2AKLA

Solution structure for phn-a like protein pa0128 from pseudomonas aeruginosa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
116
structure length
116
Chain Sequence
MVSTLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATASDDGKVIKDSVGNVLQDGDTITVIKDLKVKGSSLVVKVGTKVKNIRLVDGDHDIDCKIDGIGAMKLKSEFVRKVGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequence Specific Resonance Assignment of a Hypothetical Protein PA0128 from Pseudomonas Aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Structural genomics, unknown function
molecule keywords phnA-like protein pa0128
total genus 15
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03831 PhnA PhnA domain
A PF08274 PhnA_Zn_Ribbon PhnA Zinc-Ribbon
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2aklA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2aklA02
1Y0MA 4D8DA 1H92A 4RUGA 3R6NA 2DBMA 2I0NA 3EHRA 4LUDA 2F2WA 2KR3A 4Z8AA 1ZUYA 3NMZC 2YT6A 3UATA 2L3SA 1T0JA 3H0HA 2CSIA 2O9SA 1UHFA 1HJDA 1RI9A 2LQNA 4BBRI 4K11A 2HBWA 2K2MA 3PE0A 2H8HA 2W0ZA 2VVKA 4QT7A 2OAWA 4NB9A 2EVRA 2L0AA 4BY7I 2LZ6B 2F2VA 4A3II 2R93I 1K1ZA 5IXBA 3VRZA 1I07A 2NUZA 2GTJA 2VWFA 3REAB 4AFSC 4AG1C 3GKQA 5IHKA 2JS4A 4J9IA 1K4US 2JS0A 2GTOA 1OPKA 1R9TI 2CDTA 4RTVA 2DBKA 4BY1I 3VS1A 4A93I 1ML8A 1PFTA 4NOZA 1WI7A 1UTIA 4F14A 1N2FA 1Y1VS 2DYBA 3EG1A 3M0PA 1SHGA 2HF1A 1H3HA 1N5ZA 2D8JA 3JV3A 2HEQA 2ECZA 2KBTA 1AZEA 1PRMC 3S2DI 4X6AI 2FO0A 3M0SA 4RTWA 1NG2A 1G2BA 1ZB9A 2YUQA 4GLMA 1VYTA 2KROA 2A37A 3REBB 2RBLA 5GJVB 3VS7A 4R0KA 2NVQI 3S14I 1YCSB 2KXCA 2BZ8A 2LP5A 4OMPA 3HOWI 1UGVA 1IO6A 1WX6A 3PVLA 1VYVA 1X3WA 1UFFA 2KYBA 1U06A 1NM7A 2DM1A 1J3TA 2K3BA 1NLPC 2JA7I 5CM2M 2F2XA 1WXBA 5HCKA 3VMIA 2DRKA 2J06A 2JTEA 1M8MA 1ZUKA 5C4JI 2EGAA 3K7AI 1SRLA 1GCPA 4A3DI 3M4OI 2CSQA 4CC2A 2K9GA 3H0GI 2O31A 1I3QI 3VB9A 3GTPI 4HCKA 1JQQA 1Y1WI 4HVWA 1S1NA 1I50I 1M3AA 1GFCA 1Y57A 4M4ZA 1MV3A 4OMQA 3KFVA 1WFWA 1E6GA 1NYGA 3VS2A 1GBRA 1OEBA 1E7OA 1PKSA 1JXMA 2HSPA 4J9CA 2J6OA 1JU5C 4A3LI 1ABQA 1M30A 1UG1A 3EHQA 1K9AA 1TWFI 2DLPA 4QTTA 2GGRA 4OMLA 2ROLA 1W6XA 2CT4A 2AKKA 1KFZA 1QKWA 1B07A 3LUSA 2E2HI 2X3WD 3GCFA 3VS6A 1EFNA 2RN8A 1CKBA 5IP9I 2RQRA 2AKLA 2EBPA 2EKHA 5C4XI 1ZLMA 1UDLA 5FWBA 1TFIA 2DMOA 2EQIA 2KXDA 3U23A 1GRIA 3S1RI 3VS5A 2BZXA 3GTLI 2K79A 2HCKA 5IHIA 1BBZA 4JZ4A 1ABOA 1YP5A 2VKNA 2C0TA 2KT8A 2IIMA 4A3FI 2ED0A 1RO4A 3A98A 4IIMA 2LCSA 3GBQA 4AFUC 4QTUA 2X3XD 1PWTA 2SEMA 1RLPC 2BZYA 1WW9A 5C44I 2DX1A 3VS3A 3S17I 3M3YI 1RLQC 2JNYA 1VA7A 1NEGA 2KYMA 2YU9I 4NBCA 3I4NI 2DE0X 2RQWA 4OMOA 3TSZA 3FKII 4A3BI 2EYXA 3SEMA 3VMHA 1ZUUA 4KRTA 1UE9A 1QKXA 2DL8A 3D6WA 3S15I 1I1JA 4AG2C 4WCIA 5IHNA 1UJ0A 3GTMS 1E6HA 4NBBA 2KPIA 1GFDA 3EG0A 3ZL7C 2GQIA 3I9QA 4Z88A 2P3YA 2MCNA 4DEXA 4Y52I 4A3EI 1USPA 2J6FA 3M0RA 2A36A 2ED1A 4GBQA 3VMGA 2YUNA 2B86A 4BBSI 4Y92A 2DILA 1A0NB 2B63I 1TG0A 1ZB8A 2FPEA 1TUDA 1K76A 2A28A 3H0IA 5ECAA 2EYYA 3M0QA 4NBDA 3H3VJ 3VS0A 3GTMI 1Z9QA 2FEIA 5FLMI 3UA7A 1JEGA 3PO3I 2JS2A 1AOJA 2KRNA 2PTKA 2JMCA 1HD3A 2JXBA 2K6DA 2JA6I 1W70A 1K0XA 4RTUA 3S16I 2GBQA 1GL5A 1T3SA 1BB9A 4JJDA 4NB8A 2V1RA 2RNAA 1Z9ZA 2KE9A 4A3CI 1H8KA 4CC4B 2G6FX 5I11A 1AWOA 1L1OC 4D8KA 3HOZI 1X2QA 4OMNA 1SPKA 2EYWA 2KT1A 2E5KA 4NBAA 2DF6A 2M51A 3U50C 4NBFA 3GTGI 2NVYI 1AD5A 1UJYA 4RTZA 4Y7NI 2DL3A 2MIOA 2YDLA 5IH2A 2JMAA 2P4RA 2RPNA 1X69A 2ESWA 4J9GA 1PKTA 2OI3A 2YUPA 1OPLA 1YN8A 1M3CA 1GCQA 1CSKA 1X43A 2PZ1A 1SRMA 2YSQA 2DJQA 2AZSA 1SFOI 1T3LA 1KSWA 1PHTA 1QWEA 2O2OA 4HVUA 1NUIA 4NBEA 2KRSA 4BXXI 1ZX6A 2LMJA 1BU1A 3EG2A 3I5RA 2O88A 2K7AA 1MV0B 2A08A 2GNCA 3CQTA 3VRYA 4F16A 2JA5I 2CUBA 3EG3A 2ROTA 3PVQA 2DL7A 4OMMA 2L3PA 1I0CA 1JO8A 2C0IA 2RF0A 3NPFA 3EERA 2O9VA 1AEYA 2KNBB 1QYPA 4RTTA 4DEYA 5EC7A 1QLYA 1UHCA 1NYFA 1HSQA 1WLPB 2OJ2A 2SRCA 4ORZA 1LCKA 1BK2A 2XMFA 1X2KA 1AZGB 2DL5A 1Y1VI 3HOXI 1AVZC 4E6RA 5GJWB 3SHWA 1TWGI 3C0CA 2DE7A 3H41A 1KIKA 4CC3A 3I4MI 3NGPA 1M27C 1B3QA 2LNHB 3RZDI 2MOXA 3ESWA 2DVJA 4J9DA 4CC7A 1K83I 3S1NI 1WXUA 1U3OA 4NBHA 5I22A 3UA6A 1ZSGA 2BTTA 2DA9A 1W1FA 2EGEA 4ESRA 2F4MA 2RMOA 4JPBW 4ZNXA 2K5RA 4LUEA 1VLAA 1QWFA 2FPFA 3NHNA 3TVTA 4RTYA 3CQZI 4HXJA 4A3JI 3RNJA 2YUOA 3RZOI 3ULRB 2F4OA 1TWAI 5IP7I 3GTOI 1RLYA 1V1CA 2DL4A 1NLOC 3M0TA 2D1XA 3I07A 1RUWA 1AWJA 1G83A 2JW4A 3QWYA 5FWCA 1YWOA 2FG0A 3UF4A 2DE5A 2D8HA 3S1MI 2RQUA 3LH5A 1GBQA 3PO3S 1SSHA 1M3BA 3I35A 4J9BA 1OOTA 5L23A 1MUZA 1DL6A 2E2II 2NVXI 3PO2I 2J6KA 2L2PA 4J9HA 2RQTA 3HOYI 2CREA 4A3KI 2KRMA 3S2HI 5FW9A 5C3EI 3M0UA 1AWWA 2JA8I 2RQVA 4AFQC 4JZ3A 3THKA 3I5SA 3S1QI 2ENMA 1X6GA 3H0FA 1JXOA 3FJ5A 1X6BA 3HOUI 4A63B 1ARKA 1VYUA 1SHFA 1YNZA 2R92I 2JR6A 1I6HI 3IQLA 2EGCA 1WA7A 2J6AA 2VUMI 1YWPA 4J9EA 2C0OA 2W10A 2KGTA 2JM9A 1TWCI 2EW3A 4J9FA 2KEAA 3GTJI 2M0YA 1X3ZA 1AWXA 2JT4A 1X27A 2FRYA 1CKAA 2DNUA 2EYZA 1LQLA 2L3QA 1WDXA 3EGUA 3QWXX 1KJWA 3HOVI 4X1VA 2V1QA 2J7IA 1FYNA 4HVVA 4NBGA 1GCQC 1U5SA 1ZBJA 3O5ZA 2LJ1A 2ABLA 2E2JI 1TWHI 2CH4A 1WXTA 4LN2A 4Z89A 1WCMI 2AZVA 2NVTI 1PRLC 2J05A 2LJ0A 4LNPA 2FPDA 1XOVA 1USPB 4RTXA 1YUAA 1T0HA 4IIOA 4AFZC 4MH4A 4FSSA 4JJCA 2LQWA 2EPDA 2CUDA 2QDLA 3RBBB 1PNJA 5IXFA 1K0SA 1NEBA 2D0NA 2PNIA 2DRMA 1SEMA 2NWMA 2JM8A 3VS4A 2AK5A 2R7ZI 2HDAA 2CH4W 1WYXA 2FRWA 2LJ3A 1OV3A 4JJBA 2LX7A 3TSWA 1UUEA 2CT3A 4A3GI 3GTKI 2DE6A 1TUCA 1FMKA 3Q87A 1UECA 2PK7A 3GTQI 2BJOA 1WIEA 4F17A 4XX2A 4LE9A 1QCFA 4A3MI 4EIKA
chains in the Genus database with same CATH superfamily
4D8DA 2NYSA 4NOYA 2OTJZ 2HSEB 1S721 4E7SA 1JJ2A 4FW1A 1YITQ 2FZKB 2KI7A 3VYHB 4O6JA 4M7DE 4DBHA 4BBRI 1PM3A 3QZ5B 2K2MA 3CCMA 3PE0A 2OAWA 1WHGA 4DQYB 2YRDA 5A2Qb 1ZH1A 2EVRA 2HNIA 2R5AA 4BY7I 3M58A 1M90U 3J80b 2LZ6B 2QEXA 3CC71 2JIPA 1I07A 2BE9B 2FL7A 3CBOA 3M5AA 3UT1A 1M90R 3OYGA 2QXFA 2CDTA 2M48A 2DXBA 1KD1R 1S72Q 3VS1A 3JCMJ 1N6AA 1PFTA 1WI7A 4E7LA 1UTIA 2QQBA 2KAFA 1SHGA 2HF1A 1KC8U 3CCJT 4BI3A 1Q16A 1YJ9T 2F69A 1Y8CA 2QAZA 4BDZA 5FLXf 1VQ9Z 5CCAA 4PL6A 2FO0A 5DLOA 1D09B 1NG2A 2QEX1 3CCE1 1Q7Y1 5GAMh 1N9RA 3LWHA 2RK2A 1C0MA 5KYWB 1YIJ1 1BIBA 3VS7A 5CKEA 1YCSB 2KXCA 2BZ8A 4ZN3A 1VQ8T 2RI2A 4BD3A 3PVLA 2ZAEB 1VYVA 1U06A 3TEEA 2YLBA 1NLPC 3ER0A 1K731 2DO3A 1VQ91 4MD8A 1SIWA 2DRKA 3CCRT 2J06A 3MO8A 4MDXA 2EGAA 2F1LA 5GAOr 2RI3A 4XU0A 3CCUA 1YUKA 2L3RA 2QEXQ 4A3DI 2PVOB 5J39A 3S3OA 2EQKA 3ME9A 4CC2A 2K9GA 2XICA 1UGSB 4L6V5 1VQ7T 2HBPA 2QTXA 4XTUA 3RR6A 2QRCB 1QCOA 5GAMe 2OTLQ 2RB6A 3CMEQ 2E10A 1YJ9Z 3PMIA 1M3AA 1C6VX 2O4HA 1Y57A 2Y4XA 3X24B 1KQSP 1E6GA 4ZTJA 1RQFA 1PKSA 1JBMA 2E70A 3G71A 4C5IA 5KH6A 4A3LI 1Q7YU 1UG1A 4JRKA 2DD4A 2DLPA 2O01E 3INZA 2ROLA 4F7UA 1W6XA 3CC4Z 4FYXB 1QKWA 1B07A 3LUSA 2X3WD 4E7KA 2AKLA 2EBPA 5C4XI 2JIRA 5FWBA 2COYA 2EQIA 2NUPA 3LWIA 2BZXA 2QQSA 3EG9B 3JCMe 2RHBA 1YJWZ 1PD0A 2HCKA 2QG9B 4HT9A 1W2BZ 2CKKA 2KT8A 2ED0A 4C92C 2E5QA 1WHLA 2X3XD 3E9FA 1PWTA 2BZYA 3KIHA 1FMVA 3VS3A 1VQN1 3S17I 4KULA 2XDPA 3VKIA 2QA4T 2EQUA 2DE0X 3I56A 3TSZA 3OW2A 2EYXA 2R58A 3OMCA 3SEMA 3VMHA 2VGNA 3CBMA 3OBWA 5LJ5f 1ZUUA 2RH2A 4BI4A 4KRTA 1QKXA 2GTHA 1G5VA 4C92B 1D3BB 3CPWA 1IRXA 2ZPEB 1E6HA 1QF8A 4X9CA 2JTFA 1P9NA 3ZL7C 4HA8A 3I9QA 2RHXA 1PG5B 5LJ5e 5IAYA 1W2BS 2P3YA 3HFNA 2VPXA 3M0RA 3CMAZ 2JOYA 3OYJA 1NBEB 3CXCZ 4E7IA 3J81E 2ED1A 4GBQA 2B86A 2DILA 5GAMj 1A0NB 1ZB8A 3CMAT 2FPEA 1KD1C 1TUDA 4C92A 2H3JA 2DETA 3H0IA 3WVEB 3I55Z 2JTMA 2RJDA 5ECAA 2DZCA 1VQKA 2EYYA 4EMHA 3NTHA 2EJFA 3CCVT 1MGQA 4OP0A 2KDSA 3UA7A 1AOJA 3QKJA 1KD12 2BE7D 2QGGA 1K0XA 2OTLT 1YJN1 3GNFB 4LD6A 1GL5A 5GMKl 3CD6A 1QVGZ 2QYZA 1X6OA 3CC7A 4KBMB 2E12A 2YXYA 1KC82 2LVMA 1AWOA 3HOZI 1X2QA 5KYXA 1SG5A 3QYGB 3JCMV 3M57A 2DF6A 1WJSA 2DEUA 4ZGEB 3TCJA 1UJYA 4Y7NI 2XKOC 3M56A 1YHQ1 2P4RA 1X69A 1PKTA 4C8QD 3J7AF 1M902 2VXEA 1M3CA 2JVVA 2PZ1A 2M1HA 2NLUA 3ASKA 3SDZA 4DBQA 2AZSA 1VQNZ 1HXDA 4FCYA 4HVUA 1RAGB 4RVFA 4RCBA 2LMJA 3QWUA 1RABB 3EG2A 2P4TA 1YIJA 1MV0B 3V8JA 4II1A 5CR2A 2E41A 3CQTA 2JA5I 3EG3A 2ROTA 1JO8A 3NPFA 4M7DC 4RTTA 1QLYA 2PUKB 1NYFA 1VQKQ 2OJ2A 1Q812 1VQLA 2NUPB 4E30A 1EIFA 3X20B 4B6MA 5LJ5d 2VPZA 2DIGA 5GJWB 2DXUA 4QQ6A 3SHWA 3L2ZA 3JAMf 4C0ZA 3M4GA 5GAOl 1BYMA 2OTJT 2EYQA 4J6YA 3CCU1 4UC4A 2L8DA 3NGPA 4L5GA 2IVWA 4FYVB 5CK9A 1K8A2 2QA4A 1VQOZ 1EX4A 3SB2A 2ATCB 2HKNA 4CC7A 4FT2A 1UEBA 3CCS1 3CC7T 1VQM1 2E6ZA 3A5ZB 2F4MA 4RVHA 2CP2A 4LUEA 3MONA 1QWFA 5FU6B 4HXJA 1VQL1 3PTAA 4XQ3A 2RHYA 1JJ2P 