1VQLZ

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqlZ00
2OTL1 1NJI1 2QA4Z 1Q811 3CC21 1JJ2Y 1M902 1Q7Y2 1VQ5Z 1YI21 3CCQZ 3CCU1 3CC7Z 3CMEZ 3G4SZ 1YIT1 1KC82 1VQLZ 2QA41 1Q862 3CD6Z 2QEXZ 1VQM1 1VQO1 2OTLZ 3CMAZ 1YIJZ 1Q822 1W2BY 1KD12 3CC71 3CME1 3G4S1 1VQL1 1YI2Z 3CCVZ 3CD61 3CCUZ 3CCEZ 1YITZ 1KQSY 3OW2Y 3I561 3CCR1 1YIJ1 3CMA1 1VQMZ 1M901 1Q7Y1 3CCSZ 1VQOZ 1JJ2Z 1VQ61 1M1K2 3CCV1 1K9M2 3CCE1 1KC81 1Q861 1VQ4Z 3CCS1 3G6EZ 1VQN1 1S721 3I56Z 3CCRZ 1Q821 1K8A2 2OTJ1 1KD11 1YHQZ 1W2BZ 1VQ6Z 1K732 1VQ41 3G6E1 1VQ71 1KQSZ 3OW2Z 1YJNZ 1VQ91 1YHQ1 1QVGY 1VQPZ 1VQNZ 1S72Z 1M1K1 3CXCY 2OTJZ 1K9M1 3CPWY 3CCJZ 1QVFY 1YJWZ 1N8R2 3CCLZ 1YJN1 3I551 1VQP1 1VQ7Z 1YJ9Z 1K8A1 1VQ9Z 1VQ8Z 3G711 3CCJ1 1YJW1 1NJI2 1VQKZ 1Q812 1K731 3CC41 3CCL1 1YJ91 3I55Z 1VQ81 1QVGZ 1VQK1 3CCMZ 3CXCZ 3G71Z 3CPWZ 1VQ51 1QVFZ 3CCQ1 1N8R1 3CC2Z 3CC4Z 3CCM1 2QEX1
chains in the Genus database with same CATH superfamily
2OTL1 1Y1VI 2QKDA 2QA4Z 2RBLA 1WIIA 2RHBA 3M4OI 4BY1I 4E2YA 1VQ5Z 2E2II 1YIT1 2QLVB 1LQLA 2LFUA 3GTQI 1RQFA 1Y1VS 2RT9A 4HGZA 3J81b 1Z01A 2KI7B 2R92I 3CC71 3CME1 2V8KA 1YI2Z 3NDJA 4A3II 3MZKB 2M6NA 1Q7Y1 3CCSZ 1VQOZ 3S1RI 1WJ2A 3CCV1 3GTPI 5IT9f 5A2Qf 2NVQI 3S2HI 1S721 1VLAA 3F3PC 1Q821 1KD11 3S1QI 4A3DI 1YHQZ 4HGYA 1K732 2YU9I 5IP7I 4NH1C 4MD7A 2V8JA 3GTMI 2E2JI 2RIQA 4RVDA 2LIYA 1K9M1 2QRCB 4BBSI 2ZAEB 2LEXA 4E33A 4MXUA 1VQP1 1YJ9Z 4BY7I 3IR7A 4DK1A 3GTMS 1SIWA 2AKLA 1ML8A 3CCL1 3D6WA 2HU9A 2BJOA 3H3VJ 3J81f 2VUGA 1WZNA 3S16I 1VQ81 3G71Z 1VQ51 1X3ZA 4E32A 1N8R1 4X6AI 1TWAI 3VMHA 5AN9F 4E2WA 1I50I 1NJI1 4DQYB 2NVTI 3CC21 1Q7Y2 3H0GI 1ZB9A 2V8IA 3VTNA 4RVGA 1YI21 3FQMA 3I4NI 2JS4A 1VQLZ 3CD6Z 3HOUI 3MZLB 1VQO1 2JR6A 1Q822 3P5JB 1KD12 2K3RA 3G4S1 4CL1A 5CM2M 3IF8A 4TNUA 3CCEZ 3D2LA 2J6AA 1KQSY 3M3YI 3OW2Y 3CMA1 3HKZA 1YIJ1 2GTHA 1VQMZ 2PM9A 1K9M2 4BBRI 3I07A 1Q861 2R6MA 1TFIA 3S1MI 3G6EZ 3I56Z 1TWCI 1VQ6Z 4NFRA 3EERA 1VQ41 2JNYA 1FDIA 4HH4A 2JUBA 3HOYI 2H85A 4E30A 1KQSZ 3OW2Z 1VQNZ 1M1K1 1JWHC 4NBEA 2JIQA 3CPWY 3NFZA 1N8R2 4NBFA 1YJN1 1S7MA 3TE5B 1K8A1 4QTUA 3G711 3CCJ1 1RO4A 4NB8A 1YJW1 1NJI2 