2ZAEB

Crystal structure of protein ph1601p in complex with protein ph1771p of archaeal ribonuclease p from pyrococcus horikoshii ot3
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
EKKEKKKIAIERIDTLFTLAERVARYSPDLAKRYVELALEIQKKAKVKIPRKWKRRYCKRCHTFLIPGVNARVRLRTKRMPHVVITCLECGYIMRYPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 1
publication title Structure of an archaeal homolog of the human protein complex Rpp21-Rpp29 that is a key core component for the assembly of active ribonuclease P.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 28
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2007-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2zaeB01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2zaeB02
5CBNA 1DEEG 1EDJA 1Y47A 1H0TA 4HJGH 1OVUA 2KZJA 5CBOA 1JMBA 2KS1B 5DJTB 2SPZA 3ZDMA 3MHVA 2HR3A 2B89A 2K3RA 2KI7B 1BDCA 4HKZH 1OVRA 4HB1A 2WMMA 3FXDA 2KIKA 4MN4C 1ZW0A 1Q2NA 4ZMDA 2JWDA 1S3JA 2OTKE 2M5AA 2KZIA 4JBZA 4CPGA 4GOFA 2B87A 1LP1A 4EYYQ 1ZXGA 4WWIA 4NPEA 1EDLA 2QVAA 4GODA 4NPFX 3QWOC 1NVOA 1MFTA 1OVVA 5DJUB 2M0BA 1BDDA 2R44A 1U7MA 3RGUA 4NPDA 1LT1A 2KUBA 4ZNCA 2QRXA 2LXBA 1H0TB 2P58A 1FC2C 2LR2A 2LXCB 1EC5A 2I8DA 1JM0A 3MZWB 1U7JA 4KJMA 1SS1A 4BXLA 1EDIA 2Q1KA 4GOEA 4IOIH 5C39A 1X0TA 2M5AB 2RKLA 3S1KA 4ASWA 3PH0A 2B87B 1EDKA 1LP1B 4K35A 4ASVA 5K5GB 5EFWB 2B88A 2UWJE 3FXEA 4K3AA 2ZAEB
chains in the Genus database with same CATH superfamily
5KAFH 4QTUA 3SWKA 2K88A 1LWUC 4EWCA 1FZEA 3JC22 1QVFO 2SPZA 3CCR1 1Q811 1RF0A 2PP6A 3HUSC 3CXHD 2B89A 4L75A 1SFCB 1SP4A 2KB7P 3CD6Z 4UB6E 4IFFA 3F3PC 3I561 3P8MC 1AVYA 1K8A1 3MP7B 4GKGA 2NAPA 4RJTA 3QH9A 1Z02A 2RPRA 3MZLB 5AVZB 1DEBA 2JP3A 3I551 1VF5D 2A06D 3CCVZ 3HE4A 2RBLA 3IR9A 1AFOA 1RE4C 1E5WA 2ZXEB 5AW1B 2M5AA 3CCM1 4KHXA 2BCCJ 4U7JA 1CZQA 1IJDB 4NPEA 4A3JI 1PPJG 4E2XA 2AYDA 3CMA1 1Q861 4HGZA 3S2DI 2H89C 1IFDA 3J80f 1K732 1U7MA 3WUTA 1K05A 1VQMZ 3NXSA 1HVVA 3SSUA 3I4NI 2LXBA 5KLVD 1KQSZ 2Q9IA 5KLVK 2V3VA 2R6MA 3C9IA 2V8IA 2WPRA 2LR2A 3TDHB 2IBZD 1RQUA 3H1JJ 1NTMJ 4BY1I 5APWA 2OOYB 1HF9A 1GL2C 4W7YA 1EZVG 1SQXD 2PK7A 1SQXK 3R4YA 3K5BA 2FYUD 2OQQA 4U3FD 2FYUK 1VQOP 5GTIE 2WSCJ 2K9JA 3J80b 5KLIB 4NB9A 2AXCA 1TWGI 3GTOI 1X8YA 1PP9E 2ZJSE 4XX2A 3L75J 1HJBA 1FE6A 1H0TA 1SQQD 1SQQK 2E74B 3JCUE 1NTKJ 4XFJA 1X9VA 2WQYC 2Y9ZA 1JUNA 1NAYA 5CHXA 2I1KA 2H43A 1KD1Q 4N78D 2KI7B 2A45I 1FU1A 1BCCE 3GTMS 3NFZA 2QLVB 3H1HG 3H0GI 2E75B 4MONA 2WPVB 3OAKA 3AEBC 1M902 2W90A 3A0BE 2NPSD 2MJZA 3H1KD 3G9RA 3G4SZ 2E42A 3CWBG 2ZYDA 5A2Qf 4YXDC 5CJ0A 1KD11 5BU8B 1S9KE 1NWQA 2N1TA 1MFTA 1FZBA 3M0AA 3V2NA 3CC4P 3CXCZ 4RVDA 1X3WA 2BCCE 2KS1A 1VQPZ 3D9XA 5A2Qb 5AVXB 1USPB 2JS4A 1JTHA 3IFMA 2Q1KA 2RHBA 1Q812 2N1TD 4NOZA 5LL6f 3GHGA 2QJPB 3J7A4 2OYIC 2M6NA 3RZDI 1TWFI 4A3EI 2RH0A 3SWFA 3VP8A 1SIWA 1K8A2 2IV2X 3RL0g 1PGPA 2OTL1 1S721 1FDOA 4HJGH 1JJ2Z 2W03A 2QRDB 3WU2E 1QXFA 1KRLA 1VQ8P 3AE2C 2JJLA 1VQ7Z 3V2PA 1EXJA 1YBKA 5KKZB 1G2CA 1PIXA 1HGZA 1SQBK 1S5LX 3B8EB 2IBZG 3L75E 1LTJB 2E76D 4A3CI 1Y1VS 1Q862 1SQVE 1LT9A 5AW6B 1FOSF 1Q16A 1KZUB 1N7SA 1IK9A 3CC4Z 3CC7Z 2HPCA 2BEQD 2XKMA 4MN4C 2O3JA 4Y99B 2NVYI 1ZV8A 5C4JI 2FFDA 3VB9A 2QRCB 4AUWA 1N73A 3CCQP 2M8RA 4EDFA 1PV3A 2OARA 3UIAA 1EXIA 2XZRA 4WWIA 1FBMA 2D2CD 3L70D 2BJOA 3EQ2A 3M9BA 1N7SD 2DE6A 5APTA 4ZKUA 1J1EB 2J58A 1GK6A 4A7PA 2OTJZ 3AEAC 3A7OA 1KYOE 4D6TD 1SFCC 3CCUP 2O01N 1M57D 3CWBJ 2O01J 3NH4A 1VQ8Z 3H1KG 2OYHA 2PFXA 3G6E1 3CPWY 1X0TA 1QVGO 2XDJA 1K83I 1ML8A 1NOHA 3WMM0 3CCJ1 3CCEP 1M1JA 1L4AB 1JWHC 3CXHH 1PFIA 4RVGA 1S5LH 1FOSE 4N3YB 3MUDC 5AVQB 3KZIE 5CBNA 1DEEG 1Y47A 3TNUB 3RK3B 1Y1WI 2WSEH 2C9LY 3S15I 4MRIA 2JUBA 2J59M 1FZCA 1BGYG 1PGOA 5APVA 4TLFA 3BCCD 3HTKA 2ZT9D 1KD12 4L74A 3N7NA 2WTYA 3OW2O 1ZP0C 1URQD 2XU6A 1QVGY 2HF1A 1EZVE 3HKZA 4NBHA 1YJN1 3H25A 1MUUA 1NGMB 3P7KA 5TISH 1IC2A 2P1JA 3CMEP 3KIHA 4H0LD 4JBZA 3RK2B 1GL2B 5KLIC 2Q5UA 1Q7YQ 1LP1A 2O4HA 3LUSA 4A3FI 1Q822 1S4XA 1X3ZA 3IF4A 3MGNA 3I56Z 1N7LA 1H89A 3TK1A 4A3MI 1SQBG 3HD7B 2QRXA 1FAVA 2P58A 3OW2Y 2CPSA 1Y8CA 4OGQD 1X22A 2RMZA 2ZYGA 2OOXB 2WT7A 2YXQB 3AE6C 3SWYA 3MIWA 4MD8A 2E75C 1HUCA 4IOIH 1VQ4P 5C39A 1FDIA 1H88A 3GMAA 3CI9A 2RKLA 2KNCB 3CPWZ 3PLNA 1TWAI 1M56D 3IX0A 1YJWP 1NTZG 2A45H 1BSNA 1D7MA 4GDOA 2B88A 1JB0J 4H44B 2WPSA 1L0ND 3L70G 1IK7A 1L0NK 3C8VA 3B5NA 2OYOA 1JMBA 4TT3H 2YO2A 3BASA 4E30A 3ZDMA 2JA8I 1ZR4A 3CCLP 1NKNA 2VPYA 3E7KA 3L71J 2B63I 2W83C 3H1KJ 3RK3E 1KYOI 5AVTB 4AYBA 3U1AA 2AKLA 2W6JH 3IF8A 1J1DB 1GD2E 3ABVC 5GTHH 2KSJA 1VQ5P 2NZ2A 3PO3I 3GTQI 2Y0CA 3B5ND 2VF1A 1HBWA 5C4XI 3TGUG 4A3KI 4R4MA 1VQ9P 3FWLA 4UB6H 2WSFJ 5CMZA 1PGQA 2QJPC 1BGYJ 2WITA 2PM9A 2B87A 2QJKB 3GW6A 1ZXGA 1RH5B 3PJSK 4NPFX 1VQKP 1LTJA 1VQ4Z 2W6BA 1YI21 4I2LC 2OYIB 2R44A 1JO5A 3BCCG 3RL0B 1LTGC 1KQSO 2JR8A 1YJWZ 3C1LA 1N86A 5AW0B 4NB8A 1FC2C 5KKZC 3CD6P 2VUGA 3CC21 2J5UA 2Y0SA 2K1AA 1EZVI 1JEKA 1L0LE 1OW8A 2FY8A 4A93I 2R32A 3CCVP 1VQL1 