2ZAEB

Crystal structure of protein ph1601p in complex with protein ph1771p of archaeal ribonuclease p from pyrococcus horikoshii ot3
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
EKKEKKKIAIERIDTLFTLAERVARYSPDLAKRYVELALEIQKKAKVKIPRKWKRRYCKRCHTFLIPGVNARVRLRTKRMPHVVITCLECGYIMRYPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 1
publication title Structure of an archaeal homolog of the human protein complex Rpp21-Rpp29 that is a key core component for the assembly of active ribonuclease P.
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 28
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2007-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2zaeB01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2zaeB02
3MZWB 4EYYQ 1JM0A 4NPFX 1LP1B 1EDIA 2LXBA 3FXEA 4ASWA 2M5AA 1Q2NA 4HKZH 4NPEA 3RGUA 4ZNCA 2LXCB 5C39A 1JMBA 2B87B 2QVAA 4GOFA 1OVUA 2P58A 1EC5A 5CBNA 1FC2C 4KJMA 2M0BA 2HR3A 2B88A 1Y47A 4IOIH 1BDCA 1H0TA 2OTKE 2Q1KA 1EDJA 1DEEG 4MN4C 2SPZA 5K5GB 4HJGH 3ZDMA 4WWIA 4GODA 1LP1A 1ZXGA 4GOEA 1BDDA 5DJTB 5EFWB 5DJUB 2KZJA 4HB1A 1SS1A 4ASVA 2KUBA 3PH0A 1ZW0A 2M5AB 4K3AA 3QWOC 2RKLA 3S1KA 3MHVA 1LT1A 2WMMA 1NVOA 4CPGA 2ZAEB 1H0TB 2QRXA 2KS1B 1X0TA 2B87A 2I8DA 2JWDA 1EDKA 5CBOA 2KI7B 2B89A 1U7JA 1S3JA 1EDLA 3FXDA 1OVVA 4ZMDA 4BXLA 1U7MA 2LR2A 4NPDA 1MFTA 2UWJE 2KIKA 4K35A 2K3RA 2R44A 4JBZA 1OVRA 2KZIA
chains in the Genus database with same CATH superfamily
4H0LD 3AE3C 2R6MA 2AYDA 1EZVI 1VQOZ 2A06E 3II6A 3A2AA 1YJN1 1HJ0A 3H3VJ 1A02J 1EQ7A 4H44C 3O8ZA 2IZ0A 2QLVB 2OTLP 2B87B 3I56P 1N7LA 4U3FE 5BVZA 3L71G 2NPSC 3GKQA 4IFFA 3SWFA 1VF5C 3BCCJ 1Q861 1Q16A 4DGLA 1SQQD 1FJPA 5T67A 3D6YA 1K04A 1EDJA 2QA4Z 