3J80b 2Q51A 2JMOA 3J7A4 2OOYB 3S1NI 2O53A 2NVYI 1VQK1 2HF1A 2JIPA 2OOXB 3CPWZ 3PO2I 2IZ3A 3S14I 3CQZI 4A3FI 1L1OC 2G2KA 1NP6A 2R7ZI 3CCM1 2VPYA 1N2FA 4E31A 4MH4A 1Q811 1TWFI 2IV2X 1DL6A 2DE7A 3CCQZ 3CC7Z 3CMEZ 3VMIA 2QA41 1Q862 2QR1B 3HOWI 1VQM1 4E2XA 1WW9A 1X0TA 2YADA 2F4OA 2JA6I 2JA5I 2E2HI 3RZDI 3QWUA 3CCVZ 3LUSA 3CCUZ 1I6HI 1RNIA 3BG1B 3I561 4E2ZA 1QYPA 1M901 4AYBA 3NH8A 3JAMb 1VQ61 1M1K2 3S2DI 1KC81 4S1TA 3GTKI 3GKQA 3GTJI 1ZH1A 3CCS1 3J80f 1K83I 3VB9A 1VQN1 3CCRZ 1K8A2 1R9TI 2JIMA 2W04A 5D1OB 3NH5A 2P28A 3KIFA 3D9XA 2OZKA 4RV9A 4A3MI 4NBAA 3NH4A 1AA6A 1YHQ1 1VQPZ 3CXCY 1Z03A 2OTJZ 2QREB 1WCMI 4A3LI 1QVFY 4A3GI 3TDHB 3BG0B 3S15I 2NAPA 3CCLZ 4MD8A 5D1OA 2M48A 2VPZA 5LL6f 5FLXb 1VQ7Z 2F4MA 1Q16A 1VQ9Z 4MONA 2PMZA 1VQ8Z 1RO0A 2W03A 1FDOA 1Q812 2JA7I 3IX0A 1YJ91 1KRLA 4MD9A 2VPWA 2I3CA 5C3EI 3I55Z 3RZOI 4Y7NI 3CXCZ 4NB9A 1ZB8A 4RS4A 1YUAA 3CCQ1 1QVFZ 3CC2Z 3CC4Z 5FLMI 1Z02A 3JAMf 2JA8I 1NUIA 2K5RA 5C4JI 4EWCA 3GTOI 1JJ2Y 1M902 1RO2A 3U50C 2V45A 1P9NA 2QRDB 3CCU1 1TWGI 3G4SZ 1KC82 1Y1WI 2QEXZ 3MONA 2OTLZ 3CMAZ 3F3FC 1YIJZ 1TWHI 1W2BY 3I4MI 5T67A 2E9HA 1VQL1 1USPB 3PO3I 2E7ZA 3CD61 2VF1A 2O4HA 1YITZ 4BXXI 3CCR1 3GTLI 3NDIA 3ESWA 4Y52I 2VPXA 3K7AI 1RLYA 1JJ2Z 1Y8CA 2B63I 2WAQA 3HOVI 2P3YA 4DGLA 5FLXf 2IZ4A 3PO3S 3CCE1 2Q4ZA 2JIOA 3HOZI 3FQQA 3T4NB 1VQ4Z 4RVHA 1USPA 4XX2A 5IP9I 2JIRA 2WB1A 2OTJ1 2GTIA 1W2BZ 4RVFA 4NBBA 4A3EI 2KPIA 3HOXI 4A3BI 1SFOI 2PK7A 3G6E1 1VQ71 5D1PA 1YJNZ 1VQ91 1QVGY 1S72Z 3S17I 3IFUA 4A93I 2RPRA 4MRIA 3EEDA 3CCJZ 1YJWZ 1I3QI 3Q87A 4NBHA 4A3JI 4A3CI 4QTTA 3I551 2DE5A 2AYDA 1X3WA 4NBGA 2EGTA 5IT9b 1YUKA 2VUMI 2DE6A 1PFTA 5C44I 5A2Qb 1VQKZ 3GTGI 1K731 3CC41 2R93I 4NOZA 3FKII 3GCFA 1QVGZ 4NBCA 3CCMZ 2NVXI 5T64A 3KIHA 5C4XI 1QF8A 5T6BA 4NBDA 1QXFA 3VMGA 2GU2A 2V3VA 4A3KI 2QEX1 2Y0SA
chains in the Genus database with same CATH topology