1RL2A 1RACB 2YUOA 1VQ5Q 2F4OA 1TWAI 1OULA 3HPWA 3HRTA 3CCLQ 1YFNA 3G71Q 5KYUA 1X0TA 2DL4A 2GFUA 2QQAA 1G83A 2JW4A 4OGEA 1QCNA 4QVCA 3GF5A 3V8LA 4QVZA 2FG0A 3UF4A 1QXFA 4QQDA 3ZBDA 3CD6Z 1NE8A 1GBQA 1Q82C 3G4ST 1MUZA 4PFOA 5CQXA 3CCLT 4KT0E 4J9HA 3BDUA 4IUUA 3GPLA 3HOYI 2RPRA 3NH4A 1MNEA 2D9TA 4X34A 3M0UA 1SKUB 1FMWA 1VQ8Q 2DFUA 1EZZB 3S1QI 3JCMh 1X6GA 5J26A 2DKGA 2QK0A 5FU7C 5FLXE 1VQNA 1YNZA 3CC4Q 1I6HI 2EGCA 1Q862 2VUMI 3JB9D 2A3LA 1S72T 2KGTA 5DM7R 4NL3A 1TWCI 2DTHA 4XAXB 1VQOQ 4PJOF 4C0DC 3AHUA 3I56Q 1G3TA 5LJ3d 3P5JB 1X27A 2FRYA 4MZPA 4OF1A 1NJIC 4NH1C 5I2MA 4HVVA 4M78E 2KY9A 1U5SA 3V7CA 4AYBA 3E1SA 5IT9E 2M6NA 1VQKT 4LN2A 1M901 1VQLZ 2LJ0A 1N8R1 2YHTA 3URGA 1ZA2B 4E32A 5KYYA 1XOVA 1YITZ 5CVIA 5A2QE 1Q82R 2LQWA 1ACMB 3RBBB 2RA2A 4DBFA 2OTJQ 4ZGDB 3RMQA 4MONA 5AT1B 1YI21 1MMGA 2PVGB 4ZGJB 5L8RE 3VS4A 2AK5A 3C4SA 2HDAA 3X26B 2CH4W 1XQHA 2FRWA 2R57A 2LX7A 1X75C 1KC81 3CC21 2EQJA 3E2UA 1BI0A 1M1GA 4E2FB 1Y96A 1OI1A 2BKDN 4PJOE 2DL7A 4XX2A 2E6NA 1H92A 5D7UA 1VQ6Z 3R6NA 1WNLA 2RT9A 1G3YA 4E7JA 1V76A 5J3BA 2VUGA 4M78C 3CCRA 2L3SA 3H0HA 3HRSA 1TWBA 1G3SA 1SSFA 2HBWA 1YI2A 2ZCFB 3HHTB 3QDRB 2GQVA 4PJMA 1I4K1 2VVKA 2KQWA 2QQRA 5LJ3g 4IUQA 4DGLA 1Z03A 3OYIA 1K1ZA 3RUXA 4AG1C 4M78F 2JS0A 2GTOA 1OPKA 1R9TI 3DLLA 3LLRA 4M75D 3MHXA 1KQSY 1ZHIA 1Y1VS 5LJ3j 6AT1B 3M0PA 2CGHA 3EFRA 3BE3A 4XTXA 1N5ZA 2M16A 3JV3A 2ECZA 2HQXA 2KBTA 3S2DI 3M0SA 4J8OA 4RTWA 4M77B 5EG2A 1C1AA 1ZB9A 4MMLA 5D1PA 4XU1A 2KROA 2A37A 2V8JA 3REBB 1Q81R 4JRQA 3S14I 1N8RU 2OTL1 5CAIA 4GY5A 2LP5A 2IG0A 4OMFB 1WX6A 1UFFA 3C12A 2DM1A 1J3TA 2NUTA 3OBYA 3CCJQ 4PJOC 2FVUA 2JA7I 5FRMA 5HCKA 3G4SZ 1WHHA 3JRZA 5C4JI 4BE1A 3OYBA 3K7AI 4D6WA 1VQNT 4M7AG 3NH8A 1RNIA 3CC41 4CRIA 4JS4A 3QXEB 3H0GI 3EGXA 1YIJQ 2PM9A 3GTPI 3RDVA 1Y1WI 3L2VA 1JRIA 2F5TX 2FZCB 3GIBA 5GAN2 2KMTA 4Y28E 4M4ZA 3CCQZ 2WB1A 3CCJ1 1E7OA 1KHIA 1YJ91 2VGMA 1M8VA 3TE5B 3SWNC 4PJOD 2HZYA 5A0LA 1N9SA 1M30A 1VQPT 1OYXA 4DQ2A 3DB4A 3CBPA 2ZGWA 3CC4A 5IP9I 2CYZB 3MP1A 3RESA 2KXDA 4ZN1A 4MZMA 3U23A 3BDLA 1OX9A 1GRIA 1VQOA 2KVQG 4V2SA 2H85A 3GTLI 3O8VA 4OVAA 1VUBA 4A4KA 5IHIA 4JZ4A 2O53A 1ABOA 1YJNT 1WZNA 3A98A 3T9NA 4AFUC 2CZ6B 3SWNA 3GBQA 3QPHA 4QTUA 1YJ9A 4PLIA 3HL8A 1BI3A 3CCST 3CCLA 5C44I 2DX1A 3QDFA 1Q95G 1NEGA 3CPWS 4RMOA 3MEUA 3JCMf 2YU9I 4FT4A 1Q821 4EMKA 2E3IA 4A3BI 1ZSZB 2LCCA 3CCQA 5D6WA 3D6WA 1I1JA 1Q7YC 1Y71A 1K9MU 4C8QA 5LJ3h 2ZPHB 1PC0A 1X01A 2GQIA 4Y52I 2HKQB 3CPFA 4Q5WA 2YUNA 2E7ZA 2K5LA 3CCL1 4HH4A 1VQPQ 3JCMd 4M7DG 2A28A 4JRPA 3I561 3WXMB 3JCMc 3H3VJ 1AA6A 4XTZA 1W4SA 1WPYA 1Z9QA 2FEIA 1YHQQ 1YJNQ 2JMCA 1HD3A 4S1TA 1W70A 5GMKe 1QVGS 2P0KA 1N8R2 1T3SA 3PNWC 2V1RA 3JCMb 3SD4A 2KE9A 1MHNA 5FRNA 3QYHB 3BW1A 4JRIA 5I11A 3OYFA 3FC3A 1YITA 2LQKA 2DVEA 3EGDB 1WHJA 2CP6A 1VIEA 1KK7A 4NBAA 2MMPA 1VQK1 3F3FC 5D6XA 3U50C 1K73R 1AD5A 2DL3A 2YDLA 2MIOA 5IH2A 4IUTA 4M7DF 1QVPA 3DKMA 2ESWA 3N5BB 2YUPA 1KC8C 1YN8A 4YTLA 3GP8A 2DK3A 2ZPGB 1GCQA 1X43A 2LTOA 4WTOB 4LDUA 5GMKj 3CD61 1SFOI 1VQ4Z 2O2OA 1QWEA 2LT1A 4NBEA 1G3WA 4A53A 1QW1A 1ZX6A 1BU1A 3HKSA 3PT9A 4DOWA 3CMA1 3OS5A 2CUBA 2OTLA 3CCRZ 3UPUA 1QVGA 2RF0A 2Z0WA 3P8HA 1AEYA 2VPWA 2CZ0B 2KNBB 1KG1A 2JZ2A 4J83A 5EC7A 1UHCA 1WLPB 3G1JA 1BK2A 1Q81U 1AZGB 1Y1VI 2VF1A 1XNIA 2CZ7B 4EDUA 3OYKA 5GMKh 1Q86C 1YHQA 4BE2A 1TU0B 4E6RA 3MEWA 3OS0A 3H41A 5CKFA 3CCVA 3I4MI 3IFUA 2OAUA 1RO0A 4M7AB 3OB9A 2DVJA 4FYWB 2E64A 2LIYA 2EGTA 1WXUA 4NBHA 3UA6A 3FQMA 3EFOA 1W1FA 2X51A 4KGXB 2P0QA 2K5RA 3TVTA 2FPFA 3CQZI 2HMAA 3OYCA 1M1KC 4C8QB 3HSBA 3L2WA 3G711 3RNJA 3RZOI 5IP7I 3VU3C 4A4EA 1V1CA 1NLOC 2E65A 1AWJA 5CIUA 1VQNQ 1YWOA 2JIQA 3MEAA 1RAEB 2DE5A 1QVFA 4M77G 2GU2A 2RK1A 3FB9A 4M75B 3JB9I 2COWA 2RQUA 3FQQA 3JSCA 5GAOn 1M3BA 1U1TA 3EH1A 5GAMg 4BB7A 3PO2I 1VQMA 2QA4Z 3LX7A 4A3KI 1TH7A 3J80f 1VQ9Q 1M9SA 2CP0A 3WVDB 3H0FA 1Y7XA 1KC8R 1NPRA 3EG9A 3VUBA 2COZA 4M75A 1ARKA 2BIVA 3CCUT 3IQLA 3X25B 2C0OA 1NZ9A 5GANj 3QJ6A 2CS7A 2JM9A 2E1HA 2KEAA 1R8OB 2CP5A 3LGLA 3GTJI 2M0YA 1X3ZA 2JT4A 3JB9F 3FDRA 3NFZA 1CKAA 1NJIR 4ELZC 1D0ZA 3CCQQ 1FX7A 3CC7Z 3QWXX 4EMKC 2QLVB 5KYNA 4F7UG 1VQ7Q 2ZPIB 4MRIA 4F7UE 4XU2A 1RI0A 5A2Qf 3MCAB 2QEXZ 4LNPA 3CCVZ 1OQKA 3P8BB 5CKDA 2FPDA 1RO2A 4A4GA 3RERA 3H6ZA 1I81A 4IIOA 4FSSA 2CUDA 1PNJA 3G6ET 1K0SA 2MPXC 2PNIA 1NEBA 4LXCA 5CKBA 3FIFA 1SEMA 3CCJZ 3OS1A 3M9QA 4EPCA 5LJ5h 1IREB 4FL6A 2RJFA 4OB3B 1YJNA 3OQ5A 2CT3A 3JCMQ 3GTKI 2GFAA 2VXFA 1FMKA 1UECA 2PK7A 3EEDA 3LGFA 4F17A 2RJCA 4LE9A 4RUGA 2I0NA 4LUDA 1YIT1 2PMZA 2F2WA 4A4HA 3CXCP 1Q7Y2 3KUFA 1I5LA 4R56A 3CPWY 1T0JA 1VQ4T 1M1K1 3J81f 2CSIA 3PMTA 1UHFA 2QREB 1HJDA 2OTJ1 4MDWA 2LQNA 4BY6B 1VQLQ 4M77E 2MK5A 3VJPA 2W0ZA 1VQMZ 2EIFA 2QGFB 4QT7A 5I2SA 4ELYC 1O9SA 2L0AA 1WJRA 2F2VA 4A3II 3X28B 5IXBA 1VQMT 2MYSA 2NUZA 4AFSC 3GKQA 5IHKA 2JS4A 4J9IA 5AYFA 3CC4T 4RG2A 3L42A 4HCBA 1BCOA 2LNVA 4N4HA 4C5HA 4BI8B 2DBKA 2JUFA 1FWZA 4A93I 1ML8A 4NOZA 3S3NA 4F14A 3OYHA 3EG1A 4RVDA 3DLMA 4C92D 2DPPB 3G4SQ 2HEQA 2KK4A 3MKDA 1AZEA 1PRMC 2M9UA 3PGGA 2LEXA 4X6AI 3G4S1 4BY6C 1Q82U 3HKZA 1G2BA 1BI1A 1B34A 4GLMA 1M1KU 2RBLA 3LYIA 3CXCY 5GANh 1R0BG 4F7UB 3CME1 2CZ1B 3HOWI 2VV5A 1VQ61 2HL5C 8AT1B 3CCSA 5GAOq 2KSSA 2KYBA 1O75A 1IGUA 1KRLA 1MMDA 1NM7A 1RAAB 4X9DA 1VQ5T 4ME7A 3CC2Z 1JWHC 3HFOA 4QQGA 1B34B 2F2XA 2Y90A 5HKCA 4C0FA 3LH0A 5GANg 3S6WA 4E2XA 1M8MA 1VQ4A 1SRLA 1LNXA 4N4GA 5C0MA 1AT1B 3PFSA 2O31A 1I3QI 3BG0B 1QP3A 4HVWA 2L5QA 1MV3A 4OMQA 1WFWA 2YWWA 1GBRA 4JDSA 2JNGA 1JXMA 4PJOG 3QZ9B 2DXTA 1UB4A 2CP7A 4J9CA 1D3BA 2J6OA 4LDXA 2L89A 1ABQA 1YI2T 1QVFZ 1TWFI 4OMLA 4QTTA 3RIRA 3MP8A 1KFZA 2YRCA 2DD5A 2ZPBB 2E2HI 3VS6A 3GCFA 1EFNA 2RN8A 2RQRA 2P84A 2EKHA 5KCHA 4BE0A 2DMOA 2AYDA 3UWNA 1BCMA 3VS5A 4E7ZA 4GLKA 1VQKZ 2K3RA 1QVGP 1K9M2 2X4YA 3MJXA 3EH2A 2C0TA 2IIMA 4A3FI 4IIMA 3FRNA 1TTHB 2JMOA 4PJNA 4KUDK 5A0GA 4M75C 1VQ4Q 1RLQC 1VA7A 2P28A 1NJI2 4M78G 2KYMA 5D1OA 4JLGA 3I4NI 1Q811 4JJNK 4OMOA 4IKFA 3G71T 1D0YA 1B7TA 4CL1A 3I551 2XHCA 3M53A 3JCMW 1ZBXA 3S15I 1VIFA 3BG1B 3QBYA 5IHNA 5GAOm 2DAQA 1UJ0A 1V29B 3G71Z 4B9WA 1YI2Z 1GFDA 2DEQA 2WSEE 4Z88A 3CC2A 3OMGA 2MCNA 4DEXA 4A3EI 1USPA 4QVDA 2Q51A 4RVGA 1VQP1 1N8RC 1WJQA 1UGRB 3VMGA 3QJYA 4LDWA 2XU8A 4Y92A 1HYOA 2DYIA 2IZ4A 1TG0A 4M78D 2FYKA 1VQ7Z 3CPWP 1K76A 3IF8A 4KUIA 4C8QF 3F70A 4PKCC 4VUBA 4PJLA 1Y96B 2XK0A 2JIMA 1YJNZ 2XD0A 3CCQ1 5FLMI 1JEGA 3PO3I 2JS2A 2MAMA 8ATCB 1QVFS 2KRNA 2PTKA 1U8RA 2JXBA 2LQ8A 1WIIA 2JA6I 4FSXA 4RTUA 2NAPA 2IZ3A 1BB9A 4JJDA 1JB0E 1KHCA 4MD7A 2LRQA 1KQ1A 2QA4Q 1VQOT 1H8KA 1M1FA 1M2OA 1VQPA 1LPLA 3R6OA 4CC4B 3JAME 4F7UF 2LX9A 3OA6A 3CCRQ 1OZ2A 5GAN7 1SPKA 4M75F 1Q81C 2X35A 2KT1A 2E5KA 1YI2Q 2A7YA 2K3YA 1VQ6Q 3G6EZ 2M51A 4NBFA 2NVYI 4RTZA 3E9GA 1K8AC 2C06A 3M55A 1OU8A 1QQJA 1VQ5A 2K2VA 4E2ZA 2RPNA 5GAMf 1IHWA 1OPLA 2XI9A 2B8AA 4CI0C 3META 1SRMA 2GCXA 1M4ZA 2YSQA 3G4SA 2DJQA 5GAOp 3CCMT 1PHTA 1T3LA 1NUIA 4ANJA 4BXXI 1HK9A 1PSEA 2O88A 2K7AA 2A08A 5HY6A 2GNCA 3VRYA 4PJJA 4F16A 2RJEA 3D2LA 2L3PA 4RKUE 1I0CA 2C0IA 4RG8A 2O9VA 1QYPA 3OYEA 3JCMg 1D0XA 2DXCA 2XMFA 1YHQZ 4OB2B 2D6FA 3OSVA 3HOXI 1S7MA 3OW2Z 1AVZC 1YJWT 1LJOA 3MZLB 2IV2X 2I2LA 1VQ41 4M75E 1TWGI 2NUTB 4PLLA 5KYXB 1KIKA 4HGZA 3CCEA 2GTIA 3PIOA 2ZAEA 2XG8D 2LNHB 3OYDA 3CCUQ 3RZDI 1IGQA 2G3RA 3ESWA 4J9DA 4FU6A 4J6XA 1MMNA 1K83I 4Z02A 3S1NI 4BACA 2ZPFB 2WSCE 5D1OB 2K57A 1G8XA 5I22A 4OGCA 1ZSGA 2BTTA 2DA9A 5GANf 4ZNXA 5LJ5g 3J81b 4NS5A 4C92G 3OYNA 4RTYA 5GAN4 2OTLZ 4A3JI 1VQ9A 4RCCA 3ULRB 2VPYA 1M2VB 1OZ3A 4E7HA 2V45A 3A1PA 4XTYA 5DY9A 3NTKA 1U1SA 2K3XA 1RLYA 5GANe 4KH0B 2D1XA 1M5Q1 1RUWA 1ZSZC 3QWYA 5FWCA 3QHSA 4ZTFA 2EWNA 5KE2A 2D8HA 1TSFA 2PQWA 2DZ9A 3S1MI 3LH5A 3ZEHA 5L23A 3L2QA 4J9BA 1OOTA 3NDIA 1DL6A 3CCSQ 2E2II 3A8HB 1JJ2Y 2NVXI 4C8QC 4JUVA 1QVGY 2J6KA 2L2PA 3CCET 3SFMA 3TREA 2A0FB 3S2HI 1VQ5Z 5C3EI 3VYGA 2JA8I 4RV9A 2RQVA 4AFQC 3NFCA 3I56T 1OU9A 4AMCA 3G6EA 1VQ81 1JXOA 1VQ6T 3FJ5A 1X6BA 2V8KA 3HOUI 4A63B 3OYYA 1SHFA 2JR6A 1R77A 3CXCS 1YWPA 4FYYB 3MPUB 2W10A 1K8AU 4J9FA 1YJWA 3HTRA 4PK4A 1DJ7B 3CCUZ 3HP9A 2HQEA 3V7SA 4TNUA 1WQWA 2ZZDA 1R0CB 1WDXA 1KJWA 2V1QA 2J7IA 1YJ9Q 5LL6f 1VQ71 1GCQC 1I5OB 2LJ1A 1KD11 2ABLA 2E2JI 1TWHI 2OX7A 2W03A 2WSFE 1WCMI 2AZVA 2NVTI 2RI5A 1PRLC 2J05A 2QTVA 4MMKA 2RIQA 2EQMA 4IUVA 2FZGB 3RKWA 3QSUA 4RTXA 3TU4K 4XTVA 4AFZC 2QI2A 3CD6T 1UGPB 2D0NA 2VB6A 2NWMA 2JUBA 3IR7A 4FW2A 2K4YA 4J6WA 1RADB 1OV3A 