5C4JI 2RB6A 2VWFA 2EYWA 4FSXA 2DXUA 3INZA 1TWGI 5KYUB 2DF6A 4PJOF 3TQ7P 3CPWY 4FU6A 3SD4A 5FWCA 2L3RA 1WXBA 3I56Q 4PNOA 1OZ2A 2RNAA 2DE7A 2XK0A 3OS2A 2A36A 2FG0A 4ME7A 4BE0A 4ANJA 4LE9A 5A2Qf 1KD12 4B9XA 3I55Q 1C1AA 4KUDK 2V1RA 4FW1A 1RI0A 3CC7Z 3GNFB 1VQ9T 2MIOA 5FU6C 4O5VA 2JMCA 3S17I 4M77A 1BI3A 2V1QA 4M7DD 4R55A 1UGSB 5GANe 1W2BA 1UGRB 2C06A 3M0UA 5CIUA 1HXDA 1PD1A 1QMCA 2Y4XA 4HVVA 4ZN1A 2ROLA 2JVVA 2NVTI 4J9IA 1PRMC 2DL4A 3JSCA 3JCMg 1Q7YR 1C6VX 4K11A 3FIFA 2HD0A 2KYMA 2Y90A 3M0PA 3EERA 1YUAA 1YJW1 3JCMP 5GAMg 1G2BA 4A3EI 2E6NA 2RH2A 2EJGA 2LQ8A 2RHYA 3D9XA 1ZSGA 3SWNB 1YIJT 4HT9A 1PKSA 1RACB 1GL5A 1K8AC 1NEGA 5IP7I 3HFNA 2DJQA 2M0OA 2VASA 2YDLA 2YRCA 1QP3A 1K73R 2COZA 1QVGA 4E47A 1KC8U 3EGXA 4F17A 2RD1A 3NFCA 3ZL7C 4RCCA 3GP8A 8ATCB 1JXOA 2E12A 5C44I 4NBHA 1ABQA 2GQVA 1D0XA 1AOJA 3CD61 1WGSA 2M48A 1YI2T 3HRUA 1KQ2A 2LCSA 1W2BP 2Y0SA 3QKJA 4YTLA 2KNBB 3HOZI 3UWNA 3RKWA 2OTLT 2FRYA 2FZGB 2QQBA 3KBGA 2YHTA 2PM9A 1Q7Y2 1HSQA 2P28A 1KC8C 2X9HA 3BY7A 1ARKA 2RJEA 4NS5A 4M77B 4E33A 2HQXA 2P4TA 2VC8A 1W2BZ 2AHJB 1Y96B 4OMQA 4P5NA 1VQ61 3HFOA 5FLXE 2VPYA 3D2LA 2LNHB 2E2II 3S15I 4M75G 3CCL1 1KHIA 5HKCA 4HVWA 5A0LA 4X34A 2V8KA 1Y1VS 4M7AG 3HKZA 1Q811 2M02A 2XICA 2FZKB 3IQLA 1N8RR 2J6OA 2CP5A 1NLOC 2VF1A 3J81b 3VS1A 4AFQC 5IHKA 1OU8A 1Q95G 3P8HA 3ASKA 1QVGP 4LDWA 2KQWA 1YJNT 1VQOA 1UE9A 3GTMI 1MNEA 5CKBA 2LTOA 2J6FA 2MF2A 2NLUA 1QP2A 2IZ4A 3OA6A 2DYIA 1Y8CA 4Y52I 2OX7A 4PFOA 3KUFA 3CMEA 2JR6A 5FROA 3RMSA 4M75C 2YRVA 2JA5I 4IKFA 1Y57A 3CMAT 4M7AC 2KEAA 3S14I 2EJ9A 1VLAA 1VQ81 1U06A 4FW2A 3HRTA 2PVDB 3GTOI 5HCKA 4E7LA 1USPB 3M5AA 4QTUA 2KT8A 2EQMA 2LQWA 1FMVA 1TG0A 2MK5A 5D6XA 1N2FA 4QVDA 1VQKQ 4II1A 1UTIA 1K9MR 3GBQA 5C6SA 1VQLT 4F7UG 1K76A 1PCXA 1M1GA 4JLGA 1X69A 3FRNA 1SKUB 1N6AA 3CCEQ 3M55A 1VIEA 4RTUA 4AT1B 2FO0A 3BDUA 4A63B 3U23A 3CCUT 1JBMA 5D6YA 3E9FA 2LFUA 1VUBA 4RV9A 4MONA 1YNZA 2KI7A 3EG1A 5EG2A 1YITQ 4FYXB 1YHQZ 3JCMd 2L8DA 4EIKA 5FRMA 4JS5A 3VRZA 2FPDA 2JA6I 4F14A 5GAMd 3VYHB 2I3CA 2D8HA 4A3KI 1VQOZ 1P92A 1TTHB 1SEMA 3JAMb 5DM7R 5KE2A 3FLGA 1RAEB 3P8DA 3OYCA 3CMEZ 2NVXI 2DRKA 3G4S1 1EFNA 1VQ41 3PFSA 1M30A 2DJZA 1RO2A 3H41A 4A4KA 5CKEA 1M4ZA 1HD3A 2DAQA 1I3QI 3BG1B 1W2BS 2KK4A 3VS7A 1VYVA 3QYHB 3SFMA 1WJQA 1IHWA 2DEUA 2JJ9A 1VQMA 5FLXf 1S72Z 1M90U 4M7DE 4X1VA 5GMKj 3VYGA 4A3II 1SRLA 3RESA 3REBB 2CDTA 4HCCA 1VQNA 3CBOA 2LX9A 3I07A 2QQ9A 5T6BA 5FU6B 3VTNA 2L5QA 1JXMA 3A8OB 3CCQQ 2LRQA 3CC2A 2HBWA 1R77A 2LCLA 2RI2A 3S3NA 1VQ7Q 3V7RA 4DOVA 4J6YA 1M2VA 2RF0A 4FT2A 4Z88A 2RI3A 3G1JA 4EDUA 1YJWT 2RI5A 2CUDA 3E9GA 4WCIA 2WSCE 1BCMA 3E1SA 4RUGA 1TOVA 3I4NI 1YHQQ 2BUDA 1LQLA 3TREA 3CCRQ 4A4EA 2LX7A 4EMGA 4RTVA 4S1TA 3M4OI 2Y4YA 4B9WA 1I5LA 5GMKe 1RI9A 3BW1A 3QZ9B 2KXDA 3JAMf 1TWFI 5GAOn 2QK0A 9ATCB 4JPBW 5IT9E 3S1NI 1BI2A 4FM4B 4M7AA 4ZTFA 1KC81 2LP5A 5IXFA 1UFFA 4MZPA 1G83A 2EYYA 1AZGB 5GAN8 3CD6T 2F69A 3WVDB 1K0SA 2VPWA 2K5IA 4HGYA 1VQMZ 5GAN4 3C4SA 1OX8A 4FCYA 2EBPA 3S6WA 5D7UA 1WNLA 4RG8A 1OQKA 1S72Q 2O53A 3TDHB 1VQNZ 3CCVA 5FRNA 2DZCA 1BI1A 4QW2A 4JRKA 3J80E 2VB6A 2O9VA 1FXXA 2VVKA 2DXBA 1YJ9Q 1W6XA 3TVTA 3K7AI 3CC2Z 1VQ6T 2DE6A 2FZCB 1WA7A 1MHNA 5GAN3 1VQ5Q 1NBEB 3MO8A 2OTJ1 1X01A 3CCLT 3OYIA 4A3GI 1Y7XA 2VKNA 5GMKm 2ESWA 3WXMB 3UA7A 5LJ5h 3QJ6A 5D6WA 1M2VB 2E65A 3HHTB 3L2QA 4ZNXA 1T3LA 1K4US 2DVEA 3QYGB 1LCKA 1MMNA 4F7UA 3CC4Q 2LJ1A 3FKII 3A5ZB 4DA4A 4J8OA 3PT9A 4C8QE 3ZFJA 1PD0A 1IXDA 3LH5A 1LPLA 4M75B 5J26A 1NJIR 3HSBA 4JDSA 2JM9A 4IUVA 1E6HA 3LYIA 2RQWA 4EMHA 5GANf 3CCV1 2QG9B 4RTZA 1VQ8T 4M7AB 1QCOA 2DTIA 1ZUYA 3V8KA 5GAOq 2GTOA 5DLOA 2QEXA 3VB9A 4BY7I 1Q82U 2EQIA 2KSSA 1RNIA 5C4XI 2ABLA 1AD5A 2QKDA 3NGPA 2RHBA 2XG8D 2XHCA 2K6DA 4MZTA 2CZ7B 3CQZI 1ZLMA 2H8HA 2DNUA 4NB9A 3JCMV 3C95A 3G6E1 1TWBA 3N5BB 2G3RA 2OAWA 5IHIA 3OQ5A 1B7TA 4M7DA 3CCJQ 4C92E 4D8KA 3G711 2G6FX 1Q82C 1WI7A 1YWPA 3VS6A 1ZSZA 2NUTA 5GAMh 2K7AA 3JCMb 2ECZA 1KD1C 1BI0A 1QVPA 1V1CA 4PJOG 3CC2Q 2RHIA 3EFOA 2CH4A 5DLQE 2GTIA 1W1FA 2CZ6B 5AN9F 5GAN2 2NAPA 3M9QA 5IT9f 3FJ5A 1NJI2 2E6ZA 4EPCA 3THKA 4X6AI 5GMKl 4M77C 4RG2A 2DKGA 3QHSA 3C12A 4D8DA 4F7UB 1WQ7A 2GCXA 2P0PA 2MOXA 1YN8A 3CPFA 3I5RA 3NTIA 5LJ5f 2EKHA 2QXFA 3G4ST 2K5FA 1VQ4T 1WFWA 4PJOC 2AYDA 3CEYA 1Q86U 1T0JA 1WX6A 3IFUA 1Q81U 3JB9J 1M1K2 4DEYA 4Q5WA 2EWNA 3J80f 2NYSA 1JEGA 2QEXZ 3VMHA 4KUIA 2E4HA 3UATA 1QF8A 1WHLA 3I561 3A98A 2K9GA 3SDZA 4WTOB 1L1OC 3MKDA 1NYGA 4HVUA 2ZPIB 2F4MA 2OJ2A 1ZH1A 3A1PA 3I551 2K3YA 3QG1A 5GANg 1TSFA 4C0ZA 2BZYA 2RQRA 4IUPA 1RAFB 2COYA 3JB9I 2M1HA 3PMTA 2HDAA 3VUBA 2HQHA 3M3YI 2PVOB 2FHDA 4E7SA 5CM2M 4DBFA 2XMFA 4BBSI 2NUTB 1VQ9Q 1FWZA 1RADB 4Z02A 4QVZA 2RJCA 1KQSA 2NVYI 2M6NA 3EFOB 4BD3A 2A28A 4RVDA 1Q7YC 1GBQA 1KRLA 4A4FA 4OF1A 1AZEA 4C8QF 3CCM1 4CL1A 1NE8A 1H3ZA 3V8LA 2D0NA 2EGTA 3M0QA 2RJDA 4QQGA 4A3FI 4M78E 2BKDN 2KPIA 2PNIA 1H3HA 1D1AA 4C5IA 1QKXA 1YIJQ 1K73C 2PZ1A 1X27A 1N9SA 2F2XA 3QDFA 1YP5A 2I2LA 5AYFA 1QVFA 1OEBA 4CC4B 5LJ5g 2JXBA 2XD0A 3S2DI 2HSEB 4C92F 4A3JI 5GJVB 4AFSC 2K79A 4E7JA 2M9UA 3CBMA 1M3BA 2KMTA 2ZPBB 1N8RU 1U1TA 2JIRA 1KQSP 1EIFA 1JU5C 1Z02A 1U3OA 3NDJA 3CC71 1TWHI 4XTVA 2OTLQ 3OYGA 2OTJT 4BDZA 2RN8A 1VQKA 1ZBJA 1KQSZ 1GCPA 1NEBA 2RQVA 1H8KA 2E5KA 4BB7A 3VMIA 3MZLB 3VRYA 1N8RC 2SEMA 5KCOA 3JCMW 3ME9A 2VUBA 3CCEA 1W2BY 5LJ3h 3ER0A 3IX0A 2YWWA 2AT1B 1QVFP 1K8AU 4IIOA 4Y28E 4BBRI 2ZGWA 1YITA 4HGZA 3TSWA 1ZA2B 2ROTA 4PJOA 2DA9A 1K9MU 3QWUA 4FYWB 3PIOA 1UG1A 1RAGB 4GLKA 3CCVT 3OYLA 2JA7I 3O5ZA 2DE0X 2ZAEA 3L2RA 4PLIA 2RIQA 2X3WD 4XTWA 4KH0B 3SEMA 3EFSA 1QVFZ 2E5QA 2V26A 3I5SA 5FU7B 1Q821 5A0GA 1AWJA 1BBZA 2VXFA 4DOWA 1N27A 3PE0A 4BDYA 2B86A 2LT1A 1KD11 2O88A 3OYMA 4Y7NI 3HL8A 4Z8AA 3NMZC 4BI4A 1PRLC 3G6ET 1QVGY 5GANd 1K9MC 2FVUA 2QTVA 2OI3A 4PJJA 3GIBA 2PTKA 2KAFA 3G71T 4A3MI 1NLPC 2CP6A 1J3TA 2JIOA 2OOXB 4KULA 1NG2A 2K3RA 1WDXA 2LZ6B 4NL2A 4HCBA 3JB9F 1VQKZ 1CKAA 2FPFA 1FDIA 3S3OA 3DB4A 2LMJA 5HK3A 4M78F 4JS4A 1OI1A 2JIMA 1JJ2Z 4TNUA 3CCQA 1I8FA 2QA4A 3J7A4 4KRTA 2K5RA 4PL6A 3CCEZ 2DD5A 4XAXB 1VQ7A 3CPWZ 2C0OA 2EPDA 2H3JA 3VMGA 1PG5B 1AWOA 3MEWA 3J81E 1YITZ 2LCCA 2J06A 2KBTA 4PJOB 1G8XA 1Q861 5GAN7 4NBAA 1YHQA 1YWOA 3ULRB 3CCRA 5LJ3f 3HOVI 3E19A 2FPEA 2XIDA 4XTYA 4BY1I 2CP0A 3I56T 1NPRA 2BZ8A 2LNVA 2JUFA 5GAMj 3CD6Z 4NL3A 2X35A 2EW3A 3V8JA 2F5TX 3I55T 1KQSS 1IHVA 5LJ5d 2X4XA 3EG3A 3EGDA 1Q7Y1 1IZ6A 2RK2A 4CI0C 3I9QA 4UC4A 3DB3A 5FLXb 3EGXB 4LDUA 4M75E 5CKFA 3M4GA 1Q16A 2CKKA 2VYTA 3MP6A 3KXTA 1V29B 5GAOm 2HNIA 1VQ6Z 1AT1B 2EGCA 4C8QD 4ZGDB 3PIPA 1S72A 3FC3A 3PO3S 3EG9A 3CCLZ 1WXTA 3J7AF 1QKWA 3X28B 1K731 2FEIA 4J9HA 3CCMT 1NPPA 1FMKA 4F16A 3LGFA 1YHQ1 1YJ9A 4EMKA 3QIIA 1RO4A 2HU9A 3CCQZ 1D1BA 2QA4Z 1DL6A 2HZYA 1QVFS 1ZQ1A 2IZ3A 3BG0B 1VQ5A 2QQAA 3QSUA 1YJWQ 1VQO1 1YCSB 2YUOA 2WB1A 1VQ7Z 4KGXB 2PMZA 2G2KA 4FT4A 3JCMe 3RDVA 4BI3A 