1KQFB 1LTBC 1CI6B 1PIXA 4C7NA 1NKNA 2QJYB 1JNMA 4A3KI 1VQ51 1RY3A 3HUSB 1SVFA 5L8RJ 4PV1B 1YYCA 3FQQA 3CI9A 2OYHA 2ZT9C 5KLVE 1GK4A 1RQFA 3BRTB 1EXIA 2ZYDA 1PGQA 3CCQP 1NKZB 3RZOI 1Z01A 5AVZB 2KNCB 3VOPA 3GHGC 2B87A 2MJZA 2QJPC 4H44B 2V8KA 3D6WA 4PV1D 1RF1A 2W04A 2JA5I 2JA7I 4XA4A 2NPSB 3G71Z 2RBLA 1YI2Z 5H2FE 1RE4A 1VQ7P 1S5LX 2LR2A 5AVVB 1R8EA 2NVTI 2OOYB 2BCCJ 1CI6A 2BEZF 1DL6A 4NBDA 3VMAA 5CCGC 3CCS1 3HUSA 1BSNA 4HGZA 3WUUA 3U1AA 1VQO1 1K731 4H44D 1Q2NA 1KD12 3RGUA 1S5LH 2IZ1A 5AW0B 2NAPA 4C46A 1L0NK 2NPSD 1L0LJ 1TU3F 2ZT9B 2M3BA 3SFDC 1BCCE 1SQPG 2Y0CA 4JYCA 4X6AI 3MZKB 2BCCD 4WVZA 2WAQA 2Q3EA 1HBWA 2BJOA 3CD61 3I55Z 1WT6A 4YXWH 2WSEH 4E31A 1OWAA 1NOHA 2H8PD 3F89A 5AVTB 2QA41 1KC82 4E33A 1NU1G 3F3FC 2QJPB 3OW2Y 1VQKP 5AW9B 2NPSA 1R5LA 2O01N 1Q822 1L0LD 2ZT9D 1KILE 3RK2B 1KYOD 3L74E 1KD1Q 1SQVK 1PP9G 2V7QH 3H32B 2J5UA 3B5NC 4R4MA 4TLFA 1EZVE 1YITZ 3GLMA 5KLVJ 2YXQB 2ZFCA 3NTNA 4RV9A 4EIJA 1R9TI 3L73E 3AEAC 3MP7B 3OA7A 2Y0EA 1S9KE 4N3YB 4A3MI 2IFMA 3M91A 3M0DA 1KC8Q 3RK2D 1J1DC 1KB9D 1NTKG 1GMJA 4KT0J 3SFEC 3AE7C 2QREB 5KLIB 1E79H 2FYZA 4DCKA 1EXJA 1AA0A 4MRIA 2RT9A 1QX8A 1Q82Q 1YI21 3AEGC 3S4RA 1IFNA 1JO5A 1OVRA 3V2RA 5CCGD 1GU5A 4AYCA 1G1IA 3L70D 1VQ8Z 1RQUA 1J1EB 1BGYE 2J6AA 3SSUA 1KQGB 2LKMA 1IFMA 2P28A 1YUKA 3TGUG 4GOFA 3H32A 4W7YA 3KPEA 1Y1VI 3H1KD 1FOSE 2OTKE 1FZBA 1FU1A 2YNYA 4I7ZB 2O01H 1JY2O 5BU8B 3I551 2PK7A 2OYIB 5CHXA 4AUWA 3QWUA 1SQXG 2R5DA 5GTIH 5DJTB 3OW2O 5EFWB 2I3CA 1L0NJ 2W83C 1J1DB 3A0HE 3H1JG 2M6NA 1LNQA 1H89A 3MIWA 1VQMZ 2Q9IA 2FFDC 3N4XA 3W68A 2B63I 3MD0A 2RMZA 3ESWA 3EFFK 3PO2I 2XNDH 1FE6A 3V4QA 1H0TB 2N1TB 2G8YA 1IO4A 3L74J 1LTJA 3CC7P 5GTIE 1KQSZ 1YIT1 1L0ND 4DQYB 2K88A 2JWDA 5AW5B 3MUDC 