1W2BY 1QVFP 1UUEA 4JLIA 5CKHA 2DE6A 1IHVA 1TUCA 1VQ7A 3E19A 5LJ3f 3GTQI 2BJOA 2DIQA 1WIEA 3EFSA 2I3CA 4A3MI 1Y0MA 2YADA 3G6EQ 2DBMA 4MXUA 3EHRA 1YIJT 2MWOA 3JB9G 1NJIU 2KR3A 4Z8AA 1ZUYA 3NMZC 2YT6A 1TXQA 3UATA 2O9SA 1P92A 4PJOA 1YJWQ 1RI9A 4K11A 4E47A 1H3ZA 5C6SA 3EGDA 2H8HA 1VQ51 5M9OA 4NB9A 5GMKm 3V7RA 1Z01A 1K9M1 2R93I 3I55T 3VRZA 2VWFA 2GTJA 5KCOA 3REAB 3CCVQ 1M2VA 2EJGA 5HK3A 2YRVA 1K4US 1FDOA 4A4FA 4J7IA 2HD0A 3OYLA 2Y4YA 4RTVA 3CMAA 1Q861 4KGVB 3A8LB 4BY1I 4J5YA 2R6MA 2M02A 3OS2A 2JIOA 1WJ2A 1N2FA 2DYBA 1XJWB 2OTJA 1JJ2S 1RAFB 2LDMA 2RHUA 2AIRB 1H3HA 5A0DA 2D8JA 1LVKA 2Q4ZA 1YIJZ 4BDYA 4NFRA 3H8ZA 3NTIA 5T64A 3CCV1 2YUQA 4XK8E 1VYTA 3IX0A 2YLCA 5DLQE 5GJVB 1YITT 3S3MA 4R0KA 2G2KA 2NVQI 4EWCA 1TS9A 2D0QB 3MP6A 4OMPA 1UGVA 1IO6A 4N4IA 1X3WA 2WAQA 4MD9A 3FEOA 2K3BA 4LDYA 5IT9f 2VASA 3UDCA 4IUPA 1QP2A 2GF7A 1YBYA 4J7FA 3F3PC 5CM2M 2LC4A 1OX8A 1WXBA 3RMSA 5FROA 2DERA 3L2RA 3VMIA 4F04B 4M75G 2JTEA 1ZUKA 1KQ2A 1GCPA 1PD1A 2Y0SA 3D7SB 3M4OI 1BKBA 2E4HA 2CSQA 3CCLZ 2QA41 2RD1A 2RM4A 2PUOB 3NDJA 3VB9A 2VC8A 4HCKA 2RHIA 2K5FA 1JQQA 1I8FA 2X4JA 1KQSZ 1S1NA 1I50I 2OOXB 3J7A4 2VUBA 1GFCA 4EMKB 5GMKi 5KYUB 3KFVA 4M77A 2QDYB 1NYGA 3VS2A 1OEBA 4HCCA 2HSPA 3C95A 4QW2A 1VOMA 2K5IA 1S72Z 4HGYA 1JU5C 2P0PA 3G6E1 1UGQB 1VQ8A 4OB0B 3EHQA 1K9AA 2GGRA 2PVDB 4C0DB 5CO7A 2CT4A 2AKKA 3OSSC 1YCYA 1IZ6A 1D1CA 1CKBA 1YJW1 3VV0A 1ZLMA 2MI6A 1UDLA 1TFIA 1VQMQ 3FLGA 4XU3A 3CXCA 3S1RI 5I21A 5HK0A 2DJZA 4FM4B 2K79A 4PJOB 1BBZA 2V26A 1YP5A 2VKNA 1VQ9T 2LCSA 1RO4A 3CC2Q 1LOJA 2SEMA 1JJ2Z 1RLPC 1WW9A 4L59A 4M7AD 3M3YI 3GOXA 2JNYA 4C8QE 1D1AA 5T67A 4XTWA 4NBCA 2RQWA 1KQSA 3FKII 3G7ZA 3CPWZ 4M77C 2X4WA 1UE9A 1Q7YR 4DK1A 2DL8A 4QKUA 3Q1JA 4AG2C 1PSFA 2X4XA 4WCIA 1QVFY 5GAMd 1W2BP 3GTMS 4C92F 4C0GA 1YHQT 3QUIA 1KD1U 4NBBA 2KPIA 1MMAA 3D9XA 3EG0A 1ZA1B 5IT9b 3A8GB 1Q86R 1TUGB 2MF2A 4M77D 5KYYB 2O4XB 2J6FA 4PNOA 4ATOA 4TVRA 1D1BA 4HT8A 3CC7Q 1NP6A 2A36A 3VUZA 1Q86U 1K9MR 1RAHB 4DBRA 3QO3A 4BBSI 2XIDA 4Y91A 4M7AC 1FDIA 2B63I 1W2BA 2RO0A 3NH5A 4A54A 2EAYA 2FHDA 4PFZA 5GAN8 3LW5E 4LDVA 3M0QA 4NBDA 3VS0A 1N27A 4WF2A 3GTMI 2QEXT 3JCMX 4N0AA 2O4XA 2X9HA 3FJPA 3JB9J 4EMGA 2K6DA 3I56Z 3T4NB 3TQ7P 1Z02A 2LFUA 3S16I 3CMET 2GBQA 4M7AF 2JN0A 4NB8A 4E2YA 5D6YA 2RNAA 1VQPZ 1H641 3BY7A 1Z9ZA 5LJ5j 4BUGA 3J80E 4A3CI 2QQ9A 4P5NA 3CCSZ 2H3EB 2G6FX 2JJ9A 3KXTA 3HRUA 1L1OC 3A8OB 4D8KA 4C92E 1PCXA 4OMNA 2EYWA 2V3VA 2R5MA 1VQ8Z 3CCR1 3CCMQ 4AT1B 1IXDA 3GTGI 1TOVA 4M77F 1RAIB 2W04A 3CCEZ 2DTOA 4O5VA 2JMAA 1KQSS 4J9GA 2OI3A 4M7DA 1WZOA 2DTIA 3V8KA 5GANd 2AHJB 3EFOB 3CD6Q 1K8AR 3JAMb 1CSKA 9ATCB 3OYMA 1N8RR 3JB9H 4PFPA 1FXXA 1SF9A 1KSWA 4E2WA 2KRSA 2EFIA 2WACA 3I5RA 1M1K2 4DA4A 2FB7A 3PVQA 4OMMA 3CC2T 3CMEA 1Q822 3BFMA 2EKOA 3EERA 5AN9F 1BIAA 2PU9B 3OYAA 1VQ6A 2V8IA 4DEYA 1GXIE 1HSQA 2SRCA 4ORZA 1LCKA 1X2KA 2DL5A 1WQ7A 3C94A 5LL6S 3QG1A 1WHKA 4LD9K 1K73U 3C0CA 2DE7A 2QRDB 3KBGA 3ZFJA 4CC3A 1M27C 1B3QA 2HU9A 5T6BA 3I55Q 1K9MC 2MOXA 3PIPA 2OOYB 3CMAQ 2XDDA 1U3OA 1MNDA 4C5EA 1M1KR 4JS5A 2E3HA 3H9NA 2EGEA 2VYTA 4ESRA 3L2UA 2LCLA 2RMOA 4KH1B 4JPBW 4C5GA 1VLAA 3NHNA 3MEVA 2MWPA 2QKDA 2IPOB 1ZQ1A 3EGXB 5LJ3e 4M7DD 3TDHB 3GTOI 3CCEQ 3M0TA 3I07A 2LT4A 4M78B 5GAN3 2EJ9A 3CCMZ 1BI2A 3MZKB 4FIBA 3I35A 3PO3S 3VTNA 1SSHA 4N0AC 4IURA 2RQTA 3OY9A 5FU6C 2E9HA 2CREA 2KRMA 2OZKA 3CEYA 1XTDA 3CCJA 1AWWA 5FW9A 2M0OA 4M78A 4JZ3A 3A8MB 3THKA 2AT1B 3I5SA 2ENMA 4M7AA 3QIIA 1NPPA 4OB1B 7AT1B 5KYWA 1M90C 3CCQT 4MZTA 1VYUA 3P8DA 2R92I 3AT1B 2HQHA 1WA7A 3JCMP 2J6AA 1WHMA 4J9EA 3EAEA 3KIFA 5IN1A 2EW3A 5CQYA 1F1BB 1NJI1 3I55A 1AWXA 1IB8A 3M59A 4E31A 2XDBA 3OW2S 3SWNB 3M54A 1K732 1VQO1 2DNUA 2EYZA 3DB3A 4HKEA 1LQLA 2L3QA 5KE3A 3EGUA 4C8QG 3HOVI 4X1VA 4DOVA 1FYNA 5FLXb 4HCZA 4NBGA 4NL2A 3CMEZ 1VQLT 3GLXA 1WGSA 1ZBJA 3O5ZA 5GAN5 4M7DB 2QR1B 3RKXA 2CH4A 1WXTA 1ZSZA 4Z89A 1QMCA 3OW2Y 2F5KA 1S72A 1USPB 4KGZB 1YUAA 1T0HA 3GNGA 4MH4A 4JJCA 1K73C 4RS4A 5FU7B 4B9XA 2EPDA 2QDLA 4R55A 1Y07A 5IXFA 2HL3A 3L1AA 3CCM1 2DRMA 2JM8A 4E33A 2R7ZI 5GAN6 2BUDA 2KI7B 1WYXA 2LJ3A 3M4YA 4JJBA 3TSWA 2QASA 2HAXA 2CP3A 4M7AE 3RKYA 4A3GI 2RHZA 3Q87A 3OW2P 1K8A1 1AHJB 1QCFA 4EIKA
chains in the Genus database with same CATH topology
1Y0MA 2YADA 4D8DA 1VQ6Z 1H92A 4RUGA 3R6NA 2DBMA 2I0NA 4MXUA 2RT9A 2OTJZ 1YIT1 3EHRA 4LUDA 2PMZA 2F2WA 1S721 2KR3A 4Z8AA 1Q7Y2 1ZUYA 3NMZC 2YT6A 2VUGA 3UATA 3CPWY 2L3SA 1T0JA 3H0HA 1M1K1 3J81f 2CSIA 2O9SA 1UHFA 2QREB 1HJDA 2OTJ1 1RI9A 2LQNA 4BBRI 4K11A 2HBWA 2K2MA 3PE0A 2H8HA 1VQ51 2W0ZA 1VQMZ 2VVKA 4QT7A 2OAWA 4DQYB 4NB9A 5A2Qb 1ZH1A 2EVRA 2L0AA 4BY7I 3J80b 4DGLA 1Z03A 2LZ6B 2F2VA 1Z01A 4A3II 1K9M1 2R93I 3CC71 1K1ZA 5IXBA 3VRZA 1I07A 2NUZA 2GTJA 2VWFA 3REAB 4AFSC 4AG1C 3GKQA 5IHKA 2JS4A 4J9IA 1K4US 2JS0A 2GTOA 1OPKA 1R9TI 2CDTA 2M48A 4RTVA 1Q861 2DBKA 4BY1I 3VS1A 2R6MA 4A93I 1ML8A 1PFTA 4NOZA 1WI7A 1KQSY 1UTIA 4F14A 1N2FA 1Y1VS 2DYBA 3EG1A 3M0PA 4RVDA 2HF1A 1SHGA 1H3HA 1N5ZA 2D8JA 3JV3A 2HEQA 2ECZA 2Q4ZA 5FLXf 1VQ9Z 2KBTA 1PRMC 1YIJZ 1AZEA 3S2DI 4X6AI 2FO0A 3M0SA 4RTWA 3G4S1 4NFRA 1NG2A 5T64A 2QEX1 3HKZA 3CCV1 3CCE1 1G2BA 1ZB9A 1Q7Y1 2YUQA 5D1PA 4GLMA 1VYTA 3IX0A 2KROA 2A37A 2V8JA 2RBLA 3REBB 5GJVB 1YIJ1 3VS7A 4R0KA 2G2KA 3CXCY 2NVQI 4EWCA 3S14I 2OTL1 1YCSB 3CME1 2BZ8A 2KXCA 2LP5A 4OMPA 3HOWI 1UGVA 1VQ61 1IO6A 1WX6A 3PVLA 2ZAEB 1VYVA 1X3WA 1UFFA 2KYBA 1U06A 2WAQA 1KRLA 4MD9A 1NM7A 2DM1A 1J3TA 2K3BA 5IT9f 1NLPC 1K731 3CC2Z 1JWHC 3F3PC 2JA7I 5CM2M 1VQ91 2F2XA 1WXBA 4MD8A 5HCKA 3G4SZ 3VMIA 2DRKA 4E2XA 2J06A 2JTEA 1M8MA 1ZUKA 5C4JI 2EGAA 3K7AI 1SRLA 1GCPA 2Y0SA 1YUKA 3NH8A 3M4OI 4A3DI 1RNIA 3CC41 2CSQA 3CCLZ 2QA41 4CC2A 2K9GA 3H0GI 2O31A 1I3QI 2PM9A 3BG0B 3NDJA 3VB9A 3GTPI 4HCKA 2QRCB 1JQQA 1Y1WI 1KQSZ 1YJ9Z 4HVWA 1S1NA 1I50I 1M3AA 2OOXB 3J7A4 1GFCA 2O4HA 1Y57A 4M4ZA 1MV3A 4OMQA 3CCQZ 3KFVA 1WFWA 1E6GA 1NYGA 3VS2A 1GBRA 1RQFA 2WB1A 1OEBA 3CCJ1 1E7OA 1PKSA 1JXMA 2HSPA 1YJ91 3TE5B 1S72Z 4J9CA 4HGYA 2J6OA 1JU5C 4A3LI 3G6E1 1ABQA 1QVFZ 1M30A 1UG1A 1K9AA 3EHQA 1TWFI 2DLPA 4QTTA 2GGRA 4OMLA 2ROLA 1W6XA 2CT4A 3CC4Z 2AKKA 1KFZA 1QKWA 1B07A 3LUSA 2E2HI 2X3WD 3GCFA 3VS6A 1EFNA 2RN8A 1CKBA 5IP9I 2RQRA 2AKLA 1YJW1 2EBPA 2EKHA 5C4XI 1ZLMA 1UDLA 5FWBA 1TFIA 2DMOA 2EQIA 2KXDA 3U23A 1GRIA 3S1RI 3VS5A 1VQKZ 2H85A 2K3RA 3GTLI 2BZXA 2K79A 2RHBA 1YJWZ 2HCKA 1K9M2 5IHIA 1BBZA 4JZ4A 1W2BZ 2O53A 1ABOA 1YP5A 2VKNA 2C0TA 2KT8A 2IIMA 4A3FI 2ED0A 1RO4A 3A98A 4IIMA 2LCSA 3GBQA 1QCFA 4AFUC 4QTUA 2X3XD 1PWTA 2SEMA 2JMOA 1JJ2Z 1RLPC 2BZYA 3KIHA 1WW9A 5C44I 2DX1A 3VS3A 1VQN1 3S17I 3M3YI 1RLQC 2JNYA 1VA7A 2P28A 1NEGA 5T67A 1NJI2 2KYMA 2YU9I 5D1OA 4NBCA 1Q821 1Q811 3I4NI 2DE0X 2RQWA 4OMOA 3TSZA 3FKII 4A3BI 2EYXA 3SEMA 3VMHA 3CPWZ 1ZUUA 4CL1A 3I551 4KRTA 1UE9A 1QKXA 4DK1A 2DL8A 3D6WA 3S15I 1I1JA 2GTHA 3BG1B 4AG2C 4WCIA 5IHNA 1QVFY 1UJ0A 3GTMS 3G71Z 1E6HA 1QF8A 4NBBA 2KPIA 1YI2Z 3D9XA 3EG0A 1GFDA 1P9NA 3ZL7C 5IT9b 2GQIA 3I9QA 4Z88A 2P3YA 2MCNA 4DEXA 4Y52I 4A3EI 1USPA 2J6FA 3M0RA 3CMAZ 2Q51A 4RVGA 3CXCZ 1NP6A 1VQP1 2A36A 2ED1A 4GBQA 3VMGA 2YUNA 3CCL1 2B86A 4BBSI 4Y92A 2DILA 1A0NB 4HH4A 2B63I 2IZ4A 1TG0A 1ZB8A 1VQ7Z 2FPEA 1TUDA 1K76A 3IF8A 2A28A 3NH5A 3H0IA 3I55Z 5ECAA 2EYYA 3I561 3M0QA 4NBDA 3H3VJ 3VS0A 1YJNZ 3GTMI 1Z9QA 2FEIA 3CCQ1 5FLMI 3UA7A 3PO3I 1JEGA 2JS2A 1AOJA 2KRNA 2PTKA 2JMCA 1HD3A 4S1TA 1KD12 2JXBA 2K6DA 3I56Z 1WIIA 2JA6I 1W70A 1K0XA 3T4NB 4RTUA 1N8R2 1Z02A 2LFUA 1YJN1 3S16I 2GBQA 2IZ3A 1GL5A 1T3SA 1BB9A 4JJDA 4NB8A 4E2YA 2V1RA 2RNAA 1QVGZ 1VQPZ 1Z9ZA 4MD7A 2KE9A 1KC82 4A3CI 1H8KA 3CCSZ 4CC4B 2G6FX 5I11A 1AWOA 1L1OC 4D8KA 3HOZI 1X2QA 4OMNA 1SPKA 2EYWA 1VQ8Z 3CCR1 2KT1A 2E5KA 4NBAA 3G6EZ 1VQK1 3F3FC 2DF6A 3U50C 2M51A 4NBFA 3GTGI 2NVYI 1AD5A 1UJYA 4RTZA 4Y7NI 2DL3A 2MIOA 2YDLA 5IH2A 2W04A 3CCEZ 2JMAA 1YHQ1 2P4RA 4E2ZA 2RPNA 1X69A 2ESWA 4J9GA 1PKTA 2OI3A 2YUPA 1M902 1OPLA 1YN8A 1M3CA 1GCQA 3JAMb 1CSKA 1X43A 2PZ1A 1SRMA 2YSQA 2DJQA 2AZSA 3CD61 1SFOI 1VQ4Z 1VQNZ 1KSWA 4E2WA 1PHTA 1QWEA 1T3LA 2O2OA 1NUIA 4HVUA 4NBEA 4RVFA 2KRSA 4BXXI 1ZX6A 2LMJA 1BU1A 3QWUA 3EG2A 3I5RA 2O88A 1M1K2 2K7AA 1MV0B 2A08A 3CMA1 2GNCA 3CQTA 3VRYA 4F16A 2JA5I 2CUBA 3EG3A 3CCRZ 2ROTA 2DL7A 3PVQA 2L3PA 1Q822 1I0CA 1JO8A 2C0IA 2RF0A 3NPFA 3EERA 2O9VA 5AN9F 1AEYA 2KNBB 1QYPA 2V8IA 4RTTA 4DEYA 5EC7A 1QLYA 1UHCA 1NYFA 1HSQA 1WLPB 2OJ2A 2SRCA 4ORZA 1LCKA 1YHQZ 1BK2A 1Q812 1X2KA 1AZGB 