2MMPA 1ABOA 4XU3A 3CME1 3AT1B 2QLVB 4E6RA 1WCMI 2DIGA 2SRCA 4WF2A 2E7ZA 2K5LA 1IO6A 2AKLA 4OVAA 1M27C 2IIMA 1OOTA 3GNGA 1VQ8Z 2FRWA 4C92D 3CCSA 3CCRZ 2B63I 2H3EB 2PUKB 2W0ZA 3CC4A 2XU8A 1V76A 1PSFA 3S2HI 4MZMA 3JV3A 4BI8B 1S721 2AK5A 4LN2A 1VQPA 3VS5A 4NBCA 3M57A 3EGDB 3CD6Q 2P0KA 2RPNA 3JB9H 1JJ2S 4J9EA 5LJ3g 1N8R1 2GFUA 3CC7T 2ZPHB 4M7DG 3M59A 1K1ZA 3EHQA 3META 3CPWS 3OY9A 4L59A 3BDLA 4RTWA 2DD4A 2JUBA 3M0SA 2HBPA 4AG1C 2BE7D 3D7SB 3OBYA 3EG9B 4MMKA 3QUIA 1H641 3SB2A 1VQ6Q 3GPLA 2DK3A 2AKKA 2P4RA 4XK8E 2OZKA 3MEVA 3CCJA 3CCLQ 5GAOl 5IHNA 1YJ9Z 2VPXA 4OB2B 3Q1JA 2ZPFB 3A8LB 5CO7A 1PFTA 4M7DC 2I0NA 2HCKA 1VQ5Z 4XQ3A 1B3QA 1NP6A 2YLBA 3FEOA 3VKIA 1KHCA 4HCZA 1ZSZC 2QA4Q 1OYXA 3M0TA 4OP0A 1SIWA 2E3HA 2EGAA 4AFZC 5C3EI 4KT0E 3EGUA 3VU3C 1RUWA 1K8A1 1NJIC 2DX1A 1XJWB 1VQ4Z 3CXCZ 4O6JA 2KI7B 2NVQI 1K9M1 2LQNA 2DFUA 2VV5A 1T3SA 1X6BA 2KDSA 3U50C 3CCSZ 3A8MB 2ATCB 4QQ6A 4RCBA 5FWBA 5GANh 3PMIA 3CC4Z 2A0FB 5IN1A 5CK9A 2BE9B 2R57A 3OMGA 4M75F 1KC82 2RO0A 1VQ8Q 1U1SA 3V7CA 1VQM1 2YLCA 1VQPZ 1O75A 2JTFA 4GBQA 3NDIA 1TH7A 5KYXA 1LJOA 2DVJA 1QQJA 3LLRA 4NBGA 2DO3A 2O9SA 1SFOI 1VQN1 1Y1VI 2EKOA 3JB9D 2EFIA 2KYBA 2CSIA 1E6GA 5T67A 1Y1WI 1CSKA 1DJ7B 2COWA 3T9NA 3GTPI 3ZBDA 3OYBA 4XX2A 3CC21 1RAIB 4M78D 3GTLI 1JWHC 3LUSA 2KGTA 3VS3A 2HKQB 4GLMA 3DLMA 3G7ZA 3CCJZ 3EFRA 1PC0A 3NH5A 4NB8A 1VQ9A 3Q87A 3VS0A 1D0ZA 2W04A 2BTTA 2DBKA 1I1JA 5GAOr 5IT9b 4HCKA 3OW2A 4OMOA 2KY9A 4LUDA 3JCMJ 4HT8A 1D1CA 2C0TA 3UA6A 4HXJA 3OYJA 1TU0B 1MNDA 3G4SQ 1VQ4Q 3D6WA 2ZPGB 1RAAB 4JRIA 4E31A 4C8QG 2RT9A 2XI9A 2DPPB 2YADA 1X0TA 4DQ2A 3CCSQ 1XOVA 2A08A 1ML8A 1YIJA 5KYXB 3J80b 3NH8A 1OPKA 4CRIA 4Y92A 3M4YA 2KE9A 3A8HB 2MI6A 1VQPQ 1X3WA 3R6OA 3NPFA 2K3BA
chains in the Genus database with same CATH topology
2EGTA 1X2KA 3M0QA 2KR3A 3GTQI 2LCSA 1K8A2 2Y0SA 2D1XA 2KNBB 3HOZI 2GTHA 4RVHA 3CCS1 4A3FI 3MZKB 1K9M2 2PNIA 2KPIA 2FRYA 3QWXX 3RBBB 3CC41 1H3HA 1QKXA 2PM9A 1Q7Y2 1HSQA 2OOYB 2P28A 2PZ1A 4J9BA 1ARKA 1UJYA 1X27A 2F2XA 4NBBA 4E33A 1VQP1 1YP5A 2H85A 2L2PA 1W2BZ 4OMQA 1VQ61 3G4SZ 1OEBA 4CC4B 2LNHB 2E2II 5T64A 2JXBA 3S15I 3S2DI 3CCL1 4A3JI 1VQ9Z 2BJOA 4HVWA 2O4HA 1UHFA 1SHFA 2C0IA 3EG2A 2V8KA 5GJVB 1K0XA 1Y1VS 2VUMI 2GBQA 3HKZA 2K79A 4AFSC 1Q811 3IQLA 1PNJA 3OW2Z 1M3BA 4A3CI 1SHGA 1X2QA 4E2YA 1X6GA 1NLOC 2J6OA 2JS2A 2VF1A 3J81b 3VS1A 4AFQC 4DEXA 4CC3A 5IHKA 1S7MA 2M0YA 1JU5C 1RLYA 1Z02A 3REAB 1Z01A 1UE9A 3GTMI 1U3OA 3NDJA 2J6FA 1K9AA 3CC71 3H0HA 1TWHI 1ZB9A 2IZ4A 4Y52I 4M4ZA 2Q51A 2QEX1 3CCJ1 2JR6A 2RN8A 2JA5I 1ZBJA 2QRDB 1KQSZ 1GCPA 1NEBA 1Z9ZA 2RQVA 1H8KA 1Y57A 5GJWB 2E5KA 3VMIA 2V8JA 2Q4ZA 2JT4A 1YIJZ 2KEAA 3MZLB 1BU1A 1MV3A 1NM7A 3QWYA 3S14I 2NWMA 1VLAA 1VQ81 2E2HI 2KROA 1U06A 1T0HA 3VRYA 2SEMA 4OMPA 1SPKA 1GCQA 1VYTA 3GKQA 4E32A 3GTOI 1X43A 2EYZA 2CT4A 1M902 5HCKA 4IIMA 2DLPA 1TUDA 1UECA 1USPB 1M3CA 4MH4A 1AWXA 4QTUA 4NH1C 2KT8A 1W2BY 1QWEA 2LQWA 2CH4W 3IX0A 1ZUKA 4NOZA 1M3AA 1TG0A 2GGRA 1N2FA 2HEQA 2L0AA 2ED1A 4IIOA 4BBRI 3F3FC 2R6MA 4HGZA 1UTIA 3MONA 4JJBA 3TSWA 4DQYB 3GBQA 2ROTA 2DA9A 4J9FA 1YI2Z 3QWUA 4MD8A 2L3SA 1UG1A 2R7ZI 3RNJA 2JA7I 3OW2Y 3O5ZA 1NJI1 2DE0X 1K76A 2RIQA 2X3WD 2W03A 3GCFA 1X69A 2P3YA 2RMOA 3SEMA 3PO3I 1QVFZ 1N5ZA 2GQIA 1YUKA 2MCNA 3I5SA 3VS2A 2OTLZ 2JA8I 1Q821 1RLQC 3GTGI 1AWJA 1VYUA 4RTUA 1BBZA 1KFZA 2DILA 1OV3A 2FO0A 5D1PA 1TFIA 3H3VJ 3U23A 4A63B 1H92A 2LFUA 4RV9A 1NYFA 3PE0A 2KXCA 2B86A 4EWCA 1KD11 4MONA 1YNZA 3EG1A 2O88A 4Y7NI 1R9TI 4Z8AA 1BB9A 3S1QI 1YHQZ 4EIKA 3NMZC 1KQSY 1PRLC 2JA6I 2FPDA 3VRZA 1QVGY 5FW9A 4F14A 3IF8A 3S16I 4E2XA 2I3CA 2D8HA 5D1OA 3P5JB 4A3KI 1VQOZ 2OI3A 1SEMA 3TE5B 3JAMb 2PTKA 2DYBA 4A3MI 1NLPC 1J3TA 2K2MA 4E2ZA 2OOXB 2EVRA 1AVZC 1NG2A 2K3RA 1WDXA 4A3LI 4NFRA 2LZ6B 3HOXI 3CMEZ 2NVXI 1PHTA 2YUNA 2DRKA 3G4S1 1EFNA 1I50I 1VQKZ 1TUCA 1VQ41 2KRSA 1YJNZ 1CKAA 1M30A 2FPFA 1RO2A 1VQ91 3M0RA 2LMJA 3H41A 2W10A 2QRCB 2RPRA 1HD3A 1I3QI 3BG1B 1JJ2Z 4TNUA 3VS7A 2OTJZ 2CUBA 3J7A4 1VYVA 4KRTA 2QR1B 4JJDA 2K5RA 3ESWA 2X3XD 3CCEZ 5FLXf 1S72Z 2BZXA 4X1VA 1RLPC 3CMAZ 4BXXI 3CPWZ 1QVFY 1MV0B 2C0OA 2EPDA 3GTMS 4A3II 2CT3A 2RQTA 1SRLA 3VMGA 1AWOA 3I4MI 3REBB 4HH4A 1YITZ 2CDTA 4J9GA 2J06A 2KBTA 2HSPA 1Q861 4RTXA 3I07A 5T6BA 4NBAA 3VTNA 2L3QA 1JXMA 1YWOA 1YIJ1 3ULRB 2F2WA 4OMLA 3HOVI 2JTEA 2FPEA 2HBWA 1VA7A 4BY1I 4ESRA 2F4OA 2BZ8A 2JS4A 3H0FA 1GRIA 1KJWA 3H0IA 2VUGA 2YUPA 3CD6Z 3S1RI 3RZOI 3CCVZ 2EW3A 1FYNA 1ZX6A 5I11A 1VQLZ 5IH2A 2RF0A 4Z88A 2EYXA 4FSSA 1JO8A 2CUDA 3EG3A 3PVLA 4WCIA 4LNPA 1Q7Y1 2J7IA 2JNYA 2DL5A 4RUGA 2DM1A 3I4NI 3I9QA 5D1OB 3TSZA 4CC2A 5FLXb 3CCUZ 4A3DI 1YI21 1LQLA 1JJ2Y 1HJDA 2LX7A 5ECAA 1GBRA 4RTVA 4S1TA 3GTJI 1NUIA 3M4OI 2J6AA 1VQ6Z 1ZB8A 3H0GI 3G6EZ 1JQQA 2EGCA 2OTL1 2R92I 4R0KA 1RI9A 3PO3S 2KXDA 3JAMf 3CCLZ 1TWFI 1WXTA 1WW9A 4MXUA 3G71Z 4JPBW 3S1NI 3FQMA 1QKWA 1Y0MA 1Q822 2DRMA 2F2VA 1KC81 1K731 2FEIA 2LP5A 2M51A 4J9HA 4ORZA 4LUEA 1UFFA 4CC7A 5IXFA 2KT1A 1FMKA 1G83A 2EYYA 2DBMA 1YHQ1 1AZGB 4F16A 2RBLA 1AWWA 1AEYA 1RO4A 2HU9A 3CCQZ 2O2OA 2QA4Z 1DL6A 1SSHA 3PVQA 3HOUI 3NFZA 3GTKI 2IZ3A 3BG0B 1K0SA 3CQTA 4HGYA 1VQMZ 2LJ0A 1VQO1 1WIEA 1YCSB 2YUOA 2WB1A 1VQ7Z 3EHRA 2PMZA 2G2KA 4A93I 1MUZA 1S1NA 1KIKA 2EBPA 4Z89A 2O53A 2AZVA 1ABOA 3TDHB 1VQNZ 3CME1 3HOYI 1W70A 2DL8A 2QLVB 1B07A 1VQK1 4E6RA 4J9DA 1WCMI 1YJN1 1WYXA 2ENMA 2O9VA 2SRCA 4JZ4A 1IO6A 2AKLA 2YU9I 1UDLA 4RTYA 2KRMA 2VVKA 1M27C 2IIMA 1OOTA 1W6XA 1VQ8Z 1M901 2AZSA 2CREA 2FRWA 3K7AI 3CCRZ 3CC2Z 2B63I 2DE6A 2YT6A 4QT7A 1WA7A 3KFVA 2V8IA 2J6KA 2W0ZA 4OMNA 3SHWA 1M1K1 3VS4A 1TWCI 3KIHA 2GNCA 2OTJ1 3S2HI 4A3GI 4DGLA 2VKNA 3JV3A 2ESWA 1WXUA 3I35A 1WIIA 3UA7A 3CCE1 1S721 2AK5A 2JMOA 4LN2A 3CMA1 3VS5A 4NBCA 2RPNA 5L23A 4ZNXA 3I56Z 1T3LA 3R6NA 1K4US 1GFCA 4MD7A 2DMOA 5A2Qb 1YIT1 3TVTA 4J9EA 1ZUUA 1N8R1 1LCKA 2LJ3A 3NHNA 2JMAA 1Z9QA 1CKBA 3I55Z 1UUEA 1K1ZA 2JM8A 2JS0A 3EHQA 1YJWZ 2LJ1A 3FKII 2O31A 4NBEA 2L3PA 2LIYA 1Q862 4RTWA 2JUBA 1KSWA 3M0SA 1A0NB 4DK1A 3LH5A 4AG1C 1Q812 2WAQA 2DE5A 2JM9A 1E6HA 1RQFA 2RQWA 1USPA 3CCV1 4RTZA 2JW4A 4JJCA 2AKKA 1VQL1 1ZUYA 2P4RA 2OZKA 5EC7A 2GTOA 2GTJA 3VB9A 4BY7I 4RVFA 5FLMI 1YJ9Z 5IHNA 2EQIA 1RNIA 5C4XI 2D0NA 2ABLA 1AD5A 2QKDA 1PFTA 1P9NA 1TWAI 2I0NA 1WLPB 2HCKA 2RHBA 1VQ5Z 3NGPA 4RVGA 1UJ0A 1B3QA 1NP6A 2ZAEB 1QCFA 1I07A 4E2WA 3CCU1 4AG2C 3M0TA 2K6DA 2A37A 1PKTA 3CCMZ 4AYBA 3CQZI 1ZLMA 2H8HA 2E2JI 3NH4A 2DNUA 4NB9A 2EGAA 4AFZC 5LL6f 5C3EI 1Z03A 5I22A 3EGUA 2QREB 1RUWA 3G6E1 1K8A1 4AFUC 1K83I 2DX1A 1VQ4Z 2D8JA 3CXCZ 1BK2A 2OAWA 5IHIA 2ED0A 2KI7B 2NVQI 1E7OA 3C0CA 1K9M1 2LQNA 3RZDI 1T3SA 1X6BA 4D8KA 3G711 2G6FX 4MD9A 3U50C 3CCSZ 1WI7A 1YWPA 3VS6A 5FWBA 2HF1A 2J05A 4E30A 3CC4Z 3S1MI 2K7AA 1U5SA 4QTTA 1QYPA 1I6HI 2QDLA 2DL3A 2ECZA 3CCQ1 1KC82 1K732 2QA41 3F3PC 1V1CA 5C4JI 3KIFA 2VWFA 2CH4A 1UGVA 1VQM1 2EYWA 2GTIA 1VQPZ 4RTTA 1W1FA 