4NBFA 2QEXZ 1YJ9P 3IN6A 5AW7B 2HPCB 3FXDA 3I4NI 2WSSH 2HFED 1SFCB 2K9YA 3S15I 2O4HA 1PL5A 4NPDA 3CMEP 4N78E 1FDIA 2OYIA 4JBZA 4IL6E 4A7PA 1SQQG 2Z5HA 3TSIA 2N1TD 3L74D 1Y9BA 1OFCX 1IK9A 2DE7A 1Y1WI 4L75A 3CX5H 3FXEA 4Y52I 2YO3A 2FYUK 1YHQZ 2FFDB 3D9XA 2RPRA 1SFCD 3LUSA 4MH4A 2HR3A 3HE4B 3CCMP 1S9KD 3BCCG 1WJ2A 5D1OB 1H0TA 2DE5A 2N1TA 2OZKA 2JA6I 4L74A 4L73A 5E79H 1DD4A 1JY3N 3ZDMA 5KTBA 2O1KA 2VPWA 1K05A 4R4LA 4UB6H 2H85A 3LIDA 5AN9F 2W6AA 3G6EZ 2ZXEB 1RO0A 2W27A 3KXDA 1SFCA 4MXUA 4ZKPA 2CK3H 1NJI2 2YXRB 2RKLA 3BG1B 4UB8H 4WY4C 1NTMK 1K8A1 3MGNA 1VQM1 3I4MI 3HE5A 2E5TA 1S72P 1HGVA 2E5YA 2HLOA 2JNYA 5B5EH 1K9M2 2KLVA 5AVQB 3GTPI 2QG4A 4UB6E 1DH3A 1KYOI 3H1IE 1IC2A 5AVXB 1JY3P 2PRRA 2C0XA 3HE4A 5D1OA 1AA6A 2QEX1 4UB8E 3GW6A 1SP4A 4QTTA 1Q7Y2 1JTHB 4OGQC 1NJIQ 1QL1A 5AVSB 3P32A 5GTHH 1YJNP 1JM0A 1KB9I 1L2PA 1OW8A 1LP1B 2Q4ZA 5C4XI 1NTZE 3TF5A 2LXBA 4TT3H 2E76C 3H0GI 2XV5A 4HKZH 1PGOA 1T2KC 4BRYB 1K9MQ 1OIPA 5C39A 1QVGZ 1N8R1 3S16I 2A06G 1P84H 4WY4B 1ZRTE 1YHQ1 1BDCA 2YKOA 1RE3C 1LQLA 3JCUE 3BVHA 2NRGA 1RQVA 4U3FG 1Q7YQ 1BSHA 5CCHD 4N78D 2E7ZA 3E1RA 5DJUB 4HB1A 1X22A 2FYNC 1PV3A 3P8CD 5KAIH 1ZOYC 3AE9C 4DOJA 3G6E1 4WY4D 3K7AI 3AE2C 1KQLA 2IBZI 2OYHC 3AEEC 3JC22 1WIIA 1NO4A 5CCHA 1AV1A 1LGHB 2QRXA 2ZJSE 5KLVG 3PRJA 2QSIA 2HYNA 3C8VA 4BRYA 2R93I 2GM4A 2E76B 3CXCZ 2NVYI 1QVGO 2CPSA 5KAIE 2I8DA 2QR1B 1EDKA 4WY4A 2B89A 1QXFA 3LW5J 3U50C 1VQ6Z 1RF1C 3H1IJ 3KIFA 3CCVP 2QIWA 1RE4C 1SQBJ 3M06A 4EDFA 2F4OA 3O6QB 1RO2A 2E76D 2B9BA 1AJYA 2BCCE 1T2KD 5BU5A 2FYNB 3CCJZ 1AVOA 1CSBA 2IDBA 2HF1A 3CMAZ 1NTMD 2R3SA 1ZR4A 2KK7A 2LIYA 3H1ID 3NFQA 4L76A 3PO3S 1NTZJ 1OW7A 1FC2C 1FAVA 1N7SB 1JJ2Z 2OGUA 1FOSF 1SQBD 4BBSI 3CCSZ 4A3LI 2W90A 1L0LE 