2OTL1 1Y1VI 2QKDA 2QA4Z 2RBLA 1WIIA 2RHBA 3M4OI 4BY1I 4E2YA 1VQ5Z 2E2II 1YIT1 2QLVB 1LQLA 2LFUA 3GTQI 1RQFA 1Y1VS 2RT9A 4HGZA 3J81b 1Z01A 2KI7B 2R92I 3CC71 3CME1 2V8KA 1YI2Z 3NDJA 4A3II 3MZKB 2M6NA 1Q7Y1 3CCSZ 1VQOZ 3S1RI 3CCV1 3GTPI 5IT9f 5A2Qf 2NVQI 3S2HI 1S721 1VLAA 3F3PC 1Q821 1KD11 3S1QI 4A3DI 1YHQZ 4HGYA 1K732 2YU9I 5IP7I 4NH1C 4MD7A 2V8JA 3GTMI 2E2JI 2RIQA 4RVDA 2LIYA 1K9M1 2QRCB 4BBSI 2ZAEB 4E33A 4MXUA 1VQP1 1YJ9Z 4BY7I 4DK1A 3GTMS 2AKLA 1ML8A 3CCL1 3D6WA 2HU9A 2BJOA 3H3VJ 3J81f 2VUGA 3S16I 1VQ81 3G71Z 1VQ51 1X3ZA 4E32A 1N8R1 4X6AI 1TWAI 3VMHA 5AN9F 4E2WA 1I50I 1NJI1 4DQYB 2NVTI 3CC21 1Q7Y2 3H0GI 1ZB9A 2V8IA 3VTNA 4RVGA 1YI21 3FQMA 3I4NI 2JS4A 1VQLZ 3CD6Z 3HOUI 3MZLB 1VQO1 2JR6A 1Q822 3P5JB 1KD12 2K3RA 3G4S1 4CL1A 5CM2M 3IF8A 4TNUA 3CCEZ 2J6AA 1KQSY 3M3YI 3OW2Y 3CMA1 3HKZA 1YIJ1 2GTHA 1VQMZ 2PM9A 1K9M2 4BBRI 3I07A 1Q861 2R6MA 1TFIA 3S1MI 3G6EZ 3I56Z 1TWCI 1VQ6Z 4NFRA 3EERA 1VQ41 2JNYA 4HH4A 3HOYI 2JUBA 2H85A 4E30A 1KQSZ 3OW2Z 1VQNZ 1M1K1 1JWHC 4NBEA 3CPWY 3NFZA 1N8R2 4NBFA 1YJN1 1S7MA 3TE5B 1K8A1 4QTUA 3G711 3CCJ1 1RO4A 4NB8A 1YJW1 1NJI2 3J80b 2Q51A 2JMOA 3J7A4 2OOYB 3S1NI 2O53A 2NVYI 1VQK1 2HF1A 2OOXB 3CPWZ 3PO2I 2IZ3A 3S14I 3CQZI 4A3FI 1L1OC 2G2KA 1NP6A 2R7ZI 3CCM1 1N2FA 4E31A 4MH4A 1Q811 1TWFI 1DL6A 2DE7A 3CCQZ 3CC7Z 3CMEZ 3VMIA 2QA41 1Q862 2QR1B 3HOWI 1VQM1 4E2XA 1WW9A 1X0TA 2YADA 2F4OA 2JA6I 2JA5I 2E2HI 3RZDI 3QWUA 3CCVZ 3LUSA 3CCUZ 1I6HI 1RNIA 3BG1B 3I561 4E2ZA 1QYPA 1M901 4AYBA 3NH8A 3JAMb 1VQ61 1M1K2 3S2DI 1KC81 4S1TA 3GTKI 3GKQA 3GTJI 1ZH1A 3CCS1 3J80f 1K83I 3VB9A 1VQN1 3CCRZ 1K8A2 1R9TI 2W04A 5D1OB 3NH5A 2P28A 3KIFA 3D9XA 2OZKA 4RV9A 4A3MI 4NBAA 3NH4A 1YHQ1 1VQPZ 3CXCY 1Z03A 2OTJZ 2QREB 1WCMI 4A3LI 1QVFY 4A3GI 3TDHB 3BG0B 3S15I 3CCLZ 4MD8A 5D1OA 2M48A 5LL6f 5FLXb 1VQ7Z 2F4MA 1VQ9Z 4MONA 1VQ8Z 2PMZA 1RO0A 2W03A 1Q812 2JA7I 3IX0A 1YJ91 1KRLA 4MD9A 2I3CA 5C3EI 3I55Z 3RZOI 4Y7NI 3CXCZ 4NB9A 1ZB8A 4RS4A 1YUAA 3CCQ1 1QVFZ 3CC2Z 3CC4Z 5FLMI 1Z02A 3JAMf 2JA8I 1NUIA 2K5RA 5C4JI 4EWCA 3GTOI 1JJ2Y 1M902 1RO2A 3U50C 1P9NA 2QRDB 3CCU1 1TWGI 3G4SZ 1KC82 1Y1WI 2QEXZ 3MONA 2OTLZ 3CMAZ 3F3FC 1YIJZ 1TWHI 1W2BY 3I4MI 5T67A 2E9HA 1VQL1 1USPB 3PO3I 3CD61 2VF1A 2O4HA 1YITZ 4BXXI 3CCR1 3GTLI 3NDIA 3ESWA 4Y52I 3K7AI 1RLYA 1JJ2Z 2B63I 2WAQA 3HOVI 2P3YA 4DGLA 5FLXf 2IZ4A 3PO3S 3CCE1 2Q4ZA 3HOZI 3FQQA 3T4NB 1VQ4Z 4RVHA 