4GBQA 3NDIA 5AN9F 1VQ71 4JZ3A 1TWGI 2DVJA 3FQQA 1GCQC 5IT9f 1QWFA 3FJ5A 1NJI2 2DF6A 4RS4A 4NBGA 3CPWY 2O9SA 1SFOI 1VQN1 4X6AI 3THKA 5FWCA 1Y1VI 2KYBA 2CSIA 1WXBA 1E6GA 5T67A 1QVGZ 4D8DA 1Y1WI 2R93I 2RNAA 2DE7A 2A36A 3EEDA 1CSKA 5IXBA 2FG0A 3GTPI 2MOXA 1YN8A 5IP9I 3I5RA 2NUZA 2RQUA 2E9HA 4LE9A 4XX2A 3CCR1 5A2Qf 3CC21 1KD12 2EKHA 1WFWA 2V1RA 1UHCA 3GTLI 2CSQA 1JWHC 3CC7Z 2GU2A 1T0JA 1WX6A 2MIOA 3IFUA 2KRNA 3NPFA 1X3ZA 3LUSA 2KGTA 1M1K2 4DEYA 3VS3A 2JMCA 3S17I 3J80f 1JEGA 2V1QA 1GFDA 4GLMA 2QEXZ 3VMHA 3CCJZ 1RO0A 3M0UA 3CXCY 3UATA 1QF8A 3I561 3A98A 2K9GA 4HVVA 1L1OC 3NH5A 4NB8A 2ROLA 3Q87A 1NYGA 2NVTI 4HVUA 1PRMC 2DL4A 4J9IA 2F4MA 1M8MA 2OJ2A 3VS0A 1ZH1A 4K11A 3I551 2W04A 2BTTA 2YSQA 2KYMA 3M0PA 2DBKA 3EERA 1I1JA 1YUAA 1N8R2 4MRIA 1YJW1 5IT9b 4HCKA 2BZYA 2RQRA 3T4NB 3PO2I 1I0CA 1G2BA 4OMOA 4A3EI 3HOWI 4LUDA 1OPLA 2C0TA 3UA6A 4HXJA 3D9XA 1ZSGA 4OMMA 3UF4A 2HDAA 4NBFA 3M3YI 2PK7A 1PKSA 5CM2M 3D6WA 2XMFA 1GL5A 4BBSI 1NEGA 5IP7I 4J9CA 4E31A 2DJQA 2YDLA 2RT9A 1YJ91 3EG0A 2YADA 1X0TA 1SRMA 2NVYI 2M6NA 1XOVA 2A28A 2DL7A 4RVDA 1VQ51 2A08A 1ML8A 1GBQA 1KRLA 4F17A 3J80b 3NH8A 1OPKA 3ZL7C 1AZEA 2YUQA 1PWTA 3CCM1 1JXOA 4Y92A 5C44I 4CL1A 4NBHA 2EGEA 2KE9A 3J81f 1ABQA 1X3WA 4A3BI 4NBDA 1QLYA 1AOJA 3CD61 2M48A 2K3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2K A;  3M0Q A;  2KR3 A;  3GTQ I;  2LCS A;  2D1X A;  2KNB B;  3HOZ I;  4A3F I;  2PNI A;  2KPI A;  2FRY A;  3QWX X;  3RBB B;  1H3H A;  1QKX A;  1HSQ A;  2PZ1 A;  4J9B A;  1ARK A;  1UJY A;  1X27 A;  2F2X A;  4NBB A;  1YP5 A;  2L2P A;  4OMQ A;  1OEB A;  4CC4 B;  2LNH B;  2E2I I;  2JXB A;  3S15 I;  3S2D I;  4A3J I;  4HVW A;  2BJO A;  1UHF A;  1SHF A;  2C0I A;  3EG2 A;  5GJV B;  1K0X A;  1Y1V S;  2VUM I;  2GBQ A;  4AFS C;  2K79 A;  3IQL A;  1PNJ A;  1M3B A;  4A3C I;  1SHG A;  1X2Q A;  1X6G A;  2J6O A;  1NLO C;  2JS2 A;  3VS1 A;  4AFQ C;  4DEX A;  4CC3 A;  5IHK A;  2M0Y A;  1JU5 C;  1RLY A;  3REA B;  1UE9 A;  3GTM I;  1U3O A;  2J6F A;  1K9A A;  3H0H A;  1TWH I;  1ZB9 A;  4Y52 I;  4M4Z A;  2JR6 A;  2RN8 A;  2JA5 I;  1ZBJ A;  1Z9Z A;  1NEB A;  1GCP A;  5GJW B;  2RQV A;  1H8K A;  1Y57 A;  2E5K A;  3VMI A;  2JT4 A;  2KEA A;  1BU1 A;  1MV3 A;  1NM7 A;  3QWY A;  3S14 I;  2NWM A;  1VLA A;  2E2H I;  2KRO A;  3VRY A;  1U06 A;  1T0H A;  2SEM A;  4OMP A;  1SPK A;  1GCQ A;  1VYT A;  3GKQ A;  3GTO I;  1X43 A;  2EYZ A;  2CT4 A;  5HCK A;  4IIM A;  2DLP A;  1TUD A;  1UEC A;  1USP B;  1M3C A;  4MH4 A;  1AWX A;  4QTU A;  2KT8 A;  1QWE A;  2LQW A;  2CH4 W;  1ZUK A;  4NOZ A;  1M3A A;  1TG0 A;  2GGR A;  1N2F A;  2HEQ A;  2L0A A;  2ED1 A;  4IIO A;  4BBR I;  1UTI A;  4JJB A;  3TSW A;  3GBQ A;  2ROT A;  2DA9 A;  4J9F A;  2L3S A;  1UG1 A;  2R7Z I;  3RNJ A;  2JA7 I;  3O5Z A;  2DE0 X;  1K76 A;  2X3W D;  1X69 A;  3GCF A;  2P3Y A;  2RMO A;  3SEM A;  3PO3 I;  1N5Z A;  2GQI A;  3VS2 A;  2MCN A;  3I5S A;  2JA8 I;  1RLQ C;  4RTU A;  1VYU A;  3GTG I;  1AWJ A;  1KFZ A;  1BBZ A;  2DIL A;  1OV3 A;  2FO0 A;  1TFI A;  3H3V J;  3U23 A;  4A63 B;  1H92 A;  1NYF A;  3PE0 A;  2KXC A;  2B86 A;  2O88 A;  1YNZ A;  3EG1 A;  4Y7N I;  1R9T I;  4Z8A A;  1BB9 A;  3S1Q I;  4EIK A;  3NMZ C;  3VRZ A;  1PRL C;  2JA6 I;  2FPD A;  4F14 A;  5FW9 A;  3S16 I;  2D8H A;  4A3K I;  2OI3 A;  1SEM A;  2PTK A;  2DYB A;  4A3M I;  1NLP C;  1J3T A;  2K2M A;  2EVR A;  1AVZ C;  1NG2 A;  1WDX A;  4A3L I;  2LZ6 B;  3HOX I;  2NVX I;  1PHT A;  2YUN A;  2DRK A;  1EFN A;  1TUC A;  1I50 I;  2KRS A;  1CKA A;  1M30 A;  2FPF A;  3M0R A;  2LMJ A;  3H41 A;  2W10 A;  1HD3 A;  1I3Q I;  3VS7 A;  2CUB A;  1VYV A;  4KRT A;  4JJD A;  2K5R A;  3ESW A;  2X3X D;  2BZX A;  4X1V A;  1RLP C;  4BXX I;  2C0O A;  1MV0 B;  2EPD A;  3GTM S;  4A3I I;  2CT3 A;  2RQT A;  1SRL A;  3VMG A;  1AWO A;  3I4M I;  3REB B;  2CDT A;  4J9G A;  2J06 A;  2KBT A;  2HSP A;  4RTX A;  3I07 A;  4NBA A;  2L3Q A;  1JXM A;  1YWO A;  3ULR B;  2F2W A;  4OML A;  3HOV I;  2JTE A;  2FPE A;  2HBW A;  1VA7 A;  4BY1 I;  4ESR A;  2F4O A;  2BZ8 A;  2JS4 A;  3H0F A;  1GRI A;  1KJW A;  3H0I A;  2YUP A;  3S1R I;  3RZO I;  2EW3 A;  1FYN A;  1ZX6 A;  5I11 A;  5IH2 A;  2RF0 A;  4Z88 A;  2EYX A;  4FSS A;  1JO8 A;  2CUD A;  3EG3 A;  3PVL A;  4WCI A;  4LNP A;  2J7I A;  2JNY A;  2DL5 A;  4RUG A;  2DM1 A;  3I4N I;  3I9Q A;  3TSZ A;  4CC2 A;  4A3D I;  1LQL A;  1HJD A;  2LX7 A;  1GBR A;  4RTV A;  3GTJ I;  1NUI A;  3M4O I;  2J6A A;  1ZB8 A;  3H0G I;  1JQQ A;  2EGC A;  2R92 I;  4R0K A;  1RI9 A;  3PO3 S;  2KXD A;  1TWF I;  1WXT A;  1WW9 A;  4JPB W;  3S1N I;  1QKW A;  1Y0M A;  2DRM A;  2F2V A;  2M51 A;  2LP5 A;  2FEI A;  4ORZ A;  4J9H A;  4CC7 A;  5IXF A;  4LUE A;  1UFF A;  2KT1 A;  1FMK A;  1G83 A;  2EYY A;  2DBM A;  1AZG B;  4F16 A;  1AWW A;  2RBL A;  1AEY A;  1RO4 A;  3PVQ A;  2O2O A;  1DL6 A;  1SSH A;  3HOU I;  3GTK I;  1K0S A;  3CQT A;  2LJ0 A;  1YCS B;  1WIE A;  2YUO A;  3EHR A;  4A93 I;  1MUZ A;  1S1N A;  1KIK A;  2EBP A;  4Z89 A;  2AZV A;  1ABO A;  3HOY I;  1W70 A;  2DL8 A;  1B07 A;  4E6R A;  4J9D A;  1WCM I;  1WYX A;  2ENM A;  2O9V A;  2SRC A;  4JZ4 A;  1IO6 A;  2AKL A;  2YU9 I;  1UDL A;  4RTY A;  2KRM A;  2VVK A;  1M27 C;  2IIM A;  1OOT A;  1W6X A;  2AZS A;  2CRE A;  2FRW A;  5ECA A;  4QT7 A;  3K7A I;  2B63 I;  2YT6 A;  3TVT A;  2DE6 A;  3VS4 A;  1WA7 A;  3KFV A;  4OMN A;  2J6K A;  2W0Z A;  3SHW A;  1TWC I;  2GNC A;  3S2H I;  4A3G I;  2VKN A;  3JV3 A;  2ESW A;  1WXU A;  3I35 A;  3UA7 A;  2AK5 A;  4LN2 A;  3VS5 A;  4NBC A;  2RPN A;  5L23 A;  4ZNX A;  1T3L A;  3R6N A;  1K4U S;  1GFC A;  2DMO A;  4J9E A;  1ZUU A;  1LCK A;  2LJ3 A;  3NHN A;  2JMA A;  1Z9Q A;  1CKB A;  1UUE A;  1K1Z A;  2JM8 A;  2JS0 A;  3EHQ A;  2LJ1 A;  3FKI I;  2O31 A;  4NBE A;  2L3P A;  4RTW A;  1KSW A;  3M0S A;  1A0N B;  3LH5 A;  4AG1 C;  2DE5 A;  2JM9 A;  1E6H A;  2RQW A;  1USP A;  4RTZ A;  2JW4 A;  4JJC A;  2AKK A;  1ZUY A;  2P4R A;  5EC7 A;  2GTO A;  2GTJ A;  3VB9 A;  4BY7 I;  5FLM I;  5IHN A;  2EQI A;  5C4X I;  2D0N A;  2ABL A;  1AD5 A;  1PFT A;  1TWA I;  2I0N A;  1WLP B;  2HCK A;  3NGP A;  1UJ0 A;  1B3Q A;  1QCF A;  1I07 A;  4AG2 C;  3M0T A;  2K6D A;  2A37 A;  1PKT A;  3CQZ I;  1ZLM A;  2H8H A;  2E2J I;  2EGA A;  2DNU A;  4NB9 A;  4AFZ C;  5C3E I;  5I22 A;  3EGU A;  1RUW A;  4AFU C;  1K83 I;  2DX1 A;  2D8J A;  1BK2 A;  2OAW A;  5IHI A;  2ED0 A;  2NVQ I;  1E7O A;  3C0C A;  2LQN A;  3RZD I;  1T3S A;  1X6B A;  4D8K A;  2G6F X;  3U50 C;  1WI7 A;  1YWP A;  3VS6 A;  5FWB A;  2HF1 A;  2J05 A;  2K7A A;  3S1M I;  1U5S A;  4QTT A;  1QYP A;  1I6H I;  2QDL A;  2DL3 A;  2ECZ A;  1V1C A;  5C4J I;  2VWF A;  2CH4 A;  1UGV A;  2EYW A;  4RTT A;  1W1F A;  4GBQ A;  4JZ3 A;  1TWG I;  2DVJ A;  1GCQ C;  1QWF A;  3FJ5 A;  2DF6 A;  4NBG A;  2O9S A;  1SFO I;  