5AVUB 1YHQ1 5CCHC 3Q87A 5IP9I 4Y99C 3LW5H 2UWJE 3ITKA 3L73D 1SQBJ 4BXXI 4W80A 5KJ7D 1RE3C 1LWUA 1QF8A 3VOPA 1KQFB 4L76A 5AW9B 5GTIH 4C7NB 3U50C 2Q51A 1LJ2A 3HUSA 5AVWB 4HKZH 1VQMP 5D1OA 1J1EC 3VTPC 4BRYA 3EFFK 4W7ZA 1FZAA 2WWWA 2V7QH 3MTUE 4C46A 1JY2P 2R5BA 3JCUH 5AVSB 2LEXA 3CCQ1 1NTZJ 3L72J 1EQ7A 3FGAD 3TNUA 1ZRTE 3L70J 2LFUA 3L71E 3BG0B 4NBCA 5T64A 1RE4A 2Y0DA 3A0HE 4ZMDA 4Y52I 1NU1D 4YTPC 3HOUI 1L0NG 1NU1K 1L4AC 3L74D 4I1LA 2R3SA 4AYCA 3A0BH 1W2BY 1RQVA 3CCU1 1AA0A 3RK3C 2H85A 5BU5A 3D6WA 2IZ1A 1BGYE 2VRSA 4XA4A 2KLVA 1HH0A 4PD4E 2QSIA 1VQ6P 1EC5A 3CQZI 4E32A 3CCE1 2P2UA 3TGUJ 1KV4A 5APUA 3AE5C 1GL2A 2QEX1 1SQPG 2K37A 2F4OA 2RT9A 3H1IE 2RIQA 1QVFY 5AN9F 4I7ZB 1NJIQ 2JO1A 2IFMA 3G4SP 3PTZA 5EFWB 3Q3DA 4RVFA 3EFGA 4MD7A 1PGJA 1T3UA 3BCCJ 3CCSP 3H1LD 1T3JA 2V8JA 3G711 3RK2C 4I6MC 2P28A 1A02J 3AEEC 3VP9A 3R2PA 2I1JA 3CL3D 4WY4B 3PP5A 4H13D 1Z01A 3SFEC 3W68A 3G6EZ 3D70A 3HD7C 1H8AA 2F4MA 1VQPP 1NJI1 3T97A 3WU2H 1QYPA 3F89A 4MXUA 2WMMA 1LTTC 3S17I 1MKMA 1KC8Q 3PRJA 4NH1C 2JIMA 3S16I 4PV1D 3MZKB 2GTHA 4IL6E 3KDPB 1OZHA 3L73G 3WUUA 4OVNF 1VQ6Z 1AVOA 1NAFA 5AW8B 1NYHA 5AW4B 3GCFA 1NTZE 3L72E 2GTIA 2ZVNB 4H44C 1A02F 1LTBC 3G3ZA 1VQ7P 3AEDC 1Y1VI 3S1MI 2QJYB 1KC81 3NDIA 1BE3D 2ZVOB 2IZ3A 1KILB 5BVZA 2AEJA 3CCSZ 4RVHA 3KXDA 4JYCA 4O9BA 1IZNB 1ZLLA 2NPSC 3IN6A 1EDIA 5AW5B 2KSEA 1P84E 4GOEA 1J1DC 3HRNA 4CL1A 3HE5A 3CC7P 2H8PD 3Q5RA 1WJ2A 1EDKA 2OYIA 4K35A 2Y9YA 4ASVA 3FKII 1WMKA 3TGUE 1VQN1 1KYOH 2KLUA 3JAMf 3MONA 3CCL1 5KTBA 3S4RA 5T67A 4A3DI 3VTNA 1JNMA 2A06G 2QJKC 4S1TA 4NBGA 2NVXI 3PO2I 3D2LA 3GTKI 3S9OA 2B9BA 1HGVA 4WBAA 3F3FC 4Y7NI 3GKQA 1JOCA 4PD4D 2E7ZA 4PD4I 2PAJA 1SQPJ 4HYTB 3M9QA 4QTTA 1YITP 1USEA 3H1JE 1NTME 3KZIH 3RL0C 2QE7H 2OTJP 3AEGC 3A5TA 1VQ91 1TU3F 1W2EA 1JY3O 2ZXXA 1I50I 1CI6A 2JR6A 1KB9E 3O6QA 3PHLA 4WB4A 1YIJP 1VQK1 1DD3A 5KLVG 1TFIA 1N8RQ 1S3JA 2BASA 2WZ7A 3A3YB 2G8YA 1SQXG 1OFCX 2R5DA 1NTKE 1Y8AA 2H88C 2FYUG 4NBDA 4OWFA 4U3FG 4QMAA 1SVFA 1R9TI 3H32B 4NPDA 3B4SA 1S1CX 1WCMI 1PP9D 1R8EA 3CCV1 4X6AI 1SQQG 1NO4A 1SFCA 1GDTA 1YJ9P 1N8R1 3Q5SA 3L73J 3H1HJ 1JY3P 1OW6A 2QM8A 3V4QA 2A45G 1BCCD 4MH4A 1YITZ 1NJI2 1YI2Z 3BRTB 3AEFC 2E9HA 4LLHA 3FXEA 2D2CC 2QKDA 3MUDA 2O53A 1S2EA 5H2FE 2AXTE 1RF1B 1SFCD 1T2KC 3CC2Z 2C9NY 1YIJZ 3I56P 2DE7A 2JA6I 2P67A 3MHVA 1JY2N 2FFDC 2FXOA 2HR3A 1NP6A 2K3RA 2YXRB 1WRGA 1S9KD 1VQLZ 3HOXI 1P84I 3W67A 2YNYA 2OZKA 3TF5A 5T6BA 3CCMP 1PPJE 1SQPE 1KC82 2BCCD 2PMZA 1RO2A 3CMAP 1AQTA 4I7ZC 1VF5B 2QA4Z 3AE9C 3AE3C 1YJ9Z 2QIWA 1VL2A 1N2FA 3H6PA 2POHA 3RBXA 5AVVB 1ZB9A 1R5LA 4NBBA 1WW9A 1ZOYC 4DT0A 1NTMD 1JCDA 2Y0EA 1NTMK 1URQC 1LNQA 4WY4C 1RY3A 2VPWA 3CCRZ 4EOTA 3G4S1 3HE4B 5KLVJ 5B66E 4KJMA 4E2ZA 1KB9D 4DK1A 1KB9I 4DCKA 2M5AB 1SQXJ 4H0LC 3V6IA 3PH0A 3KYQA 3RBZA 3BVHA 5D1PA 3L75D 2V8KA 2FYUJ 2G3AA 3QWUA 4U3FJ 2E74D 4NBEA 1SQVD 3I55Z 4K3AA 1VQO1 1SQVK 2YKOA 1OXZA 4A3BI 1LTAC 2W04A 3GTJI 1ZB8A 1IFJA 3H1HE 2GUSA 3CCMZ 1OVUA 1VQP1 1AV1A 4UB8E 5AW2B 1Q7Y1 2Z5IA 3E1RA 2HODB 1SQQJ 2E75D 1LTSC 3NH5A 1OIPA 2QEXZ 2QR1B 3J81f 3CMAZ 4C7RA 5APSA 1BDCA 5E79E 5KAIE 3VMAA 3CWBE 1N2DC 3OJAB 5L8RJ 2JKVA 2QJYC 3GTLI 1GZLA 1YTZT 2QM7A 2YO3A 4RS4A 2E2HI 1KILC 5CCGC 4RKUJ 4HB1A 3Q5PA 1K73Q 2K9JB 1USPA 1XTGB 1WT6A 3L36A 3I5CA 1BCCG 3AE1C 2QG4A 2HU9A 1ZR2A 3EERA 2KK7A 1AQ5A 3KPEA 1KYOD 2KZIA 4NFRA 2JA5I 3JSVC 4D6TG 3U59A 1N8R2 2NPSB 2O1JA 3D6ZA 2C0XA 4GODA 3Q2YA 1L1OC 1HJ0A 4JQ0D 1JMMA 3VMZA 2M0BA 1NKZB 2W8ZA 1S7MA 1QVGZ 1P9NA 3FWNA 3A0HH 2V4HA 1SFOI 3CC41 1Q90D 3CC71 2CK3H 2IZ4A 3IFUA 1JM0A 1GU5A 3M4OI 1VDFA 1MV8A 2WSFH 2BCCG 3Q1MA 1UIXA 5CM2M 2K5RA 2OTLP 3M0DC 4PD4H 5CCHA 2N1TB 4A3LI 5KLVE 3GTGI 1JY2O 2ZAEB 3OW2Z 1EDJA 1NHLA 1M90Q 2IBZE 1QLED 1RE3A 1EZVD 4BBRI 1SQXE 2KS1B 3GF7A 2GUVA 1QX8A 3AE7C 3TDKA 3M3YI 2KPIA 2FYUE 1YQ3C 4U3FE 1VQ81 1JTHB 2WSSH 1Y9BA 1OX3A 5CCHD 4JF7A 2K9YA 3VYIA 3LW5J 4EIJA 2CPBA 2Q7CA 1SQQE 1GU4A 4GT1A 2E76B 2ZYAA 2KIKA 3EEDA 2YU9I 2ITAA 1M901 1K04A 3M9HA 1KQSY 3D6YA 2XNDH 1SQVG 1FJKA 2NVTI 4N78E 5KJ7C 1HWTC 3T4NB 2O1KA 4DJGA 1PZQA 2E5YA 1L4AA 1EDLA 2N9BA 1G1JA 1J2JB 3VMYA 1OVVA 1G2CB 2R7ZI 4HH2A 1ZH1A 2OTLZ 1FS0E 1RF1C 1S72Z 3H1KE 2D2CB 2LKMA 1LT9B 4ZNCA 1K9MQ 3S14I 1L2PA 1JY3N 4RESB 1N7SB 2IX7C 3G6EP 1KFNA 2HPCB 1M1KQ 1SLQA 1KQLA 2PGDA 2MKVA 5GTHE 3CCJP 1Q7Y2 1L4AD 4BXLA 5B5EE 2G2KA 2GA1A 3F5HA 2FFDB 4D6TJ 1I3QI 1N73B 2Q6QA 3BRVB 3GTMI 3CXHI 3RK3D 3V2QA 1Q86Q 5K5GB 2DW3A 3D71A 3CX5E 2VUMI 1K9M1 1VF5C 2W27A 4DQYB 1P84H 4OH8B 2KZJA 3NMDA 3LIDA 1M1K1 1RF0C 3USSA 2JDIH 2M48A 2LIYA 1M8OB 1OVRA 1VLAA 4BY7I 4E2YA 3HD7A 2JEEA 2OYHB 3AE8C 3VMXA 1YJNP 3KQGA 3CXCY 3EWKA 2ZT9B 2QREB 1M1JB 1FZGA 3RK2D 1GL2D 3MD0A 4JYBA 1URQB 2V45A 3S1RI 1M7LA 1ZW0A 1Q2NA 4RV9A 3U1CA 2HODA 1SQBE 2KNCA 1WZNA 4WVZA 5C3EI 1KQGB 2IBZI 2Q3IA 2KOGA 1FZCB 3CCJZ 3HD7D 1LTIC 1DIPA 1L0LD 2IFNA 3CME1 1L0LK 4H13C 2N9YB 4H0LB 2VPXA 2WSCH 2JIRA 1KB9H 3HTKB 3KIFA 5AW3B 1YQ4C 1DX7A 2RN0A 2AEFA 3B71A 3L4FA 