1VQLZ

The structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqlZ00
1N8R1 1YHQ1 1M1K2 3G6E1 1K9M1 2OTLZ 1VQ4Z 3CC41 3CCVZ 1VQ51 1VQP1 1YJN1 1VQOZ 3CCQ1 3I561 1YJ9Z 1YITZ 3CMEZ 1VQ8Z 3I551 3G4S1 1YJWZ 3G71Z 3CXCZ 2OTL1 1VQ61 1VQ41 1M901 3CCLZ 3CPWY 1KD11 3CCU1 1YI2Z 1Q7Y1 1VQM1 3CCJ1 3CC7Z 1VQ81 2OTJZ 1K8A2 3CC2Z 1Q862 3G711 1VQK1 2QA41 3CCM1 1QVFZ 3CCR1 1QVGZ 1S72Z 1Q821 1NJI1 3CMAZ 1W2BZ 3OW2Z 3CCSZ 1M1K1 1KC82 1K8A1 1QVFY 1Q812 3CCV1 1VQLZ 1VQ7Z 1YIJZ 1K732 1VQNZ 1VQO1 3CXCY 1YJ91 1YIT1 3CME1 1VQ9Z 3CD6Z 1YJW1 1YHQZ 3CCEZ 1KQSZ 3G6EZ 1K731 1K9M2 3CCL1 3CC4Z 1YI21 1VQ5Z 1YJNZ 1KQSY 3CC71 3CCQZ 3I56Z 2OTJ1 3CC21 1Q861 1QVGY 3CD61 3I55Z 3G4SZ 3CCE1 1W2BY 3OW2Y 2QEXZ 1VQ6Z 1S721 1M902 3CMA1 3CCS1 3CCUZ 1KD12 1Q7Y2 1KC81 1N8R2 1VQMZ 3CCJZ 1Q811 3CPWZ 1VQ71 1YIJ1 1VQL1 1VQN1 1JJ2Z 2QEX1 1VQPZ 1VQKZ 2QA4Z 1JJ2Y 3CCMZ 3CCRZ 1VQ91 1Q822 1NJI2
chains in the Genus database with same CATH superfamily
1N8R1 4A3KI 2GTIA 1ZH1A 1TWHI 2O53A 1VQ4Z 5CM2M 5A2Qb 2PMZA 1VQ51 1YJN1 1VQOZ 3PO3I 3NH8A 1QXFA 4X6AI 2KI7B 4BY7I 3GTLI 4NBFA 3JAMf 4NFRA 1YJWZ 1NP6A 3FKII 3D6WA 3IX0A 1M901 3I4MI 4A3GI 3IFUA 1Q7Y1 4MRIA 3CC7Z 1YUAA 3K7AI 4HH4A 4A3FI 2OOYB 1Y1VI 2QA41 1WIIA 2BJOA 2W03A 4NB9A 5FLXf 1QVFZ 1VLAA 2PK7A 1Q821 3OW2Z 3EERA 4NBDA 2E9HA 4QTTA 1VQLZ 2RT9A 1RO2A 5IP9I 1AA6A 1N2FA 2AYDA 3GTMS 3EEDA 1R9TI 5T64A 1YJ91 1YIT1 2RIQA 2QKDA 3HKZA 1SIWA 3KIHA 2E2II 3CCL1 1YI21 1VQ5Z 1YJNZ 5A2Qf 1KQSY 2JR6A 3GTKI 3CC21 2HU9A 4A3MI 3I4NI 4Y52I 4DK1A 3OW2Y 2QREB 2NAPA 3J81b 3JAMb 1S721 3GTQI 2VPWA 4A93I 3M4OI 3CCS1 1N8R2 4MXUA 4RV9A 1I6HI 1PFTA 2JIQA 1VQ71 1YIJ1 3ESWA 2QRCB 2QA4Z 2R7ZI 3S15I 1VQ91 3CD61 1NJI2 3S1MI 3FQQA 1Y1VS 3G6E1 3GKQA 2OTLZ 1KRLA 1VQP1 2WB1A 3S16I 4RVDA 3QWUA 5T6BA 1WZNA 1ZB8A 5AN9F 3GTMI 4MH4A 1YJ9Z 1YITZ 1I50I 3HOXI 1LQLA 2RPRA 3G4S1 3S17I 4E2YA 4AYBA 4DGLA 3HOZI 3S1NI 3CCLZ 3VTNA 1Z02A 1RQFA 2JIOA 1YI2Z 5D1OA 3S2HI 1VQ81 1TWAI 3CC2Z 3MZLB 3HOUI 3G711 4A3JI 3IF8A 1VQK1 3J7A4 1WJ2A 5D1PA 4E32A 2I3CA 1QVGZ 1S72Z 4A3CI 1NJI1 3J81f 3CCSZ 2VPZA 4HGZA 1VQ7Z 3F3FC 1YIJZ 2RHBA 3RZDI 1RNIA 1VQ9Z 