1USPA 4XX2A 5IP9I 2WB1A 2OTJ1 2GTIA 1W2BZ 4RVFA 4NBBA 4A3EI 2KPIA 3HOXI 4A3BI 1SFOI 2PK7A 3G6E1 1VQ71 5D1PA 1YJNZ 1VQ91 1QVGY 1S72Z 3S17I 3IFUA 4A93I 2RPRA 4MRIA 3EEDA 3CCJZ 1YJWZ 1I3QI 4A3JI 3Q87A 4NBHA 4A3CI 4QTTA 3I551 2DE5A 1X3WA 4NBGA 2EGTA 5IT9b 1YUKA 2VUMI 2DE6A 1PFTA 5C44I 5A2Qb 1VQKZ 3GTGI 1K731 3CC41 2R93I 4NOZA 3FKII 3GCFA 1QVGZ 4NBCA 3CCMZ 2NVXI 5T64A 3KIHA 5C4XI 1QF8A 5T6BA 4NBDA 3VMGA 2GU2A 4A3KI 2QEX1 2Y0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTL 1;  1NJI 1;  2QA4 Z;  1Q81 1;  3CC2 1;  1JJ2 Y;  1M90 2;  1Q7Y 2;  1VQ5 Z;  1YI2 1;  3CCQ Z;  3CCU 1;  3CC7 Z;  3CME Z;  3G4S Z;  1YIT 1;  1KC8 2;  1VQL Z;  2QA4 1;  1Q86 2;  3CD6 Z;  2QEX Z;  1VQM 1;  1VQO 1;  2OTL Z;  3CMA Z;  1YIJ Z;  1Q82 2;  1W2B Y;  1KD1 2;  3CC7 1;  3CME 1;  3G4S 1;  1VQL 1;  1YI2 Z;  3CCV Z;  3CD6 1;  3CCU Z;  3CCE Z;  1YIT Z;  1KQS Y;  3OW2 Y;  3I56 1;  3CCR 1;  1YIJ 1;  3CMA 1;  1VQM Z;  1M90 1;  1Q7Y 1;  3CCS Z;  1VQO Z;  1JJ2 Z;  1VQ6 1;  1M1K 2;  3CCV 1;  1K9M 2;  3CCE 1;  1KC8 1;  1Q86 1;  1VQ4 Z;  3CCS 1;  3G6E Z;  1VQN 1;  1S72 1;  3I56 Z;  3CCR Z;  1Q82 1;  1K8A 2;  2OTJ 1;  1KD1 1;  1YHQ Z;  1W2B Z;  1VQ6 Z;  1K73 2;  1VQ4 1;  3G6E 1;  1VQ7 1;  1KQS Z;  3OW2 Z;  1YJN Z;  1VQ9 1;  1YHQ 1;  1QVG Y;  1VQP Z;  1VQN Z;  1S72 Z;  1M1K 1;  3CXC Y;  2OTJ Z;  1K9M 1;  3CPW Y;  3CCJ Z;  1QVF Y;  1YJW Z;  1N8R 2;  3CCL Z;  1YJN 1;  3I55 1;  1VQP 1;  1VQ7 Z;  1YJ9 Z;  1K8A 1;  1VQ9 Z;  1VQ8 Z;  3G71 1;  3CCJ 1;  1YJW 1;  1NJI 2;  1VQK Z;  1Q81 2;  1K73 1;  3CC4 1;  3CCL 1;  1YJ9 1;  3I55 Z;  1VQ8 1;  1QVG Z;  1VQK 1;  3CCM Z;  3CXC Z;  3G71 Z;  3CPW Z;  1VQ5 1;  1QVF Z;  3CCQ 1;  1N8R 1;  3CC2 Z;  3CC4 Z;  3CCM 1;  2QEX 1; 
#chains in the Genus database with same CATH topology
 2OTL 1;  1Y1V I;  2QKD A;  2QA4 Z;  2RBL A;  1WII A;  2RHB A;  3M4O I;  4BY1 I;  4E2Y A;  1VQ5 Z;  2E2I I;  1YIT 1;  2QLV B;  1LQL A;  2LFU A;  3GTQ I;  1RQF A;  1Y1V S;  2RT9 A;  4HGZ A;  3J81 b;  1Z01 A;  2KI7 B;  2R92 I;  3CC7 1;  3CME 1;  2V8K A;  1YI2 Z;  3NDJ A;  4A3I I;  3MZK B;  2M6N A;  1Q7Y 1;  3CCS Z;  