4PJ0E 3SFDC 1JJ2Y 1UIIA 2AEMA 5KAFE 1SQVJ 3VN0A 2NPSA 2YKPA 4PV1C 1NH4A 3L70E 2WVRA 4OGQB 1W2BZ 3KHUA 4H44D 2M3EA 1T6AA 4ASWA 1LP1B 4JPZB 3LIEA 5FLXf 1G1IA 3II6A 1VQ41 1HTLC 1YJNZ 4D6TE 2P10A 1YJW1 1ZRTD 2XNXA 3L71D 1L0NJ 3VMHA 2E5TA 5AW7B 4YPCA 5AVYB 3FQMA 3IAOA 1QVFZ 1YTZI 3AECC 2W6AA 1NU1G 2WT7B 2ZFCA 1RO4A 4B86A 1Q82Q 2FYZA 5FLXb 4AQRD 2E2JI 3L74G 2JIQA 5H2FH 2YIUB 2AXTH 1X79B 2M3BA 1E79H 1IFIA 1OWAA 1VQOZ 3V2RA 1BGYD 1GW3A 3CX5D 2WAQA 4E2WA 3CX5I 1VQ51 2KXPB 2L91A 3BCCE 3HOZI 2R92I 3B5NB 1YI2P 4CPGA 2Z4EA 3RL0D 2IYPA 2N1TC 3H1ID 3I07A 1IFPA 2YADA 3JAMb 1Z56A 5DJUB 3O8ZA 1GW4A 1Q821 3L35A 5M1BA 1QL1A 1JCCA 3CC2P 2EGTA 4XE5B 2HG5D 1RO0A 1KMIZ 4NBAA 4C7NA 1K9M2 3CLQA 1VPCA 2LXCB 3H1LG 2I8DA 1U7JA 1M1K2 1VQLP 1YHQP 2YKQA 3CD61 2JNYA 3GHGC 3S1KA 3RZOI 1GMJA 3V5BA 1GK4A 1OW7A 1SQBD 2OGUA 3FX0A 2B87B 2P7JA 2JIPA 2E76C 1CW5A 3GG2A 1L0LG 1QGKB 3M06A 5B66H 2QA4P 1PFTA 1KTMA 1AA6A 5DJTB 3H3VJ 3CPWO 1KILE 2NRGA 3P32A 2H7HA 1KN7A 2L5GB 2JA7I 1NTZD 3L72D 2FYNB 1NTZK 2HYNA 1LT9C 2XV5A 3CCRP 5APYA 3P8CE 4TNUA 1L0NE 1N7SC 1VQM1 4UB8H 1TWCI 2BEZF 1T2KD 3VMIA 5E79H 5KAIH 1BE3G 2FKWB 4KT0J 1N73C 4DOJA 1R5SA 2O01H 1LWUB 3TE5B 2WB1A 3I55P 4EYYQ 3L37A 4BWNA 2I3CA 1YHQZ 1NVOA 2JIOA 1NU1J 4BBSI 1P84D 1RNIA 3L71G 3HUSB 3GTPI 5IT9f 3L74J 1QL2A 1LQLA 5D1OB 2R3CA 2WSEJ 2P3YA 4BRYB 3TGUD 2QEXP 5CJ4A 3TYYA 1URQA 4R4LA 4WY4A 4MD9A 2Z5HA 4IFDK 4YXWH 1RQFA 1U57A 3ESWA 3MZWB 1W5CE 2OYHC 1IO4A 1VQ61 5IT9b 2ZT9C 2DE5A 1M1JC 2KYVA 3CCQZ 3G71P 3H1JD 1IFMA 4RO0A 1FJPA 2NVQI 4LGDE 3H1IG 1YUAA 4WY4D 1WIIA 4Y28J 2E43A 2YMYA 5CBOA 1FZCC 3E1IA 3H1LJ 2YMKA 2JMOA 3CCS1 2VPZA 3N4XA 4LC1A 1XTCC 3CCUZ 2GM4A 1CSBA 3IR7A 4H13B 1NTKD 3L73E 1MZ9A 1NTKK 2HFED 1KILA 5CCGA 3FXDA 5TJHA 4HGYA 1L0LJ 4A3GI 3CCEZ 2E74C 2FXMA 2KP8A 3WUVA 3OA7A 3GLMA 1OMIA 4OGQC 1PP9G 1I6HI 2IZ0A 4Z1MH 5APXA 4PV1B 3I4MI 2QVAA 4GIFA 3QWOC 1RLYA 2Q4ZA 3V4WA 1BDDA 1KILD 5CCGD 1DD4A 2C0WA 4E33A 3RGUA 3G71Z 1Z03A 3T97B 1LT1A 1YUKA 3L72G 2R93I 1LGHB 1H0TB 3J81b 3CXHE 3M91A 3P8CD 1S5LE 1NU1E 1VQ71 1TWHI 3TSIA 1BE3J 3L74E 1SS1A 2IYOA 4L73A 2YIUC 4DZOA 3S1NI 3HOVI 1VQNP 4HH4A 3S2HI 4N6JA 1T8ZA 2A06E 3CMEZ 3M0DA 1K731 3VMGA 5C44I 2OTKE 3NTNA 5B5EH 3B5NC 1KORA 1PPJD 5IP7I 1SQPD 3K7AI 1SQPK 4IFMA 3HOWI 1FDMA 3GF3A 4NBFA 1NUIA 4IL6X 3CX5H 4E31A 1PL5A 1S72P 5TISE 3NH8A 3H32A 1KFMA 4EI2A 3HE5B 2PRRA 3H1LE 1YIT1 2JWAA 1QEXA 1AJYA 3S1QI 3BATA 3HOYI 2OTJ1 4ZKPA 3H1IJ 1USDA 2E2II 3H1JG 1NTMG 1DH3A 1DL6A 2JWDA 3P5JB 2GU2A 5KJ7A 1ZN5A 1YIJ1 4GOFA 3NDJA 1LTJC 3GHGB 2HLOA 1VQNZ 2FXPA 3CCLZ 4DGLA 1RF1A 2IPPA 3L75G 4M3LA 1GTWA 5APQA 2KUBA 1FZFA 2J6AA 3FQQA 1NTKG 5AVRB 5FLMI 1CI6B 3A2AA 3BG1B 3H1HD 1VQ5Z 1Q81Q 2WPQA 3O6QB 1PP9J 1MFZA 2FYNC 2IDBA 1RHZB 3NFQA 1W2BO 2QA41 1VQ9Z 2V7QJ 1BSHA 1YJ91 1YYCA 1K8AQ 3PO3S 3AE4C 2Q3EA 4IL6H 3CWBD 1IFNA 1ZMEC 4PJ0H 4A3II 1BE3E 2FBWC 1BCCJ 1VQKZ
chains in the Genus database with same CATH topology
1YJNZ 4QTUA 1YJW1 4EWCA 1JMBA 3CC2Z 3VMHA 1YIJZ 3FQMA 2SPZA 2DE7A 4E30A 3CCR1 2JA6I 1Q811 3ZDMA 3MHVA 1QVFZ 2JA8I 2HR3A 2B89A 1NP6A 2K3RA 2B63I 3CD6Z 1RO4A 3F3PC 5FLXb 3I561 2E2JI 4AYBA 2AKLA 1K8A1 3IF8A 1VQLZ 3HOXI 2OZKA 1Z02A 2RPRA 3MZLB 5T6BA 1VQOZ 3PO3I 3GTQI 3I551 3CCVZ 2RBLA 2VF1A 1KC82 5C4XI 2PMZA 4A3KI 2WAQA 4E2WA 1VQ51 1RO2A 2M5AA 3CCM1 3HOZI 2QA4Z 2R92I 2PM9A 4CPGA 2B87A 1ZXGA 1YJ9Z 4NPEA 4A3JI 4NPFX 4E2XA 3I07A 1N2FA 2YADA 3JAMb 4HGZA 1Q861 3CMA1 3S2DI 5DJUB 1Q821 1VQ4Z 1YI21 2R44A 3J80f 1K732 1ZB9A 1U7MA 2EGTA 4NBBA 1WW9A 1VQMZ 1YJWZ 1RO0A 3I4NI 2LXBA 1KQSZ 4NBAA 2R6MA 4NB8A 2V8IA 1K9M2 1FC2C 2LR2A 3CCRZ 2LXCB 2VUGA 3TDHB 3CC21 2Y0SA 3G4S1 4BY1I 2I8DA 2OOYB 1U7JA 4KJMA 2PK7A 1M1K2 4E2ZA 4DK1A 3CD61 2JNYA 2M5AB 3S1KA 3RZOI 4A93I 3PH0A 3J80b 2B87B 1VQL1 1YHQ1 5D1PA 2V8KA 3Q87A 4NB9A 3QWUA 5IP9I 4NBEA 3I55Z 2UWJE 4K3AA 1VQO1 1TWGI 3GTOI 4A3BI 4BXXI 4XX2A 1H0TA 2W04A 3GTJI 1PFTA 1ZB8A 3CCMZ 1OVUA 1QF8A 1VQP1 1Q7Y1 5DJTB 3H3VJ 3U50C 2Q51A 3NH5A 2QEXZ 2QR1B 3J81f 3CMAZ 2KI7B 1BDCA 4HKZH 3GTMS 3NFZA 5D1OA 2JA7I 2QLVB 3H0GI 3GTLI 4MONA 4RS4A 2E2HI 4TNUA 4HB1A 1VQM1 3CCQ1 1USPA 1M902 1TWCI 2LFUA 3G4SZ 3VMIA 3BG0B 4NBCA 5T64A 4ZMDA 2HU9A 5A2Qf 3EERA 4Y52I 2KZIA 4NFRA 2JA5I 3HOUI 3TE5B 1N8R2 2WB1A 4EYYQ 1KD11 4GODA 1YHQZ 2I3CA 1L1OC 1NVOA 4BBSI 1MFTA 1RNIA 2M0BA 1W2BY 3GTPI 5IT9f 3CXCZ 3CCU1 2H85A 1LQLA 5D1OB 1S7MA 3D6WA 1QVGZ 1P9NA 4RVDA 2P3YA 1X3WA 1VQPZ 1SFOI 3CC41 3D9XA 4MD9A 3CC71 5A2Qb 1RQFA 1USPB 1EC5A 3CQZI 2IZ4A 3IFUA 4E32A 3CCE1 2JS4A 3ESWA 1JM0A 3MZWB 2QEX1 3M4OI 2Q1KA 2F4OA 2RHBA 2RT9A 1Q812 2RIQA 1QVFY 4NOZA 1VQ61 5AN9F 5LL6f 5IT9b 5CM2M 2K5RA 2DE5A 3J7A4 2M6NA 3CCQZ 3RZDI 1TWFI 4A3EI 1K8A2 5EFWB 4RVFA 4A3LI 2NVQI 4MD7A 3GTGI 2ZAEB 2OTL1 1YUAA 3OW2Z 1EDJA 2V8JA 1S721 3G711 1WIIA 4HJGH 1JJ2Z 2W03A 2QRDB 4BBRI 1KRLA 2P28A 5CBOA 2KS1B 1VQ7Z 3M3YI 2KPIA 3CCS1 2JMOA 1Z01A 1VQ81 3G6EZ 3CCUZ 2F4MA 4A3CI 1Y1VS 1Q862 1NJI1 1QYPA 4MXUA 3CC4Z 2WMMA 3FXDA 