3CD6Z 2Y0SA 4BBSI 1RO4A 2DE6A 1WW9A 1KQSZ 4BBRI 3G6EZ 3LUSA 2R93I 3VMGA 1K9M2 2VUMI 2ZAEB 4A3LI 2OTJ1 4E30A 3P5JB 1QVGY 1X0TA 3G4SZ 3CCE1 1QYPA 3MZKB 2LEXA 4E31A 4A3II 1TWGI 1FDOA 3IR7A 3CPWZ 1VQN1 2P28A 4E33A 1YUKA 1TWCI 2QEX1 2NVXI 2JUBA 1VQKZ 3NDIA 1JJ2Y 4NOZA 5C3EI 4EWCA 1YHQ1 2LFUA 1M1K2 2G2KA 1K9M1 2R6MA 2NVYI 2DE5A 2R92I 1QF8A 3TE5B 2JS4A 1Y8CA 3I551 2E7ZA 5C4JI 3GTJI 4DQYB 1VQ41 2H85A 3CPWY 2P3YA 2LIYA 2AKLA 1DL6A 2GU2A 2GTHA 2OTJZ 2JMOA 4MD9A 1Z01A 3GTOI 1USPB 3HOVI 2E2JI 3T4NB 4E2ZA 1I3QI 4MD7A 1P9NA 4RVHA 1W2BZ 1M1K1 2JA5I 1JWHC 1K8A1 1Q812 2VPXA 4S1TA 1TWFI 2V3VA 3CCV1 2Q4ZA 2IZ3A 3FQMA 1VQNZ 4A3BI 2YADA 2HF1A 2VF1A 3NH5A 4TNUA 4BXXI 3CME1 3D9XA 2V8IA 2EGTA 1YHQZ 4A3DI 2J6AA 1Y1WI 5FLMI 1K731 2NVQI 2DE7A 2QR1B 5C4XI 5LL6f 2NVTI 3I55Z 4NB8A 5IT9f 1W2BY 3U50C 3CMA1 1X3ZA 1KD12 5IP7I 2IZ4A 5T67A 3S14I 4A3EI 1Q811 3NH4A 4NBBA 1X3WA 3MONA 5D1OB 1JJ2Z 3H3VJ 2WAQA 1VQPZ 3VMIA 2JA8I 3D2LA 2VUGA 3S1RI 2W04A 1RLYA 2K5RA 2O4HA 2QRDB 4RVGA 2Q51A 2M6NA 3HOYI 2K3RA 3CC41 2M48A 3CCVZ 4CL1A 4MONA 4NBCA 3CCQ1 3M3YI 2RBLA 3I561 2JA7I 3CMEZ 1VQ8Z 2PM9A 5C44I 3S2DI 4NH1C 3RZOI 3G71Z 3CXCZ 2OTL1 1VQ61 1L1OC 3VMHA 4Y7NI 1FDIA 1K83I 1TFIA 3J80b 1ZB9A 1KD11 3CCU1 3CQZI 3VB9A 1VQM1 3CCJ1 4NBAA 4E2WA 3BG1B 1K8A2 1Q862 2JA6I 2IV2X 3I07A 3NDJA 2JIMA 3CCM1 1ML8A 3CCR1 5IT9b 2KPIA 4E2XA 3CMAZ 4MD8A 1KC82 2V8JA 1WCMI 1SFOI 1QVFY 1USPA 1K732 3PO3S 1VQO1 1NUIA 4NBHA 3KIFA 3GTGI 2JIPA 3CXCY 4HGYA 1YJW1 2V45A 3CCEZ 1RO0A 2YU9I 3CC4Z 3BG0B 2JIRA 2B63I 3CC71 2VPYA 3CCQZ 2OZKA 3I56Z 3NFZA 3GCFA 2QLVB 2F4MA 1Q861 2JNYA 1Q16A 2V8KA 5FLXb 4NBEA 3Q87A 2QEXZ 1VQ6Z 1Z03A 4NBGA 3S1QI 1M902 3CCUZ 3J80f 1Q7Y2 1KC81 1VQMZ 3CCJZ 4XX2A 3TDHB 3GTPI 3F3PC 4QTUA 3HOWI 1S7MA 3PO2I 1VQL1 2F4OA 4BY1I 3H0GI 2E2HI 2OOXB 4RS4A 3CCMZ 3CCRZ 4RVFA 1Q822
chains in the Genus database with same CATH topology