2DL5A 1Y1VI 2VF1A 2XMFA 3HOXI 4E30A 1S7MA 3OW2Z 1AVZC 3MZLB 4E6RA 5GJWB 3SHWA 1VQ41 1TWGI 3C0CA 3JAMf 2DE7A 2QRDB 3H41A 1KIKA 4HGZA 3CCU1 4CC3A 2GTIA 3I4MI 3IFUA 3NGPA 1M27C 1RO0A 1B3QA 2LNHB 1K8A2 2HU9A 5T6BA 1VQOZ 3RZDI 2MOXA 2OOYB 3ESWA 2DVJA 4J9DA 4CC7A 1K83I 3S1NI 2LIYA 2EGTA 1WXUA 5D1OB 3CCS1 1U3OA 4NBHA 5I22A 3UA6A 1ZSGA 1VQM1 3FQMA 2BTTA 2DA9A 1W1FA 2EGEA 4ESRA 2F4MA 4RVHA 2RMOA 4JPBW 4ZNXA 2K5RA 4LUEA 1VLAA 3MONA 1QWFA 2FPFA 3NHNA 3J81b 3TVTA 4RTYA 3CQZI 1VQL1 4HXJA 2OTLZ 2QKDA 4A3JI 3G711 3RNJA 2YUOA 3RZOI 3ULRB 2F4OA 1TWAI 5IP7I 3TDHB 3GTOI 1RLYA 1V1CA 1X0TA 2DL4A 1NLOC 3M0TA 2D1XA 3I07A 1RUWA 1AWJA 1G83A 2JW4A 3QWYA 5FWCA 1YWOA 3CCMZ 4OMMA 2FG0A 3UF4A 3MZKB 2DE5A 2D8HA 2GU2A 3CD6Z 3S1MI 2RQUA 3FQQA 3LH5A 1GBQA 3PO3S 3VTNA 1M3BA 1SSHA 3I35A 1OOTA 4J9BA 5L23A 3NDIA 1MUZA 1DL6A 2E2II 1JJ2Y 2NVXI 3PO2I 1QVGY 2J6KA 2L2PA 4J9HA 2RQTA 2QA4Z 3HOYI 2RPRA 2E9HA 3NH4A 2CREA 4A3KI 2KRMA 2OZKA 3S2HI 1VQ5Z 5C3EI 3J80f 3M0UA 5FW9A 1AWWA 2JA8I 4RV9A 2RQVA 4AFQC 4JZ3A 3THKA 3I5SA 3S1QI 2ENMA 1X6GA 1VQ81 1JXOA 3H0FA 3FJ5A 1X6BA 2V8KA 3HOUI 4A63B 1ARKA 1VYUA 1SHFA 2R92I 1YNZA 2JR6A 1I6HI 3IQLA 2EGCA 1WA7A 1Q862 2J6AA 2VUMI 1YWPA 4J9EA 2C0OA 3KIFA 2W10A 2KGTA 2JM9A 1TWCI 2EW3A 4J9FA 2KEAA 3GTJI 3CCUZ 2M0YA 1X3ZA 1NJI1 1AWXA 2JT4A 4E31A 1K732 3P5JB 4TNUA 1X27A 3NFZA 2FRYA 1VQO1 1CKAA 2DNUA 2EYZA 1LQLA 2L3QA 1WDXA 3EGUA 4NH1C 3CC7Z 3QWXX 1KJWA 3HOVI 4X1VA 2V1QA 2J7IA 1FYNA 4HVVA 5FLXb 5LL6f 4NBGA 1VQ71 3CMEZ 1GCQC 1U5SA 2QLVB 1ZBJA 3O5ZA 4AYBA 2LJ1A 1KD11 2ABLA 2E2JI 1TWHI 2M6NA 2QR1B 4MRIA 1WXTA 2W03A 2CH4A 4LN2A 4Z89A 3OW2Y 1M901 1WCMI 5A2Qf 1VQLZ 2AZVA 2NVTI 1PRLC 2J05A 2LJ0A 2QEXZ 1N8R1 3CCVZ 4LNPA 2RIQA 2FPDA 4E32A 1RO2A 1XOVA 1YITZ 1USPB 4RTXA 1YUAA 1T0HA 4IIOA 4AFZC 4MH4A 4FSSA 4JJCA 2LQWA 4RS4A 2EPDA 2CUDA 2QDLA 3RBBB 1PNJA 5IXFA 1K0SA 4MONA 1YI21 3CCM1 1NEBA 2D0NA 2DRMA 1SEMA 2NWMA 3CCJZ 2PNIA 2JUBA 2JM8A 3VS4A 4E33A 2AK5A 2R7ZI 2HDAA 2CH4W 2KI7B 1WYXA 2FRWA 2LJ3A 1OV3A 4JJBA 2LX7A 1W2BY 3TSWA 1UUEA 1KC81 3CC21 2CT3A 4A3GI 3GTKI 2DE6A 1TUCA 1FMKA 3Q87A 1UECA 2PK7A 3GTQI 1K8A1 3EEDA 2BJOA 1WIEA 4F17A 4XX2A 4LE9A 2I3CA 4A3MI 4EIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0M A;  4D8D A;  1H92 A;  4RUG A;  3R6N A;  2DBM A;  2I0N A;  3EHR A;  4LUD A;  2F2W A;  2KR3 A;  4Z8A A;  1ZUY A;  3NMZ C;  2YT6 A;  3UAT A;  2L3S A;  1T0J A;  3H0H A;  2CSI A;  2O9S A;  1UHF A;  1HJD A;  1RI9 A;  2LQN A;  4BBR I;  4K11 A;  2HBW A;  2K2M A;  3PE0 A;  2H8H A;  2W0Z A;  2VVK A;  4QT7 A;  2OAW A;  4NB9 A;  2EVR A;  2L0A A;  4BY7 I;  2LZ6 B;  2F2V A;  4A3I I;  2R93 I;  1K1Z A;  5IXB A;  3VRZ A;  1I07 A;  2NUZ A;  2GTJ A;  2VWF A;  3REA B;  4AFS C;  4AG1 C;  3GKQ A;  5IHK A;  2JS4 A;  4J9I A;  1K4U S;  2JS0 A;  2GTO A;  1OPK A;  1R9T I;  2CDT A;  4RTV A;  2DBK A;  4BY1 I;  3VS1 A;  4A93 I;  1ML8 A;  1PFT A;  4NOZ A;  1WI7 A;  1UTI A;  4F14 A;  1N2F A;  1Y1V S;  2DYB A;  3EG1 A;  3M0P A;  1SHG A;  2HF1 A;  1H3H A;  1N5Z A;  2D8J A;  3JV3 A;  2HEQ A;  2ECZ A;  2KBT A;  1AZE A;  1PRM C;  3S2D I;  4X6A I;  2FO0 A;  3M0S A;  4RTW A;  1NG2 A;  1G2B A;  1ZB9 A;  2YUQ A;  4GLM A;  1VYT A;  2KRO A;  2A37 A;  3REB B;  2RBL A;  5GJV B;  3VS7 A;  4R0K A;  2NVQ I;  3S14 I;  1YCS B;  2KXC A;  2BZ8 A;  2LP5 A;  4OMP A;  3HOW I;  1UGV A;  1IO6 A;  1WX6 A;  3PVL A;  1VYV A;  1X3W A;  1UFF A;  2KYB A;  1U06 A;  1NM7 A;  2DM1 A;  1J3T A;  2K3B A;  1NLP C;  2JA7 I;  5CM2 M;  2F2X A;  1WXB A;  5HCK A;  3VMI A;  2DRK A;  2J06 A;  2JTE A;  1M8M A;  1ZUK A;  5C4J I;  2EGA A;  3K7A I;  1SRL A;  1GCP A;  4A3D I;  3M4O I;  2CSQ A;  4CC2 A;  2K9G A;  3H0G I;  2O31 A;  1I3Q I;  3VB9 A;  3GTP I;  4HCK A;  1JQQ A;  1Y1W I;  4HVW A;  1S1N A;  1I50 I;  1M3A A;  1GFC A;  1Y57 A;  4M4Z A;  1MV3 A;  4OMQ A;  3KFV A;  1WFW A;  1E6G A;  1NYG A;  3VS2 A;  1GBR A;  1OEB A;  1E7O A;  1PKS A;  1JXM A;  2HSP A;  4J9C A;  2J6O A;  1JU5 C;  4A3L I;  1ABQ A;  1M30 A;  1UG1 A;  3EHQ A;  1K9A A;  1TWF I;  2DLP A;  4QTT A;  2GGR A;  4OML A;  2ROL A;  1W6X A;  2CT4 A;  2AKK A;  1KFZ A;  1QKW A;  1B07 A;  3LUS A;  2E2H I;  2X3W D;  3GCF A;  3VS6 A;  1EFN A;  2RN8 A;  1CKB A;  5IP9 I;  2RQR A;  2AKL A;  2EBP A;  2EKH A;  5C4X I;  1ZLM A;  1UDL A;  5FWB A;  1TFI A;  2DMO A;  2EQI A;  2KXD A;  3U23 A;  1GRI A;  3S1R I;  3VS5 A;  2BZX A;  3GTL I;  2K79 A;  2HCK A;  5IHI A;  1BBZ A;  4JZ4 A;  1ABO A;  1YP5 A;  2VKN A;  2C0T A;  2KT8 A;  2IIM A;  4A3F I;  2ED0 A;  1RO4 A;  3A98 A;  4IIM A;  2LCS A;  3GBQ A;  4AFU C;  4QTU A;  2X3X D;  1PWT A;  2SEM A;  1RLP C;  2BZY A;  1WW9 A;  5C44 I;  2DX1 A;  3VS3 A;  3S17 I;  3M3Y I;  1RLQ C;  2JNY A;  1VA7 A;  1NEG A;  2KYM A;  2YU9 I;  4NBC A;  3I4N I;  2DE0 X;  2RQW A;  4OMO A;  3TSZ A;  3FKI I;  4A3B I;  2EYX A;  3SEM A;  3VMH A;  1ZUU A;  4KRT A;  1UE9 A;  1QKX A;  2DL8 A;  3D6W A;  3S15 I;  1I1J A;  4AG2 C;  4WCI A;  5IHN A;  1UJ0 A;  3GTM S;  1E6H A;  4NBB A;  2KPI A;  1GFD A;  3EG0 A;  3ZL7 C;  2GQI A;  3I9Q A;  4Z88 A;  2P3Y A;  2MCN A;  4DEX A;  4Y52 I;  4A3E I;  1USP A;  2J6F A;  3M0R A;  2A36 A;  2ED1 A;  4GBQ A;  3VMG A;  2YUN A;  2B86 A;  4BBS I;  4Y92 A;  2DIL A;  1A0N B;  2B63 I;  1TG0 A;  1ZB8 A;  2FPE A;  1TUD A;  1K76 A;  2A28 A;  3H0I A;  5ECA A;  2EYY A;  3M0Q A;  4NBD A;  3H3V J;  3VS0 A;  3GTM I;  1Z9Q A;  2FEI A;  5FLM I;  3UA7 A;  1JEG A;  3PO3 I;  2JS2 A;  1AOJ A;  2KRN A;  2PTK A;  2JMC A;  1HD3 A;  2JXB A;  2K6D A;  2JA6 I;  1W70 A;  1K0X A;  4RTU A;  3S16 I;  2GBQ A;  1GL5 A;  1T3S A;  1BB9 A;  4JJD A;  4NB8 A;  2V1R A;  2RNA A;  1Z9Z A;  2KE9 A;  4A3C I;  1H8K A;  4CC4 B;  2G6F X;  5I11 A;  1AWO A;  1L1O C;  4D8K A;  3HOZ I;  1X2Q A;  4OMN A;  1SPK A;  2EYW A;  2KT1 A;  2E5K A;  4NBA A;  2DF6 A;  2M51 A;  3U50 C;  4NBF A;  3GTG I;  2NVY I;  1AD5 A;  1UJY A;  4RTZ A;  4Y7N I;  2DL3 A;  2MIO A;  2YDL A;  5IH2 A;  2JMA A;  2P4R A;  2RPN A;  1X69 A;  2ESW A;  4J9G A;  1PKT A;  2OI3 A;  2YUP A;  1OPL A;  1YN8 A;  1M3C A;  1GCQ A;  1CSK A;  1X43 A;  2PZ1 A;  1SRM A;  2YSQ A;  2DJQ A;  2AZS A;  1SFO I;  1T3L A;  1KSW A;  1PHT A;  1QWE A;  2O2O A;  4HVU A;  1NUI A;  4NBE A;  2KRS A;  4BXX I;  1ZX6 A;  2LMJ A;  1BU1 A;  3EG2 A;  3I5R A;  2O88 A;  2K7A A;  1MV0 B;  2A08 A;  2GNC A;  3CQT A;  3VRY A;  4F16 A;  2JA5 I;  2CUB A;  3EG3 A;  2ROT A;  3PVQ A;  2DL7 A;  4OMM A;  2L3P A;  1I0C A;  1JO8 A;  2C0I A;  2RF0 A;  3NPF A;  3EER A;  2O9V A;  1AEY A;  2KNB B;  1QYP A;  4RTT A;  4DEY A;  5EC7 A;  1QLY A;  1UHC A;  1NYF A;  1HSQ A;  1WLP B;  2OJ2 A;  2SRC A;  4ORZ A;  1LCK A;  1BK2 A;  2XMF A;  1X2K A;  1AZG B;  2DL5 A;  1Y1V I;  3HOX I;  1AVZ C;  4E6R A;  5GJW B;  3SHW A;  1TWG I;  3C0C A;  2DE7 A;  3H41 A;  1KIK A;  4CC3 A;  3I4M I;  3NGP A;  1M27 C;  1B3Q A;  2LNH B;  3RZD I;  2MOX A;  3ESW A;  2DVJ A;  4J9D A;  4CC7 A;  1K83 I;  3S1N I;  1WXU A;  1U3O A;  4NBH A;  5I22 A;  3UA6 A;  1ZSG A;  2BTT A;  2DA9 A;  1W1F A;  2EGE A;  4ESR A;  2F4M A;  2RMO A;  4JPB W;  4ZNX A;  2K5R A;  4LUE A;  1VLA A;  1QWF A;  2FPF A;  3NHN A;  3TVT A;  4RTY A;  3CQZ I;  4HXJ A;  4A3J I;  3RNJ A;  2YUO A;  3RZO I;  3ULR B;  2F4O A;  1TWA I;  5IP7 I;  3GTO I;  1RLY A;  1V1C A;  2DL4 A;  1NLO C;  3M0T A;  2D1X A;  3I07 A;  1RUW A;  1AWJ A;  1G83 A;  2JW4 A;  3QWY A;  5FWC A;  1YWO A;  2FG0 A;  3UF4 A;  2DE5 A;  2D8H A;  3S1M I;  2RQU A;  3LH5 A;  1GBQ A;  3PO3 S;  1SSH A;  1M3B A;  3I35 A;  4J9B A;  1OOT A;  5L23 A;  1MUZ A;  1DL6 A;  2E2I I;  2NVX I;  3PO2 I;  2J6K A;  2L2P A;  4J9H A;  2RQT A;  3HOY I;  2CRE A;  4A3K I;  2KRM A;  3S2H I;  5FW9 A;  5C3E I;  3M0U A;  1AWW A;  2JA8 I;  2RQV A;  4AFQ C;  4JZ3 A;  3THK A;  3I5S A;  3S1Q I;  2ENM A;  1X6G A;  3H0F A;  1JXO A;  3FJ5 A;  1X6B A;  3HOU I;  4A63 B;  1ARK A;  1VYU A;  1SHF A;  1YNZ A;  2R92 I;  2JR6 A;  1I6H I;  3IQL A;  2EGC A;  1WA7 A;  2J6A A;  2VUM I;  1YWP A;  4J9E A;  2C0O A;  2W10 A;  2KGT A;  2JM9 A;  1TWC I;  2EW3 A;  4J9F A;  2KEA A;  3GTJ I;  2M0Y A;  1X3Z A;  1AWX A;  2JT4 A;  1X27 A;  2FRY A;  1CKA A;  2DNU A;  2EYZ A;  1LQL A;  2L3Q A;  1WDX A;  3EGU A;  3QWX X;  1KJW A;  3HOV I;  4X1V A;  2V1Q A;  2J7I A;  1FYN A;  4HVV A;  4NBG A;  1GCQ C;  1U5S A;  1ZBJ A;  3O5Z A;  2LJ1 A;  2ABL A;  2E2J I;  1TWH I;  2CH4 A;  1WXT A;  4LN2 A;  4Z89 A;  1WCM I;  2AZV A;  2NVT I;  1PRL C;  2J05 A;  2LJ0 A;  4LNP A;  2FPD A;  1XOV A;  1USP B;  4RTX A;  1YUA A;  1T0H A;  4IIO A;  4AFZ C;  4MH4 A;  4FSS A;  4JJC A;  2LQW A;  2EPD A;  2CUD A;  2QDL A;  3RBB B;  1PNJ A;  5IXF A;  1K0S A;  1NEB A;  2D0N A;  2PNI A;  2DRM A;  1SEM A;  2NWM A;  2JM8 A;  3VS4 A;  2AK5 A;  2R7Z I;  2HDA A;  2CH4 W;  1WYX A;  2FRW A;  2LJ3 A;  1OV3 A;  4JJB A;  2LX7 A;  3TSW A;  1UUE A;  2CT3 A;  4A3G I;  3GTK I;  2DE6 A;  1TUC A;  1FMK A;  3Q87 A;  1UEC A;  2PK7 A;  3GTQ I;  2BJO A;  1WIE A;  4F17 A;  4XX2 A;  4LE9 A;  1QCF A;  4A3M I;  4EIK A; 