3S17I 4NH1C 3CC7Z 3S16I 2KIKA 3EEDA 4HGYA 2YU9I 4MN4C 4A3GI 3CCEZ 1M901 3MZKB 1KQSY 2NVYI 5C4JI 2GTHA 3VB9A 2QRCB 2NVTI 1I6HI 1VQ6Z 3T4NB 3I4MI 3GCFA 4WWIA 2GTIA 1EDLA 2QVAA 3QWOC 1OVVA 1RLYA 2R7ZI 2BJOA 2Q4ZA 1BDDA 1ZH1A 2DE6A 4E33A 2OTLZ 3RGUA 1S72Z 3G71Z 1Y1VI 1Z03A 3S1MI 1LT1A 4ZNCA 1YUKA 1KC81 3S14I 3NDIA 2OTJZ 2R93I 2IZ3A 1H0TB 3J81b 3CCSZ 1VQ71 4RVHA 1TWHI 3NH4A 1VQ8Z 1Q7Y2 1SS1A 4BXLA 2G2KA 1EDIA 3S1NI 4GOEA 3HOVI 1I3QI 3G6E1 3CPWY 1X0TA 4CL1A 1ML8A 1K83I 4HH4A 3GTMI 3S2HI 3CCJ1 3CMEZ 1EDKA 1JWHC 1K731 4K35A 4ASVA 5K5GB 3FKII 3VMGA 4RVGA 1VQN1 3JAMf 5C44I 2VUMI 2OTKE 3MONA 5CBNA 3CCL1 1DEEG 1Y47A 1K9M1 1Y1WI 5T67A 4DQYB 4A3DI 3VTNA 2KZJA 5IP7I 3K7AI 3S15I 4S1TA 4MRIA 2JUBA 4NBGA 2NVXI 3PO2I 3GTKI 1M1K1 3F3FC 4Y7NI 3HOWI 3GKQA 4NBFA 1NUIA 2M48A 4E31A 2LIYA 4QTTA 1OVRA 1VLAA 1KD12 4BY7I 4E2YA 3NH8A 1VQ91 3CXCY 1YIT1 2QREB 1I50I 1QVGY 3S1QI 2HF1A 3HOYI 2JR6A 2OTJ1 3HKZA 1VQK1 2E2II 4NBHA 1YJN1 3S1RI 1ZW0A 1DL6A 1Q2NA 1TFIA 4RV9A 2JWDA 1S3JA 3KIHA 3P5JB 2GU2A 4JBZA 5C3EI 1YIJ1 4GOFA 1LP1A 2O4HA 3NDJA 3LUSA 3CCJZ 4A3FI 1Q822 1X3ZA 3CME1 4NBDA 3I56Z 1VQNZ 4A3MI 3CCLZ 1R9TI 4DGLA 4NPDA 3KIFA 2KUBA 2QRXA 2J6AA 1WCMI 3FQQA 2P58A 3OW2Y 5FLMI 3CCV1 1JJ2Y 4X6AI 3BG1B 1VQ5Z 2OOXB 1N8R1 4MD8A 4IOIH 5C39A 2QA41 1VQ9Z 1W2BZ 2RKLA 3CPWZ 1TWAI 1YJ91 4ASWA 3PO3S 4MH4A 1LP1B 1YITZ 3IX0A 5FLXf 1NJI2 1YI2Z 1VQ41 2B88A 2E9HA 2QKDA 3FXEA 4A3II 2O53A 1VQKZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBN A;  1DEE G;  1EDJ A;  1Y47 A;  1H0T A;  4HJG H;  1OVU A;  2KZJ A;  5CBO A;  1JMB A;  2KS1 B;  5DJT B;  2SPZ A;  3ZDM A;  3MHV A;  2HR3 A;  2B89 A;  2K3R A;  2KI7 B;  1BDC A;  4HKZ H;  1OVR A;  4HB1 A;  2WMM A;  3FXD A;  2KIK A;  4MN4 C;  1ZW0 A;  1Q2N A;  4ZMD A;  2JWD A;  1S3J A;  2OTK E;  2M5A A;  2KZI A;  4JBZ A;  4CPG A;  4GOF A;  2B87 A;  1LP1 A;  4EYY Q;  1ZXG A;  4WWI A;  4NPE A;  1EDL A;  2QVA A;  4GOD A;  4NPF X;  3QWO C;  1NVO A;  1MFT A;  1OVV A;  5DJU B;  2M0B A;  1BDD A;  2R44 A;  1U7M A;  3RGU A;  4NPD A;  1LT1 A;  2KUB A;  4ZNC A;  2QRX A;  2LXB A;  1H0T B;  2P58 A;  1FC2 C;  2LR2 A;  2LXC B;  1EC5 A;  2I8D A;  1JM0 A;  3MZW B;  1U7J A;  4KJM A;  1SS1 A;  4BXL A;  1EDI A;  2Q1K A;  4GOE A;  4IOI H;  5C39 A;  1X0T A;  2M5A B;  2RKL A;  3S1K A;  4ASW A;  3PH0 A;  2B87 B;  1EDK A;  1LP1 B;  4K35 A;  4ASV A;  5K5G B;  5EFW B;  2B88 A;  2UWJ E;  3FXE A;  4K3A A;  2ZAE B; 
#chains in the Genus database with same CATH topology
 5KAF H;  4QTU A;  3SWK A;  2K88 A;  1LWU C;  4EWC A;  1FZE A;  3JC2 2;  1QVF O;  2SPZ A;  3CCR 1;  1Q81 1;  1RF0 A;  2PP6 A;  3HUS C;  3CXH D;  2B89 A;  4L75 A;  1SFC B;  1SP4 A;  2KB7 P;  3CD6 Z;  4UB6 E;  4IFF A;  3F3P C;  3I56 1;  3P8M C;  1AVY A;  1K8A 1;  3MP7 B;  4GKG A;  2NAP A;  4RJT A;  3QH9 A;  1Z02 A;  2RPR A;  3MZL B;  5AVZ B;  1DEB A;  2JP3 A;  3I55 1;  1VF5 D;  2A06 D;  3CCV Z;  3HE4 A;  2RBL A;  3IR9 A;  1AFO A;  1RE4 C;  1E5W A;  2ZXE B;  5AW1 B;  2M5A A;  3CCM 1;  4KHX A;  2BCC J;  4U7J A;  1CZQ A;  1IJD B;  4NPE A;  4A3J I;  1PPJ G;  4E2X A;  2AYD A;  3CMA 1;  1Q86 1;  4HGZ A;  3S2D I;  2H89 C;  1IFD A;  3J80 f;  1K73 2;  1U7M A;  3WUT A;  1K05 A;  1VQM Z;  3NXS A;  1HVV A;  3SSU A;  3I4N I;  2LXB A;  5KLV D;  1KQS Z;  2Q9I A;  5KLV K;  2V3V A;  2R6M A;  3C9I A;  2V8I A;  2WPR A;  2LR2 A;  3TDH B;  2IBZ D;  1RQU A;  3H1J J;  1NTM J;  4BY1 I;  5APW A;  2OOY B;  1HF9 A;  1GL2 C;  4W7Y A;  1EZV G;  1SQX D;  2PK7 A;  1SQX K;  3R4Y A;  3K5B A;  2FYU D;  2OQQ A;  4U3F D;  2FYU K;  1VQO P;  5GTI E;  2WSC J;  2K9J A;  3J80 b;  5KLI B;  4NB9 A;  2AXC A;  1TWG I;  3GTO I;  1X8Y A;  1PP9 E;  2ZJS E;  4XX2 A;  3L75 J;  1HJB A;  1FE6 A;  1H0T A;  1SQQ D;  1SQQ K;  2E74 B;  3JCU E;  1NTK J;  4XFJ A;  1X9V A;  2WQY C;  2Y9Z A;  1JUN A;  1NAY A;  5CHX A;  2I1K A;  2H43 A;  1KD1 Q;  4N78 D;  2KI7 B;  2A45 I;  1FU1 A;  1BCC E;  3GTM S;  3NFZ A;  2QLV B;  3H1H G;  3H0G I;  2E75 B;  4MON A;  2WPV B;  3OAK A;  3AEB C;  1M90 2;  2W90 A;  3A0B E;  2NPS D;  2MJZ A;  3H1K D;  3G9R A;  3G4S Z;  2E42 A;  3CWB G;  2ZYD A;  5A2Q f;  4YXD C;  5CJ0 A;  1KD1 1;  5BU8 B;  1S9K E;  1NWQ A;  2N1T A;  1MFT A;  1FZB A;  3M0A A;  3V2N A;  3CC4 P;  3CXC Z;  4RVD A;  1X3W A;  2BCC E;  2KS1 A;  1VQP Z;  3D9X A;  5A2Q b;  5AVX B;  1USP B;  2JS4 A;  1JTH A;  3IFM A;  2Q1K A;  2RHB A;  1Q81 2;  2N1T D;  4NOZ A;  5LL6 f;  3GHG A;  2QJP B;  3J7A 4;  2OYI C;  2M6N A;  3RZD I;  1TWF I;  4A3E I;  2RH0 A;  3SWF A;  3VP8 A;  1SIW A;  1K8A 2;  2IV2 X;  3RL0 g;  1PGP A;  2OTL 1;  1S72 1;  1FDO A;  4HJG H;  1JJ2 Z;  2W03 A;  2QRD B;  3WU2 E;  1QXF A;  1KRL A;  1VQ8 P;  3AE2 C;  2JJL A;  1VQ7 Z;  3V2P A;  1EXJ A;  1YBK A;  5KKZ B;  1G2C A;  1PIX A;  1HGZ A;  1SQB K;  1S5L X;  3B8E B;  2IBZ G;  3L75 E;  1LTJ B;  2E76 D;  4A3C I;  1Y1V S;  1Q86 2;  1SQV E;  1LT9 A;  5AW6 B;  1FOS F;  1Q16 A;  1KZU B;  1N7S