3L4FA 1KYOE 2P7JA 1BCCG 3L75D 5APVA 5M1BA 1QVFZ 1LT9A 3P5JB 2HODB 3VMXA 4E2YA 1N2DC 2FY8A 1RF1B 2OTJZ 3CD6Z 3HOUI 3GTGI 1N7SD 1NTZD 1RE3A 1Y8AA 1GL2B 4NBAA 2Y0DA 2HU9A 1XTGB 3O6QA 5CJ0A 3GTMS 2E42A 4BY7I 1FZGA 1KB9E 2RN0A 1ZRTD 3EERA 3MONA 3HOYI 3L74G 1AVYA 1FDOA 1GW4A 4RVGA 5FLMI 1Q821 1JCCA 2FBWC 2WB1A 1EZVG 2M3EA 1N7SA 1M901 3L70E 4A3DI 4S1TA 3M0DC 1BE3E 5H2FH 3M9QA 1GL2D 3G71P 1M1K2 1VQ61 1YI2P 3GTLI 1U7MA 3L73G 1VQNZ 4RJTA 3AEFC 4H13C 5AW3B 2R44A 1KORA 1IFJA 3G9RA 2HODA 3JSVC 1VQ41 3H1KE 1IK7A 4MONA 2QM7A 3RK3B 3RK2C 2YO2A 4I1LA 1KTMA 1KFMA 1GL2A 3CPWZ 2J58A 3CCJ1 2IBZE 2QVAA 4Y99C 1FDMA 3CMA1 1BGYG 1JY2N 1QYPA 1N2FA 3I55P 1M1KQ 2SPZA 3S1NI 3AE6C 1LTSC 2QKDA 1OZHA 2OARA 4JYBA 3CCQZ 4PJ0H 2XKMA 2A45I 3RK3D 1HTLC 1IZNB 3F5HA 3TYYA 1MFZA 5KLIC 3KHUA 2V45A 2WPSA 3NDIA 4E32A 2OTJ1 3AECC 1M1JB 1Z03A 1L0NE 3NH5A 3CWBJ 4JF7A 4H13B 4NFRA 1JMMA 1OW6A 5AVWB 5B66E 2GTIA 1ML8A 1J1EC 1VQ7Z 1DIPA 2ZYAA 1YITP 2ZXXA 3WU2E 1GU4A 1JY2P 4AQRD 4PJ0E 2KS1B 1LTJC 3H25A 1RNIA 1ZV8A 4Y99B 5C3EI 4E2XA 5AVUB 4WB4A 3USSA 3CWBD 2KPIA 4H13D 1FBMA 1LJ2A 4RS4A 2IX7C 4I7ZC 2V3VA 3L70J 1VQN1 1SQVE 3H6PA 2OTL1 2H88C 2OYIC 3CL3D 1BE3J 3GTJI 3IFMA 3GF3A 1VQ8P 2WPQA 2IV2X 5IT9b 1FS0E 1Q812 3AEBC 3V2PA 1PPJD 5APTA 4U7JA 2WQYC 4NPEA 3Q2YA 2P2UA 1M1JA 2PAJA 5CM2M 3WUVA 3CCRZ 3H1KJ 3JAMb 1A02F 2B88A 3T4NB 2L5GB 1VQ9Z 1BE3D 3OAKA 3EFGA 2N1TC 2KS1A 1PFTA 2Z4EA 4QTUA 2VPZA 1W2BZ 3CC4Z 2M48A 1LTJB 1RF0A 1JB0J 1U57A 3A0HH 3R4YA 1SS1A 3NDJA 3CCQ1 1OMIA 1M8OB 2KUBA 1Q81Q 3TE5B 1ZW0A 1SFCC 2VUMI 2M5AB 5AW4B 1VQMP 3MZLB 2KSJA 1LWUA 2PP6A 1WW9A 2GTHA 2WT7B 2JUBA 3M4OI 4DT0A 2VPXA 1KQSY 1KZUB 4GT1A 2IBZD 2F4MA 2C0WA 2JDIH 1SQPK 1ZN5A 4W80A 4D6TD 4IL6X 1GZLA 1VQ71 