#chains in the Genus database with same CATH topology
 4D8D A;  2NYS A;  4NOY A;  2OTJ Z;  2HSE B;  1S72 1;  4E7S A;  1JJ2 A;  4FW1 A;  1YIT Q;  2FZK B;  2KI7 A;  3VYH B;  4O6J A;  4M7D E;  4DBH A;  4BBR I;  1PM3 A;  3QZ5 B;  2K2M A;  3CCM A;  3PE0 A;  2OAW A;  1WHG A;  4DQY B;  2YRD A;  5A2Q b;  1ZH1 A;  2EVR A;  2HNI A;  2R5A A;  4BY7 I;  3M58 A;  1M90 U;  3J80 b;  2LZ6 B;  2QEX A;  3CC7 1;  2JIP A;  1I07 A;  2BE9 B;  2FL7 A;  3CBO A;  3M5A A;  3UT1 A;  1M90 R;  3OYG A;  2QXF A;  2CDT A;  2M48 A;  2DXB A;  1KD1 R;  1S72 Q;  3VS1 A;  3JCM J;  1N6A A;  1PFT A;  1WI7 A;  4E7L A;  1UTI A;  2QQB A;  2KAF A;  1SHG A;  2HF1 A;  1KC8 U;  3CCJ T;  4BI3 A;  1Q16 A;  1YJ9 T;  2F69 A;  1Y8C A;  2QAZ A;  4BDZ A;  5FLX f;  1VQ9 Z;  5CCA A;  4PL6 A;  2FO0 A;  5DLO A;  1D09 B;  1NG2 A;  2QEX 1;  3CCE 1;  1Q7Y 1;  5GAM h;  1N9R A;  3LWH A;  2RK2 A;  1C0M A;  5KYW B;  1YIJ 1;  1BIB A;  3VS7 A;  5CKE A;  1YCS B;  2KXC A;  2BZ8 A;  4ZN3 A;  1VQ8 T;  2RI2 A;  4BD3 A;  3PVL A;  2ZAE B;  1VYV A;  1U06 A;  3TEE A;  2YLB A;  1NLP C;  3ER0 A;  1K73 1;  2DO3 A;  1VQ9 1;  4MD8 A;  1SIW A;  2DRK A;  3CCR T;  2J06 A;  3MO8 A;  4MDX A;  2EGA A;  2F1L A;  5GAO r;  2RI3 A;  4XU0 A;  3CCU A;  1YUK A;  2L3R A;  2QEX Q;  4A3D I;  2PVO B;  5J39 A;  3S3O A;  2EQK A;  3ME9 A;  4CC2 A;  2K9G A;  2XIC A;  1UGS B;  4L6V 5;  1VQ7 T;  2HBP A;  2QTX A;  4XTU A;  3RR6 A;  2QRC B;  1QCO A;  5GAM e;  2OTL Q;  2RB6 A;  3CME Q;  2E10 A;  1YJ9 Z;  3PMI A;  1M3A A;  1C6V X;  2O4H A;  1Y57 A;  2Y4X A;  3X24 B;  1KQS P;  1E6G A;  4ZTJ A;  1RQF A;  1PKS A;  1JBM A;  2E70 A;  3G71 A;  4C5I A;  5KH6 A;  4A3L I;  1Q7Y U;  1UG1 A;  4JRK A;  2DD4 A;  2DLP A;  2O01 E;  3INZ A;  2ROL A;  4F7U A;  1W6X A;  3CC4 Z;  4FYX B;  1QKW A;  1B07 A;  3LUS A;  2X3W D;  4E7K A;  2AKL A;  2EBP A;  5C4X I;  2JIR A;  5FWB A;  2COY A;  2EQI A;  2NUP A;  3LWI A;  2BZX A;  2QQS A;  3EG9 B;  3JCM e;  2RHB A;  1YJW Z;  1PD0 A;  2HCK A;  2QG9 B;  4HT9 A;  1W2B Z;  2CKK A;  2KT8 A;  2ED0 A;  4C92 C;  2E5Q A;  1WHL A;  2X3X D;  3E9F A;  1PWT A;  2BZY A;  3KIH A;  1FMV A;  3VS3 A;  1VQN 1;  3S17 I;  4KUL A;  2XDP A;  3VKI A;  2QA4 T;  2EQU A;  2DE0 X;  3I56 A;  3TSZ A;  3OW2 A;  2EYX A;  2R58 A;  3OMC A;  3SEM A;  3VMH A;  2VGN A;  3CBM A;  3OBW A;  5LJ5 f;  1ZUU A;  2RH2 A;  4BI4 A;  4KRT A;  1QKX A;  2GTH A;  1G5V A;  4C92 B;  1D3B B;  3CPW A;  1IRX A;  2ZPE B;  1E6H A;  1QF8 A;  4X9C A;  2JTF A;  1P9N A;  3ZL7 C;  4HA8 A;  3I9Q A;  2RHX A;  1PG5 B;  5LJ5 e;  5IAY A;  1W2B S;  2P3Y A;  3HFN A;  2VPX A;  3M0R A;  3CMA Z;  2JOY A;  3OYJ A;  1NBE B;  3CXC Z;  4E7I A;  3J81 E;  2ED1 A;  4GBQ A;  2B86 A;  2DIL A;  5GAM j;  1A0N B;  1ZB8 A;  3CMA T;  2FPE A;  1KD1 C;  1TUD A;  4C92 A;  2H3J A;  2DET A;  3H0I A;  3WVE B;  3I55 Z;  2JTM A;  2RJD A;  5ECA A;  2DZC A;  1VQK A;  2EYY A;  4EMH A;  3NTH A;  2EJF A;  3CCV T;  1MGQ A;  4OP0 A;  2KDS A;  3UA7 A;  1AOJ A;  3QKJ A;  1KD1 2;  2BE7 D;  2QGG A;  1K0X A;  2OTL T;  1YJN 1;  3GNF B;  4LD6 A;  1GL5 A;  5GMK l;  3CD6 A;  1QVG Z;  2QYZ A;  1X6O A;  3CC7 A;  4KBM B;  2E12 A;  2YXY A;  1KC8 2;  2LVM A;  1AWO A;  3HOZ I;  1X2Q A;  5KYX A;  1SG5 A;  3QYG B;  3JCM V;  3M57 A;  2DF6 A;  1WJS A;  2DEU A;  4ZGE B;  3TCJ A;  1UJY A;  4Y7N I;  2XKO C;  3M56 A;  1YHQ 1;  2P4R A;  1X69 A;  1PKT A;  4C8Q D;  3J7A F;  1M90 2;  2VXE A;  1M3C A;  2JVV A;  2PZ1 A;  2M1H A;  2NLU A;  3ASK A;  3SDZ A;  4DBQ A;  2AZS A;  1VQN Z;  1HXD A;  4FCY A;  4HVU A;  1RAG B;  4RVF A;  4RCB A;  2LMJ A;  3QWU A;  1RAB B;  3EG2 A;  2P4T A;  1YIJ A;  1MV0 B;  3V8J A;  4II1 A;  5CR2 A;  2E41 A;  3CQT A;  2JA5 I;  3EG3 A;  2ROT A;  1JO8 A;  3NPF A;  4M7D C;  4RTT A;  1QLY A;  2PUK B;  1NYF A;  1VQK Q;  2OJ2 A;  1Q81 2;  1VQL A;  2NUP B;  4E30 A;  1EIF A;  3X20 B;  4B6M A;  5LJ5 d;  2VPZ A;  2DIG A;  5GJW B;  2DXU A;  4QQ6 A;  3SHW A;  3L2Z A;  3JAM f;  4C0Z A;  3M4G A;  5GAO l;  1BYM A;  2OTJ T;  2EYQ A;  4J6Y A;  3CCU 1;  4UC4 A;  2L8D A;  3NGP A;  4L5G A;  2IVW A;  4FYV B;  5CK9 A;  1K8A 2;  2QA4 A;  1VQO Z;  1EX4 A;  3SB2 A;  2ATC B;  2HKN A;  4CC7 A;  4FT2 A;  1UEB A;  3CCS 1;  3CC7 T;  1VQM 1;  2E6Z A;  3A5Z B;  2F4M A;  4RVH A;  2CP2 A;  4LUE A;  3MON A;  1QWF A;  5FU6 B;  4HXJ A;  1VQL 1;  3PTA A;  4XQ3 A;  2RHY A;  1JJ2 P;  1RL2 A;  1RAC B;  2YUO A;  1VQ5 Q;  2F4O A;  1TWA I;  1OUL A;  3HPW A;  3HRT A;  3CCL Q;  1YFN A;  3G71 Q;  5KYU A;  1X0T A;  2DL4 A;  2GFU A;  2QQA A;  1G83 A;  2JW4 A;  4OGE A;  1QCN A;  4QVC A;  3GF5 A;  3V8L A;  4QVZ A;  2FG0 A;  3UF4 A;  1QXF A;  4QQD A;  3ZBD A;  3CD6 Z;  1NE8 A;  1GBQ A;  1Q82 C;  3G4S T;  1MUZ A;  4PFO A;  5CQX A;  3CCL T;  4KT0 E;  4J9H A;  3BDU A;  4IUU A;  3GPL A;  3HOY I;  2RPR A;  3NH4 A;  1MNE A;  2D9T A;  4X34 A;  3M0U A;  1SKU B;  1FMW A;  1VQ8 Q;  2DFU A;  1EZZ B;  3S1Q I;  3JCM h;  1X6G A;  5J26 A;  2DKG A;  2QK0 A;  5FU7 C;  5FLX E;  1VQN A;  1YNZ A;  3CC4 Q;  1I6H I;  2EGC A;  1Q86 2;  2VUM I;  3JB9 D;  2A3L A;  1S72 T;  2KGT A;  5DM7 R;  4NL3 A;  1TWC I;  2DTH A;  4XAX B;  1VQO Q;  4PJO F;  4C0D C;  3AHU A;  3I56 Q;  1G3T A;  5LJ3 d;  3P5J B;  1X27 A;  2FRY A;  4MZP A;  4OF1 A;  1NJI C;  4NH1 C;  5I2M A;  4HVV A;  4M78 E;  2KY9 A;  1U5S A;  3V7C A;  4AYB A;  3E1S A;  5IT9 E;  2M6N A;  1VQK T;  4LN2 A;  1M90 1;  1VQL Z;  2LJ0 A;  1N8R 1;  2YHT A;  3URG A;  1ZA2 B;  4E32 A;  5KYY A;  1XOV A;  1YIT Z;  5CVI A;  5A2Q E;  1Q82 R;  2LQW A;  1ACM B;  3RBB B;  2RA2 A;  4DBF A;  2OTJ Q;  4ZGD B;  3RMQ A;  4MON A;  5AT1 B;  1YI2 1;  1MMG A;  2PVG B;  4ZGJ B;  5L8R E;  3VS4 A;  2AK5 A;  3C4S A;  2HDA A;  3X26 B;  2CH4 W;  1XQH A;  2FRW A;  2R57 A;  2LX7 A;  1X75 C;  1KC8 1;  3CC2 1;  2EQJ A;  3E2U A;  1BI0 A;  1M1G A;  4E2F B;  1Y96 A;  1OI1 A;  2BKD N;  4PJO E;  2DL7 A;  4XX2 A;  2E6N A;  1H92 A;  5D7U A;  1VQ6 Z;  3R6N A;  1WNL A;  2RT9 A;  1G3Y A;  4E7J A;  1V76 A;  5J3B A;  2VUG A;  4M78 C;  3CCR A;  2L3S A;  3H0H A;  3HRS A;  1TWB A;  1G3S A;  1SSF A;  2HBW A;  1YI2 A;  2ZCF B;  3HHT B;  3QDR B;  2GQV A;  4PJM A;  1I4K 1;  2VVK A;  2KQW A;  2QQR A;  5LJ3 g;  4IUQ A;  4DGL A;  1Z03 A;  3OYI A;  1K1Z A;  3RUX A;  4AG1 C;  4M78 F;  2JS0 A;  2GTO A;  1OPK A;  1R9T I;  3DLL A;  3LLR A;  4M75 D;  3MHX A;  1KQS Y;  1ZHI A;  1Y1V S;  5LJ3 j;  6AT1 B;  3M0P A;  2CGH A;  3EFR A;  3BE3 A;  4XTX A;  1N5Z A;  2M16 A;  3JV3 A;  2ECZ A;  2HQX A;  2KBT A;  3S2D I;  3M0S A;  4J8O A;  4RTW A;  4M77 B;  5EG2 A;  1C1A A;  1ZB9 A;  4MML A;  5D1P A;  4XU1 A;  2KRO A;  2A37 A;  2V8J A;  3REB B;  1Q81 R;  4JRQ A;  3S14 I;  1N8R U;  2OTL 1;  5CAI A;  4GY5 A;  2LP5 A;  2IG0 A;  4OMF B;  1WX6 A;  1UFF A;  3C12 A;  2DM1 A;  1J3T A;  2NUT A;  3OBY A;  3CCJ Q;  4PJO C;  2FVU A;  2JA7 I;  5FRM A;  5HCK A;  3G4S Z;  1WHH A;  3JRZ A;  5C4J I;  4BE1 A;  3OYB A;  3K7A I;  4D6W A;  1VQN T;  4M7A G;  3NH8 A;  1RNI A;  3CC4 1;  4CRI A;  4JS4 A;  3QXE B;  3H0G I;  3EGX A;  1YIJ Q;  2PM9 A;  3GTP I;  3RDV A;  1Y1W I;  3L2V A;  1JRI A;  2F5T X;  2FZC B;  3GIB A;  5GAN 2;  2KMT A;  4Y28 E;  4M4Z A;  3CCQ Z;  2WB1 A;  3CCJ 1;  1E7O A;  1KHI A;  1YJ9 1;  2VGM A;  1M8V A;  3TE5 B;  3SWN C;  4PJO D;  2HZY A;  5A0L A;  1N9S A;  1M30 A;  1VQP T;  1OYX A;  4DQ2 A;  3DB4 A;  3CBP A;  2ZGW A;  3CC4 A;  5IP9 I;  2CYZ B;  3MP1 A;  3RES A;  2KXD A;  4ZN1 A;  4MZM A;  3U23 A;  3BDL A;  1OX9 A;  1GRI A;  1VQO A;  2KVQ G;  4V2S A;  2H85 A;  3GTL I;  3O8V A;  4OVA A;  1VUB A;  4A4K A;  5IHI A;  4JZ4 A;  2O53 A;  1ABO A;  1YJN T;  1WZN A;  3A98 A;  3T9N A;  4AFU C;  2CZ6 B;  3SWN A;  3GBQ A;  3QPH A;  4QTU A;  1YJ9 A;  4PLI A;  3HL8 A;  1BI3 A;  3CCS T;  3CCL A;  5C44 I;  2DX1 A;  3QDF A;  1Q95 G;  1NEG A;  3CPW S;  4RMO A;  3MEU A;  3JCM f;  2YU9 I;  4FT4 A;  1Q82 1;  4EMK A;  2E3I A;  4A3B I;  1ZSZ B;  2LCC A;  3CCQ A;  5D6W A;  3D6W A;  1I1J A;  1Q7Y C;  1Y71 A;  1K9M U;  4C8Q A;  5LJ3 h;  2ZPH B;  1PC0 A;  1X01 A;  2GQI A;  4Y52 I;  2HKQ B;  3CPF A;  4Q5W A;  2YUN A;  2E7Z A;  2K5L A;  3CCL 1;  4HH4 A;  1VQP Q;  3JCM d;  4M7D G;  2A28 A;  4JRP A;  3I56 1;  3WXM B;  3JCM c;  3H3V J;  1AA6 A;  4XTZ A;  1W4S A;  1WPY A;  1Z9Q A;  2FEI A;  1YHQ Q;  1YJN Q;  2JMC A;  1HD3 A;  4S1T A;  1W70 A;  5GMK e;  1QVG S;  2P0K A;  1N8R 2;  1T3S A;  3PNW C;  2V1R A;  3JCM b;  3SD4 A;  2KE9 A;  1MHN A;  5FRN A;  3QYH B;  3BW1 A;  4JRI A;  5I11 A;  3OYF A;  3FC3 A;  1YIT A;  2LQK A;  2DVE A;  3EGD B;  1WHJ A;  2CP6 A;  1VIE A;  1KK7 A;  4NBA A;  2MMP A;  1VQK 1;  3F3F C;  5D6X A;  3U50 C;  1K73 R;  1AD5 A;  2DL3 A;  2YDL A;  2MIO A;  5IH2 A;  4IUT A;  4M7D F;  1QVP A;  3DKM A;  2ESW A;  3N5B B;  2YUP A;  1KC8 C;  1YN8 A;  4YTL A;  3GP8 A;  2DK3 A;  2ZPG B;  1GCQ A;  1X43 A;  2LTO A;  4WTO B;  4LDU A;  5GMK j;  3CD6 1;  1SFO I;  1VQ4 Z;  2O2O A;  1QWE A;  2LT1 A;  4NBE A;  1G3W A;  4A53 A;  1QW1 A;  1ZX6 A;  1BU1 A;  3HKS A;  3PT9 A;  4DOW A;  3CMA 1;  3OS5 A;  2CUB A;  2OTL A;  3CCR Z;  3UPU A;  1QVG A;  2RF0 A;  2Z0W A;  3P8H A;  1AEY A;  2VPW A;  2CZ0 B;  2KNB B;  1KG1 A;  2JZ2 A;  4J83 A;  5EC7 A;  1UHC A;  1WLP B;  3G1J A;  1BK2 A;  1Q81 U;  1AZG B;  1Y1V I;  2VF1 A;  1XNI A;  2CZ7 B;  4EDU A;  3OYK A;  5GMK h;  1Q86 C;  1YHQ A;  4BE2 A;  1TU0 B;  4E6R A;  3MEW A;  3OS0 A;  3H41 A;  5CKF A;  3CCV A;  3I4M I;  3IFU A;  2OAU A;  1RO0 A;  4M7A B;  3OB9 A;  2DVJ A;  4FYW B;  2E64 A;  2LIY A;  2EGT A;  1WXU A;  4NBH A;  3UA6 A;  3FQM A;  3EFO A;  1W1F A;  2X51 A;  4KGX B;  2P0Q A;  2K5R A;  3TVT A;  2FPF A;  3CQZ I;  2HMA A;  3OYC A;  1M1K C;  4C8Q B;  3HSB A;  3L2W A;  3G71 1;  3RNJ A;  3RZO I;  5IP7 I;  3VU3 C;  4A4E A;  1V1C A;  1NLO C;  2E65 A;  1AWJ A;  5CIU A;  1VQN Q;  1YWO A;  2JIQ A;  3MEA A;  1RAE B;  2DE5 A;  1QVF A;  4M77 G;  2GU2 A;  2RK1 A;  3FB9 A;  4M75 B;  3JB9 I;  2COW A;  2RQU A;  3FQQ A;  3JSC A;  5GAO n;  1M3B A;  1U1T A;  3EH1 A;  5GAM g;  4BB7 A;  3PO2 I;  1VQM A;  2QA4 Z;  3LX7 A;  4A3K I;  1TH7 A;  3J80 f;  1VQ9 Q;  1M9S A;  2CP0 A;  3WVD B;  3H0F A;  1Y7X A;  1KC8 R;  1NPR A;  3EG9 A;  3VUB A;  2COZ A;  4M75 A;  1ARK A;  2BIV A;  3CCU T;  3IQL A;  3X25 B;  2C0O A;  1NZ9 A;  5GAN j;  3QJ6 A;  2CS7 A;  2JM9 A;  2E1H A;  2KEA A;  1R8O B;  2CP5 A;  3LGL A;  3GTJ I;  2M0Y A;  1X3Z A;  2JT4 A;  3JB9 F;  3FDR A;  3NFZ A;  1CKA A;  1NJI R;  4ELZ C;  1D0Z A;  3CCQ Q;  1FX7 A;  3CC7 Z;  3QWX X;  4EMK C;  2QLV B;  5KYN A;  4F7U G;  1VQ7 Q;  2ZPI B;  4MRI A;  4F7U E;  4XU2 A;  1RI0 A;  5A2Q f;  3MCA B;  2QEX Z;  4LNP A;  3CCV Z;  1OQK A;  3P8B B;  5CKD A;  2FPD A;  1RO2 A;  4A4G A;  3RER A;  3H6Z A;  1I81 A;  4IIO A;  4FSS A;  2CUD A;  1PNJ A;  3G6E T;  1K0S A;  2MPX C;  2PNI A;  1NEB A;  4LXC A;  5CKB A;  3FIF A;  1SEM A;  3CCJ Z;  3OS1 A;  3M9Q A;  4EPC A;  5LJ5 h;  1IRE B;  4FL6 A;  2RJF A;  4OB3 B;  1YJN A;  3OQ5 A;  2CT3 A;  3JCM Q;  3GTK I;  2GFA A;  2VXF A;  1FMK A;  1UEC A;  2PK7 A;  3EED A;  3LGF A;  4F17 A;  2RJC A;  4LE9 A;  4RUG A;  2I0N A;  4LUD A;  1YIT 1;  2PMZ A;  2F2W A;  4A4H A;  3CXC P;  1Q7Y 2;  3KUF A;  1I5L A;  4R56 A;  3CPW Y;  1T0J A;  1VQ4 T;  1M1K 1;  3J81 f;  2CSI A;  3PMT A;  1UHF A;  2QRE B;  1HJD A;  2OTJ 1;  4MDW A;  2LQN A;  4BY6 B;  1VQL Q;  4M77 E;  2MK5 A;  3VJP A;  2W0Z A;  1VQM Z;  2EIF A;  2QGF B;  4QT7 A;  5I2S A;  4ELY C;  1O9S A;  2L0A A;  1WJR A;  2F2V A;  4A3I I;  3X28 B;  5IXB A;  1VQM T;  2MYS A;  2NUZ A;  4AFS C;  3GKQ A;  5IHK A;  2JS4 A;  4J9I A;  5AYF A;  3CC4 T;  4RG2 A;  3L42 A;  4HCB A;  1BCO A;  2LNV A;  4N4H A;  4C5H A;  4BI8 B;  2DBK A;  2JUF A;  1FWZ A;  4A93 I;  1ML8 A;  4NOZ A;  3S3N A;  4F14 A;  3OYH A;  3EG1 A;  4RVD A;  3DLM A;  4C92 D;  2DPP B;  3G4S Q;  2HEQ A;  2KK4 A;  3MKD A;  1AZE A;  1PRM C;  2M9U A;  3PGG A;  2LEX A;  4X6A I;  3G4S 1;  4BY6 C;  1Q82 U;  3HKZ A;  1G2B A;  1BI1 A;  1B34 A;  4GLM A;  1M1K U;  2RBL A;  3LYI A;  3CXC Y;  5GAN h;  1R0B G;  4F7U B;  3CME 1;  2CZ1 B;  3HOW I;  2VV5 A;  1VQ6 1;  2HL5 C;  8AT1 B;  3CCS A;  5GAO q;  2KSS A;  2KYB A;  1O75 A;  1IGU A;  1KRL A;  1MMD A;  1NM7 A;  1RAA B;  4X9D A;  1VQ5 T;  4ME7 A;  3CC2 Z;  1JWH C;  3HFO A;  4QQG A;  1B34 B;  2F2X A;  2Y90 A;  5HKC A;  4C0F A;  3LH0 A;  5GAN g;  3S6W A;  4E2X A;  1M8M A;  1VQ4 A;  1SRL A;  1LNX A;  4N4G A;  5C0M A;  1AT1 B;  3PFS A;  2O31 A;  1I3Q I;  3BG0 B;  1QP3 A;  4HVW A;  2L5Q A;  1MV3 A;  4OMQ A;  1WFW A;  2YWW A;  1GBR A;  4JDS A;  2JNG A;  1JXM A;  4PJO G;  3QZ9 B;  2DXT A;  1UB4 A;  2CP7 A;  4J9C A;  1D3B A;  2J6O A;  4LDX A;  2L89 A;  1ABQ A;  1YI2 T;  1QVF Z;  1TWF I;  4OML A;  4QTT A;  3RIR A;  3MP8 A;  1KFZ A;  2YRC A;  2DD5 A;  2ZPB B;  2E2H I;  3VS6 A;  3GCF A;  1EFN A;  2RN8 A;  2RQR A;  2P84 A;  2EKH A;  5KCH A;  4BE0 A;  2DMO A;  2AYD A;  3UWN A;  1BCM A;  3VS5 A;  4E7Z A;  4GLK A;  1VQK Z;  2K3R A;  1QVG P;  1K9M 2;  2X4Y A;  3MJX A;  3EH2 A;  2C0T A;  2IIM A;  4A3F I;  4IIM A;  3FRN A;  1TTH B;  2JMO A;  4PJN A;  4KUD K;  5A0G A;  4M75 C;  1VQ4 Q;  1RLQ C;  1VA7 A;  2P28 A;  1NJI 2;  4M78 G;  2KYM A;  5D1O A;  4JLG A;  3I4N I;  1Q81 1;  4JJN K;  4OMO A;  4IKF A;  3G71 T;  1D0Y A;  1B7T A;  4CL1 A;  3I55 1;  2XHC A;  3M53 A;  3JCM W;  1ZBX A;  3S15 I;  1VIF A;  3BG1 B;  3QBY A;  5IHN A;  5GAO m;  2DAQ A;  1UJ0 A;  1V29 B;  3G71 Z;  4B9W A;  1YI2 Z;  1GFD A;  2DEQ A;  2WSE E;  4Z88 A;  3CC2 A;  3OMG A;  2MCN A;  4DEX A;  4A3E I;  1USP A;  4QVD A;  2Q51 A;  4RVG A;  1VQP 1;  1N8R C;  1WJQ A;  1UGR B;  3VMG A;  3QJY A;  4LDW A;  2XU8 A;  4Y92 A;  1HYO A;  2DYI A;  2IZ4 A;  1TG0 A;  4M78 D;  2FYK A;  1VQ7 Z;  3CPW P;  1K76 A;  3IF8 A;  4KUI A;  4C8Q F;  3F70 A;  4PKC C;  4VUB A;  4PJL A;  1Y96 B;  2XK0 A;  2JIM A;  1YJN Z;  2XD0 A;  3CCQ 1;  5FLM I;  1JEG A;  3PO3 I;  2JS2 A;  2MAM A;  8ATC B;  1QVF S;  2KRN A;  2PTK A;  1U8R A;  2JXB A;  2LQ8 A;  1WII A;  2JA6 I;  4FSX A;  4RTU A;  2NAP A;  2IZ3 A;  1BB9 A;  4JJD A;  1JB0 E;  1KHC A;  4MD7 A;  2LRQ A;  1KQ1 A;  2QA4 Q;  1VQO T;  1H8K A;  1M1F A;  1M2O A;  1VQP A;  1LPL A;  3R6O A;  4CC4 B;  3JAM E;  4F7U F;  2LX9 A;  3OA6 A;  3CCR Q;  1OZ2 A;  5GAN 7;  1SPK A;  4M75 F;  1Q81 C;  2X35 A;  2KT1 A;  2E5K A;  1YI2 Q;  2A7Y A;  2K3Y A;  1VQ6 Q;  3G6E Z;  2M51 A;  4NBF A;  2NVY I;  4RTZ A;  3E9G A;  1K8A C;  2C06 A;  3M55 A;  1OU8 A;  1QQJ A;  1VQ5 A;  2K2V A;  4E2Z A;  2RPN A;  5GAM f;  1IHW A;  1OPL A;  2XI9 A;  2B8A A;  4CI0 C;  3MET A;  1SRM A;  2GCX A;  1M4Z A;  2YSQ A;  3G4S A;  2DJQ A;  5GAO p;  3CCM T;  1PHT A;  1T3L A;  1NUI A;  4ANJ A;  4BXX I;  1HK9 A;  1PSE A;  2O88 A;  2K7A A;  2A08 A;  5HY6 A;  2GNC A;  3VRY A;  4PJJ A;  4F16 A;  2RJE A;  3D2L A;  2L3P A;  4RKU E;  1I0C A;  2C0I A;  4RG8 A;  2O9V A;  1QYP A;  3OYE A;  3JCM g;  1D0X A;  2DXC A;  2XMF A;  1YHQ Z;  4OB2 B;  2D6F A;  3OSV A;  3HOX I;  1S7M A;  3OW2 Z;  1AVZ C;  1YJW T;  1LJO A;  3MZL B;  2IV2 X;  2I2L A;  1VQ4 1;  4M75 E;  1TWG I;  2NUT B;  4PLL A;  5KYX B;  1KIK A;  4HGZ A;  3CCE A;  2GTI A;  3PIO A;  2ZAE A;  2XG8 D;  2LNH B;  3OYD A;  3CCU Q;  3RZD I;  1IGQ A;  2G3R A;  3ESW A;  4J9D A;  4FU6 A;  4J6X A;  1MMN A;  1K83 I;  4Z02 A;  3S1N I;  4BAC A;  2ZPF B;  2WSC E;  5D1O B;  2K57 A;  1G8X A;  5I22 A;  4OGC A;  1ZSG A;  2BTT A;  2DA9 A;  5GAN f;  4ZNX A;  5LJ5 g;  3J81 b;  4NS5 A;  4C92 G;  3OYN A;  4RTY A;  5GAN 4;  2OTL Z;  4A3J I;  1VQ9 A;  4RCC A;  3ULR B;  2VPY A;  1M2V B;  1OZ3 A;  4E7H A;  2V45 A;  3A1P A;  4XTY A;  5DY9 A;  3NTK A;  1U1S A;  2K3X A;  1RLY A;  5GAN e;  4KH0 B;  2D1X A;  1M5Q 1;  1RUW A;  1ZSZ C;  3QWY A;  5FWC A;  3QHS A;  4ZTF A;  2EWN A;  5KE2 A;  2D8H A;  1TSF A;  2PQW A;  2DZ9 A;  3S1M I;  3LH5 A;  3ZEH A;  5L23 A;  3L2Q A;  4J9B A;  1OOT A;  3NDI A;  1DL6 A;  3CCS Q;  2E2I I;  3A8H B;  1JJ2 Y;  2NVX I;  4C8Q C;  4JUV A;  1QVG Y;  2J6K A;  2L2P A;  3CCE T;  3SFM A;  3TRE A;  2A0F B;  3S2H