1VQO Z;  3S1R I;  1WJ2 A;  3CCV 1;  3GTP I;  5IT9 f;  5A2Q f;  2NVQ I;  3S2H I;  1S72 1;  1VLA A;  3F3P C;  1Q82 1;  1KD1 1;  3S1Q I;  4A3D I;  1YHQ Z;  4HGY A;  1K73 2;  2YU9 I;  5IP7 I;  4NH1 C;  4MD7 A;  2V8J A;  3GTM I;  2E2J I;  2RIQ A;  4RVD A;  2LIY A;  1K9M 1;  2QRC B;  4BBS I;  2ZAE B;  2LEX A;  4E33 A;  4MXU A;  1VQP 1;  1YJ9 Z;  4BY7 I;  3IR7 A;  4DK1 A;  3GTM S;  1SIW A;  2AKL A;  1ML8 A;  3CCL 1;  3D6W A;  2HU9 A;  2BJO A;  3H3V J;  3J81 f;  2VUG A;  1WZN A;  3S16 I;  1VQ8 1;  3G71 Z;  1VQ5 1;  1X3Z A;  4E32 A;  1N8R 1;  4X6A I;  1TWA I;  3VMH A;  5AN9 F;  4E2W A;  1I50 I;  1NJI 1;  4DQY B;  2NVT I;  3CC2 1;  1Q7Y 2;  3H0G I;  1ZB9 A;  2V8I A;  3VTN A;  4RVG A;  1YI2 1;  3FQM A;  3I4N I;  2JS4 A;  1VQL Z;  3CD6 Z;  3HOU I;  3MZL B;  1VQO 1;  2JR6 A;  1Q82 2;  3P5J B;  1KD1 2;  2K3R A;  3G4S 1;  4CL1 A;  5CM2 M;  3IF8 A;  4TNU A;  3CCE Z;  3D2L A;  2J6A A;  1KQS Y;  3M3Y I;  3OW2 Y;  3CMA 1;  3HKZ A;  1YIJ 1;  2GTH A;  1VQM Z;  2PM9 A;  1K9M 2;  4BBR I;  3I07 A;  1Q86 1;  2R6M A;  1TFI A;  3S1M I;  3G6E Z;  3I56 Z;  1TWC I;  1VQ6 Z;  4NFR A;  3EER A;  1VQ4 1;  2JNY A;  1FDI A;  4HH4 A;  2JUB A;  3HOY I;  2H85 A;  4E30 A;  1KQS Z;  3OW2 Z;  1VQN Z;  1M1K 1;  1JWH C;  4NBE A;  2JIQ A;  3CPW Y;  3NFZ A;  1N8R 2;  4NBF A;  1YJN 1;  1S7M A;  3TE5 B;  1K8A 1;  4QTU A;  3G71 1;  3CCJ 1;  1RO4 A;  4NB8 A;  1YJW 1;  1NJI 2;  3J80 b;  2Q51 A;  2JMO A;  3J7A 4;  2OOY B;  3S1N I;  2O53 A;  2NVY I;  1VQK 1;  2HF1 A;  2JIP A;  2OOX B;  3CPW Z;  3PO2 I;  2IZ3 A;  3S14 I;  3CQZ I;  4A3F I;  1L1O C;  2G2K A;  1NP6 A;  2R7Z I;  3CCM 1;  2VPY A;  1N2F A;  4E31 A;  4MH4 A;  1Q81 1;  1TWF I;  2IV2 X;  1DL6 A;  2DE7 A;  3CCQ Z;  3CC7 Z;  3CME Z;  3VMI A;  2QA4 1;  1Q86 2;  2QR1 B;  3HOW I;  1VQM 1;  4E2X A;  1WW9 A;  1X0T A;  2YAD A;  2F4O A;  2JA6 I;  2JA5 I;  2E2H I;  3RZD I;  3QWU A;  3CCV Z;  3LUS A;  3CCU Z;  1I6H I;  1RNI A;  3BG1 B;  3I56 1;  4E2Z A;  1QYP A;  1M90 1;  4AYB A;  3NH8 A;  3JAM b;  1VQ6 1;  1M1K 2;  3S2D I;  1KC8 1;  4S1T A;  3GTK I;  3GKQ A;  3GTJ I;  1ZH1 A;  3CCS 1;  