A;  1IK9 A;  3CC4 Z;  3CC7 Z;  2HPC A;  2BEQ D;  2XKM A;  4MN4 C;  2O3J A;  4Y99 B;  2NVY I;  1ZV8 A;  5C4J I;  2FFD A;  3VB9 A;  2QRC B;  4AUW A;  1N73 A;  3CCQ P;  2M8R A;  4EDF A;  1PV3 A;  2OAR A;  3UIA A;  1EXI A;  2XZR A;  4WWI A;  1FBM A;  2D2C D;  3L70 D;  2BJO A;  3EQ2 A;  3M9B A;  1N7S D;  2DE6 A;  5APT A;  4ZKU A;  1J1E B;  2J58 A;  1GK6 A;  4A7P A;  2OTJ Z;  3AEA C;  3A7O A;  1KYO E;  4D6T D;  1SFC C;  3CCU P;  2O01 N;  1M57 D;  3CWB J;  2O01 J;  3NH4 A;  1VQ8 Z;  3H1K G;  2OYH A;  2PFX A;  3G6E 1;  3CPW Y;  1X0T A;  1QVG O;  2XDJ A;  1K83 I;  1ML8 A;  1NOH A;  3WMM 0;  3CCJ 1;  3CCE P;  1M1J A;  1L4A B;  1JWH C;  3CXH H;  1PFI A;  4RVG A;  1S5L H;  1FOS E;  4N3Y B;  3MUD C;  5AVQ B;  3KZI E;  5CBN A;  1DEE G;  1Y47 A;  3TNU B;  3RK3 B;  1Y1W I;  2WSE H;  2C9L Y;  3S15 I;  4MRI A;  2JUB A;  2J59 M;  1FZC A;  1BGY G;  1PGO A;  5APV A;  4TLF A;  3BCC D;  3HTK A;  2ZT9 D;  1KD1 2;  4L74 A;  3N7N A;  2WTY A;  3OW2 O;  1ZP0 C;  1URQ D;  2XU6 A;  1QVG Y;  2HF1 A;  1EZV E;  3HKZ A;  4NBH A;  1YJN 1;  3H25 A;  1MUU A;  1NGM B;  3P7K A;  5TIS H;  1IC2 A;  2P1J A;  3CME P;  3KIH A;  4H0L D;  4JBZ A;  3RK2 B;  1GL2 B;  5KLI C;  2Q5U A;  1Q7Y Q;  1LP1 A;  2O4H A;  3LUS A;  4A3F I;  1Q82 2;  1S4X A;  1X3Z A;  3IF4 A;  3MGN A;  3I56 Z;  1N7L A;  1H89 A;  3TK1 A;  4A3M I;  1SQB G;  3HD7 B;  2QRX A;  1FAV A;  2P58 A;  3OW2 Y;  2CPS A;  1Y8C A;  4OGQ D;  1X22 A;  2RMZ A;  2ZYG A;  2OOX B;  2WT7 A;  2YXQ B;  3AE6 C;  3SWY A;  3MIW A;  4MD8 A;  2E75 C;  1HUC A;  4IOI H;  1VQ4 P;  5C39 A;  1FDI A;  1H88 A;  3GMA A;  3CI9 A;  2RKL A;  2KNC B;  3CPW Z;  3PLN A;  1TWA I;  1M56 D;  3IX0 A;  1YJW P;  1NTZ G;  2A45 H;  1BSN A;  1D7M A;  4GDO A;  2B88 A;  1JB0 J;  4H44 B;  2WPS A;  1L0N D;  3L70 G;  1IK7 A;  1L0N K;  3C8V A;  3B5N A;  2OYO A;  1JMB A;  4TT3 H;  2YO2 A;  3BAS A;  4E30 A;  3ZDM A;  2JA8 I;  1ZR4 A;  3CCL P;  1NKN A;  2VPY A;  3E7K A;  3L71 J;  2B63 I;  2W83 C;  3H1K J;  3RK3 E;  1KYO I;  5AVT B;  4AYB A;  3U1A A;  2AKL A;  2W6J H;  3IF8 A;  1J1D B;  1GD2 E;  3ABV C;  5GTH H;  2KSJ A;  1VQ5 P;  2NZ2 A;  3PO3 I;  3GTQ I;  2Y0C A;  3B5N D;  2VF1 A;  1HBW A;  5C4X I;  3TGU G;  4A3K I;  4R4M A;  1VQ9 P;  3FWL A;  4UB6 H;  2WSF J;  5CMZ A;  1PGQ A;  2QJP C;  1BGY J;  2WIT A;  2PM9 A;  2B87 A;  2QJK B;  3GW6 A;  1ZXG A;  1RH5 B;  3PJS K;  4NPF X;  1VQK P;  1LTJ A;  1VQ4 Z;  2W6B A;  1YI2 1;  4I2L C;  2OYI B;  2R44 A;  1JO5 A;  3BCC G;  3RL0 B;  1LTG C;  1KQS O;  2JR8 A;  1YJW Z;  3C1L A;  1N86 A;  5AW0 B;  4NB8 A;  1FC2 C;  5KKZ C;  3CD6 P;  2VUG A;  3CC2 1;  2J5U A;  2Y0S A;  2K1A A;  1EZV I;  1JEK A;  1L0L E;  1OW8 A;  2FY8 A;  4A93 I;  2R32 A;  3CCV P;  1VQL 1;  5AVU B;  1YHQ 1;  5CCH C;  3Q87 A;  5IP9 I;  4Y99 C;  3LW5 H;  2UWJ E;  3ITK A;  3L73 D;  1SQB J;  4BXX I;  4W80 A;  5KJ7 D;  1RE3 C;  1LWU A;  1QF8 A;  3VOP A;  1KQF B;  4L76 A;  5AW9 B;  5GTI H;  4C7N B;  3U50 C;  2Q51 A;  1LJ2 A;  3HUS A;  5AVW B;  4HKZ H;  1VQM P;  5D1O A;  1J1E C;  3VTP C;  4BRY A;  3EFF K;  4W7Z A;  1FZA A;  2WWW A;  2V7Q H;  3MTU E;  4C46 A;  1JY2 P;  2R5B A;  3JCU H;  5AVS B;  2LEX A;  3CCQ 1;  1NTZ J;  3L72 J;  1EQ7 A;  3FGA D;  3TNU A;  1ZRT E;  3L70 J;  2LFU A;  3L71 E;  3BG0 B;  4NBC A;  5T64 A;  1RE4 A;  2Y0D A;  3A0H E;  4ZMD A;  4Y52 I;  1NU1 D;  4YTP C;  3HOU I;  1L0N G;  1NU1 K;  1L4A C;  3L74 D;  4I1L A;  2R3S A;  4AYC A;  3A0B H;  1W2B Y;  1RQV A;  3CCU 1;  1AA0 A;  3RK3 C;  2H85 A;  5BU5 A;  3D6W A;  2IZ1 A;  1BGY E;  2VRS A;  4XA4 A;  2KLV A;  1HH0 A;  4PD4 E;  2QSI A;  1VQ6 P;  1EC5 A;  3CQZ I;  4E32 A;  3CCE 1;  2P2U A;  3TGU J;  1KV4 A;  5APU A;  3AE5 C;  1GL2 A;  2QEX 1;  1SQP G;  2K37 A;  2F4O A;  2RT9 A;  3H1I E;  2RIQ A;  1QVF Y;  5AN9 F;  4I7Z B;  1NJI Q;  2JO1 A;  2IFM A;  3G4S P;  3PTZ A;  5EFW B;  3Q3D A;  4RVF A;  3EFG A;  4MD7 A;  1PGJ A;  1T3U A;  3BCC J;  3CCS P;  3H1L D;  1T3J A;  2V8J A;  3G71 1;  3RK2 C;  4I6M C;  2P28 A;  1A02 J;  3AEE C;  3VP9 A;  3R2P A;  2I1J A;  3CL3 D;  4WY4 B;  3PP5 A;  4H13 D;  1Z01 A;  3SFE C;  3W68 A;  3G6E Z;  3D70 A;  3HD7 C;  1H8A A;  2F4M A;  1VQP P;  1NJI 1;  3T97 A;  3WU2 H;  1QYP A;  3F89 A;  4MXU A;  2WMM A;  1LTT C;  3S17 I;  1MKM A;  1KC8 Q;  3PRJ A;  4NH1 C;  2JIM A;  3S16 I;  4PV1 D;  3MZK B;  2GTH A;  4IL6 E;  3KDP B;  1OZH A;  3L73 G;  3WUU A;  4OVN F;  1VQ6 Z;  1AVO A;  1NAF A;  5AW8 B;  1NYH A;  5AW4 B;  3GCF A;  1NTZ E;  3L72 E;  2GTI A;  2ZVN B;  4H44 C;  1A02 F;  1LTB C;  3G3Z A;  1VQ7 P;  3AED C;  1Y1V I;  3S1M I;  2QJY B;  1KC8 1;  3NDI A;  1BE3 D;  2ZVO B;  2IZ3 A;  1KIL B;  5BVZ A;  2AEJ A;  3CCS Z;  4RVH A;  3KXD A;  4JYC A;  4O9B A;  1IZN B;  1ZLL A;  2NPS C;  3IN6 A;  1EDI A;  5AW5 B;  2KSE A;  1P84 E;  4GOE A;  1J1D C;  3HRN A;  4CL1 A;  3HE5 A;  3CC7 P;  2H8P D;  3Q5R A;  1WJ2 A;  1EDK A;  2OYI A;  4K35 A;  2Y9Y A;  4ASV A;  