I;  1VQ5 Z;  5C3E I;  3VYG A;  2JA8 I;  4RV9 A;  2RQV A;  4AFQ C;  3NFC A;  3I56 T;  1OU9 A;  4AMC A;  3G6E A;  1VQ8 1;  1JXO A;  1VQ6 T;  3FJ5 A;  1X6B A;  2V8K A;  3HOU I;  4A63 B;  3OYY A;  1SHF A;  2JR6 A;  1R77 A;  3CXC S;  1YWP A;  4FYY B;  3MPU B;  2W10 A;  1K8A U;  4J9F A;  1YJW A;  3HTR A;  4PK4 A;  1DJ7 B;  3CCU Z;  3HP9 A;  2HQE A;  3V7S A;  4TNU A;  1WQW A;  2ZZD A;  1R0C B;  1WDX A;  1KJW A;  2V1Q A;  2J7I A;  1YJ9 Q;  5LL6 f;  1VQ7 1;  1GCQ C;  1I5O B;  2LJ1 A;  1KD1 1;  2ABL A;  2E2J I;  1TWH I;  2OX7 A;  2W03 A;  2WSF E;  1WCM I;  2AZV A;  2NVT I;  2RI5 A;  1PRL C;  2J05 A;  2QTV A;  4MMK A;  2RIQ A;  2EQM A;  4IUV A;  2FZG B;  3RKW A;  3QSU A;  4RTX A;  3TU4 K;  4XTV A;  4AFZ C;  2QI2 A;  3CD6 T;  1UGP B;  2D0N A;  2VB6 A;  2NWM A;  2JUB A;  3IR7 A;  4FW2 A;  2K4Y A;  4J6W A;  1RAD B;  1OV3 A;  1W2B Y;  1QVF P;  1UUE A;  4JLI A;  5CKH A;  2DE6 A;  1IHV A;  1TUC A;  1VQ7 A;  3E19 A;  5LJ3 f;  3GTQ I;  2BJO A;  2DIQ A;  1WIE A;  3EFS A;  2I3C A;  4A3M I;  1Y0M A;  2YAD A;  3G6E Q;  2DBM A;  4MXU A;  3EHR A;  1YIJ T;  2MWO A;  3JB9 G;  1NJI U;  2KR3 A;  4Z8A A;  1ZUY A;  3NMZ C;  2YT6 A;  1TXQ A;  3UAT A;  2O9S A;  1P92 A;  4PJO A;  1YJW Q;  1RI9 A;  4K11 A;  4E47 A;  1H3Z A;  5C6S A;  3EGD A;  2H8H A;  1VQ5 1;  5M9O A;  4NB9 A;  5GMK m;  3V7R A;  1Z01 A;  1K9M 1;  2R93 I;  3I55 T;  3VRZ A;  2VWF A;  2GTJ A;  5KCO A;  3REA B;  3CCV Q;  1M2V A;  2EJG A;  5HK3 A;  2YRV A;  1K4U S;  1FDO A;  4A4F A;  4J7I A;  2HD0 A;  3OYL A;  2Y4Y A;  4RTV A;  3CMA A;  1Q86 1;  4KGV B;  3A8L B;  4BY1 I;  4J5Y A;  2R6M A;  2M02 A;  3OS2 A;  2JIO A;  1WJ2 A;  1N2F A;  2DYB A;  1XJW B;  2OTJ A;  1JJ2 S;  1RAF B;  2LDM A;  2RHU A;  2AIR B;  1H3H A;  5A0D A;  2D8J A;  1LVK A;  2Q4Z A;  1YIJ Z;  4BDY A;  4NFR A;  3H8Z A;  3NTI A;  5T64 A;  3CCV 1;  2YUQ A;  4XK8 E;  1VYT A;  3IX0 A;  2YLC A;  5DLQ E;  5GJV B;  1YIT T;  3S3M A;  4R0K A;  2G2K A;  2NVQ I;  4EWC A;  1TS9 A;  2D0Q B;  3MP6 A;  4OMP A;  1UGV A;  1IO6 A;  4N4I A;  1X3W A;  2WAQ A;  4MD9 A;  3FEO A;  2K3B A;  4LDY A;  5IT9 f;  2VAS A;  3UDC A;  4IUP A;  1QP2 A;  2GF7 A;  1YBY A;  4J7F A;  3F3P C;  5CM2 M;  2LC4 A;  1OX8 A;  1WXB A;  3RMS A;  5FRO A;  2DER A;  3L2R A;  3VMI A;  4F04 B;  4M75 G;  2JTE A;  1ZUK A;  1KQ2 A;  1GCP A;  1PD1 A;  2Y0S A;  3D7S B;  3M4O I;  1BKB A;  2E4H A;  2CSQ A;  3CCL Z;  2QA4 1;  2RD1 A;  2RM4 A;  2PUO B;  3NDJ A;  3VB9 A;  2VC8 A;  4HCK A;  2RHI A;  2K5F A;  1JQQ A;  1I8F A;  2X4J A;  1KQS Z;  1S1N A;  1I50 I;  2OOX B;  3J7A 4;  2VUB A;  1GFC A;  4EMK B;  5GMK i;  5KYU B;  3KFV A;  4M77 A;  2QDY B;  1NYG A;  3VS2 A;  1OEB A;  4HCC A;  2HSP A;  3C95 A;  4QW2 A;  1VOM A;  2K5I A;  1S72 Z;  4HGY A;  1JU5 C;  2P0P A;  3G6E 1;  1UGQ B;  1VQ8 A;  4OB0 B;  3EHQ A;  1K9A A;  2GGR A;  2PVD B;  4C0D B;  5CO7 A;  2CT4 A;  2AKK A;  3OSS C;  1YCY A;  1IZ6 A;  1D1C A;  1CKB A;  1YJW 1;  3VV0 A;  1ZLM A;  2MI6 A;  1UDL A;  1TFI A;  1VQM Q;  3FLG A;  4XU3 A;  3CXC A;  3S1R I;  5I21 A;  5HK0 A;  2DJZ A;  4FM4 B;  2K79 A;  4PJO B;  1BBZ A;  2V26 A;  1YP5 A;  2VKN A;  1VQ9 T;  2LCS A;  1RO4 A;  3CC2 Q;  1LOJ A;  2SEM A;  1JJ2 Z;  1RLP C;  1WW9 A;  4L59 A;  4M7A D;  3M3Y I;  3GOX A;  2JNY A;  4C8Q E;  1D1A A;  5T67 A;  4XTW A;  4NBC A;  2RQW A;  1KQS A;  3FKI I;  3G7Z A;  3CPW Z;  4M77 C;  2X4W A;  1UE9 A;  1Q7Y R;  4DK1 A;  2DL8 A;  4QKU A;  3Q1J A;  4AG2 C;  1PSF A;  2X4X A;  4WCI A;  1QVF Y;  5GAM d;  1W2B P;  3GTM S;  4C92 F;  4C0G A;  1YHQ T;  3QUI A;  1KD1 U;  4NBB A;  2KPI A;  1MMA A;  3D9X A;  3EG0 A;  1ZA1 B;  5IT9 b;  3A8G B;  1Q86 R;  1TUG B;  2MF2 A;  4M77 D;  5KYY B;  2O4X B;  2J6F A;  4PNO A;  4ATO A;  4TVR A;  1D1B A;  4HT8 A;  3CC7 Q;  1NP6 A;  2A36 A;  3VUZ A;  1Q86 U;  1K9M R;  1RAH B;  4DBR A;  3QO3 A;  4BBS I;  2XID A;  4Y91 A;  4M7A C;  1FDI A;  2B63 I;  1W2B A;  2RO0 A;  3NH5 A;  4A54 A;  2EAY A;  2FHD A;  4PFZ A;  5GAN 8;  3LW5 E;  4LDV A;  3M0Q A;  4NBD A;  3VS0 A;  1N27 A;  4WF2 A;  3GTM I;  2QEX T;  3JCM X;  4N0A A;  2O4X A;  2X9H A;  3FJP A;  3JB9 J;  4EMG A;  2K6D A;  3I56 Z;  3T4N B;  3TQ7 P;  1Z02 A;  2LFU A;  3S16 I;  3CME T;  2GBQ A;  4M7A F;  2JN0 A;  4NB8 A;  4E2Y A;  5D6Y A;  2RNA A;  1VQP Z;  1H64 1;  3BY7 A;  1Z9Z A;  5LJ5 j;  4BUG A;  3J80 E;  4A3C I;  2QQ9 A;  4P5N A;  3CCS Z;  2H3E B;  2G6F X;  2JJ9 A;  3KXT A;  3HRU A;  1L1O C;  3A8O B;  4D8K A;  4C92 E;  1PCX A;  4OMN A;  2EYW A;  2V3V A;  2R5M A;  1VQ8 Z;  3CCR 1;  3CCM Q;  4AT1 B;  1IXD A;  3GTG I;  1TOV A;  4M77 F;  1RAI B;  2W04 A;  3CCE Z;  2DTO A;  4O5V A;  2JMA A;  1KQS S;  4J9G A;  2OI3 A;  4M7D A;  1WZO A;  2DTI A;  3V8K A;  5GAN d;  2AHJ B;  3EFO B;  3CD6 Q;  1K8A R;  3JAM b;  1CSK A;  9ATC B;  3OYM A;  1N8R R;  3JB9 H;  4PFP A;  1FXX A;  1SF9 A;  1KSW A;  4E2W A;  2KRS A;  2EFI A;  2WAC A;  3I5R A;  1M1K 2;  4DA4 A;  2FB7 A;  3PVQ A;  4OMM A;  3CC2 T;  3CME A;  1Q82 2;  3BFM A;  2EKO A;  3EER A;  5AN9 F;  1BIA A;  2PU9 B;  3OYA A;  1VQ6 A;  2V8I A;  4DEY A;  1GXI E;  1HSQ A;  2SRC A;  4ORZ A;  1LCK A;  1X2K A;  2DL5 A;  1WQ7 A;  3C94 A;  5LL6 S;  3QG1 A;  1WHK A;  4LD9 K;  1K73 U;  3C0C A;  2DE7 A;  2QRD B;  3KBG A;  3ZFJ A;  4CC3 A;  1M27 C;  1B3Q A;  2HU9 A;  5T6B A;  3I55 Q;  1K9M C;  2MOX A;  3PIP A;  2OOY B;  3CMA Q;  2XDD A;  1U3O A;  1MND A;  4C5E A;  1M1K R;  4JS5 A;  2E3H A;  3H9N A;  2EGE A;  2VYT A;  4ESR A;  3L2U A;  2LCL A;  2RMO A;  4KH1 B;  4JPB W;  4C5G A;  1VLA A;  3NHN A;  3MEV A;  2MWP A;  2QKD A;  2IPO B;  1ZQ1 A;  3EGX B;  5LJ3 e;  4M7D D;  3TDH B;  3GTO I;  3CCE Q;  3M0T A;  3I07 A;  2LT4 A;  4M78 B;  5GAN 3;  2EJ9 A;  3CCM Z;  1BI2 A;  3MZK B;  4FIB A;  3I35 A;  3PO3 S;  3VTN A;  1SSH A;  4N0A C;  4IUR A;  2RQT A;  3OY9 A;  5FU6 C;  2E9H A;  2CRE A;  2KRM A;  2OZK A;  3CEY A;  1XTD A;  3CCJ A;  1AWW A;  5FW9 A;  2M0O A;  4M78 A;  4JZ3 A;  3A8M B;  3THK A;  2AT1 B;  3I5S A;  2ENM A;  4M7A A;  3QII A;  1NPP A;  4OB1 B;  7AT1 B;  5KYW A;  1M90 C;  3CCQ T;  4MZT A;  1VYU A;  3P8D A;  2R92 I;  3AT1 B;  2HQH A;  1WA7 A;  3JCM P;  2J6A A;  1WHM A;  4J9E A;  3EAE A;  3KIF A;  5IN1 A;  2EW3 A;  5CQY A;  1F1B B;  1NJI 1;  3I55 A;  1AWX A;  1IB8 A;  3M59 A;  4E31 A;  2XDB A;  3OW2 S;  3SWN B;  3M54 A;  1K73 2;  1VQO 1;  2DNU A;  2EYZ A;  3DB3 A;  4HKE A;  1LQL A;  2L3Q A;  5KE3 A;  3EGU A;  4C8Q G;  3HOV I;  4X1V A;  4DOV A;  1FYN A;  5FLX b;  4HCZ A;  4NBG A;  4NL2 A;  3CME Z;  1VQL T;  3GLX A;  1WGS A;  1ZBJ A;  3O5Z A;  5GAN 5;  4M7D B;  2QR1 B;  3RKX A;  2CH4 A;  1WXT A;  1ZSZ A;  4Z89 A;  1QMC A;  3OW2 Y;  2F5K A;  1S72 A;  1USP B;  4KGZ B;  1YUA A;  1T0H A;  3GNG A;  4MH4 A;  4JJC A;  1K73 C;  4RS4 A;  5FU7 B;  4B9X A;  2EPD A;  2QDL A;  4R55 A;  1Y07 A;  5IXF A;  2HL3 A;  3L1A A;  3CCM 1;  2DRM A;  2JM8 A;  4E33 A;  2R7Z I;  5GAN 6;  2BUD A;  2KI7 B;  1WYX A;  2LJ3 A;  3M4Y A;  4JJB A;  3TSW A;  2QAS A;  2HAX A;  2CP3 A;  4M7A E;  3RKY A;  4A3G I;  2RHZ A;  3Q87 A;  3OW2 P;  1K8A 1;  1AHJ B;  1QCF A;  4EIK A; 
#chains in the Genus database with same CATH homology