3J80 f;  1K83 I;  3VB9 A;  1VQN 1;  3CCR Z;  1K8A 2;  1R9T I;  2JIM A;  2W04 A;  5D1O B;  3NH5 A;  2P28 A;  3KIF A;  3D9X A;  2OZK A;  4RV9 A;  4A3M I;  4NBA A;  3NH4 A;  1AA6 A;  1YHQ 1;  1VQP Z;  3CXC Y;  1Z03 A;  2OTJ Z;  2QRE B;  1WCM I;  4A3L I;  1QVF Y;  4A3G I;  3TDH B;  3BG0 B;  3S15 I;  2NAP A;  3CCL Z;  4MD8 A;  5D1O A;  2M48 A;  2VPZ A;  5LL6 f;  5FLX b;  1VQ7 Z;  2F4M A;  1Q16 A;  1VQ9 Z;  4MON A;  2PMZ A;  1VQ8 Z;  1RO0 A;  2W03 A;  1FDO A;  1Q81 2;  2JA7 I;  3IX0 A;  1YJ9 1;  1KRL A;  4MD9 A;  2VPW A;  2I3C A;  5C3E I;  3I55 Z;  3RZO I;  4Y7N I;  3CXC Z;  4NB9 A;  1ZB8 A;  4RS4 A;  1YUA A;  3CCQ 1;  1QVF Z;  3CC2 Z;  3CC4 Z;  5FLM I;  1Z02 A;  3JAM f;  2JA8 I;  1NUI A;  2K5R A;  5C4J I;  4EWC A;  3GTO I;  1JJ2 Y;  1M90 2;  1RO2 A;  3U50 C;  2V45 A;  1P9N A;  2QRD B;  3CCU 1;  1TWG I;  3G4S Z;  1KC8 2;  1Y1W I;  2QEX Z;  3MON A;  2OTL Z;  3CMA Z;  3F3F C;  1YIJ Z;  1TWH I;  1W2B Y;  3I4M I;  5T67 A;  2E9H A;  1VQL 1;  1USP B;  3PO3 I;  2E7Z A;  3CD6 1;  2VF1 A;  2O4H A;  1YIT Z;  4BXX I;  3CCR 1;  3GTL I;  3NDI A;  3ESW A;  4Y52 I;  2VPX A;  3K7A I;  1RLY A;  1JJ2 Z;  1Y8C A;  2B63 I;  2WAQ A;  3HOV I;  2P3Y A;  4DGL A;  5FLX f;  2IZ4 A;  3PO3 S;  3CCE 1;  2Q4Z A;  2JIO A;  3HOZ I;  3FQQ A;  3T4N B;  1VQ4 Z;  4RVH A;  1USP A;  4XX2 A;  5IP9 I;  2JIR A;  2WB1 A;  2OTJ 1;  2GTI A;  1W2B Z;  4RVF A;  4NBB A;  4A3E I;  2KPI A;  3HOX I;  4A3B I;  1SFO I;  2PK7 A;  3G6E 1;  1VQ7 1;  5D1P A;  1YJN Z;  1VQ9 1;  1QVG Y;  1S72 Z;  3S17 I;  3IFU A;  4A93 I;  2RPR A;  4MRI A;  3EED A;  3CCJ Z;  1YJW Z;  1I3Q I;  3Q87 A;  4NBH A;  4A3J I;  4A3C I;  4QTT A;  3I55 1;  2DE5 A;  2AYD A;  1X3W A;  4NBG A;  2EGT A;  5IT9 b;  1YUK A;  2VUM I;  2DE6 A;  1PFT A;  5C44 I;  5A2Q b;  1VQK Z;  3GTG I;  1K73 1;  3CC4 1;  2R93 I;  4NOZ A;  3FKI I;  3GCF A;  1QVG Z;  4NBC A;  3CCM Z;  2NVX I;  5T64 A;  3KIH A;  5C4X I;  1QF8 A;  5T6B A;  4NBD A;  1QXF A;  3VMG A;  2GU2 A;  2V3V A;  4A3K I;  2QEX 1;  2Y0S A; 
#chains in the Genus database with same CATH homology