3FKI I;  1WMK A;  3TGU E;  1VQN 1;  1KYO H;  2KLU A;  3JAM f;  3MON A;  3CCL 1;  5KTB A;  3S4R A;  5T67 A;  4A3D I;  3VTN A;  1JNM A;  2A06 G;  2QJK C;  4S1T A;  4NBG A;  2NVX I;  3PO2 I;  3D2L A;  3GTK I;  3S9O A;  2B9B A;  1HGV A;  4WBA A;  3F3F C;  4Y7N I;  3GKQ A;  1JOC A;  4PD4 D;  2E7Z A;  4PD4 I;  2PAJ A;  1SQP J;  4HYT B;  3M9Q A;  4QTT A;  1YIT P;  1USE A;  3H1J E;  1NTM E;  3KZI H;  3RL0 C;  2QE7 H;  2OTJ P;  3AEG C;  3A5T A;  1VQ9 1;  1TU3 F;  1W2E A;  1JY3 O;  2ZXX A;  1I50 I;  1CI6 A;  2JR6 A;  1KB9 E;  3O6Q A;  3PHL A;  4WB4 A;  1YIJ P;  1VQK 1;  1DD3 A;  5KLV G;  1TFI A;  1N8R Q;  1S3J A;  2BAS A;  2WZ7 A;  3A3Y B;  2G8Y A;  1SQX G;  1OFC X;  2R5D A;  1NTK E;  1Y8A A;  2H88 C;  2FYU G;  4NBD A;  4OWF A;  4U3F G;  4QMA A;  1SVF A;  1R9T I;  3H32 B;  4NPD A;  3B4S A;  1S1C X;  1WCM I;  1PP9 D;  1R8E A;  3CCV 1;  4X6A I;  1SQQ G;  1NO4 A;  1SFC A;  1GDT A;  1YJ9 P;  1N8R 1;  3Q5S A;  3L73 J;  3H1H J;  1JY3 P;  1OW6 A;  2QM8 A;  3V4Q A;  2A45 G;  1BCC D;  4MH4 A;  1YIT Z;  1NJI 2;  1YI2 Z;  3BRT B;  3AEF C;  2E9H A;  4LLH A;  3FXE A;  2D2C C;  2QKD A;  3MUD A;  2O53 A;  1S2E A;  5H2F E;  2AXT E;  1RF1 B;  1SFC D;  1T2K C;  3CC2 Z;  2C9N Y;  1YIJ Z;  3I56 P;  2DE7 A;  2JA6 I;  2P67 A;  3MHV A;  1JY2 N;  2FFD C;  2FXO A;  2HR3 A;  1NP6 A;  2K3R A;  2YXR B;  1WRG A;  1S9K D;  1VQL Z;  3HOX I;  1P84 I;  3W67 A;  2YNY A;  2OZK A;  3TF5 A;  5T6B A;  3CCM P;  1PPJ E;  1SQP E;  1KC8 2;  2BCC D;  2PMZ A;  1RO2 A;  3CMA P;  1AQT A;  4I7Z C;  1VF5 B;  2QA4 Z;  3AE9 C;  3AE3 C;  1YJ9 Z;  2QIW A;  1VL2 A;  1N2F A;  3H6P A;  2POH A;  3RBX A;  5AVV B;  1ZB9 A;  1R5L A;  4NBB A;  1WW9 A;  1ZOY C;  4DT0 A;  1NTM D;  1JCD A;  2Y0E A;  1NTM K;  1URQ C;  1LNQ A;  4WY4 C;  1RY3 A;  2VPW A;  3CCR Z;  4EOT A;  3G4S 1;  3HE4 B;  5KLV J;  5B66 E;  4KJM A;  4E2Z A;  1KB9 D;  4DK1 A;  1KB9 I;  4DCK A;  2M5A B;  1SQX J;  4H0L C;  3V6I A;  3PH0 A;  3KYQ A;  3RBZ A;  3BVH A;  5D1P A;  3L75 D;  2V8K A;  2FYU J;  2G3A A;  3QWU A;  4U3F J;  2E74 D;  4NBE A;  1SQV D;  3I55 Z;  4K3A A;  1VQO 1;  1SQV K;  2YKO A;  1OXZ A;  4A3B I;  1LTA C;  2W04 A;  3GTJ I;  1ZB8 A;  1IFJ A;  3H1H E;  2GUS A;  3CCM Z;  1OVU A;  1VQP 1;  1AV1 A;  4UB8 E;  5AW2 B;  1Q7Y 1;  2Z5I A;  3E1R A;  2HOD B;  1SQQ J;  2E75 D;  1LTS C;  3NH5 A;  1OIP A;  2QEX Z;  2QR1 B;  3J81 f;  3CMA Z;  4C7R A;  5APS A;  1BDC A;  5E79 E;  5KAI E;  3VMA A;  3CWB E;  1N2D C;  3OJA B;  5L8R J;  2JKV A;  2QJY C;  3GTL I;  1GZL A;  1YTZ T;  2QM7 A;  2YO3 A;  4RS4 A;  2E2H I;  1KIL C;  5CCG C;  4RKU J;  4HB1 A;  3Q5P A;  1K73 Q;  2K9J B;  1USP A;  1XTG B;  1WT6 A;  3L36 A;  3I5C A;  1BCC G;  3AE1 C;  2QG4 A;  2HU9 A;  1ZR2 A;  3EER A;  2KK7 A;  1AQ5 A;  3KPE A;  1KYO D;  2KZI A;  4NFR A;  2JA5 I;  3JSV C;  4D6T G;  3U59 A;  1N8R 2;  2NPS B;  2O1J A;  3D6Z A;  2C0X A;  4GOD A;  3Q2Y A;  1L1O C;  1HJ0 A;  4JQ0 D;  1JMM A;  3VMZ A;  2M0B A;  1NKZ B;  2W8Z A;  1S7M A;  1QVG Z;  1P9N A;  3FWN A;  3A0H H;  2V4H A;  1SFO I;  3CC4 1;  1Q90 D;  3CC7 1;  2CK3 H;  2IZ4 A;  3IFU A;  1JM0 A;  1GU5 A;  3M4O I;  1VDF A;  1MV8 A;  2WSF H;  2BCC G;  3Q1M A;  1UIX A;  5CM2 M;  2K5R A;  2OTL P;  3M0D C;  4PD4 H;  5CCH A;  2N1T B;  4A3L I;  5KLV E;  3GTG I;  1JY2 O;  2ZAE B;  3OW2 Z;  1EDJ A;  1NHL A;  1M90 Q;  2IBZ E;  1QLE D;  1RE3 A;  1EZV D;  4BBR I;  1SQX E;  2KS1 B;  3GF7 A;  2GUV A;  1QX8 A;  3AE7 C;  3TDK A;  3M3Y I;  2KPI A;  2FYU E;  1YQ3 C;  4U3F E;  1VQ8 1;  1JTH B;  2WSS H;  1Y9B A;  1OX3 A;  5CCH D;  4JF7 A;  2K9Y A;  3VYI A;  3LW5 J;  4EIJ A;  2CPB A;  2Q7C A;  1SQQ E;  1GU4 A;  4GT1 A;  2E76 B;  2ZYA A;  2KIK A;  3EED A;  2YU9 I;  2ITA A;  1M90 1;  1K04 A;  3M9H A;  1KQS Y;  3D6Y A;  2XND H;  1SQV G;  1FJK A;  2NVT I;  4N78 E;  5KJ7 C;  1HWT C;  3T4N B;  2O1K A;  4DJG A;  1PZQ A;  2E5Y A;  1L4A A;  1EDL A;  2N9B A;  1G1J A;  1J2J B;  3VMY A;  1OVV A;  1G2C B;  2R7Z I;  4HH2 A;  1ZH1 A;  2OTL Z;  1FS0 E;  1RF1 C;  1S72 Z;  3H1K E;  2D2C B;  2LKM A;  1LT9 B;  4ZNC A;  1K9M Q;  3S14 I;  1L2P A;  1JY3 N;  4RES B;  1N7S B;  2IX7 C;  3G6E P;  1KFN A;  2HPC B;  1M1K Q;  1SLQ A;  1KQL A;  2PGD A;  2MKV A;  5GTH E;  3CCJ P;  1Q7Y 2;  1L4A D;  4BXL A;  5B5E E;  2G2K A;  2GA1 A;  3F5H A;  2FFD B;  4D6T J;  1I3Q I;  1N73 B;  2Q6Q A;  3BRV B;  3GTM I;  3CXH I;  3RK3 D;  3V2Q A;  1Q86 Q;  5K5G B;  2DW3 A;  3D71 A;  3CX5 E;  2VUM I;  1K9M 1;  1VF5 C;  2W27 A;  4DQY B;  1P84 H;  4OH8 B;  2KZJ A;  3NMD A;  3LID A;  1M1K 1;  1RF0 C;  3USS A;  2JDI H;  2M48 A;  2LIY A;  1M8O B;  1OVR A;  1VLA A;  4BY7 I;  4E2Y A;  3HD7 A;  2JEE A;  2OYH B;  3AE8 C;  3VMX A;  1YJN P;  3KQG A;  3CXC Y;  3EWK A;  2ZT9 B;  2QRE B;  1M1J B;  1FZG A;  3RK2 D;  1GL2 D;  3MD0 A;  4JYB A;  1URQ B;  2V45 A;  3S1R I;  1M7L A;  1ZW0 A;  1Q2N A;  4RV9 A;  3U1C A;  2HOD A;  1SQB E;  2KNC A;  1WZN A;  4WVZ A;  