3THK A;  4X6A I;  5FWC A;  1Y1V I;  2KYB A;  2CSI A;  1WXB A;  1E6G A;  4D8D A;  1Y1W I;  2R93 I;  2RNA A;  2DE7 A;  2A36 A;  5IXB A;  1CSK A;  2FG0 A;  3GTP I;  2MOX A;  1YN8 A;  5IP9 I;  3I5R A;  2NUZ A;  2RQU A;  4LE9 A;  4XX2 A;  2EKH A;  1WFW A;  2V1R A;  1UHC A;  3GTL I;  2CSQ A;  1T0J A;  1WX6 A;  2MIO A;  2KRN A;  3NPF A;  1X3Z A;  3LUS A;  2KGT A;  4DEY A;  3VS3 A;  2JMC A;  3S17 I;  1JEG A;  2V1Q A;  1GFD A;  4GLM A;  3VMH A;  3M0U A;  3UAT A;  3A98 A;  2K9G A;  4HVV A;  1L1O C;  4NB8 A;  2ROL A;  3Q87 A;  1NYG A;  2NVT I;  4HVU A;  1PRM C;  2DL4 A;  4J9I A;  2F4M A;  1M8M A;  2OJ2 A;  3VS0 A;  4K11 A;  2YSQ A;  2BTT A;  2KYM A;  3M0P A;  2DBK A;  3EER A;  1I1J A;  1YUA A;  4HCK A;  2BZY A;  2RQR A;  3PO2 I;  1I0C A;  1G2B A;  4OMO A;  4A3E I;  3HOW I;  4LUD A;  1OPL A;  2C0T A;  3UA6 A;  4HXJ A;  1ZSG A;  4OMM A;  3UF4 A;  2HDA A;  4NBF A;  3M3Y I;  2PK7 A;  1PKS A;  5CM2 M;  3D6W A;  2XMF A;  1GL5 A;  4BBS I;  1NEG A;  5IP7 I;  4J9C A;  2DJQ A;  2YDL A;  3EG0 A;  1SRM A;  2NVY I;  1XOV A;  2A28 A;  2DL7 A;  2A08 A;  1ML8 A;  1GBQ A;  4F17 A;  1OPK A;  3ZL7 C;  1AZE A;  2YUQ A;  1PWT A;  1JXO A;  4Y92 A;  5C44 I;  4NBH A;  2EGE A;  2KE9 A;  1ABQ A;  1X3W A;  4A3B I;  4NBD A;  1QLY A;  1AOJ A;  2K3B A; 
#chains in the Genus database with same CATH topology
 4LXC A;  5LJ3 d;  2KR3 A;  3S3M A;  2O4X A;  4IUT A;  2GTH A;  4PJN A;  5FU7 C;  3BE3 A;  3X26 B;  3MZK B;  3QWX X;  5KYY A;  5I2S A;  1KD1 U;  1YI2 A;  3L1A A;  1M90 R;  3CXC S;  1XQH A;  4C92 G;  1M1K R;  3OW2 P;  2H85 A;  1YHQ T;  4J6X A;  2OTL A;  5T64 A;  1VQO T;  1VQ9 Z;  2BJO A;  1UHF A;  1WHG A;  1SHF A;  2C0I A;  3EG2 A;  2QQR A;  2VUM I;  1XTD A;  3TEE A;  2K57 A;  3OW2 Z;  4A3C I;  1SHG A;  2JS2 A;  1BIA A;  3CME T;  2EQU A;  2X51 A;  1R0C B;  2DET A;  1S7M A;  1RLY A;  1Z01 A;  2K4Y A;  4C92 C;  1K9A A;  2RA2 A;  3H0H A;  3MHX A;  3HPW A;  2RHU A;  4Y91 A;  2QEX 1;  1YJN A;  1Z9Z A;  5GJW B;  5J3B A;  1S72 T;  3QXE B;  2DER A;  2V8J A;  2Q4Z A;  2HQE A;  1YIJ Z;  1BU1 A;  1MV3 A;  1NM7 A;  1LOJ A;  3QWY A;  2NWM A;  4M77 E;  2E2H I;  3IR7 A;  1KK7 A;  5CVI A;  1T0H A;  4OMP A;  1VYT A;  3GKQ A;  4E32 A;  2CT4 A;  3NTH A;  1M90 2;  4E7K A;  3PGG A;  2NUP A;  1TUD A;  1UEC A;  1M3C A;  4N4H A;  1AWX A;  4NH1 C;  1QWE A;  3P8B B;  3CMA A;  2CH4 W;  2QDY B;  3MP1 A;  4QKU A;  4L5G A;  2GGR A;  2HEQ A;  2L0A A;  1SG5 A;  3F3F C;  2R6M A;  4JUV A;  5CR2 A;  4DQY B;  1BCO A;  2E70 A;  1YI2 Z;  4MD8 A;  2R7Z I;  4J6W A;  3RNJ A;  5CAI A;  4F04 B;  3PTA A;  1Q7Y U;  1NJI 1;  2HL5 C;  4D6W A;  3OB9 A;  1I5O B;  5A2Q E;  1X6O A;  1N5Z A;  2VXE A;  2OTL Z;  3VV0 A;  3DLL A;  1RLQ C;  3GTG I;  1VYU A;  1KFZ A;  2DIL A;  1OV3 A;  5D1P A;  4J7I A;  4M7D B;  1M5Q 1;  1WPY A;  1NYF A;  1VQL A;  5KCH A;  2KXC A;  1X75 C;  4N0A A;  1ZSZ B;  1R9T I;  3S1Q I;  1AA6 A;  1KQS Y;  1U8R A;  5FW9 A;  3IF8 A;  4E2X A;  1EZZ B;  4C0D B;  3OS0 A;  3OYA A;  3JB9 G;  2XDD A;  1K73 U;  2EIF A;  5CCA A;  2CZ1 B;  3TE5 B;  4C0F A;  2DYB A;  4M75 D;  3QJY A;  2EVR A;  4A3L I;  3LGL A;  4A4H A;  3HOX I;  4M7A D;  1PHT A;  1ZA1 B;  4M78 G;  5KYU A;  4XTX A;  1TUC A;  4AMC A;  2KRS A;  1YJN Z;  5KYN A;  1VQM T;  3OSS C;  2F1L A;  2RPR A;  4IUQ A;  4NOY A;  3BFM A;  2X4W A;  1BKB A;  2CUB A;  1VQN T;  2NUP B;  5CQX A;  3MP8 A;  4E7I A;  3CMA Z;  4BXX I;  1QVF Y;  3LX7 A;  1UGP B;  3A8G B;  4N4G A;  4XU2 A;  3GTM S;  2HKN A;  2RQT A;  3G6E Q;  1TUG B;  2E64 A;  5KH6 A;  3CC2 T;  3I4M I;  4C8Q A;  3OW2 S;  3G71 Q;  2QI2 A;  5GAN 5;  4RTX A;  1OX9 A;  2IVW A;  2L3Q A;  5KYW A;  3AHU A;  4OML A;  1YI2 Q;  1VA7 A;  4ESR A;  2F4O A;  2JS4 A;  3H0F A;  1GRI A;  1KJW A;  3H0I A;  4E7Z A;  5GAN j;  2VUG A;  3S1R I;  3UT1 A;  4MML A;  1BYM A;  1ZX6 A;  5IH2 A;  1VQL Z;  4J5Y A;  2EYX A;  4FSS A;  1JO8 A;  3SWN A;  3PVL A;  1RL2 A;  4LNP A;  2J7I A;  1KQ1 A;  2LEX A;  2DL5 A;  1HK9 A;  1UB4 A;  1VIF A;  3EH2 A;  2WSE E;  4C5E A;  2DEQ A;  4E7H A;  3TSZ A;  2O01 E;  2YXY A;  4CC2 A;  3CCU Z;  3EAE A;  8AT1 B;  4M77 F;  1OU9 A;  4C92 A;  1JJ2 Y;  5M9O A;  3OYF A;  1YJW A;  4EMK C;  1JJ2 A;  3L2Z A;  3OYD A;  4VUB A;  1NUI A;  2RM4 A;  2PQW A;  2QTX A;  2A7Y A;  4ATO A;  4R0K A;  4HKE A;  3L2U A;  3CPW A;  1WW9 A;  2PVG B;  4LDV A;  3FQM A;  1R0B G;  1Y0M A;  1Q82 2;  2GF7 A;  1ZBX A;  4B6M A;  2VPZ A;  4ORZ A;  4LUE A;  1YJN Q;  2KT1 A;  1PM3 A;  3L42 A;  1AEY A;  1AWW A;  3MCA B;  2RBL A;  4PJM A;  1JB0 E;  4OB3 B;  3HOU I;  1Q86 R;  3NFZ A;  3CQT A;  1WHJ A;  1UEB A;  2LJ0 A;  1Q81 R;  2FYK A;  3EHR A;  5HY6 A;  4A93 I;  3M58 A;  3H6Z A;  1S1N A;  1KIK A;  2E1H A;  4J83 A;  4C8Q B;  1Y96 A;  2AZV A;  3CMA Q;  1IRX A;  2PU9 B;  3CD6 A;  3HOY I;  3MEA A;  1W70 A;  1B07 A;  1VQK 1;  1WYX A;  2ENM A;  1MMG A;  4JZ4 A;  2QAZ A;  2YU9 I;  1UDL A;  2R5A A;  4RTY A;  2KRM A;  4DBH A;  5LJ5 j;  3OYN A;  5KYW B;  1KG1 A;  2IV2 X;  4QT7 A;  3JRZ A;  2V45 A;  2JTM A;  2V8I A;  2J6K A;  3SHW A;  1TWC I;  2GNC A;  4PFP A;  3CBP A;  2LDM A;  4TVR A;  1WXU A;  3I35 A;  3CCM Q;  1WII A;  1YFN A;  1WJ2 A;  3CCE 1;  4BE1 A;  2L89 A;  3OYH A;  1JJ2 P;  3H8Z A;  1RAH B;  1VQ6 A;  5L23 A;  3X25 B;  1R8O B;  2E3I A;  1JRI A;  1AHJ B;  1VQL Q;  1YIT 1;  3CCL A;  2D9T A;  5L8R E;  1WQW A;  4XTZ A;  3CPW P;  2JMA A;  4C92 B;  2AIR B;  1YJW Z;  4QVC A;  5GMK i;  2IG0 A;  2QEX T;  2ZPE B;  2L3P A;  3CCU Q;  1Q86 2;  4ZGE B;  2E10 A;  1Q81 2;  2WAC A;  3FDR A;  2HMA A;  2LC4 A;  4LDY A;  2WAQ A;  4ELY C;  2DE5 A;  1QW1 A;  1TS9 A;  7AT1 B;  1USP A;  2K3X A;  1C0M A;  2JW4 A;  4JJC A;  2M16 A;  1F1B B;  1I81 A;  1O9S A;  3OS5 A;  2GTJ A;  5FLM I;  1VOM A;  2BIV A;  1OZ3 A;  1WLP B;  4MDW A;  4RVG A;  1UJ0 A;  5LJ5 e;  1MMA A;  2ZAE B;  1I07 A;  4AG2 C;  1VQ8 A;  5GAO p;  1PKT A;  1FDO A;  1SF9 A;  4AYB A;  2ZZD A;  5I2M A;  3VJP A;  3WVE B;  5LL6 f;  4M78 A;  3PNW C;  3CC7 Q;  5I22 A;  1EX4 A;  1K83 I;  2D8J A;  1BK2 A;  2DIQ A;  4RMO A;  2QAS A;  2ED0 A;  3TCJ A;  3C0C A;  2A3L A;  3RZD I;  3QDR B;  2JOY A;  4MD9 A;  2R5M A;  2HF1 A;  4E30 A;  3S1M I;  1QYP A;  1I6H I;  2QDL A;  2MPX C;  3CCQ 1;  1K73 2;  2QA4 1;  3KIF A;  3JCM X;  1UGV A;  4OB1 B;  4RTT A;  1VQ7 1;  4M7A E;  3HKS A;  4JZ3 A;  3FQQ A;  1GCQ C;  4PK4 A;  1QWF A;  1HYO A;  2EQK A;  2CGH A;  4RS4 A;  1FMW A;  1QXF A;  1OUL A;  1M1F A;  1QVG Z;  1IGQ A;  2R93 I;  3JCM Q;  1G5V A;  5IXB A;  3EED A;  2E41 A;  5IP9 I;  2NUZ A;  2RQU A;  2E9H A;  3CCR 1;  5A0D A;  2DZ9 A;  4LD9 K;  1UHC A;  5KE3 A;  2CSQ A;  3FB9 A;  2D0Q B;  2GU2 A;  1WJS A;  4BUG A;  2KRN A;  1X3Z A;  3V7S A;  3L2V A;  1GFD A;  5GAM e;  1RO0 A;  1K8A R;  3CXC Y;  3G4S A;  1VQ4 