1N8R1 4A3KI 2GTIA 1ZH1A 1TWHI 2O53A 1VQ4Z 5CM2M 5A2Qb 2PMZA 1VQ51 1YJN1 1VQOZ 3PO3I 3NH8A 4X6AI 2KI7B 4BY7I 3GTLI 4NBFA 3JAMf 4NFRA 1YJWZ 1NP6A 3FKII 3D6WA 3IX0A 1M901 3I4MI 4A3GI 3IFUA 1Q7Y1 4MRIA 3CC7Z 1YUAA 3K7AI 4HH4A 4A3FI 2OOYB 1Y1VI 2QA41 1WIIA 2BJOA 2W03A 4NB9A 5FLXf 1QVFZ 1VLAA 2PK7A 1Q821 3OW2Z 3EERA 4NBDA 2E9HA 4QTTA 1VQLZ 2RT9A 1RO2A 5IP9I 1N2FA 3GTMS 3EEDA 1R9TI 5T64A 1YJ91 1YIT1 2RIQA 2QKDA 3HKZA 3KIHA 2E2II 3CCL1 1YI21 1VQ5Z 1YJNZ 5A2Qf 1KQSY 2JR6A 3GTKI 3CC21 2HU9A 4A3MI 3I4NI 4Y52I 4DK1A 3OW2Y 2QREB 3J81b 3JAMb 1S721 3GTQI 4A93I 3M4OI 3CCS1 1N8R2 4MXUA 4RV9A 1I6HI 1PFTA 1VQ71 1YIJ1 3ESWA 2QRCB 2QA4Z 2R7ZI 3S15I 1VQ91 3CD61 1NJI2 3S1MI 3FQQA 1Y1VS 3G6E1 3GKQA 2OTLZ 1KRLA 1VQP1 2WB1A 3S16I 4RVDA 3QWUA 5T6BA 1ZB8A 5AN9F 3GTMI 4MH4A 1YJ9Z 1YITZ 1I50I 3HOXI 1LQLA 2RPRA 3G4S1 3S17I 4E2YA 4AYBA 4DGLA 3HOZI 3S1NI 3CCLZ 3VTNA 1Z02A 1RQFA 1YI2Z 5D1OA 3S2HI 1VQ81 1TWAI 3CC2Z 3MZLB 3HOUI 3G711 4A3JI 3IF8A 1VQK1 3J7A4 5D1PA 4E32A 2I3CA 1QVGZ 1S72Z 4A3CI 1NJI1 3J81f 3CCSZ 4HGZA 1VQ7Z 3F3FC 1YIJZ 2RHBA 3RZDI 1RNIA 1VQ9Z 3CD6Z 2Y0SA 4BBSI 1RO4A 2DE6A 1WW9A 1KQSZ 4BBRI 3G6EZ 3LUSA 2R93I 3VMGA 1K9M2 2VUMI 2ZAEB 4A3LI 2OTJ1 4E30A 3P5JB 1QVGY 1X0TA 3G4SZ 3CCE1 1QYPA 3MZKB 4E31A 4A3II 1TWGI 3CPWZ 1VQN1 2P28A 4E33A 1YUKA 1TWCI 2QEX1 2NVXI 2JUBA 1VQKZ 3NDIA 1JJ2Y 4NOZA 5C3EI 4EWCA 1YHQ1 2LFUA 1M1K2 2G2KA 1K9M1 2R6MA 2NVYI 2DE5A 2R92I 1QF8A 3TE5B 2JS4A 3I551 5C4JI 3GTJI 4DQYB 1VQ41 2H85A 3CPWY 2P3YA 2LIYA 2AKLA 1DL6A 2GU2A 2GTHA 2OTJZ 2JMOA 4MD9A 1Z01A 3GTOI 1USPB 3HOVI 2E2JI 3T4NB 4E2ZA 1I3QI 4MD7A 1P9NA 4RVHA 1W2BZ 1M1K1 2JA5I 1JWHC 1K8A1 1Q812 4S1TA 1TWFI 3CCV1 1VQNZ 2Q4ZA 2IZ3A 3FQMA 4A3BI 2YADA 2HF1A 2VF1A 3NH5A 4TNUA 4BXXI 3CME1 3D9XA 2V8IA 2EGTA 1YHQZ 4A3DI 2J6AA 1Y1WI 5FLMI 1K731 2NVQI 2DE7A 2QR1B 5C4XI 5LL6f 2NVTI 3I55Z 4NB8A 5IT9f 1W2BY 3U50C 3CMA1 1X3ZA 1KD12 5IP7I 2IZ4A 5T67A 3S14I 4A3EI 1Q811 3NH4A 4NBBA 1X3WA 3MONA 5D1OB 1JJ2Z 3H3VJ 2WAQA 1VQPZ 3VMIA 2JA8I 2VUGA 3S1RI 2W04A 1RLYA 2K5RA 2O4HA 2QRDB 4RVGA 2Q51A 2M6NA 3HOYI 2K3RA 3CC41 2M48A 3CCVZ 4CL1A 4MONA 4NBCA 3CCQ1 3M3YI 2RBLA 3I561 2JA7I 3CMEZ 1VQ8Z 2PM9A 5C44I 3S2DI 4NH1C 3RZOI 3G71Z 3CXCZ 2OTL1 1VQ61 1L1OC 3VMHA 4Y7NI 1K83I 1TFIA 3J80b 1ZB9A 1KD11 3CCU1 3CQZI 3VB9A 1VQM1 3CCJ1 4NBAA 4E2WA 3BG1B 1K8A2 1Q862 2JA6I 3I07A 3NDJA 3CCM1 1ML8A 3CCR1 