1DD3A 3AEDC 1VQPZ 5APYA 4EI2A 3Q3DA 4BY1I 1HUCA 1NJI1 1XTCC 3G4SP 2QEXP 1U7JA 1ZB8A 2YIUC 4XFJA 3H1LJ 4PD4I 4MD7A 1NU1K 1KV4A 1WMKA 2YKQA 3H1IG 4BWNA 2XZRA 1GD2E 4IL6H 2KSEA 2LEXA 1YJWZ 1SQBG 1DX7A 3L71J 2V8JA 1W2BO 2KZIA 3E1IA 3VMGA 4DZOA 4NPFX 2GUVA 3D70A 3NFZA 4NBBA 2GUSA 3L72E 1M56D 2M5AA 1SQVJ 3S1MI 3H1LD 3T97B 1YHQP 4BXXI 2WT7A 1DEBA 2PMZA 1ZMEC 4NB8A 1NAYA 1NTZG 3VP9A 1ZLLA 1Y47A 3KQGA 3CCR1 3HE5B 2IPPA 2W6JH 2PFXA 3L71D 3P8CE 3KZIE 3L37A 1NTKK 2JWAA 4RVHA 3HRNA 1VQ91 4WWIA 1TWHI 3S17I 3R2PA 2N9YB 1SQVD 3CC41 2JR8A 3G6EP 3CCEZ 2YIUB 1FZFA 3V2QA 1YJ9Z 5C4JI 2FYUE 3AE8C 1SFOI 3PP5A 4GIFA 1KQSO 3MHVA 3LW5H 1TWCI 3TK1A 3AE5C 2AKLA 5CCHC 1HVVA 1P9NA 2Y9ZA 3AE4C 3T97A 1L4AA 3U1CA 1VQP1 4JPZB 1YQ4C 1EDLA 1SQXK 1PZQA 2WTYA 3J7A4 2IZ4A 3HD7A 1VLAA 2Q3IA 1YIJZ 2KIKA 1SQPJ 3PTZA 1NTME 1NH4A 1YJW1 1URQA 1Y1VS 1QVGY 1SQBE 2RHBA 5IT9f 2BEQD 1RLYA 2NVQI 4ASWA 5CJ4A 3SWKA 3MTUE 3CC2P 1MKMA 3PJSK 1NU1J 1JMBA 3L75E 2C9NY 3L72J 2BCCG 3JAMf 3IR9A 1SQPD 1VQLZ 4IFDK 3H1HE 3JCUH 2JIRA 3NXSA 2YMYA 2VUGA 3BRVB 2JA8I 5LL6f 5KJ7A 3VMHA 2R5BA 1YTZI 1S72Z 3RBXA 3M0AA 1SQQK 1LT9C 1L0LG 2IZ3A 2E2II 1NU1D 3CC71 2K5RA 3L72D 3CCE1 1GDTA 3FX0A 3VTNA 1VQ5P 1YJ91 1D7MA 3CXCY 2W8ZA 2ZVNB 2AEJA 3CCLZ 2FYUJ 1G2CB 1X0TA 2H7HA 3EQ2A 5KAFE 4XX2A 1JWHC 2HG5D 4ZKUA 1E5WA 1I6HI 1N7SC 1NHLA 1NTKD 2WZ7A 1Z02A 3AE1C 4RESB 2Q5UA 3CCUZ 2Z5IA 5APQA 2J59M 1LTAC 1TWAI 3M9HA 3L70G 1YIJ1 1BE3G 2Q6QA 3MZWB 1HJBA 4EYYQ 2AXTH 2FYUD 1S7MA 1K8A2 1EDIA 3IF4A 1GK6A 3OJAB 1LT9B 3I5CA 3J81b 1JUNA 4GDOA 1NTMJ 1JJ2Y 1VL2A 4Y28J 5D1PA 1S4XA 3W67A 3CMAP 1M1K1 1FJKA 5APUA 1NAFA 1GL2C 3G3ZA 2E74B 4M3LA 4HYTB 5APSA 2G3AA 3H1KG 1YQ3C 2M0BA 3RK3E 1PGPA 1X79B 3CCSP 4IOIH 1VQ4Z 1X3WA 3KDPB 1JEKA 2AEFA 1QVFY 1VQOP 1KYOH 1VQL1 1G2CA 3CXHD 3L75J 2IBZG 4HJGH 2AXTE 1FZCA 3CX5D 2MKVA 2E43A 2Q7CA 3RL0C 3HOWI 5AW1B 5IP7I 1BDDA 3H1HJ 1S721 1IFIA 1SQXD 3S9OA 1K8AQ 2OTJP 2E74D 4NBHA 3CD6P 2P10A 2H43A 1JCDA 3BASA 2JIOA 2XNXA 2QA4P 3D2LA 1KB9H 2QJKC 4HH4A 3J80b 1N8R2 5IP9I 1KD11 3CCVZ 1W2EA 3CWBE 1NWQA 2E2JI 1L0NG 3H1HD 4NOZA 3RK3C 2JMOA 2Y0SA 4O9BA 3CCL1 5A2Qb 1X9VA 1HH0A 3GTQI 1QLED 1MZ9A 2ZVOB 2P1JA 3H1LG 3B71A 4BXLA 3UIAA 4BBRI 1KC81 1VQNP 4A3FI 1PPJE 2JKVA 4PD4D 4K35A 3CCU1 1Q90D 3GG2A 3RL0B 4YPCA 2JIPA 3CPWY 1AQ5A 3VMYA 4NH1C 1WCMI 1N8RQ 1I3QI 1SQVG 1NGMB 4KHXA 2LXCB 5KLVK 3GTOI 1M1JC 2OTLZ 3I56Z 3FWLA 2P58A 3V5BA 3PLNA 1H8AA 5KKZB 2XU6A 2QJKB 1QVFO 3S2HI 3ITKA 1KMIZ 3BCCD 2OQQA 3RL0D 1Q811 3N7NA 1IJDB 2RIQA 2V8IA 4GOEA 4HGYA 1QEXA 1ZH1A 1RF0C 1P84D 3B4SA 2KP8A 2WSCJ 3PH0A 4D6TE 3EWKA 3KIHA 3V6IA 2GU2A 3I07A 2P67A 2O1JA 5B66H 3S1KA 1LWUC 3CQZI 1VF5B 4E2ZA 2WMMA 3WU2H 2W03A 2QRDB 4AYBA 4I2LC 2I1JA 3L36A 5AW2B 1USEA 4B86A 3CCV1 2JIMA 3IR7A 2KB7P 3VP8A 2KI7B 2FXOA 3GF7A 4XE5B 2N9BA 2ITAA 1OVVA 2R32A 4A3GI 2R7ZI 3RBZA 1LTTC 2JJLA 1VF5D 2KYVA 4TNUA 3VTPC 3H1LE 1Q862 2KLUA 3CPWO 1RHZB 4OVNF 2KNCA 3PHLA 3L71E 4U3FJ 2WPRA 3J81f 1LTGC 1WZNA 3KYQA 3GHGB 3A5TA 1TWFI 3S14I 1RH5B 1S5LE 2A45G 1OVUA 1X8YA 4LC1A 3CCRP 3L72G 1UIIA 1WRGA 1LWUB 2A06D 3I561 2QM8A 1W2BY 4I6MC 1VQ9P 1RO4A 1M902 4YTPC 3IX0A 1HGZA 1H88A 5K5GB 4W7ZA 3BATA 4GODA 2NZ2A 3CC4P 1ZXGA 3VMZA 2IFNA 1VPCA 1M7LA 1CZQA 2PGDA 2I1KA 2WITA 4U3FD 2ZYGA 1Q86Q 1YUAA 4WBAA 1MUUA 1VQKZ 2E2HI 1K83I 3CXHI 3GMAA 3CX5I 3QWOC 1S1CX 3OW2Z 3VYIA 1OXZA 1QL2A 1CW5A 2C9LY 4D6TJ 3J80f 3G711 2ZAEB 2E75C 3QH9A 3Q5SA 3EEDA 5C44I 1S2EA 3GCFA 2DW3A 2FYUG 1M90Q 1VQPP 2G2KA 2D2CC 