A;  4R56 A;  3JAM E;  3CXC A;  3QPH A;  2YRD A;  1M8M A;  4FYV B;  2YSQ A;  4PLL A;  4OB0 B;  1N8R 2;  4MRI A;  2CZ0 B;  2DTH A;  4M78 B;  3T4N B;  3PO2 I;  1I0C A;  1XNI A;  3HOW I;  4BAC A;  3RIR A;  1OPL A;  3URG A;  1BIB A;  4OMM A;  3UF4 A;  4OGC A;  4F7U E;  4NBF A;  2PK7 A;  1LNX A;  5CKH A;  2MWO A;  2IPO B;  4J9C A;  4FIB A;  3LH0 A;  1YJ9 1;  1GXI E;  3EG0 A;  1SRM A;  4ELZ C;  1KC8 R;  2DL7 A;  1VQ5 1;  2YUQ A;  1G3S A;  1PWT A;  4M77 D;  2FB7 A;  2JN0 A;  2EGE A;  4JRP A;  1M9S A;  3J81 f;  2EAY A;  4DBQ A;  4A3B I;  4NBD A;  1QLY A;  1ZHI A;  1NJI U;  1X2K A;  2F5K A;  3HRS A;  4PJO D;  3GTQ I;  1K8A 2;  2MWP A;  2D1X A;  3RR6 A;  4EMK B;  4BE2 A;  3RMQ A;  4RVH A;  3CCS 1;  2X4J A;  1K9M 2;  3RBB B;  3CXC P;  3OMC A;  2V3V A;  1D3B A;  3CC4 1;  4KH1 B;  2OOY B;  4J9B A;  1UJY A;  1N9R A;  4NBB A;  1WJR A;  1VQP 1;  5HK0 A;  2L2P A;  1M1K U;  2DXC A;  2CYZ B;  4C0D C;  1M8V A;  3G4S Z;  3OYK A;  2O4H A;  1K0X A;  2GBQ A;  1PNJ A;  3TU4 K;  1X6G A;  1X2Q A;  4E2Y A;  3EH1 A;  4DEX A;  4CC3 A;  2M0Y A;  1VQK T;  1Y71 A;  3REA B;  1M90 C;  4M7A F;  4A4G A;  1M1K C;  1QVG S;  1ZB9 A;  4M4Z A;  2Q51 A;  3CCJ 1;  2QRD B;  3CCE T;  2CP7 A;  4X9C A;  2JT4 A;  1YCY A;  5LJ3 j;  2KRO A;  4C0G A;  2EQJ A;  1SPK A;  1GCQ A;  1X43 A;  1YIT T;  2EYZ A;  1VQO Q;  2OTJ A;  3OYY A;  2P84 A;  2VGM A;  4IIM A;  2DLP A;  4MH4 A;  4M75 A;  4BY6 C;  1ZUK A;  4L6V 5;  4FYY B;  4NOZ A;  1M3A A;  3CME Q;  2PUO B;  2ED1 A;  3QO3 A;  1G3T A;  1SSF A;  1D3B B;  3MON A;  4JJB A;  3DKM A;  4IUU A;  3MJX A;  4HA8 A;  1RAB B;  4J9F A;  4N0A C;  2DXT A;  2L3S A;  4KGZ B;  2HAX A;  3OW2 Y;  4GY5 A;  3RER A;  3RKY A;  4ZN3 A;  2W03 A;  3GCF A;  2P3Y A;  2RMO A;  3VS2 A;  3PO3 I;  2GQI A;  3UDC A;  1YUK A;  2MCN A;  2JA8 I;  4V2S A;  2LQK A;  1TFI A;  2Z0W A;  3H3V J;  4F7U F;  3L2W A;  1H92 A;  4EWC A;  3OYE A;  1BB9 A;  1W4S A;  2KVQ G;  3M54 A;  3S16 I;  3C94 A;  1TXQ A;  5D1O A;  3P5J B;  1G3W A;  2CS7 A;  3FJP A;  5LJ3 e;  3M53 A;  3LWH A;  4FL6 A;  2K2M A;  4E2Z A;  4IUR A;  1AVZ C;  1FX7 A;  4NFR A;  5LL6 S;  4LDX A;  3G6E A;  3CCQ T;  2YUN A;  2QA4 T;  2WSF E;  1I50 I;  3LWI A;  4N4I A;  3X24 B;  3G71 A;  1VQ9 1;  1VQ7 T;  3M0R A;  1WHH A;  4C8Q C;  2W10 A;  1M2O A;  2QRC B;  2OTJ Z;  1B34 A;  5AT1 B;  3RKX A;  2K2V A;  2QR1 B;  2XDP A;  1IRE B;  4JJD A;  1D09 B;  3ESW A;  2X3X D;  4M7D F;  3NTK A;  2BZX A;  1WHM A;  4XTU A;  1RLP C;  1IB8 A;  1MV0 B;  2QGG A;  4C5H A;  2CT3 A;  3OSV A;  3CCR T;  4A53 A;  5I21 A;  4HH4 A;  4J9G A;  5CKD A;  1WZO A;  2HSP A;  1WHK A;  3ZEH A;  2QYZ A;  3SWN C;  4DBR A;  2QGF B;  1YIJ 1;  2F2W A;  1YBY A;  4RKU E;  2JTE A;  2FL7 A;  1VQM Q;  3UPU A;  1IGU A;  2YUP A;  3RZO I;  3CCV Z;  3QZ5 B;  4ZGJ B;  1FYN A;  3HP9 A;  4JRQ A;  5I11 A;  4M77 G;  3JCM h;  5IAY A;  1VQN Q;  4JLI A;  2JNY A;  3I56 A;  2JIQ A;  2DM1 A;  1QCN A;  3GOX A;  5D1O B;  3OS1 A;  2ZCF B;  4A3D I;  1YI2 1;  1PSE A;  3I55 A;  1HJD A;  1GBR A;  2B8A A;  3MPU B;  3GTJ I;  1YJ9 T;  2J6A A;  4ZTJ A;  1ZB8 A;  3H0G I;  3G6E Z;  1JQQ A;  2CP2 A;  2GFA A;  2OTL 1;  2R92 I;  4PJO E;  1VQ5 T;  4C5G A;  3GLX A;  1MMD A;  3MEU A;  4MXU A;  3G71 Z;  2DRM A;  2O4X B;  2F2V A;  2M51 A;  4KGV B;  4LD6 A;  4CC7 A;  2XKO C;  2DBM A;  5KYY B;  2JZ2 A;  1B34 B;  2MYS A;  5J39 A;  3PVQ A;  2O2O A;  1SSH A;  3GTK I;  1WIE A;  2OTJ Q;  4KBM B;  5GAN 6;  1MUZ A;  3CCM A;  3CCS T;  4Z89 A;  5DY9 A;  3CC4 T;  2EYQ A;  2OAU A;  4JJN K;  2DL8 A;  4PJL A;  4A54 A;  4MDX A;  1ACM B;  1WZN A;  4QQD A;  4J9D A;  1YJN 1;  5CQY A;  2XDB A;  1VQP T;  2P0Q A;  2JNG A;  2CRE A;  2AZS A;  1M90 1;  5ECA A;  2LVM A;  2YT6 A;  3VS4 A;  1D0Y A;  3KFV A;  4OMN A;  4OGE A;  1M1K 1;  3KIH A;  3H9N A;  3LW5 E;  1Q86 C;  3CCU A;  1I4K 1;  4DGL A;  1NZ9 A;  1Q81 C;  3OBW A;  2RJF A;  3GF5 A;  2JMO A;  4XU1 A;  3CMA 1;  3CCV Q;  2JIP A;  3I56 Z;  4OMF B;  3R6N A;  1GFC A;  4MD7 A;  2DMO A;  5A2Q b;  1ZUU A;  2LJ3 A;  2MAM A;  3NHN A;  6AT1 B;  1Z9Q A;  1CKB A;  1Y07 A;  3I55 Z;  3QBY A;  1UUE A;  2JS0 A;  2JM8 A;  4X9D A;  2RHZ A;  2O31 A;  4XU0 A;  4NBE A;  3CCJ T;  2LIY A;  1KSW A;  1A0N B;  4DK1 A;  3JCM f;  3RUX A;  2RHX A;  3CC7 A;  3O8V A;  1RQF A;  5GAM f;  3F70 A;  1VQL 1;  4M78 C;  5EC7 A;  3HTR A;  1Q82 R;  4RVF A;  4PKC C;  2VGN A;  5GMK h;  2HL3 A;  1P9N A;  1TWA I;  1KD1 R;  1QCF A;  3X20 B;  4E2F B;  3JCM c;  4E2W A;  3CCU 1;  4PFZ A;  1MGQ A;  4BY6 B;  2A37 A;  3CCM Z;  2DTO A;  2RK1 A;  2E2J I;  3NH4 A;  1G3Y A;  2X4Y A;  1Z03 A;  2QQS A;  2QRE B;  2R58 A;  4J7F A;  4AFU C;  2LT4 A;  5C0M A;  2EJF A;  1E7O A;  2QEX Q;  3VUZ A;  3M56 A;  2CP3 A;  3E2U A;  1UGQ B;  2J05 A;  1U5S A;  4QTT A;  1LVK A;  2DL3 A;  2D6F A;  3F3P C;  5C4J I;  2RB6 A;  2VWF A;  2EYW A;  4FSX A;  2DXU A;  3INZ A;  1TWG I;  5KYU B;  2DF6 A;  4PJO F;  3TQ7 P;  3CPW Y;  4FU6 A;  3SD4 A;  5FWC A;  2L3R A;  1WXB A;  3I56 Q;  4PNO A;  1OZ2 A;  2RNA A;  2DE7 A;  2XK0 A;  3OS2 A;  2A36 A;  2FG0 A;  4ME7 A;  4BE0 A;  4ANJ A;  4LE9 A;  5A2Q f;  1KD1 2;  4B9X A;  3I55 Q;  1C1A A;  4KUD K;  2V1R A;  4FW1 A;  1RI0 A;  3CC7 Z;  3GNF B;  1VQ9 T;  2MIO A;  5FU6 C;  4O5V A;  2JMC A;  3S17 I;  4M77 A;  1BI3 A;  2V1Q A;  4M7D D;  4R55 A;  1UGS B;  5GAN e;  1W2B A;  1UGR B;  2C06 A;  3M0U A;  5CIU A;  1HXD A;  1PD1 A;  1QMC A;  2Y4X A;  4HVV A;  4ZN1 A;  2ROL A;  2JVV A;  2NVT I;  4J9I A;  1PRM C;  2DL4 A;  3JSC A;  3JCM g;  1Q7Y R;  1C6V X;  4K11 A;  3FIF A;  2HD0 A;  2KYM A;  2Y90 A;  3M0P A;  3EER A;  1YUA A;  1YJW 1;  3JCM P;  5GAM g;  1G2B A;  4A3E I;  2E6N A;  2RH2 A;  2EJG A;  2LQ8 A;  2RHY A;  3D9X A;  1ZSG A;  3SWN B;  1YIJ T;  4HT9 A;  1PKS A;  1RAC B;  1GL5 A;  1K8A C;  1NEG A;  5IP7 I;  3HFN A;  2DJQ A;  2M0O A;  2VAS A;  2YDL A;  2YRC A;  1QP3 A;  1K73 R;  2COZ A;  1QVG A;  4E47 A;  1KC8 U;  3EGX A;  4F17 A;  2RD1 A;  3NFC A;  3ZL7 C;  4RCC A;  3GP8 A;  8ATC B;  1JXO A;  2E12 A;  5C44 I;  4NBH A;  1ABQ A;  2GQV A;  1D0X A;  1AOJ A;  3CD6 1;  1WGS A;  2M48 A;  1YI2 T;  3HRU A;  1KQ2 A;  2LCS A;  1W2B P;  2Y0S A;  3QKJ A;  4YTL A;  2KNB B;  3HOZ I;  3UWN A;  3RKW A;  2OTL T;  2FRY A;  2FZG B;  2QQB A;  3KBG A;  2YHT A;  2PM9 A;  1Q7Y 2;  1HSQ A;  2P28 A;  1KC8 C;  2X9H A;  3BY7 A;  1ARK A;  2RJE A;  4NS5 A;  4M77 B;  4E33 A;  2HQX A;  2P4T A;  2VC8 A;  1W2B Z;  2AHJ B;  1Y96 B;  4OMQ A;  4P5N A;  1VQ6 1;  3HFO A;  5FLX E;  2VPY A;  3D2L A;  2LNH B;  2E2I I;  3S15 I;  4M75 G;  3CCL 1;  1KHI A;  5HKC A;  4HVW A;  5A0L A;  4X34 A;  2V8K A;  1Y1V S;  4M7A G;  3HKZ A;  1Q81 1;  2M02 A;  2XIC A;  2FZK B;  3IQL A;  1N8R R;  2J6O A;  2CP5 A;  1NLO C;  2VF1 A;  3J81 b;  3VS1 A;  4AFQ C;  