5IT9b 2KPIA 4E2XA 3CMAZ 4MD8A 1KC82 2V8JA 1WCMI 1SFOI 1QVFY 1USPA 1K732 3PO3S 1VQO1 1NUIA 4NBHA 3KIFA 3GTGI 3CXCY 4HGYA 1YJW1 3CCEZ 1RO0A 2YU9I 3CC4Z 3BG0B 2B63I 3CC71 3CCQZ 2OZKA 3I56Z 3NFZA 3GCFA 2QLVB 2F4MA 1Q861 2JNYA 2V8KA 5FLXb 4NBEA 3Q87A 2QEXZ 1VQ6Z 1Z03A 4NBGA 3S1QI 1M902 3CCUZ 3J80f 1Q7Y2 1KC81 1VQMZ 3CCJZ 4XX2A 3TDHB 3GTPI 3F3PC 4QTUA 3HOWI 1S7MA 3PO2I 1VQL1 2F4OA 4BY1I 3H0GI 2E2HI 2OOXB 4RS4A 3CCMZ 3CCRZ 4RVFA 1Q822
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R 1;  1YHQ 1;  1M1K 2;  3G6E 1;  1K9M 1;  2OTL Z;  1VQ4 Z;  3CC4 1;  3CCV Z;  1VQ5 1;  1VQP 1;  1YJN 1;  1VQO Z;  3CCQ 1;  3I56 1;  1YJ9 Z;  1YIT Z;  3CME Z;  1VQ8 Z;  3I55 1;  3G4S 1;  1YJW Z;  3G71 Z;  3CXC Z;  2OTL 1;  1VQ6 1;  1VQ4 1;  1M90 1;  3CCL Z;  3CPW Y;  1KD1 1;  3CCU 1;  1YI2 Z;  1Q7Y 1;  1VQM 1;  3CCJ 1;  3CC7 Z;  1VQ8 1;  2OTJ Z;  1K8A 2;  3CC2 Z;  1Q86 2;  3G71 1;  1VQK 1;  2QA4 1;  3CCM 1;  1QVF Z;  3CCR 1;  1QVG Z;  1S72 Z;  1Q82 1;  1NJI 1;  3CMA Z;  1W2B Z;  3OW2 Z;  3CCS Z;  1M1K 1;  1KC8 2;  1K8A 1;  1QVF Y;  1Q81 2;  3CCV 1;  1VQL Z;  1VQ7 Z;  1YIJ Z;  1K73 2;  1VQN Z;  1VQO 1;  3CXC Y;  1YJ9 1;  1YIT 1;  3CME 1;  1VQ9 Z;  3CD6 Z;  1YJW 1;  1YHQ Z;  3CCE Z;  1KQS Z;  3G6E Z;  1K73 1;  1K9M 2;  3CCL 1;  3CC4 Z;  1YI2 1;  1VQ5 Z;  1YJN Z;  1KQS Y;  3CC7 1;  3CCQ Z;  3I56 Z;  2OTJ 1;  3CC2 1;  1Q86 1;  1QVG Y;  3CD6 1;  3I55 Z;  3G4S Z;  3CCE 1;  1W2B Y;  3OW2 Y;  2QEX Z;  1VQ6 Z;  1S72 1;  1M90 2;  3CMA 1;  3CCS 1;  3CCU Z;  1KD1 2;  1Q7Y 2;  1KC8 1;  1N8R 2;  1VQM Z;  3CCJ Z;  1Q81 1;  3CPW Z;  1VQ7 1;  1YIJ 1;  1VQL 1;  1VQN 1;  1JJ2 Z;  2QEX 1;  1VQP Z;  1VQK Z;  2QA4 Z;  1JJ2 Y;  3CCM Z;  3CCR Z;  1VQ9 1;  1Q82 2;  1NJI 2; 
#chains in the Genus database with same CATH topology
 1N8R 1;  4A3K I;  2GTI A;  1ZH1 A;  1TWH I;  2O53 A;  1VQ4 Z;  5CM2 M;  5A2Q b;  2PMZ A;  1VQ5 1;  1YJN 1;  1VQO Z;  3PO3 I;  3NH8 A;  1QXF A;  4X6A I;  2KI7 B;  4BY7 I;  3GTL I;  4NBF A;  3JAM f;  4NFR A;  1YJW Z;  1NP6 A;  3FKI I;  3D6W A;  3IX0 A;  1M90 1;  3I4M I;  4A3G I;  3IFU A;  1Q7Y 1;  4MRI A;  3CC7 