3GHGA 5KLVD 1KILC 4CL1A 4A3EI 1ZR2A 2QE7H 1L4AC 1G1JA 5A2Qf 1K732 3WMM0 3RL0g 3S1RI 4NBGA 5T64A 4ZMDA 1FZAA 2CPBA 1N73C 3HD7C 1AFOA 3CLQA 4JQ0D 1L1OC 1YJWP 4Y7NI 3V4WA 4GKGA 2A45H 5CCGA 2Y9YA 2WVRA 3L35A 2O53A 4HH2A 3B5NB 5AVYB 1X3ZA 2IYPA 3U59A 3HOXI 1URQC 1SQPE 3IF8A 1BCCJ 1NTMG 4EWCA 4ZNCA 3FWNA 4EOTA 2R3CA 1K9M1 3KZIH 1NU1E 3SWYA 1K73Q 4MN4C 2E75B 3L75G 3B5ND 2VRSA 1TWGI 2WPVB 5KJ7C 3A0BH 2D2CB 1KILB 1BCCD 1Y8CA 1PP9E 3H1HG 5APXA 1L4AB 2KZJA 3FGAD 4RVFA 1Q7Y1 3CCEP 1OX3A 1HWTC 1VQK1 3A3YB 2WSEJ 2BASA 3P7KA 5FLXb 2OYOA 1HF9A 2LFUA 3G4SZ 1N73B 3HD7B 3B8EB 2P3YA 3B5NA 3L73J 1P84I 2E75D 1LT1A 5AW8B 1IFDA 2JR6A 4MD9A 1NVOA 2IYOA 3A0BE 1ZB9A 2D2CD 1NTKE 1KILD 1URQB 2QRCB 2EGTA 3CC7Z 1VDFA 1L4AD 2V7QJ 3ABVC 4C7RA 2KXPB 4A3CI 2WWWA 1VQ81 3HKZA 3CXHH 1UIXA 1J2JB 3IAOA 3S2DI 4A3BI 3F3PC 1EZVD 1ZP0C 2AXCA 3HD7D 2V4HA 2WSFH 1YIJP 5AVRB 2JS4A 1MFTA 4NB9A 1BGYJ 3L73D 3CMEZ 1NYHA 2W6BA 3TNUB 1MV8A 3V2NA 1KILA 3C9IA 1FZEA 1URQD 2R92I 3TGUE 2PM9A 1W5CE 1LTIC 3FKII 2YKPA 3Q87A 2K37A 3CXHE 3A7OA 1N73A 3CX5E 3TDKA 2HPCA 1EC5A 4KJMA 3GTKI 1TFIA 3K5BA 1BGYD 1VQLP 3CCMZ 1QGKB 1N86A 1SQXE 4LLHA 2K1AA 4A3JI 5KJ7D 1Z56A 2L91A 1T6AA 3H1JE 1FZCC 3D71A 5E79E 4DK1A 1SQBK 2YMKA 3FQMA 3VN0A 2NVXI 3PO3I 4PD4H 2JP3A 5APWA 2H89C 2FFDA 2O01J 3TDHB 2KOGA 3TNUA 5AW6B 1T3UA 1T3JA 1PP9J 1GTWA 3G4S1 4E2WA 1NTZK 3CCLP 2YADA 1AQTA 5KAFH 3Q5PA 4PD4E 5B5EE 3MUDA 1SIWA 3M9BA 3Q1MA 4A3II 2E74C 3GTMI 1SQQE 4N6JA 1NTKJ 3CWBG 3HOZI 2JO1A 3HOVI 3S1QI 3Q5RA 1PP9D 3CC2Z 1KN7A 1R5SA 2JIQA 2XDJA 3CCUP 1IFPA 2OOXB 2K3RA 1USDA 1YTZT 4YXDC 3CME1 4E30A 1FZCB 1SLQA 2FXMA 2K9JB 1YJNZ 4DJGA 4H0LC 1QF8A 5GTHE 1PPJG 1VQ6P 3E7KA 3BG0B 3BCCE 3NMDA 4RO0A 1KFNA 4MD8A 4NBCA 3VB9A 