5IHK A;  1OU8 A;  1Q95 G;  3P8H A;  3ASK A;  1QVG P;  4LDW A;  2KQW A;  1YJN T;  1VQO A;  1UE9 A;  3GTM I;  1MNE A;  5CKB A;  2LTO A;  2J6F A;  2MF2 A;  2NLU A;  1QP2 A;  2IZ4 A;  3OA6 A;  2DYI A;  1Y8C A;  4Y52 I;  2OX7 A;  4PFO A;  3KUF A;  3CME A;  2JR6 A;  5FRO A;  3RMS A;  4M75 C;  2YRV A;  2JA5 I;  4IKF A;  1Y57 A;  3CMA T;  4M7A C;  2KEA A;  3S14 I;  2EJ9 A;  1VLA A;  1VQ8 1;  1U06 A;  4FW2 A;  3HRT A;  2PVD B;  3GTO I;  5HCK A;  4E7L A;  1USP B;  3M5A A;  4QTU A;  2KT8 A;  2EQM A;  2LQW A;  1FMV A;  1TG0 A;  2MK5 A;  5D6X A;  1N2F A;  4QVD A;  1VQK Q;  4II1 A;  1UTI A;  1K9M R;  3GBQ A;  5C6S A;  1VQL T;  4F7U G;  1K76 A;  1PCX A;  1M1G A;  4JLG A;  1X69 A;  3FRN A;  1SKU B;  1N6A A;  3CCE Q;  3M55 A;  1VIE A;  4RTU A;  4AT1 B;  2FO0 A;  3BDU A;  4A63 B;  3U23 A;  3CCU T;  1JBM A;  5D6Y A;  3E9F A;  2LFU A;  1VUB A;  4RV9 A;  4MON A;  1YNZ A;  2KI7 A;  3EG1 A;  5EG2 A;  1YIT Q;  4FYX B;  1YHQ Z;  3JCM d;  2L8D A;  4EIK A;  5FRM A;  4JS5 A;  3VRZ A;  2FPD A;  2JA6 I;  4F14 A;  5GAM d;  3VYH B;  2I3C A;  2D8H A;  4A3K I;  1VQO Z;  1P92 A;  1TTH B;  1SEM A;  3JAM b;  5DM7 R;  5KE2 A;  3FLG A;  1RAE B;  3P8D A;  3OYC A;  3CME Z;  2NVX I;  2DRK A;  3G4S 1;  1EFN A;  1VQ4 1;  3PFS A;  1M30 A;  2DJZ A;  1RO2 A;  3H41 A;  4A4K A;  5CKE A;  1M4Z A;  1HD3 A;  2DAQ A;  1I3Q I;  3BG1 B;  1W2B S;  2KK4 A;  3VS7 A;  1VYV A;  3QYH B;  3SFM A;  1WJQ A;  1IHW A;  2DEU A;  2JJ9 A;  1VQM A;  5FLX f;  1S72 Z;  1M90 U;  4M7D E;  4X1V A;  5GMK j;  3VYG A;  4A3I I;  1SRL A;  3RES A;  3REB B;  2CDT A;  4HCC A;  1VQN A;  3CBO A;  2LX9 A;  3I07 A;  2QQ9 A;  5T6B A;  5FU6 B;  3VTN A;  2L5Q A;  1JXM A;  3A8O B;  3CCQ Q;  2LRQ A;  3CC2 A;  2HBW A;  1R77 A;  2LCL A;  2RI2 A;  3S3N A;  1VQ7 Q;  3V7R A;  4DOV A;  4J6Y A;  1M2V A;  2RF0 A;  4FT2 A;  4Z88 A;  2RI3 A;  3G1J A;  4EDU A;  1YJW T;  2RI5 A;  2CUD A;  3E9G A;  4WCI A;  2WSC E;  1BCM A;  3E1S A;  4RUG A;  1TOV A;  3I4N I;  1YHQ Q;  2BUD A;  1LQL A;  3TRE A;  3CCR Q;  4A4E A;  2LX7 A;  4EMG A;  4RTV A;  4S1T A;  3M4O I;  2Y4Y A;  4B9W A;  1I5L A;  5GMK e;  1RI9 A;  3BW1 A;  3QZ9 B;  2KXD A;  3JAM f;  1TWF I;  5GAO n;  2QK0 A;  9ATC B;  4JPB W;  5IT9 E;  3S1N I;  1BI2 A;  4FM4 B;  4M7A A;  4ZTF A;  1KC8 1;  2LP5 A;  5IXF A;  1UFF A;  4MZP A;  1G83 A;  2EYY A;  1AZG B;  5GAN 8;  3CD6 T;  2F69 A;  3WVD B;  1K0S A;  2VPW A;  2K5I A;  4HGY A;  1VQM Z;  5GAN 4;  3C4S A;  1OX8 A;  4FCY A;  2EBP A;  3S6W A;  5D7U A;  1WNL A;  4RG8 A;  1OQK A;  1S72 Q;  2O53 A;  3TDH B;  1VQN Z;  3CCV A;  5FRN A;  2DZC A;  1BI1 A;  4QW2 A;  4JRK A;  3J80 E;  2VB6 A;  2O9V A;  1FXX A;  2VVK A;  2DXB A;  1YJ9 Q;  1W6X A;  3TVT A;  3K7A I;  3CC2 Z;  1VQ6 T;  2DE6 A;  2FZC B;  1WA7 A;  1MHN A;  5GAN 3;  1VQ5 Q;  1NBE B;  3MO8 A;  2OTJ 1;  1X01 A;  3CCL T;  3OYI A;  4A3G I;  1Y7X A;  2VKN A;  5GMK m;  2ESW A;  3WXM B;  3UA7 A;  5LJ5 h;  3QJ6 A;  5D6W A;  1M2V B;  2E65 A;  3HHT B;  3L2Q A;  4ZNX A;  1T3L A;  1K4U S;  2DVE A;  3QYG B;  1LCK A;  1MMN A;  4F7U A;  3CC4 Q;  2LJ1 A;  3FKI I;  3A5Z B;  4DA4 A;  4J8O A;  3PT9 A;  4C8Q E;  3ZFJ A;  1PD0 A;  1IXD A;  3LH5 A;  1LPL A;  4M75 B;  5J26 A;  1NJI R;  3HSB A;  4JDS A;  2JM9 A;  4IUV A;  1E6H A;  3LYI A;  2RQW A;  4EMH A;  5GAN f;  3CCV 1;  2QG9 B;  4RTZ A;  1VQ8 T;  4M7A B;  1QCO A;  2DTI A;  1ZUY A;  3V8K A;  5GAO q;  2GTO A;  5DLO A;  2QEX A;  3VB9 A;  4BY7 I;  1Q82 U;  2EQI A;  2KSS A;  1RNI A;  5C4X I;  2ABL A;  1AD5 A;  2QKD A;  3NGP A;  2RHB A;  2XG8 D;  2XHC A;  2K6D A;  4MZT A;  2CZ7 B;  3CQZ I;  1ZLM A;  2H8H A;  2DNU A;  4NB9 A;  3JCM V;  3C95 A;  3G6E 1;  1TWB A;  3N5B B;  2G3R A;  2OAW A;  5IHI A;  3OQ5 A;  1B7T A;  4M7D A;  3CCJ Q;  4C92 E;  4D8K A;  3G71 1;  2G6F X;  1Q82 C;  1WI7 A;  1YWP A;  3VS6 A;  1ZSZ A;  2NUT A;  5GAM h;  2K7A A;  3JCM b;  2ECZ A;  1KD1 C;  1BI0 A;  1QVP A;  1V1C A;  4PJO G;  3CC2 Q;  2RHI A;  3EFO A;  2CH4 A;  5DLQ E;  2GTI A;  1W1F A;  2CZ6 B;  5AN9 F;  5GAN 2;  2NAP A;  3M9Q A;  5IT9 f;  3FJ5 A;  1NJI 2;  2E6Z A;  4EPC A;  3THK A;  4X6A I;  5GMK l;  4M77 C;  4RG2 A;  2DKG A;  3QHS A;  3C12 A;  4D8D A;  4F7U B;  1WQ7 A;  2GCX A;  2P0P A;  2MOX A;  1YN8 A;  3CPF A;  3I5R A;  3NTI A;  5LJ5 f;  2EKH A;  2QXF A;  3G4S T;  2K5F A;  1VQ4 T;  1WFW A;  4PJO C;  2AYD A;  3CEY A;  1Q86 U;  1T0J A;  1WX6 A;  3IFU A;  1Q81 U;  3JB9 J;  1M1K 2;  4DEY A;  4Q5W A;  2EWN A;  3J80 f;  2NYS A;  1JEG A;  2QEX Z;  3VMH A;  4KUI A;  2E4H A;  3UAT A;  1QF8 A;  1WHL A;  3I56 1;  3A98 A;  2K9G A;  3SDZ A;  4WTO B;  1L1O C;  3MKD A;  1NYG A;  4HVU A;  2ZPI B;  2F4M A;  2OJ2 A;  1ZH1 A;  3A1P A;  3I55 1;  2K3Y A;  3QG1 A;  5GAN g;  1TSF A;  4C0Z A;  2BZY A;  2RQR A;  4IUP A;  1RAF B;  2COY A;  3JB9 I;  2M1H A;  3PMT A;  2HDA A;  3VUB A;  2HQH A;  3M3Y I;  2PVO B;  2FHD A;  4E7S A;  5CM2 M;  4DBF A;  2XMF A;  4BBS I;  2NUT B;  1VQ9 Q;  1FWZ A;  1RAD B;  4Z02 A;  4QVZ A;  2RJC A;  1KQS A;  2NVY I;  2M6N A;  3EFO B;  4BD3 A;  2A28 A;  4RVD A;  1Q7Y C;  1GBQ A;  1KRL A;  4A4F A;  4OF1 A;  1AZE A;  4C8Q F;  3CCM 1;  4CL1 A;  1NE8 A;  1H3Z A;  3V8L A;  2D0N A;  2EGT A;  3M0Q A;  2RJD A;  4QQG A;  4A3F I;  4M78 E;  2BKD N;  2KPI A;  2PNI A;  1H3H A;  1D1A A;  4C5I A;  1QKX A;  1YIJ Q;  1K73 C;  2PZ1 A;  1X27 A;  1N9S A;  2F2X A;  3QDF A;  1YP5 A;  2I2L A;  5AYF A;  1QVF A;  1OEB A;  4CC4 B;  5LJ5 g;  2JXB A;  2XD0 A;  3S2D I;  2HSE B;  4C92 F;  4A3J I;  5GJV B;  4AFS C;  2K79 A;  4E7J A;  2M9U A;  3CBM A;  1M3B A;  2KMT A;  2ZPB B;  1N8R U;  1U1T A;  2JIR A;  1KQS P;  1EIF A;  1JU5 C;  1Z02 A;  1U3O A;  3NDJ A;  3CC7 1;  1TWH I;  4XTV A;  2OTL Q;  3OYG A;  2OTJ T;  4BDZ A;  2RN8 A;  1VQK A;  1ZBJ A;  1KQS Z;  1GCP A;  1NEB A;  2RQV A;  1H8K A;  2E5K A;  4BB7 A;  3VMI A;  3MZL B;  3VRY A;  1N8R C;  2SEM A;  5KCO A;  3JCM W;  3ME9 A;  2VUB A;  3CCE A;  1W2B Y;  5LJ3 h;  3ER0 A;  3IX0 A;  2YWW A;  2AT1 B;  1QVF P;  1K8A U;  4IIO A;  4Y28 E;  4BBR I;  2ZGW A;  1YIT A;  4HGZ A;  3TSW A;  1ZA2 B;  2ROT A;  4PJO A;  2DA9 A;  1K9M U;  3QWU A;  4FYW B;  3PIO A;  1UG1 A;  1RAG B;  4GLK A;  3CCV T;  3OYL A;  2JA7 I;  3O5Z A;  2DE0 X;  2ZAE A;  3L2R A;  4PLI A;  2RIQ A;  2X3W D;  4XTW A;  4KH0 B;  3SEM A;  3EFS A;  1QVF Z;  2E5Q A;  2V26 A;  3I5S A;  5FU7 B;  1Q82 1;  5A0G A;  1AWJ A;  1BBZ A;  2VXF A;  4DOW A;  1N27 A;  3PE0 A;  4BDY A;  2B86 A;  2LT1 A;  1KD1 1;  2O88 A;  3OYM A;  4Y7N I;  3HL8 A;  4Z8A A;  3NMZ C;  4BI4 A;  1PRL C;  3G6E T;  1QVG Y;  5GAN d;  1K9M C;  2FVU A;  2QTV A;  2OI3 A;  4PJJ A;  3GIB A;  2PTK A;  2KAF A;  3G71 T;  4A3M I;  1NLP C;  2CP6 A;  1J3T A;  2JIO A;  2OOX B;  4KUL A;  1NG2 A;  2K3R A;  1WDX A;  2LZ6 B;  4NL2 A;  4HCB