Z;  1YUA A;  3K7A I;  4HH4 A;  4A3F I;  2OOY B;  1Y1V I;  2QA4 1;  1WII A;  2BJO A;  2W03 A;  4NB9 A;  5FLX f;  1QVF Z;  1VLA A;  2PK7 A;  1Q82 1;  3OW2 Z;  3EER A;  4NBD A;  2E9H A;  4QTT A;  1VQL Z;  2RT9 A;  1RO2 A;  5IP9 I;  1AA6 A;  1N2F A;  2AYD A;  3GTM S;  3EED A;  1R9T I;  5T64 A;  1YJ9 1;  1YIT 1;  2RIQ A;  2QKD A;  3HKZ A;  1SIW A;  3KIH A;  2E2I I;  3CCL 1;  1YI2 1;  1VQ5 Z;  1YJN Z;  5A2Q f;  1KQS Y;  2JR6 A;  3GTK I;  3CC2 1;  2HU9 A;  4A3M I;  3I4N I;  4Y52 I;  4DK1 A;  3OW2 Y;  2QRE B;  2NAP A;  3J81 b;  3JAM b;  1S72 1;  3GTQ I;  2VPW A;  4A93 I;  3M4O I;  3CCS 1;  1N8R 2;  4MXU A;  4RV9 A;  1I6H I;  1PFT A;  2JIQ A;  1VQ7 1;  1YIJ 1;  3ESW A;  2QRC B;  2QA4 Z;  2R7Z I;  3S15 I;  1VQ9 1;  3CD6 1;  1NJI 2;  3S1M I;  3FQQ A;  1Y1V S;  3G6E 1;  3GKQ A;  2OTL Z;  1KRL A;  1VQP 1;  2WB1 A;  3S16 I;  4RVD A;  3QWU A;  5T6B A;  1WZN A;  1ZB8 A;  5AN9 F;  3GTM I;  4MH4 A;  1YJ9 Z;  1YIT Z;  1I50 I;  3HOX I;  1LQL A;  2RPR A;  3G4S 1;  3S17 I;  4E2Y A;  4AYB A;  4DGL A;  3HOZ I;  3S1N I;  3CCL Z;  3VTN A;  1Z02 A;  1RQF A;  2JIO A;  1YI2 Z;  5D1O A;  3S2H I;  1VQ8 1;  1TWA I;  3CC2 Z;  3MZL B;  3HOU I;  3G71 1;  4A3J I;  3IF8 A;  1VQK 1;  3J7A 4;  1WJ2 A;  5D1P A;  4E32 A;  2I3C A;  1QVG Z;  1S72 Z;  4A3C I;  1NJI 1;  3J81 f;  3CCS Z;  2VPZ A;  4HGZ A;  1VQ7 Z;  3F3F C;  1YIJ Z;  2RHB A;  3RZD I;  1RNI A;  1VQ9 Z;  3CD6 Z;  2Y0S A;  4BBS I;  1RO4 A;  2DE6 A;  1WW9 A;  1KQS Z;  4BBR I;  3G6E Z;  3LUS A;  2R93 I;  3VMG A;  1K9M 2;  2VUM I;  2ZAE B;  4A3L I;  2OTJ 1;  4E30 A;  3P5J B;  1QVG Y;  1X0T A;  3G4S Z;  3CCE 1;  1QYP A;  3MZK B;  2LEX A;  4E31 A;  4A3I I;  1TWG I;  1FDO A;  3IR7 A;  3CPW Z;  1VQN 1;  2P28 A;  4E33 A;  1YUK A;  1TWC I;  2QEX 1;  2NVX I;  2JUB A;  1VQK Z;  3NDI A;  1JJ2 Y;  4NOZ A;  5C3E I;  4EWC A;  1YHQ 1;  2LFU A;  1M1K 2;  2G2K A;  1K9M 1;  2R6M A;  2NVY I;  2DE5 A;  2R92 I;  1QF8 A;  3TE5 B;  2JS4 A;  1Y8C A;  3I55 1;  2E7Z A;  5C4J I;  3GTJ I;  4DQY B;  1VQ4 1;  2H85 A;  3CPW Y;  2P3Y A;  2LIY A;  2AKL A;  1DL6 A;  2GU2 A;  2GTH A;  2OTJ Z;  2JMO