 2OTL 1;  1Y1V I;  2QKD A;  2QA4 Z;  2RBL A;  1WII A;  2RHB A;  3M4O I;  4BY1 I;  4E2Y A;  1VQ5 Z;  2E2I I;  1YIT 1;  2QLV B;  1LQL A;  2LFU A;  3GTQ I;  1RQF A;  1Y1V S;  2RT9 A;  4HGZ A;  3J81 b;  1Z01 A;  2KI7 B;  2R92 I;  3CC7 1;  3CME 1;  2V8K A;  1YI2 Z;  3NDJ A;  4A3I I;  3MZK B;  2M6N A;  1Q7Y 1;  3CCS Z;  1VQO Z;  3S1R I;  3CCV 1;  3GTP I;  5IT9 f;  5A2Q f;  2NVQ I;  3S2H I;  1S72 1;  1VLA A;  3F3P C;  1Q82 1;  1KD1 1;  3S1Q I;  4A3D I;  1YHQ Z;  4HGY A;  1K73 2;  2YU9 I;  5IP7 I;  4NH1 C;  4MD7 A;  2V8J A;  3GTM I;  2E2J I;  2RIQ A;  4RVD A;  2LIY A;  1K9M 1;  2QRC B;  4BBS I;  2ZAE B;  4E33 A;  4MXU A;  1VQP 1;  1YJ9 Z;  4BY7 I;  4DK1 A;  3GTM S;  2AKL A;  1ML8 A;  3CCL 1;  3D6W A;  2HU9 A;  2BJO A;  3H3V J;  3J81 f;  2VUG A;  3S16 I;  1VQ8 1;  3G71 Z;  1VQ5 1;  1X3Z A;  4E32 A;  1N8R 1;  4X6A I;  1TWA I;  3VMH A;  5AN9 F;  4E2W A;  1I50 I;  1NJI 1;  4DQY B;  2NVT I;  3CC2 1;  1Q7Y 2;  3H0G I;  1ZB9 A;  2V8I A;  3VTN A;  4RVG A;  1YI2 1;  3FQM A;  3I4N I;  2JS4 A;  1VQL Z;  3CD6 Z;  3HOU I;  3MZL B;  1VQO 1;  2JR6 A;  1Q82 2;  3P5J B;  1KD1 2;  2K3R A;  3G4S 1;  4CL1 A;  5CM2 M;  3IF8 A;  4TNU A;  3CCE Z;  2J6A A;  1KQS Y;  3M3Y I;  3OW2 Y;  3CMA 1;  3HKZ A;  1YIJ 1;  2GTH A;  1VQM Z;  2PM9 A;  1K9M 2;  4BBR I;  3I07 A;  1Q86 1;  2R6M A;  1TFI A;  3S1M I;  3G6E Z;  3I56 Z;  1TWC I;  1VQ6 Z;  4NFR A;  3EER A;  1VQ4 1;  2JNY A;  4HH4 A;  3HOY I;  2JUB A;  2H85 A;  4E30 A;  1KQS Z;  3OW2 Z;  1VQN Z;  1M1K 1;  1JWH C;  4NBE A;  3CPW Y;  3NFZ A;  1N8R 2;  4NBF A;  1YJN 1;  1S7M A;  3TE5 B;  1K8A 1;  4QTU A;  3G71 1;  3CCJ 1;  1RO4 A;  4NB8 A;  1YJW 1;  1NJI 2;  3J80 b;  2Q51 A;  2JMO A;  3J7A 4;  2OOY B;  3S1N I;  2O53 A;  2NVY I;  1VQK 1;  2HF1 A;  2OOX B;  3CPW Z;  3PO2 I;  2IZ3 A;  3S14 I;  3CQZ I;  4A3F I;  1L1O C;  2G2K A;  1NP6 A;  2R7Z I;  3CCM 1;  1N2F A;  4E31 A;  4MH4 A;  1Q81 1;  1TWF I;  1DL6 A;  2DE7 A;  3CCQ Z;  3CC7 Z;  3CME Z;  3VMI A;  2QA4 1;  1Q86 2;  2QR1 B;  3HOW I;  1VQM 1;  4E2X A;  1WW9 A;  1X0T A;  2YAD A;  2F4O A;  2JA6 I;  2JA5 I;  2E2H I;  3RZD I;  3QWU A;  3CCV Z;  3LUS A;  3CCU