5C3E I;  1KQG B;  2IBZ I;  2Q3I A;  2KOG A;  1FZC B;  3CCJ Z;  3HD7 D;  1LTI C;  1DIP A;  1L0L D;  2IFN A;  3CME 1;  1L0L K;  4H13 C;  2N9Y B;  4H0L B;  2VPX A;  2WSC H;  2JIR A;  1KB9 H;  3HTK B;  3KIF A;  5AW3 B;  1YQ4 C;  1DX7 A;  2RN0 A;  2AEF A;  3B71 A;  3L4F A;  4PJ0 E;  3SFD C;  1JJ2 Y;  1UII A;  2AEM A;  5KAF E;  1SQV J;  3VN0 A;  2NPS A;  2YKP A;  4PV1 C;  1NH4 A;  3L70 E;  2WVR A;  4OGQ B;  1W2B Z;  3KHU A;  4H44 D;  2M3E A;  1T6A A;  4ASW A;  1LP1 B;  4JPZ B;  3LIE A;  5FLX f;  1G1I A;  3II6 A;  1VQ4 1;  1HTL C;  1YJN Z;  4D6T E;  2P10 A;  1YJW 1;  1ZRT D;  2XNX A;  3L71 D;  1L0N J;  3VMH A;  2E5T A;  5AW7 B;  4YPC A;  5AVY B;  3FQM A;  3IAO A;  1QVF Z;  1YTZ I;  3AEC C;  2W6A A;  1NU1 G;  2WT7 B;  2ZFC A;  1RO4 A;  4B86 A;  1Q82 Q;  2FYZ A;  5FLX b;  4AQR D;  2E2J I;  3L74 G;  2JIQ A;  5H2F H;  2YIU B;  2AXT H;  1X79 B;  2M3B A;  1E79 H;  1IFI A;  1OWA A;  1VQO Z;  3V2R A;  1BGY D;  1GW3 A;  3CX5 D;  2WAQ A;  4E2W A;  3CX5 I;  1VQ5 1;  2KXP B;  2L91 A;  3BCC E;  3HOZ I;  2R92 I;  3B5N B;  1YI2 P;  4CPG A;  2Z4E A;  3RL0 D;  2IYP A;  2N1T C;  3H1I D;  3I07 A;  1IFP A;  2YAD A;  3JAM b;  1Z56 A;  5DJU B;  3O8Z A;  1GW4 A;  1Q82 1;  3L35 A;  5M1B A;  1QL1 A;  1JCC A;  3CC2 P;  2EGT A;  4XE5 B;  2HG5 D;  1RO0 A;  1KMI Z;  4NBA A;  4C7N A;  1K9M 2;  3CLQ A;  1VPC A;  2LXC B;  3H1L G;  2I8D A;  1U7J A;  1M1K 2;  1VQL P;  1YHQ P;  2YKQ A;  3CD6 1;  2JNY A;  3GHG C;  3S1K A;  3RZO I;  1GMJ A;  3V5B A;  1GK4 A;  1OW7 A;  1SQB D;  2OGU A;  3FX0 A;  2B87 B;  2P7J A;  2JIP A;  2E76 C;  1CW5 A;  3GG2 A;  1L0L G;  1QGK B;  3M06 A;  5B66 H;  2QA4 P;  1PFT A;  1KTM A;  1AA6 A;  5DJT B;  3H3V J;  3CPW O;  1KIL E;  2NRG A;  3P32 A;  2H7H A;  1KN7 A;  2L5G B;  2JA7 I;  1NTZ D;  3L72 D;  2FYN B;  1NTZ K;  2HYN A;  1LT9 C;  2XV5 A;  3CCR P;  5APY A;  3P8C E;  4TNU A;  1L0N E;  1N7S C;  1VQM 1;  4UB8 H;  1TWC I;  2BEZ F;  1T2K D;  3VMI A;  5E79 H;  5KAI H;  1BE3 G;  2FKW B;  4KT0 J;  1N73 C;  4DOJ A;  1R5S A;  2O01 H;  1LWU B;  3TE5 B;  2WB1 A;  3I55 P;  4EYY Q;  3L37 A;  4BWN A;  2I3C A;  1YHQ Z;  1NVO A;  2JIO A;  1NU1 J;  4BBS I;  1P84 D;  1RNI A;  3L71 G;  3HUS B;  3GTP I;  5IT9 f;  3L74 J;  1QL2 A;  1LQL A;  5D1O B;  2R3C A;  2WSE J;  2P3Y A;  4BRY B;  3TGU D;  2QEX P;  5CJ4 A;  3TYY A;  1URQ A;  4R4L A;  4WY4 A;  4MD9 A;  2Z5H A;  4IFD K;  4YXW H;  1RQF A;  1U57 A;  3ESW A;  3MZW B;  1W5C E;  2OYH C;  1IO4 A;  1VQ6 1;  5IT9 b;  2ZT9 C;  2DE5 A;  1M1J C;  2KYV A;  3CCQ Z;  3G71 P;  3H1J D;  1IFM A;  4RO0 A;  1FJP A;  2NVQ I;  4LGD E;  3H1I G;  1YUA A;  4WY4 D;  1WII A;  4Y28 J;  2E43 A;  2YMY A;  5CBO A;  1FZC C;  3E1I A;  3H1L J;  2YMK A;  2JMO A;  3CCS 1;  2VPZ A;  3N4X A;  4LC1 A;  1XTC C;  3CCU Z;  2GM4 A;  1CSB A;  3IR7 A;  4H13 B;  1NTK D;  3L73 E;  1MZ9 A;  1NTK K;  2HFE D;  1KIL A;  5CCG A;  3FXD A;  5TJH A;  4HGY A;  1L0L J;  4A3G I;  3CCE Z;  2E74 C;  2FXM A;  2KP8 A;  3WUV A;  3OA7 A;  3GLM A;  1OMI A;  4OGQ C;  1PP9 G;  1I6H I;  2IZ0 A;  4Z1M H;  5APX A;  4PV1 B;  3I4M I;  2QVA A;  4GIF A;  3QWO C;  1RLY A;  2Q4Z A;  3V4W A;  1BDD A;  1KIL D;  5CCG D;  1DD4 A;  2C0W A;  4E33 A;  3RGU A;  3G71 Z;  1Z03 A;  3T97 B;  1LT1 A;  1YUK A;  3L72 G;  2R93 I;  1LGH B;  1H0T B;  3J81 b;  3CXH E;  3M91 A;  3P8C D;  1S5L E;  1NU1 E;  1VQ7 1;  1TWH I;  3TSI A;  1BE3 J;  3L74 E;  1SS1 A;  2IYO A;  4L73 A;  2YIU C;  4DZO A;  3S1N I;  3HOV I;  1VQN P;  4HH4 A;  3S2H I;  4N6J A;  1T8Z A;  2A06 E;  3CME Z;  3M0D A;  1K73 1;  3VMG A;  5C44 I;  2OTK E;  3NTN A;  5B5E H;  3B5N C;  1KOR A;  1PPJ D;  5IP7 I;  1SQP D;  3K7A I;  1SQP K;  4IFM A;  3HOW I;  1FDM A;  3GF3 A;  4NBF A;  1NUI A;  4IL6 X;  3CX5 H;  4E31 A;  1PL5 A;  1S72 P;  5TIS E;  3NH8 A;  3H32 A;  1KFM A;  4EI2 A;  3HE5 B;  2PRR A;  3H1L E;  1YIT 1;  2JWA A;  1QEX A;  1AJY A;  3S1Q I;  3BAT A;  3HOY I;  2OTJ 1;  4ZKP A;  3H1I J;  1USD A;  2E2I I;  3H1J G;  1NTM G;  1DH3 A;  1DL6 A;  2JWD A;  3P5J B;  2GU2 A;  5KJ7 A;  1ZN5 A;  1YIJ 1;  4GOF A;  3NDJ A;  1LTJ C;  3GHG B;  2HLO A;  1VQN Z;  2FXP A;  3CCL Z;  4DGL A;  1RF1 A;  2IPP A;  3L75 G;  4M3L A;  1GTW A;  5APQ A;  2KUB A;  1FZF A;  2J6A A;  3FQQ A;  1NTK G;  5AVR B;  5FLM I;  1CI6 B;  3A2A A;  3BG1 B;  3H1H D;  1VQ5 Z;  1Q81 Q;  2WPQ A;  3O6Q B;  1PP9 J;  1MFZ A;  2FYN C;  2IDB A;  1RHZ B;  3NFQ A;  1W2B O;  2QA4 1;  1VQ9 Z;  2V7Q J;  1BSH A;  1YJ9 1;  1YYC A;  1K8A Q;  3PO3 S;  3AE4 C;  2Q3E A;  4IL6 H;  3CWB D;  1IFN A;  1ZME C;  4PJ0 H;  4A3I I;  1BE3 E;  2FBW C;  1BCC J;  1VQK Z; 
#chains in the Genus database with same CATH homology