A;  3JB9 F;  1VQK Z;  1CKA A;  2FPF A;  1FDI A;  3S3O A;  3DB4 A;  2LMJ A;  5HK3 A;  4M78 F;  4JS4 A;  1OI1 A;  2JIM A;  1JJ2 Z;  4TNU A;  3CCQ A;  1I8F A;  2QA4 A;  3J7A 4;  4KRT A;  2K5R A;  4PL6 A;  3CCE Z;  2DD5 A;  4XAX B;  1VQ7 A;  3CPW Z;  2C0O A;  2EPD A;  2H3J A;  3VMG A;  1PG5 B;  1AWO A;  3MEW A;  3J81 E;  1YIT Z;  2LCC A;  2J06 A;  2KBT A;  4PJO B;  1G8X A;  1Q86 1;  5GAN 7;  4NBA A;  1YHQ A;  1YWO A;  3ULR B;  3CCR A;  5LJ3 f;  3HOV I;  3E19 A;  2FPE A;  2XID A;  4XTY A;  4BY1 I;  2CP0 A;  3I56 T;  1NPR A;  2BZ8 A;  2LNV A;  2JUF A;  5GAM j;  3CD6 Z;  4NL3 A;  2X35 A;  2EW3 A;  3V8J A;  2F5T X;  3I55 T;  1KQS S;  1IHV A;  5LJ5 d;  2X4X A;  3EG3 A;  3EGD A;  1Q7Y 1;  1IZ6 A;  2RK2 A;  4CI0 C;  3I9Q A;  4UC4 A;  3DB3 A;  5FLX b;  3EGX B;  4LDU A;  4M75 E;  5CKF A;  3M4G A;  1Q16 A;  2CKK A;  2VYT A;  3MP6 A;  3KXT A;  1V29 B;  5GAO m;  2HNI A;  1VQ6 Z;  1AT1 B;  2EGC A;  4C8Q D;  4ZGD B;  3PIP A;  1S72 A;  3FC3 A;  3PO3 S;  3EG9 A;  3CCL Z;  1WXT A;  3J7A F;  1QKW A;  3X28 B;  1K73 1;  2FEI A;  4J9H A;  3CCM T;  1NPP A;  1FMK A;  4F16 A;  3LGF A;  1YHQ 1;  1YJ9 A;  4EMK A;  3QII A;  1RO4 A;  2HU9 A;  3CCQ Z;  1D1B A;  2QA4 Z;  1DL6 A;  2HZY A;  1QVF S;  1ZQ1 A;  2IZ3 A;  3BG0 B;  1VQ5 A;  2QQA A;  3QSU A;  1YJW Q;  1VQO 1;  1YCS B;  2YUO A;  2WB1 A;  1VQ7 Z;  4KGX B;  2PMZ A;  2G2K A;  4FT4 A;  3JCM e;  3RDV A;  4BI3 A;  2MMP A;  1ABO A;  4XU3 A;  3CME 1;  3AT1 B;  2QLV B;  4E6R A;  1WCM I;  2DIG A;  2SRC A;  4WF2 A;  2E7Z A;  2K5L A;  1IO6 A;  2AKL A;  4OVA A;  1M27 C;  2IIM A;  1OOT A;  3GNG A;  1VQ8 Z;  2FRW A;  4C92 D;  3CCS A;  3CCR Z;  2B63 I;  2H3E B;  2PUK B;  2W0Z A;  3CC4 A;  2XU8 A;  1V76 A;  1PSF A;  3S2H I;  4MZM A;  3JV3 A;  4BI8 B;  1S72 1;  2AK5 A;  4LN2 A;  1VQP A;  3VS5 A;  4NBC A;  3M57 A;  3EGD B;  3CD6 Q;  2P0K A;  2RPN A;  3JB9 H;  1JJ2 S;  4J9E A;  5LJ3 g;  1N8R 1;  2GFU A;  3CC7 T;  2ZPH B;  4M7D G;  3M59 A;  1K1Z A;  3EHQ A;  3MET A;  3CPW S;  3OY9 A;  4L59 A;  3BDL A;  4RTW A;  2DD4 A;  2JUB A;  3M0S A;  2HBP A;  4AG1 C;  2BE7 D;  3D7S B;  3OBY A;  3EG9 B;  4MMK A;  3QUI A;  1H64 1;  3SB2 A;  1VQ6 Q;  3GPL A;  2DK3 A;  2AKK A;  2P4R A;  4XK8 E;  2OZK A;  3MEV A;  3CCJ A;  3CCL Q;  5GAO l;  5IHN A;  1YJ9 Z;  2VPX A;  4OB2 B;  3Q1J A;  2ZPF B;  3A8L B;  5CO7 A;  1PFT A;  4M7D C;  2I0N A;  2HCK A;  1VQ5 Z;  4XQ3 A;  1B3Q A;  1NP6 A;  2YLB A;  3FEO A;  3VKI A;  1KHC A;  4HCZ A;  1ZSZ C;  2QA4 Q;  1OYX A;  3M0T A;  4OP0 A;  1SIW A;  2E3H A;  2EGA A;  4AFZ C;  5C3E I;  4KT0 E;  3EGU A;  3VU3 C;  1RUW A;  1K8A 1;  1NJI C;  2DX1 A;  1XJW B;  1VQ4 Z;  3CXC Z;  4O6J A;  2KI7 B;  2NVQ I;  1K9M 1;  2LQN A;  2DFU A;  2VV5 A;  1T3S A;  1X6B A;  2KDS A;  3U50 C;  3CCS Z;  3A8M B;  2ATC B;  4QQ6 A;  4RCB A;  5FWB A;  5GAN h;  3PMI A;  3CC4 Z;  2A0F B;  5IN1 A;  5CK9 A;  2BE9 B;  2R57 A;  3OMG A;  4M75 F;  1KC8 2;  2RO0 A;  1VQ8 Q;  1U1S A;  3V7C A;  1VQM 1;  2YLC A;  1VQP Z;  1O75 A;  2JTF A;  4GBQ A;  3NDI A;  1TH7 A;  5KYX A;  1LJO A;  2DVJ A;  1QQJ A;  3LLR A;  4NBG A;  2DO3 A;  2O9S A;  1SFO I;  1VQN 1;  1Y1V I;  2EKO A;  3JB9 D;  2EFI A;  2KYB A;  2CSI A;  1E6G A;  5T67 A;  1Y1W I;  1CSK A;  1DJ7 B;  2COW A;  3T9N A;  3GTP I;  3ZBD A;  3OYB A;  4XX2 A;  3CC2 1;  1RAI B;  4M78 D;  3GTL I;  1JWH C;  3LUS A;  2KGT A;  3VS3 A;  2HKQ B;  4GLM A;  3DLM A;  3G7Z A;  3CCJ Z;  3EFR A;  1PC0 A;  3NH5 A;  4NB8 A;  1VQ9 A;  3Q87 A;  3VS0 A;  1D0Z A;  2W04 A;  2BTT A;  2DBK A;  1I1J A;  5GAO r;  5IT9 b;  4HCK A;  3OW2 A;  4OMO A;  2KY9 A;  4LUD A;  3JCM J;  4HT8 A;  1D1C A;  2C0T A;  3UA6 A;  4HXJ A;  3OYJ A;  1TU0 B;  1MND A;  3G4S Q;  1VQ4 Q;  3D6W A;  2ZPG B;  1RAA B;  4JRI A;  4E31 A;  4C8Q G;  2RT9 A;  2XI9 A;  2DPP B;  2YAD A;  1X0T A;  4DQ2 A;  3CCS Q;  1XOV A;  2A08 A;  1ML8 A;  1YIJ A;  5KYX B;  3J80 b;  3NH8 A;  1OPK A;  4CRI A;  4Y92 A;  3M4Y A;  2KE9 A;  3A8H B;  2MI6 A;  1VQP Q;  1X3W A;  3R6O A;  3NPF A;  2K3B A; 
#chains in the Genus database with same CATH homology
 2EGT A;  1X2K A;  3M0Q A;  2KR3 A;  3GTQ I;  2LCS A;  1K8A 2;  2Y0S A;  2D1X A;  2KNB B;  3HOZ I;  2GTH A;  4RVH A;  3CCS 1;  4A3F I;  3MZK B;  1K9M 2;  2PNI A;  2KPI A;  2FRY A;  3QWX X;  3RBB B;  3CC4 1;  1H3H A;  1QKX A;  2PM9 A;  1Q7Y 2;  1HSQ A;  2OOY B;  2P28 A;  2PZ1 A;  4J9B A;  1ARK A;  1UJY A;  1X27 A;  2F2X A;  4NBB A;  4E33 A;  1VQP 1;  1YP5 A;  2H85 A;  2L2P A;  1W2B Z;  4OMQ A;  1VQ6 1;  3G4S Z;  1OEB A;  4CC4 B;  2LNH B;  2E2I I;  5T64 A;  2JXB A;  3S15 I;  3S2D I;  3CCL 1;  4A3J I;  1VQ9 Z;  2BJO A;  4HVW A;  2O4H A;  1UHF A;  1SHF A;  2C0I A;  3EG2 A;  2V8K A;  5GJV B;  1K0X A;  1Y1V S;  2VUM I;  2GBQ A;  3HKZ A;  2K79 A;  4AFS C;  1Q81 1;  3IQL A;  1PNJ A;  3OW2 Z;  1M3B A;  4A3C I;  1SHG A;  1X2Q A;  4E2Y A;  1X6G A;  1NLO C;  2J6O A;  2JS2 A;  2VF1 A;  3J81 b;  3VS1 A;  4AFQ C;  4DEX A;  4CC3 A;  5IHK A;  1S7M A;  2M0Y A;  1JU5 C;  1RLY A;  1Z02 A;  3REA B;  1Z01 A;  1UE9 A;  3GTM I;  1U3O A;  3NDJ A;  2J6F A;  1K9A A;  3CC7 1;  3H0H A;  1TWH I;  1ZB9 A;  2IZ4 A;  4Y52 I;  4M4Z A;  2Q51 A;  2QEX 1;  3CCJ 1;  2JR6 A;  2RN8 A;  2JA5 I;  1ZBJ A;  2QRD B;  1KQS Z;  1GCP A;  1NEB A;  1Z9Z A;  2RQV A;  1H8K A;  1Y57 A;  5GJW B;  2E5K A;  3VMI A;  2V8J A;  2Q4Z A;  2JT4 A;  1YIJ Z;  2KEA A;  3MZL B;  1BU1 A;  1MV3 A;  1NM7 A;  3QWY A;  3S14 I;  2NWM A;  1VLA A;  1VQ8 1;  2E2H I;  2KRO A;  1U06 A;  1T0H A;  3VRY A;  2SEM A;  4OMP A;  1SPK A;  1GCQ A;  1VYT A;  3GKQ A;  4E32 A;  3GTO I;  1X43 A;  2EYZ A;  2CT4 A;  1M90 2;  5HCK A;  4IIM A;  2DLP A;  1TUD A;  1UEC A;  1USP B;  1M3C A;  4MH4 A;  1AWX A;  4QTU A;  4NH1 C;  2KT8 A;  1W2B Y;  1QWE A;  2LQW A;  2CH4 W;  3IX0 A;  1ZUK A;  4NOZ A;  1M3A A;  1TG0 A;  2GGR A;  1N2F A;  2HEQ A;  2L0A A;  2ED1 A;  4IIO A;  4BBR I;  3F3F C;  2R6M A;  4HGZ A;  1UTI A;  3MON A;  4JJB A;  3TSW A;  4DQY B;  3GBQ A;  2ROT A;  2DA9 A;  4J9F A;  1YI2 Z;  3QWU A;  4MD8 A;  2L3S A;  1UG1 A;  2R7Z I;  3RNJ A;  2JA7 I;  3OW2 Y;  3O5Z A;  1NJI 1;  2DE0 X;  1K76 A;  2RIQ A;  2X3W D;  2W03 A;  3GCF A;  1X69 A;  2P3Y A;  2RMO A;  3SEM A;  3PO3 I;  1QVF Z;  1N5Z A;  2GQI A;  1YUK A;  2MCN A;  3I5S A;  3VS2 A;  2OTL Z;  2JA8 I;  1Q82 1;  1RLQ C;  3GTG I;  1AWJ A;  1VYU A;  4RTU A;  1BBZ A;  1KFZ A;  2DIL A;  1OV3 A;  2FO0 A;  5D1P A;  1TFI A;  3H3V J;  3U23 A;  4A63 B;  1H92 A;  2LFU A;  4RV9 A;  1NYF A;  3PE0 A;  2KXC A;  2B86 A;  4EWC A;  1KD1 1;  4MON A;  1YNZ A;  3EG1 A;  2O88 A;  4Y7N I;  1R9T I;  4Z8A A;  1BB9 A;  3S1Q I;  1YHQ Z;  4EIK A;  3NMZ C;  1KQS Y;  1PRL C;  2JA6 I;  2FPD A;  3VRZ A;  1QVG Y;  5FW9 A;  4F14 A;  3IF8 A;  3S16 I;  4E2X A;  2I3C A;  2D8H A;  5D1O A;  