Z;  1I6H I;  1RNI A;  3BG1 B;  3I56 1;  4E2Z A;  1QYP A;  1M90 1;  4AYB A;  3NH8 A;  3JAM b;  1VQ6 1;  1M1K 2;  3S2D I;  1KC8 1;  4S1T A;  3GTK I;  3GKQ A;  3GTJ I;  1ZH1 A;  3CCS 1;  3J80 f;  1K83 I;  3VB9 A;  1VQN 1;  3CCR Z;  1K8A 2;  1R9T I;  2W04 A;  5D1O B;  3NH5 A;  2P28 A;  3KIF A;  3D9X A;  2OZK A;  4RV9 A;  4A3M I;  4NBA A;  3NH4 A;  1YHQ 1;  1VQP Z;  3CXC Y;  1Z03 A;  2OTJ Z;  2QRE B;  1WCM I;  4A3L I;  1QVF Y;  4A3G I;  3TDH B;  3BG0 B;  3S15 I;  3CCL Z;  4MD8 A;  5D1O A;  2M48 A;  5LL6 f;  5FLX b;  1VQ7 Z;  2F4M A;  1VQ9 Z;  4MON A;  1VQ8 Z;  2PMZ A;  1RO0 A;  2W03 A;  1Q81 2;  2JA7 I;  3IX0 A;  1YJ9 1;  1KRL A;  4MD9 A;  2I3C A;  5C3E I;  3I55 Z;  3RZO I;  4Y7N I;  3CXC Z;  4NB9 A;  1ZB8 A;  4RS4 A;  1YUA A;  3CCQ 1;  1QVF Z;  3CC2 Z;  3CC4 Z;  5FLM I;  1Z02 A;  3JAM f;  2JA8 I;  1NUI A;  2K5R A;  5C4J I;  4EWC A;  3GTO I;  1JJ2 Y;  1M90 2;  1RO2 A;  3U50 C;  1P9N A;  2QRD B;  3CCU 1;  1TWG I;  3G4S Z;  1KC8 2;  1Y1W I;  2QEX Z;  3MON A;  2OTL Z;  3CMA Z;  3F3F C;  1YIJ Z;  1TWH I;  1W2B Y;  3I4M I;  5T67 A;  2E9H A;  1VQL 1;  1USP B;  3PO3 I;  3CD6 1;  2VF1 A;  2O4H A;  1YIT Z;  4BXX I;  3CCR 1;  3GTL I;  3NDI A;  3ESW A;  4Y52 I;  3K7A I;  1RLY A;  1JJ2 Z;  2B63 I;  2WAQ A;  3HOV I;  2P3Y A;  4DGL A;  5FLX f;  2IZ4 A;  3PO3 S;  3CCE 1;  2Q4Z A;  3HOZ I;  3FQQ A;  3T4N B;  1VQ4 Z;  4RVH A;  1USP A;  4XX2 A;  5IP9 I;  2WB1 A;  2OTJ 1;  2GTI A;  1W2B Z;  4RVF A;  4NBB A;  4A3E I;  2KPI A;  3HOX I;  4A3B I;  1SFO I;  2PK7 A;  3G6E 1;  1VQ7 1;  5D1P A;  1YJN Z;  1VQ9 1;  1QVG Y;  1S72 Z;  3S17 I;  3IFU A;  4A93 I;  2RPR A;  4MRI A;  3EED A;  3CCJ Z;  1YJW Z;  1I3Q I;  4A3J I;  3Q87 A;  4NBH A;  4A3C I;  4QTT A;  3I55 1;  2DE5 A;  1X3W A;  4NBG A;  2EGT A;  5IT9 b;  1YUK A;  2VUM I;  2DE6 A;  1PFT A;  5C44 I;  5A2Q b;  1VQK Z;  3GTG I;  1K73 1;  3CC4 1;  2R93 I;  4NOZ A;  3FKI I;  3GCF A;  1QVG Z;  4NBC A;  3CCM Z;  2NVX I;  5T64 A;  3KIH A;  5C4X I;  1QF8 A;  5T6B A;  4NBD A;  3VMG A;  2GU2 A;  4A3K I;  2QEX 1;  2Y0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...