 1YJN Z;  4QTU A;  1YJW 1;  4EWC A;  1JMB A;  3CC2 Z;  3VMH A;  1YIJ Z;  3FQM A;  2SPZ A;  2DE7 A;  4E30 A;  3CCR 1;  2JA6 I;  1Q81 1;  3ZDM A;  3MHV A;  1QVF Z;  2JA8 I;  2HR3 A;  2B89 A;  1NP6 A;  2K3R A;  2B63 I;  3CD6 Z;  1RO4 A;  3F3P C;  5FLX b;  3I56 1;  2E2J I;  4AYB A;  2AKL A;  1K8A 1;  3IF8 A;  1VQL Z;  3HOX I;  2OZK A;  1Z02 A;  2RPR A;  3MZL B;  5T6B A;  1VQO Z;  3PO3 I;  3GTQ I;  3I55 1;  3CCV Z;  2RBL A;  2VF1 A;  1KC8 2;  5C4X I;  2PMZ A;  4A3K I;  2WAQ A;  4E2W A;  1VQ5 1;  1RO2 A;  2M5A A;  3CCM 1;  3HOZ I;  2QA4 Z;  2R92 I;  2PM9 A;  4CPG A;  2B87 A;  1ZXG A;  1YJ9 Z;  4NPE A;  4A3J I;  4NPF X;  4E2X A;  3I07 A;  1N2F A;  2YAD A;  3JAM b;  4HGZ A;  1Q86 1;  3CMA 1;  3S2D I;  5DJU B;  1Q82 1;  1VQ4 Z;  1YI2 1;  2R44 A;  3J80 f;  1K73 2;  1ZB9 A;  1U7M A;  2EGT A;  4NBB A;  1WW9 A;  1VQM Z;  1YJW Z;  1RO0 A;  3I4N I;  2LXB A;  1KQS Z;  4NBA A;  2R6M A;  4NB8 A;  2V8I A;  1K9M 2;  1FC2 C;  2LR2 A;  3CCR Z;  2LXC B;  2VUG A;  3TDH B;  3CC2 1;  2Y0S A;  3G4S 1;  4BY1 I;  2I8D A;  2OOY B;  1U7J A;  4KJM A;  2PK7 A;  1M1K 2;  4E2Z A;  4DK1 A;  3CD6 1;  2JNY A;  2M5A B;  3S1K A;  3RZO I;  4A93 I;  3PH0 A;  3J80 b;  2B87 B;  1VQL 1;  1YHQ 1;  5D1P A;  2V8K A;  3Q87 A;  4NB9 A;  3QWU A;  5IP9 I;  4NBE A;  3I55 Z;  2UWJ E;  4K3A A;  1VQO 1;  1TWG I;  3GTO I;  4A3B I;  4BXX I;  4XX2 A;  1H0T A;  2W04 A;  3GTJ I;  1PFT A;  1ZB8 A;  3CCM Z;  1OVU A;  1QF8 A;  1VQP 1;  1Q7Y 1;  5DJT B;  3H3V J;  3U50 C;  2Q51 A;  3NH5 A;  2QEX Z;  2QR1 B;  3J81 f;  3CMA Z;  2KI7 B;  1BDC A;  4HKZ H;  3GTM S;  3NFZ A;  5D1O A;  2JA7 I;  2QLV B;  3H0G I;  3GTL I;  4MON A;  4RS4 A;  2E2H I;  4TNU A;  4HB1 A;  1VQM 1;  3CCQ 1;  1USP A;  1M90 2;  1TWC I;  2LFU A;  3G4S Z;  3VMI A;  3BG0 B;  4NBC A;  5T64 A;  4ZMD A;  2HU9 A;  5A2Q f;  3EER A;  4Y52 I;  2KZI A;  4NFR A;  2JA5 I;  3HOU I;  3TE5 B;  1N8R 2;  2WB1 A;  4EYY Q;  1KD1 1;  4GOD A;  1YHQ Z;  2I3C A;  1L1O C;  1NVO A;  4BBS I;  1MFT A;  1RNI A;  2M0B A;  1W2B Y;  3GTP I;  5IT9 f;  3CXC Z;  3CCU 1;  2H85 A;  1LQL A;  5D1O B;  1S7M A;  3D6W A;  1QVG Z;  1P9N A;  4RVD A;  2P3Y A;  1X3W A;  1VQP Z;  1SFO I;  3CC4 1;  3D9X A;  4MD9 A;  3CC7 1;  5A2Q b;  1RQF A;  1USP B;  1EC5 A;  3CQZ I;  2IZ4 A;  3IFU A;  4E32 A;  3CCE 1;  2JS4 A;  3ESW A;  1JM0 A;  3MZW B;  2QEX 1;  3M4O I;  2Q1K A;  2F4O A;  2RHB A;  2RT9 A;  1Q81 2;  2RIQ A;  1QVF Y;  4NOZ A;  1VQ6 1;  5AN9 F;  5LL6 f;  5IT9 b;  5CM2 M;  2K5R A;  2DE5 A;  3J7A 4;  2M6N A;  3CCQ Z;  3RZD I;  1TWF I;  4A3E I;  1K8A 2;  5EFW B;  4RVF A;  4A3L I;  2NVQ I;  4MD7 A;  3GTG I;  2ZAE B;  2OTL 1;  1YUA A;  3OW2 Z;  1EDJ A;  2V8J A;  1S72 1;  3G71 1;  1WII A;  4HJG H;  1JJ2 Z;  2W03 A;  2QRD B;  4BBR I;  1KRL A;  2P28 A;  5CBO A;  2KS1 B;  1VQ7 Z;  3M3Y I;  2KPI A;  3CCS 1;  2JMO A;  1Z01 A;  1VQ8 1;  3G6E Z;  3CCU Z;  2F4M A;  4A3C I;  1Y1V S;  1Q86 2;  1NJI 1;  1QYP A;  4MXU A;  3CC4 Z;  2WMM A;  3FXD A;  3S17 I;  4NH1 C;  3CC7 Z;  3S16 I;  2KIK A;  3EED A;  4HGY A;  2YU9 I;  4MN4 C;  4A3G I;  3CCE Z;  1M90 1;  3MZK B;  1KQS Y;  2NVY I;  5C4J I;  2GTH A;  3VB9 A;  2QRC B;  2NVT I;  1I6H I;  1VQ6 Z;  3T4N B;  3I4M I;  3GCF A;  4WWI A;  2GTI A;  1EDL A;  2QVA A;  3QWO C;  1OVV A;  1RLY A;  2R7Z I;  2BJO A;  2Q4Z A;  1BDD A;  1ZH1 A;  2DE6 A;  4E33 A;  2OTL Z;  3RGU A;  1S72 Z;  3G71 Z;  1Y1V I;  1Z03 A;  3S1M I;  1LT1 A;  4ZNC A;  1YUK A;  1KC8 1;  3S14 I;  3NDI A;  2OTJ Z;  2R93 I;  2IZ3 A;  1H0T B;  3J81 b;  3CCS Z;  1VQ7 1;  4RVH A;  1TWH I;  3NH4 A;  1VQ8 Z;  1Q7Y 2;  1SS1 A;  4BXL A;  2G2K A;  1EDI A;  3S1N I;  4GOE A;  3HOV I;  1I3Q I;  3G6E 1;  3CPW Y;  1X0T A;  4CL1 A;  1ML8 A;  1K83 I;  4HH4 A;  3GTM I;  3S2H I;  3CCJ 1;  3CME Z;  1EDK A;  1JWH C;  1K73 1;  4K35 A;  4ASV A;  5K5G B;  3FKI I;  3VMG A;  4RVG A;  1VQN 1;  3JAM f;  5C44 I;  2VUM I;  2OTK E;  3MON A;  5CBN A;  3CCL 1;  1DEE G;  1Y47 A;  1K9M 1;  1Y1W I;  5T67 A;  4DQY B;  4A3D I;  3VTN A;  2KZJ A;  5IP7 I;  3K7A I;  3S15 I;  4S1T A;  4MRI A;  2JUB A;  4NBG A;  2NVX I;  3PO2 I;  3GTK I;  1M1K 1;  3F3F C;  4Y7N I;  3HOW I;  3GKQ A;  4NBF A;  1NUI A;  2M48 A;  4E31 A;  2LIY A;  4QTT A;  1OVR A;  1VLA A;  1KD1 2;  4BY7 I;  4E2Y A;  3NH8 A;  1VQ9 1;  3CXC Y;  1YIT 1;  2QRE B;  1I50 I;  1QVG Y;  3S1Q I;  2HF1 A;  3HOY I;  2JR6 A;  2OTJ 1;  3HKZ A;  1VQK 1;  2E2I I;  4NBH A;  1YJN 1;  3S1R I;  1ZW0 A;  1DL6 A;  1Q2N A;  1TFI A;  4RV9 A;  2JWD A;  1S3J A;  3KIH A;  3P5J B;  2GU2 A;  4JBZ A;  5C3E I;  1YIJ 1;  4GOF A;  1LP1 A;  2O4H A;  3NDJ A;  3LUS A;  3CCJ Z;  4A3F I;  1Q82 2;  1X3Z A;  3CME 1;  4NBD A;  3I56 Z;  1VQN Z;  4A3M I;  3CCL Z;  1R9T I;  4DGL A;  4NPD A;  3KIF A;  2KUB A;  2QRX A;  2J6A A;  1WCM I;  3FQQ A;  2P58 A;  3OW2 Y;  5FLM I;  3CCV 1;  1JJ2 Y;  4X6A I;  3BG1 B;  1VQ5 Z;  2OOX B;  1N8R 1;  4MD8 A;  4IOI H;  5C39 A;  2QA4 1;  1VQ9 Z;  1W2B Z;  2RKL A;  3CPW Z;  1TWA I;  1YJ9 1;  4ASW A;  3PO3 S;  4MH4 A;  1LP1 B;  1YIT Z;  3IX0 A;  5FLX f;  1NJI 2;  1YI2 Z;  1VQ4 1;  2B88 A;  2E9H A;  2QKD A;  3FXE A;  4A3I I;  2O53 A;  1VQK Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...