3P5J B;  4A3K I;  1VQO Z;  2OI3 A;  1SEM A;  3TE5 B;  3JAM b;  2PTK A;  2DYB A;  4A3M I;  1NLP C;  1J3T A;  2K2M A;  4E2Z A;  2OOX B;  2EVR A;  1AVZ C;  1NG2 A;  2K3R A;  1WDX A;  4A3L I;  4NFR A;  2LZ6 B;  3HOX I;  3CME Z;  2NVX I;  1PHT A;  2YUN A;  2DRK A;  3G4S 1;  1EFN A;  1I50 I;  1VQK Z;  1TUC A;  1VQ4 1;  2KRS A;  1YJN Z;  1CKA A;  1M30 A;  2FPF A;  1RO2 A;  1VQ9 1;  3M0R A;  2LMJ A;  3H41 A;  2W10 A;  2QRC B;  2RPR A;  1HD3 A;  1I3Q I;  3BG1 B;  1JJ2 Z;  4TNU A;  3VS7 A;  2OTJ Z;  2CUB A;  3J7A 4;  1VYV A;  4KRT A;  2QR1 B;  4JJD A;  2K5R A;  3ESW A;  2X3X D;  3CCE Z;  5FLX f;  1S72 Z;  2BZX A;  4X1V A;  1RLP C;  3CMA Z;  4BXX I;  3CPW Z;  1QVF Y;  1MV0 B;  2C0O A;  2EPD A;  3GTM S;  4A3I I;  2CT3 A;  2RQT A;  1SRL A;  3VMG A;  1AWO A;  3I4M I;  3REB B;  4HH4 A;  1YIT Z;  2CDT A;  4J9G A;  2J06 A;  2KBT A;  2HSP A;  1Q86 1;  4RTX A;  3I07 A;  5T6B A;  4NBA A;  3VTN A;  2L3Q A;  1JXM A;  1YWO A;  1YIJ 1;  3ULR B;  2F2W A;  4OML A;  3HOV I;  2JTE A;  2FPE A;  2HBW A;  1VA7 A;  4BY1 I;  4ESR A;  2F4O A;  2BZ8 A;  2JS4 A;  3H0F A;  1GRI A;  1KJW A;  3H0I A;  2VUG A;  2YUP A;  3CD6 Z;  3S1R I;  3RZO I;  3CCV Z;  2EW3 A;  1FYN A;  1ZX6 A;  5I11 A;  1VQL Z;  5IH2 A;  2RF0 A;  4Z88 A;  2EYX A;  4FSS A;  1JO8 A;  2CUD A;  3EG3 A;  3PVL A;  4WCI A;  4LNP A;  1Q7Y 1;  2J7I A;  2JNY A;  2DL5 A;  4RUG A;  2DM1 A;  3I4N I;  3I9Q A;  5D1O B;  3TSZ A;  4CC2 A;  5FLX b;  3CCU Z;  4A3D I;  1YI2 1;  1LQL A;  1JJ2 Y;  1HJD A;  2LX7 A;  5ECA A;  1GBR A;  4RTV A;  4S1T A;  3GTJ I;  1NUI A;  3M4O I;  2J6A A;  1VQ6 Z;  1ZB8 A;  3H0G I;  3G6E Z;  1JQQ A;  2EGC A;  2OTL 1;  2R92 I;  4R0K A;  1RI9 A;  3PO3 S;  2KXD A;  3JAM f;  3CCL Z;  1TWF I;  1WXT A;  1WW9 A;  4MXU A;  3G71 Z;  4JPB W;  3S1N I;  3FQM A;  1QKW A;  1Y0M A;  1Q82 2;  2DRM A;  2F2V A;  1KC8 1;  1K73 1;  2FEI A;  2LP5 A;  2M51 A;  4J9H A;  4ORZ A;  4LUE A;  1UFF A;  4CC7 A;  5IXF A;  2KT1 A;  1FMK A;  1G83 A;  2EYY A;  2DBM A;  1YHQ 1;  1AZG B;  4F16 A;  2RBL A;  1AWW A;  1AEY A;  1RO4 A;  2HU9 A;  3CCQ Z;  2O2O A;  2QA4 Z;  1DL6 A;  1SSH A;  3PVQ A;  3HOU I;  3NFZ A;  3GTK I;  2IZ3 A;  3BG0 B;  1K0S A;  3CQT A;  4HGY A;  1VQM Z;  2LJ0 A;  1VQO 1;  1WIE A;  1YCS B;  2YUO A;  2WB1 A;  1VQ7 Z;  3EHR A;  2PMZ A;  2G2K A;  4A93 I;  1MUZ A;  1S1N A;  1KIK A;  2EBP A;  4Z89 A;  2O53 A;  2AZV A;  1ABO A;  3TDH B;  1VQN Z;  3CME 1;  3HOY I;  1W70 A;  2DL8 A;  2QLV B;  1B07 A;  1VQK 1;  4E6R A;  4J9D A;  1WCM I;  1YJN 1;  1WYX A;  2ENM A;  2O9V A;  2SRC A;  4JZ4 A;  1IO6 A;  2AKL A;  2YU9 I;  1UDL A;  4RTY A;  2KRM A;  2VVK A;  1M27 C;  2IIM A;  1OOT A;  1W6X A;  1VQ8 Z;  1M90 1;  2AZS A;  2CRE A;  2FRW A;  3K7A I;  3CCR Z;  3CC2 Z;  2B63 I;  2DE6 A;  2YT6 A;  4QT7 A;  1WA7 A;  3KFV A;  2V8I A;  2J6K A;  2W0Z A;  4OMN A;  3SHW A;  1M1K 1;  3VS4 A;  1TWC I;  3KIH A;  2GNC A;  2OTJ 1;  3S2H I;  4A3G I;  4DGL A;  2VKN A;  3JV3 A;  2ESW A;  1WXU A;  3I35 A;  1WII A;  3UA7 A;  3CCE 1;  1S72 1;  2AK5 A;  2JMO A;  4LN2 A;  3CMA 1;  3VS5 A;  4NBC A;  2RPN A;  5L23 A;  4ZNX A;  3I56 Z;  1T3L A;  3R6N A;  1K4U S;  1GFC A;  4MD7 A;  2DMO A;  5A2Q b;  1YIT 1;  3TVT A;  4J9E A;  1ZUU A;  1N8R 1;  1LCK A;  2LJ3 A;  3NHN A;  2JMA A;  1Z9Q A;  1CKB A;  3I55 Z;  1UUE A;  1K1Z A;  2JM8 A;  2JS0 A;  3EHQ A;  1YJW Z;  2LJ1 A;  3FKI I;  2O31 A;  4NBE A;  2L3P A;  2LIY A;  1Q86 2;  4RTW A;  2JUB A;  1KSW A;  3M0S A;  1A0N B;  4DK1 A;  3LH5 A;  4AG1 C;  1Q81 2;  2WAQ A;  2DE5 A;  2JM9 A;  1E6H A;  1RQF A;  2RQW A;  1USP A;  3CCV 1;  4RTZ A;  2JW4 A;  4JJC A;  2AKK A;  1VQL 1;  1ZUY A;  2P4R A;  2OZK A;  5EC7 A;  2GTO A;  2GTJ A;  3VB9 A;  4BY7 I;  4RVF A;  5FLM I;  1YJ9 Z;  5IHN A;  2EQI A;  1RNI A;  5C4X I;  2D0N A;  2ABL A;  1AD5 A;  2QKD A;  1PFT A;  1P9N A;  1TWA I;  2I0N A;  1WLP B;  2HCK A;  2RHB A;  1VQ5 Z;  3NGP A;  4RVG A;  1UJ0 A;  1B3Q A;  1NP6 A;  2ZAE B;  1QCF A;  1I07 A;  4E2W A;  3CCU 1;  4AG2 C;  3M0T A;  2K6D A;  2A37 A;  1PKT A;  3CCM Z;  4AYB A;  3CQZ I;  1ZLM A;  2H8H A;  2E2J I;  3NH4 A;  2DNU A;  4NB9 A;  2EGA A;  4AFZ C;  5LL6 f;  5C3E I;  1Z03 A;  5I22 A;  3EGU A;  2QRE B;  1RUW A;  3G6E 1;  1K8A 1;  4AFU C;  1K83 I;  2DX1 A;  1VQ4 Z;  2D8J A;  3CXC Z;  1BK2 A;  2OAW A;  5IHI A;  2ED0 A;  2KI7 B;  2NVQ I;  1E7O A;  3C0C A;  1K9M 1;  2LQN A;  3RZD I;  1T3S A;  1X6B A;  4D8K A;  3G71 1;  2G6F X;  4MD9 A;  3U50 C;  3CCS Z;  1WI7 A;  1YWP A;  3VS6 A;  5FWB A;  2HF1 A;  2J05 A;  4E30 A;  3CC4 Z;  3S1M I;  2K7A A;  1U5S A;  4QTT A;  1QYP A;  1I6H I;  2QDL A;  2DL3 A;  2ECZ A;  3CCQ 1;  1KC8 2;  1K73 2;  2QA4 1;  3F3P C;  1V1C A;  5C4J I;  3KIF A;  2VWF A;  2CH4 A;  1UGV A;  1VQM 1;  2EYW A;  2GTI A;  1VQP Z;  4RTT A;  1W1F A;  4GBQ A;  3NDI A;  5AN9 F;  1VQ7 1;  4JZ3 A;  1TWG I;  2DVJ A;  3FQQ A;  1GCQ C;  5IT9 f;  1QWF A;  3FJ5 A;  1NJI 2;  2DF6 A;  4RS4 A;  4NBG A;  3CPW Y;  2O9S A;  1SFO I;  1VQN 1;  4X6A I;  3THK A;  5FWC A;  1Y1V I;  2KYB A;  2CSI A;  1WXB A;  1E6G A;  5T67 A;  1QVG Z;  4D8D A;  1Y1W I;  2R93 I;  2RNA A;  2DE7 A;  2A36 A;  3EED A;  1CSK A;  5IXB A;  2FG0 A;  3GTP I;  2MOX A;  1YN8 A;  5IP9 I;  3I5R A;  2NUZ A;  2RQU A;  2E9H A;  4LE9 A;  4XX2 A;  3CCR 1;  5A2Q f;  3CC2 1;  1KD1 2;  2EKH A;  1WFW A;  2V1R A;  1UHC A;  3GTL I;  2CSQ A;  1JWH C;  3CC7 Z;  2GU2 A;  1T0J A;  1WX6 A;  2MIO A;  3IFU A;  2KRN A;  3NPF A;  1X3Z A;  3LUS A;  2KGT A;  1M1K 2;  4DEY A;  3VS3 A;  2JMC A;  3S17 I;  3J80 f;  1JEG A;  2V1Q A;  1GFD A;  4GLM A;  2QEX Z;  3VMH A;  3CCJ Z;  1RO0 A;  3M0U A;  3CXC Y;  3UAT A;  1QF8 A;  3I56 1;  3A98 A;  2K9G A;  4HVV A;  1L1O C;  3NH5 A;  4NB8 A;  2ROL A;  3Q87 A;  1NYG A;  2NVT I;  4HVU A;  1PRM C;  2DL4 A;  4J9I A;  2F4M A;  1M8M A;  2OJ2 A;  3VS0 A;  1ZH1 A;  4K11 A;  3I55 1;  2W04 A;  2BTT A;  2YSQ A;  2KYM A;  3M0P A;  2DBK A;  3EER A;  1I1J A;  1YUA A;  1N8R 2;  4MRI A;  1YJW 1;  5IT9 b;  4HCK A;  2BZY A;  2RQR A;  3T4N B;  3PO2 I;  1I0C A;  1G2B A;  4OMO A;  4A3E I;  3HOW I;  4LUD A;  1OPL A;  2C0T A;  3UA6 A;  4HXJ A;  3D9X A;  1ZSG A;  4OMM A;  3UF4 A;  2HDA A;  4NBF A;  3M3Y I;  2PK7 A;  1PKS A;  5CM2 M;  3D6W A;  2XMF A;  1GL5 A;  4BBS I;  1NEG A;  5IP7 I;  4J9C A;  4E31 A;  2DJQ A;  2YDL A;  2RT9 A;  1YJ9 1;  3EG0 A;  2YAD A;  1X0T A;  1SRM A;  2NVY I;  2M6N A;  1XOV A;  2A28 A;  2DL7 A;  4RVD A;  1VQ5 1;  2A08 A;  1ML8 A;  1GBQ A;  1KRL A;  4F17 A;  3J80 b;  3NH8 A;  1OPK A;  3ZL7 C;  1AZE A;  2YUQ A;  1PWT A;  3CCM 1;  1JXO A;  4Y92 A;  5C44 I;  4CL1 A;  4NBH A;  2EGE A;  2KE9 A;  3J81 f;  1ABQ A;  1X3W A;  4A3B I;  4NBD A;  1QLY A;  1AOJ A;  3CD6 1;  2M48 A;  2K3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...