 1Y0M A;  2YAD A;  4D8D A;  1VQ6 Z;  1H92 A;  4RUG A;  3R6N A;  2DBM A;  2I0N A;  4MXU A;  2RT9 A;  2OTJ Z;  1YIT 1;  3EHR A;  4LUD A;  2PMZ A;  2F2W A;  1S72 1;  2KR3 A;  4Z8A A;  1Q7Y 2;  1ZUY A;  3NMZ C;  2YT6 A;  2VUG A;  3UAT A;  3CPW Y;  2L3S A;  1T0J A;  3H0H A;  1M1K 1;  3J81 f;  2CSI A;  2O9S A;  1UHF A;  2QRE B;  1HJD A;  2OTJ 1;  1RI9 A;  2LQN A;  4BBR I;  4K11 A;  2HBW A;  2K2M A;  3PE0 A;  2H8H A;  1VQ5 1;  2W0Z A;  1VQM Z;  2VVK A;  4QT7 A;  2OAW A;  4DQY B;  4NB9 A;  5A2Q b;  1ZH1 A;  2EVR A;  2L0A A;  4BY7 I;  3J80 b;  4DGL A;  1Z03 A;  2LZ6 B;  2F2V A;  1Z01 A;  4A3I I;  1K9M 1;  2R93 I;  3CC7 1;  1K1Z A;  5IXB A;  3VRZ A;  1I07 A;  2NUZ A;  2GTJ A;  2VWF A;  3REA B;  4AFS C;  4AG1 C;  3GKQ A;  5IHK A;  2JS4 A;  4J9I A;  1K4U S;  2JS0 A;  2GTO A;  1OPK A;  1R9T I;  2CDT A;  2M48 A;  4RTV A;  1Q86 1;  2DBK A;  4BY1 I;  3VS1 A;  2R6M A;  4A93 I;  1ML8 A;  1PFT A;  4NOZ A;  1WI7 A;  1KQS Y;  1UTI A;  4F14 A;  1N2F A;  1Y1V S;  2DYB A;  3EG1 A;  3M0P A;  4RVD A;  2HF1 A;  1SHG A;  1H3H A;  1N5Z A;  2D8J A;  3JV3 A;  2HEQ A;  2ECZ A;  2Q4Z A;  5FLX f;  1VQ9 Z;  2KBT A;  1PRM C;  1YIJ Z;  1AZE A;  3S2D I;  4X6A I;  2FO0 A;  3M0S A;  4RTW A;  3G4S 1;  4NFR A;  1NG2 A;  5T64 A;  2QEX 1;  3HKZ A;  3CCV 1;  3CCE 1;  1G2B A;  1ZB9 A;  1Q7Y 1;  2YUQ A;  5D1P A;  4GLM A;  1VYT A;  3IX0 A;  2KRO A;  2A37 A;  2V8J A;  2RBL A;  3REB B;  5GJV B;  1YIJ 1;  3VS7 A;  4R0K A;  2G2K A;  3CXC Y;  2NVQ I;  4EWC A;  3S14 I;  2OTL 1;  1YCS B;  3CME 1;  2BZ8 A;  2KXC A;  2LP5 A;  4OMP A;  3HOW I;  1UGV A;  1VQ6 1;  1IO6 A;  1WX6 A;  3PVL A;  2ZAE B;  1VYV A;  1X3W A;  1UFF A;  2KYB A;  1U06 A;  2WAQ A;  1KRL A;  4MD9 A;  1NM7 A;  2DM1 A;  1J3T A;  2K3B A;  5IT9 f;  1NLP C;  1K73 1;  3CC2 Z;  1JWH C;  3F3P C;  2JA7 I;  5CM2 M;  1VQ9 1;  2F2X A;  1WXB A;  4MD8 A;  5HCK A;  3G4S Z;  3VMI A;  2DRK A;  4E2X A;  2J06 A;  2JTE A;  1M8M A;  1ZUK A;  5C4J I;  2EGA A;  3K7A I;  1SRL A;  1GCP A;  2Y0S A;  1YUK A;  3NH8 A;  3M4O I;  4A3D I;  1RNI A;  3CC4 1;  2CSQ A;  3CCL Z;  2QA4 1;  4CC2 A;  2K9G A;  3H0G I;  2O31 A;  1I3Q I;  2PM9 A;  3BG0 B;  3NDJ A;  3VB9 A;  3GTP I;  4HCK A;  2QRC B;  1JQQ A;  1Y1W I;  1KQS Z;  1YJ9 Z;  4HVW A;  1S1N A;  1I50 I;  1M3A A;  2OOX B;  3J7A 4;  1GFC A;  2O4H A;  1Y57 A;  4M4Z A;  1MV3 A;  4OMQ A;  3CCQ Z;  3KFV A;  1WFW A;  1E6G A;  1NYG A;  3VS2 A;  1GBR A;  1RQF A;  2WB1 A;  1OEB A;  3CCJ 1;  1E7O A;  1PKS A;  1JXM A;  2HSP A;  1YJ9 1;  3TE5 B;  1S72 Z;  4J9C A;  4HGY A;  2J6O A;  1JU5 C;  4A3L I;  3G6E 1;  1ABQ A;  1QVF Z;  1M30 A;  1UG1 A;  1K9A A;  3EHQ A;  1TWF I;  2DLP A;  4QTT A;  2GGR A;  4OML A;  2ROL A;  1W6X A;  2CT4 A;  3CC4 Z;  2AKK A;  1KFZ A;  1QKW A;  1B07 A;  3LUS A;  2E2H I;  2X3W D;  3GCF A;  3VS6 A;  1EFN A;  2RN8 A;  1CKB A;  5IP9 I;  2RQR A;  2AKL A;  1YJW 1;  2EBP A;  2EKH A;  5C4X I;  1ZLM A;  1UDL A;  5FWB A;  1TFI A;  2DMO A;  2EQI A;  2KXD A;  3U23 A;  1GRI A;  3S1R I;  3VS5 A;  1VQK Z;  2H85 A;  2K3R A;  3GTL I;  2BZX A;  2K79 A;  2RHB A;  1YJW Z;  2HCK A;  1K9M 2;  5IHI A;  1BBZ A;  4JZ4 A;  1W2B Z;  2O53 A;  1ABO A;  1YP5 A;  2VKN A;  2C0T A;  2KT8 A;  2IIM A;  4A3F I;  2ED0 A;  1RO4 A;  3A98 A;  4IIM A;  2LCS A;  3GBQ A;  1QCF A;  4AFU C;  4QTU A;  2X3X D;  1PWT A;  2SEM A;  2JMO A;  1JJ2 Z;  1RLP C;  2BZY A;  3KIH A;  1WW9 A;  5C44 I;  2DX1 A;  3VS3 A;  1VQN 1;  3S17 I;  3M3Y I;  1RLQ C;  2JNY A;  1VA7 A;  2P28 A;  1NEG A;  5T67 A;  1NJI 2;  2KYM A;  2YU9 I;  5D1O A;  4NBC A;  1Q82 1;  1Q81 1;  3I4N I;  2DE0 X;  2RQW A;  4OMO A;  3TSZ A;  3FKI I;  4A3B I;  2EYX A;  3SEM A;  3VMH A;  3CPW Z;  1ZUU A;  4CL1 A;  3I55 1;  4KRT A;  1UE9 A;  1QKX A;  4DK1 A;  2DL8 A;  3D6W A;  3S15 I;  1I1J A;  2GTH A;  3BG1 B;  4AG2 C;  4WCI A;  5IHN A;  1QVF Y;  1UJ0 A;  3GTM S;  3G71 Z;  1E6H A;  1QF8 A;  4NBB A;  2KPI A;  1YI2 Z;  3D9X A;  3EG0 A;  1GFD A;  1P9N A;  3ZL7 C;  5IT9 b;  2GQI A;  3I9Q A;  4Z88 A;  2P3Y A;  2MCN A;  4DEX A;  4Y52 I;  4A3E I;  1USP A;  2J6F A;  3M0R A;  3CMA Z;  2Q51 A;  4RVG A;  3CXC Z;  1NP6 A;  1VQP 1;  2A36 A;  2ED1 A;  4GBQ A;  3VMG A;  2YUN A;  3CCL 1;  2B86 A;  4BBS I;  4Y92 A;  2DIL A;  1A0N B;  4HH4 A;  2B63 I;  2IZ4 A;  1TG0 A;  1ZB8 A;  1VQ7 Z;  2FPE A;  1TUD A;  1K76 A;  3IF8 A;  2A28 A;  3NH5 A;  3H0I A;  3I55 Z;  5ECA A;  2EYY A;  3I56 1;  3M0Q A;  4NBD A;  3H3V J;  3VS0 A;  1YJN Z;  3GTM I;  1Z9Q A;  2FEI A;  3CCQ 1;  5FLM I;  3UA7 A;  3PO3 I;  1JEG A;  2JS2 A;  1AOJ A;  2KRN A;  2PTK A;  2JMC A;  1HD3 A;  4S1T A;  1KD1 2;  2JXB A;  2K6D A;  3I56 Z;  1WII A;  2JA6 I;  1W70 A;  1K0X A;  3T4N B;  4RTU A;  1N8R 2;  1Z02 A;  2LFU A;  1YJN 1;  3S16 I;  2GBQ A;  2IZ3 A;  1GL5 A;  1T3S A;  1BB9 A;  4JJD A;  4NB8 A;  4E2Y A;  2V1R A;  2RNA A;  1QVG Z;  1VQP Z;  1Z9Z A;  4MD7 A;  2KE9 A;  1KC8 2;  4A3C I;  1H8K A;  3CCS Z;  4CC4 B;  2G6F X;  5I11 A;  1AWO A;  1L1O C;  4D8K A;  3HOZ I;  1X2Q A;  4OMN A;  1SPK A;  2EYW A;  1VQ8 Z;  3CCR 1;  2KT1 A;  2E5K A;  4NBA A;  3G6E Z;  1VQK 1;  3F3F C;  2DF6 A;  3U50 C;  2M51 A;  4NBF A;  3GTG I;  2NVY I;  1AD5 A;  1UJY A;  4RTZ A;  4Y7N I;  2DL3 A;  2MIO A;  2YDL A;  5IH2 A;  2W04 A;  3CCE Z;  2JMA A;  1YHQ 1;  2P4R A;  4E2Z A;  2RPN A;  1X69 A;  2ESW A;  4J9G A;  1PKT A;  2OI3 A;  2YUP A;  1M90 2;  1OPL A;  1YN8 A;  1M3C A;  1GCQ A;  3JAM b;  1CSK A;  1X43 A;  2PZ1 A;  1SRM A;  2YSQ A;  2DJQ A;  2AZS A;  3CD6 1;  1SFO I;  1VQ4 Z;  1VQN Z;  1KSW A;  4E2W A;  1PHT A;  1QWE A;  1T3L A;  2O2O A;  1NUI A;  4HVU A;  4NBE A;  4RVF A;  2KRS A;  4BXX I;  1ZX6 A;  2LMJ A;  1BU1 A;  3QWU A;  3EG2 A;  3I5R A;  2O88 A;  1M1K 2;  2K7A A;  1MV0 B;  2A08 A;  3CMA 1;  2GNC A;  3CQT A;  3VRY A;  4F16 A;  2JA5 I;  2CUB A;  3EG3 A;  3CCR Z;  2ROT A;  2DL7 A;  3PVQ A;  2L3P A;  1Q82 2;  1I0C A;  1JO8 A;  2C0I A;  2RF0 A;  3NPF A;  3EER A;  2O9V A;  5AN9 F;  1AEY A;  2KNB B;  1QYP A;  2V8I A;  4RTT A;  4DEY A;  5EC7 A;  1QLY A;  1UHC A;  1NYF A;  1HSQ A;  1WLP B;  2OJ2 A;  2SRC A;  4ORZ A;  1LCK A;  1YHQ Z;  1BK2 A;  1Q81 2;  1X2K A;  1AZG B;  2DL5 A;  1Y1V I;  2VF1 A;  2XMF A;  3HOX I;  4E30 A;  1S7M A;  3OW2 Z;  1AVZ C;  3MZL B;  4E6R A;  5GJW B;  3SHW A;  1VQ4 1;  1TWG I;  3C0C A;  3JAM f;  2DE7 A;  2QRD B;  3H41 A;  1KIK A;  4HGZ A;  3CCU 1;  4CC3 A;  2GTI A;  3I4M I;  3IFU A;  3NGP A;  1M27 C;  1RO0 A;  1B3Q A;  2LNH B;  1K8A 2;  2HU9 A;  5T6B A;  1VQO Z;  3RZD I;  2MOX A;  2OOY B;  3ESW A;  2DVJ A;  4J9D A;  4CC7 A;  1K83 I;  3S1N I;  2LIY A;  2EGT A;  1WXU A;  5D1O B;  3CCS 1;  1U3O A;  4NBH A;  5I22 A;  3UA6 A;  1ZSG A;  1VQM 1;  3FQM A;  2BTT A;  2DA9 A;  1W1F A;  2EGE A;  4ESR A;  2F4M A;  4RVH A;  2RMO A;  4JPB W;  4ZNX A;  2K5R A;  4LUE A;  1VLA A;  3MON A;  1QWF A;  2FPF A;  3NHN A;  3J81 b;  3TVT A;  4RTY A;  3CQZ I;  1VQL 1;  4HXJ A;  2OTL Z;  2QKD A;  4A3J I;  3G71 1;  3RNJ A;  2YUO A;  3RZO I;  3ULR B;  2F4O A;  1TWA I;  5IP7 I;  3TDH B;  3GTO I;  1RLY A;  1V1C A;  1X0T A;  2DL4 A;  1NLO C;  3M0T A;  2D1X A;  3I07 A;  1RUW A;  1AWJ A;  1G83 A;  2JW4 A;  3QWY A;  5FWC A;  1YWO A;  3CCM Z;  4OMM A;  2FG0 A;  3UF4 A;  3MZK B;  2DE5 A;  2D8H A;  2GU2 A;  3CD6 Z;  3S1M I;  2RQU A;  3FQQ A;  3LH5 A;  1GBQ A;  3PO3 S;  3VTN A;  1M3B A;  1SSH A;  3I35 A;  1OOT A;  4J9B A;  5L23 A;  3NDI A;  1MUZ A;  1DL6 A;  2E2I I;  1JJ2 Y;  2NVX I;  3PO2 I;  1QVG Y;  2J6K A;  2L2P A;  4J9H A;  2RQT A;  2QA4 Z;  3HOY I;  2RPR A;  2E9H A;  3NH4 A;  2CRE A;  4A3K I;  2KRM A;  2OZK A;  3S2H I;  1VQ5 Z;  5C3E I;  3J80 f;  3M0U A;  5FW9 A;  1AWW A;  2JA8 I;  4RV9 A;  2RQV A;  4AFQ C;  4JZ3 A;  3THK A;  3I5S A;  3S1Q I;  2ENM A;  1X6G A;  1VQ8 1;  1JXO A;  3H0F A;  3FJ5 A;  1X6B A;  2V8K A;  3HOU I;  4A63 B;  1ARK A;  1VYU A;  1SHF A;  2R92 I;  1YNZ A;  2JR6 A;  1I6H I;  3IQL A;  2EGC A;  1WA7 A;  1Q86 2;  2J6A A;  2VUM I;  1YWP A;  4J9E A;  2C0O A;  3KIF A;  2W10 A;  2KGT A;  2JM9 A;  1TWC I;  2EW3 A;  4J9F A;  2KEA A;  3GTJ I;  3CCU Z;  2M0Y A;  1X3Z A;  1NJI 1;  1AWX A;  2JT4 A;  4E31 A;  1K73 2;  3P5J B;  4TNU A;  1X27 A;  3NFZ A;  2FRY A;  1VQO 1;  1CKA A;  2DNU A;  2EYZ A;  1LQL A;  2L3Q A;  1WDX A;  3EGU A;  4NH1 C;  3CC7 Z;  3QWX X;  1KJW A;  3HOV I;  4X1V A;  2V1Q A;  2J7I A;  1FYN A;  4HVV A;  5FLX b;  5LL6 f;  4NBG A;  1VQ7 1;  3CME Z;  1GCQ C;  1U5S A;  2QLV B;  1ZBJ A;  3O5Z A;  4AYB A;  2LJ1 A;  1KD1 1;  2ABL A;  2E2J I;  1TWH I;  2M6N A;  2QR1 B;  4MRI A;  1WXT A;  2W03 A;  2CH4 A;  4LN2 A;  4Z89 A;  3OW2 Y;  1M90 1;  1WCM I;  5A2Q f;  1VQL Z;  2AZV A;  2NVT I;  1PRL C;  2J05 A;  2LJ0 A;  2QEX Z;  1N8R 1;  3CCV Z;  4LNP A;  2RIQ A;  2FPD A;  4E32 A;  1RO2 A;  1XOV A;  1YIT Z;  1USP B;  4RTX A;  1YUA A;  1T0H A;  4IIO A;  4AFZ C;  4MH4 A;  4FSS A;  4JJC A;  2LQW A;  4RS4 A;  2EPD A;  2CUD A;  2QDL A;  3RBB B;  1PNJ A;  5IXF A;  1K0S A;  4MON A;  1YI2 1;  3CCM 1;  1NEB A;  2D0N A;  2DRM A;  1SEM A;  2NWM A;  3CCJ Z;  2PNI A;  2JUB A;  2JM8 A;  3VS4 A;  4E33 A;  2AK5 A;  2R7Z I;  2HDA A;  2CH4 W;  2KI7 B;  1WYX A;  2FRW A;  2LJ3 A;  1OV3 A;  4JJB A;  2LX7 A;  1W2B Y;  3TSW A;  1UUE A;  1KC8 1;  3CC2 1;  2CT3 A;  4A3G I;  3GTK I;  2DE6 A;  1TUC A;  1FMK A;  3Q87 A;  1UEC A;  2PK7 A;  3GTQ I;  1K8A 1;  3EED A;  2BJO A;  1WIE A;  4F17 A;  4XX2 A;  4LE9 A;  2I3C A;  4A3M I;  4EIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...