A;  4MD9 A;  1Z01 A;  3GTO I;  1USP B;  3HOV I;  2E2J I;  3T4N B;  4E2Z A;  1I3Q I;  4MD7 A;  1P9N A;  4RVH A;  1W2B Z;  1M1K 1;  2JA5 I;  1JWH C;  1K8A 1;  1Q81 2;  2VPX A;  4S1T A;  1TWF I;  2V3V A;  3CCV 1;  2Q4Z A;  2IZ3 A;  3FQM A;  1VQN Z;  4A3B I;  2YAD A;  2HF1 A;  2VF1 A;  3NH5 A;  4TNU A;  4BXX I;  3CME 1;  3D9X A;  2V8I A;  2EGT A;  1YHQ Z;  4A3D I;  2J6A A;  1Y1W I;  5FLM I;  1K73 1;  2NVQ I;  2DE7 A;  2QR1 B;  5C4X I;  5LL6 f;  2NVT I;  3I55 Z;  4NB8 A;  5IT9 f;  1W2B Y;  3U50 C;  3CMA 1;  1X3Z A;  1KD1 2;  5IP7 I;  2IZ4 A;  5T67 A;  3S14 I;  4A3E I;  1Q81 1;  3NH4 A;  4NBB A;  1X3W A;  3MON A;  5D1O B;  1JJ2 Z;  3H3V J;  2WAQ A;  1VQP Z;  3VMI A;  2JA8 I;  3D2L A;  2VUG A;  3S1R I;  2W04 A;  1RLY A;  2K5R A;  2O4H A;  2QRD B;  4RVG A;  2Q51 A;  2M6N A;  3HOY I;  2K3R A;  3CC4 1;  2M48 A;  3CCV Z;  4CL1 A;  4MON A;  4NBC A;  3CCQ 1;  3M3Y I;  2RBL A;  3I56 1;  2JA7 I;  3CME Z;  1VQ8 Z;  2PM9 A;  5C44 I;  3S2D I;  4NH1 C;  3RZO I;  3G71 Z;  3CXC Z;  2OTL 1;  1VQ6 1;  1L1O C;  3VMH A;  4Y7N I;  1FDI A;  1K83 I;  1TFI A;  3J80 b;  1ZB9 A;  1KD1 1;  3CCU 1;  3CQZ I;  3VB9 A;  1VQM 1;  3CCJ 1;  4NBA A;  4E2W A;  3BG1 B;  1K8A 2;  1Q86 2;  2JA6 I;  2IV2 X;  3I07 A;  3NDJ A;  2JIM A;  3CCM 1;  1ML8 A;  3CCR 1;  5IT9 b;  2KPI A;  4E2X A;  3CMA Z;  4MD8 A;  1KC8 2;  2V8J A;  1WCM I;  1SFO I;  1QVF Y;  1USP A;  1K73 2;  3PO3 S;  1VQO 1;  1NUI A;  4NBH A;  3KIF A;  3GTG I;  2JIP A;  3CXC Y;  4HGY A;  1YJW 1;  2V45 A;  3CCE Z;  1RO0 A;  2YU9 I;  3CC4 Z;  3BG0 B;  2JIR A;  2B63 I;  3CC7 1;  2VPY A;  3CCQ Z;  2OZK A;  3I56 Z;  3NFZ A;  3GCF A;  2QLV B;  2F4M A;  1Q86 1;  2JNY A;  1Q16 A;  2V8K A;  5FLX b;  4NBE A;  3Q87 A;  2QEX Z;  1VQ6 Z;  1Z03 A;  4NBG A;  3S1Q I;  1M90 2;  3CCU Z;  3J80 f;  1Q7Y 2;  1KC8 1;  1VQM Z;  3CCJ Z;  4XX2 A;  3TDH B;  3GTP I;  3F3P C;  4QTU A;  3HOW I;  1S7M A;  3PO2 I;  1VQL 1;  2F4O A;  4BY1 I;  3H0G I;  2E2H I;  2OOX B;  4RS4 A;  3CCM Z;  3CCR Z;  4RVF A;  1Q82 2; 
#chains in the Genus database with same CATH homology
 1N8R 1;  4A3K I;  2GTI A;  1ZH1 A;  1TWH I;  2O53 A;  1VQ4 Z;  5CM2 M;  5A2Q b;  2PMZ A;  1VQ5 1;  1YJN 1;  1VQO Z;  3PO3 I;  3NH8 A;  4X6A I;  2KI7 B;  4BY7 I;  3GTL I;  4NBF A;  3JAM f;  4NFR A;  1YJW Z;  1NP6 A;  3FKI I;  3D6W A;  3IX0 A;  1M90 1;  3I4M I;  4A3G I;  3IFU A;  1Q7Y 1;  4MRI A;  3CC7 Z;  1YUA A;  3K7A I;  4HH4 A;  4A3F I;  2OOY B;  1Y1V I;  2QA4 1;  1WII A;  2BJO A;  2W03 A;  4NB9 A;  5FLX f;  1QVF Z;  1VLA A;  2PK7 A;  1Q82 1;  3OW2 Z;  3EER A;  4NBD A;  2E9H A;  4QTT A;  1VQL Z;  2RT9 A;  1RO2 A;  5IP9 I;  1N2F A;  3GTM S;  3EED A;  1R9T I;  5T64 A;  1YJ9 1;  1YIT 1;  2RIQ A;  2QKD A;  3HKZ A;  3KIH A;  2E2I I;  3CCL 1;  1YI2 1;  1VQ5 Z;  1YJN Z;  5A2Q f;  1KQS Y;  2JR6 A;  3GTK I;  3CC2 1;  2HU9 A;  4A3M I;  3I4N I;  4Y52 I;  4DK1 A;  3OW2 Y;  2QRE B;  3J81 b;  3JAM b;  1S72 1;  3GTQ I;  4A93 I;  3M4O I;  3CCS 1;  1N8R 2;  4MXU A;  4RV9 A;  1I6H I;  1PFT A;  1VQ7 1;  1YIJ 1;  3ESW A;  2QRC B;  2QA4 Z;  2R7Z I;  3S15 I;  1VQ9 1;  3CD6 1;  1NJI 2;  3S1M I;  3FQQ A;  1Y1V S;  3G6E 1;  3GKQ A;  2OTL Z;  1KRL A;  1VQP 1;  2WB1 A;  3S16 I;  4RVD A;  3QWU A;  5T6B A;  1ZB8 A;  5AN9 F;  3GTM I;  4MH4 A;  1YJ9 Z;  1YIT Z;  1I50 I;  3HOX I;  1LQL A;  2RPR A;  3G4S 1;  3S17 I;  4E2Y A;  4AYB A;  4DGL A;  3HOZ I;  3S1N I;  3CCL Z;  3VTN A;  1Z02 A;  1RQF A;  1YI2 Z;  5D1O A;  3S2H I;  1VQ8 1;  1TWA I;  3CC2 Z;  3MZL B;  3HOU I;  3G71 1;  4A3J I;  3IF8 A;  1VQK 1;  3J7A 4;  5D1P A;  4E32 A;  2I3C A;  1QVG Z;  1S72 Z;  4A3C I;  1NJI 1;  3J81 f;  3CCS Z;  4HGZ A;  1VQ7 Z;  3F3F C;  1YIJ Z;  2RHB A;  3RZD I;  1RNI A;  1VQ9 Z;  3CD6 Z;  2Y0S A;  4BBS I;  1RO4 A;  2DE6 A;  1WW9 A;  1KQS Z;  4BBR I;  3G6E Z;  3LUS A;  2R93 I;  3VMG A;  1K9M 2;  2VUM I;  2ZAE B;  4A3L I;  2OTJ 1;  4E30 A;  3P5J B;  1QVG Y;  1X0T A;  3G4S Z;  3CCE 1;  1QYP A;  3MZK B;  4E31 A;  4A3I I;  1TWG I;  3CPW Z;  1VQN 1;  2P28 A;  4E33 A;  1YUK A;  1TWC I;  2QEX 1;  2NVX I;  2JUB A;  1VQK Z;  3NDI A;  1JJ2 Y;  4NOZ A;  5C3E I;  4EWC A;  1YHQ 1;  2LFU A;  1M1K 2;  2G2K A;  1K9M 1;  2R6M A;  2NVY I;  2DE5 A;  2R92 I;  1QF8 A;  3TE5 B;  2JS4 A;  3I55 1;  5C4J I;  3GTJ I;  4DQY B;  1VQ4 1;  2H85 A;  3CPW Y;  2P3Y A;  2LIY A;  2AKL A;  1DL6 A;  2GU2 A;  2GTH A;  2OTJ Z;  2JMO A;  4MD9 A;  1Z01 A;  3GTO I;  1USP B;  3HOV I;  2E2J I;  3T4N B;  4E2Z A;  1I3Q I;  4MD7 A;  1P9N A;  4RVH A;  1W2B Z;  1M1K 1;  2JA5 I;  1JWH C;  1K8A 1;  1Q81 2;  4S1T A;  1TWF I;  3CCV 1;  1VQN Z;  2Q4Z A;  2IZ3 A;  3FQM A;  4A3B I;  2YAD A;  2HF1 A;  2VF1 A;  3NH5 A;  4TNU A;  4BXX I;  3CME 1;  3D9X A;  2V8I A;  2EGT A;  1YHQ Z;  4A3D I;  2J6A A;  1Y1W I;  5FLM I;  1K73 1;  2NVQ I;  2DE7 A;  2QR1 B;  5C4X I;  5LL6 f;  2NVT I;  3I55 Z;  4NB8 A;  5IT9 f;  1W2B Y;  3U50 C;  3CMA 1;  1X3Z A;  1KD1 2;  5IP7 I;  2IZ4 A;  5T67 A;  3S14 I;  4A3E I;  1Q81 1;  3NH4 A;  4NBB A;  1X3W A;  3MON A;  5D1O B;  1JJ2 Z;  3H3V J;  2WAQ A;  1VQP Z;  3VMI A;  2JA8 I;  2VUG A;  3S1R I;  2W04 A;  1RLY A;  2K5R A;  2O4H A;  2QRD B;  4RVG A;  2Q51 A;  2M6N A;  3HOY I;  2K3R A;  3CC4 1;  2M48 A;  3CCV Z;  4CL1 A;  4MON A;  4NBC A;  3CCQ 1;  3M3Y I;  2RBL A;  3I56 1;  2JA7 I;  3CME Z;  1VQ8 Z;  2PM9 A;  5C44 I;  3S2D I;  4NH1 C;  3RZO I;  3G71 Z;  3CXC Z;  2OTL 1;  1VQ6 1;  1L1O C;  3VMH A;  4Y7N I;  1K83 I;  1TFI A;  3J80 b;  1ZB9 A;  1KD1 1;  3CCU 1;  3CQZ I;  3VB9 A;  1VQM 1;  3CCJ 1;  4NBA A;  4E2W A;  3BG1 B;  1K8A 2;  1Q86 2;  2JA6 I;  3I07 A;  3NDJ A;  3CCM 1;  1ML8 A;  3CCR 1;  5IT9 b;  2KPI A;  4E2X A;  3CMA Z;  4MD8 A;  1KC8 2;  2V8J A;  1WCM I;  1SFO I;  1QVF Y;  1USP A;  1K73 2;  3PO3 S;  1VQO 1;  1NUI A;  4NBH A;  3KIF A;  3GTG I;  3CXC Y;  4HGY A;  1YJW 1;  3CCE Z;  1RO0 A;  2YU9 I;  3CC4 Z;  3BG0 B;  2B63 I;  3CC7 1;  3CCQ Z;  2OZK A;  3I56 Z;  3NFZ A;  3GCF A;  2QLV B;  2F4M A;  1Q86 1;  2JNY A;  2V8K A;  5FLX b;  4NBE A;  3Q87 A;  2QEX Z;  1VQ6 Z;  1Z03 A;  4NBG A;  3S1Q I;  1M90 2;  3CCU Z;  3J80 f;  1Q7Y 2;  1KC8 1;  1VQM Z;  3CCJ Z;  4XX2 A;  3TDH B;  3GTP I;  3F3P C;  4QTU A;  3HOW I;  1S7M A;  3PO2 I;  1VQL 1;  2F4O A;  4BY1 I;  3H0G I;  2E2H I;  2OOX B;  4RS4 A;  3CCM Z;  3CCR Z;  4RVF A;  1Q82 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...