1YBKA 2Q51A 2FXPA 4OWFA 4QMAA 4A93I 1NP6A 3TGUJ 3HTKB 3M3YI 5T6BA 5CBNA 3NH8A 2VF1A 1P84E 2YU9I 1VQ4P 1JTHA 2WSCH 1USPB 2Q1KA 3VMIA 3CCM1 1DEEG 4OGQB 2AEMA 1VQ5Z 4RVDA 2WSFJ 1LP1A 3CCJP 2GA1A 2RH0A 1SQXJ 1JY3O 2E9HA 1KRLA 4LGDE 1NUIA 4ASVA 2VPYA 3H1JJ 3TGUD 4OH8B 1T8ZA 4K3AA 2O3JA 5FLXf 4NBEA 4IFMA 3WUTA 2FKWB 5TISH 2K9JA 4OGQD 4D6TG 4CPGA 2POHA 1GW3A 1PFIA 4H0LB 3NH4A 4RKUJ 3P8MC 2QJYC 2JEEA 3C1LA 1PGJA 5TJHA 3HTKA 4C7NB 3H1JD 5CBOA 3LIEA 3HUSC 3IFUA 1I50I 1S3JA 4PV1C 5KKZC 3D6ZA 1USPA 5CMZA 1L0LK 5TISE 1M57D 3CC21 2UWJE 3RZDI 2OYHB 4Z1MH 2DE6A 2M8RA 1SQQJ 1JOCA
chains in the Genus database with same CATH topology
1Q862 3VMGA 1JM0A 4NPFX 2R6MA 3NFZA 4NBBA 1LP1B 2Q4ZA 1VQOZ 5C4XI 1YJN1 2LXBA 3H3VJ 3H0GI 3J81f 2M5AA 4HKZH 3S1MI 3S14I 5C39A 1TWFI 1QVGZ 1N8R1 2QLVB 4BXXI 2B87B 2PMZA 3S16I 1OVUA 4NB8A 3GKQA 1YHQ1 3I561 1W2BY 1Y47A 1BDCA 3CCR1 1Q861 1RO4A 4DGLA 1M902 3IX0A 4RVHA 5T67A 1EDJA 1LQLA 2QA4Z 5K5GB 1VQ91 4WWIA 4GODA 1ZXGA 1TWHI 3S17I 4A3KI 1VQ51 3CC41 5DJUB 4HB1A 1YUAA 1VQKZ 3CCEZ 2E2HI 1K83I 3G6E1 3FQQA 3K7AI 3QWOC 3OW2Z 1YJ9Z 5C4JI 1RQFA 1SFOI 3MHVA 1TWCI 1WIIA 3J80f 3G711 2ZAEB 2AKLA 3RZOI 2QRXA 3EEDA 5C44I 3GCFA 1Z01A 1P9NA 2R93I 2G2KA 3CXCZ 4CL1A 2NVYI 4A3EI 2B87A 2I8DA 2QR1B 1VQP1 5A2Qf 1EDKA 2V8KA 3D6WA 2B89A 2W04A 3U50C 1VQ6Z 1K732 2JA5I 3S1RI 1EDLA 2JA7I 4NBGA 5T64A 4ZMDA 3G71Z 3J7A4 2RBLA 2IZ4A 1YI2Z 1VLAA 3KIFA 2LR2A 1L1OC 1YIJZ 4Y7NI 2NVTI 2KIKA 2OOYB 1DL6A 4NBDA 1YJW1 2F4OA 2O53A 1X3ZA 1Y1VS 1RO2A 3CCS1 2RHBA 3HOXI 5IT9f 1QVGY 4HGZA 3IF8A 1RLYA 2NVQI 1VQO1 1K731 4ASWA 1Q2NA 3CCJZ 1KD12 3RGUA 2HF1A 4EWCA 4ZNCA 3CMAZ 1JMBA 2LIYA 3PO3S 1JJ2Z 1FC2C 1K9M1 3JAMf 1VQLZ 3CCSZ 4BBSI 4A3LI 4X6AI 3MZKB 2WAQA 2VUGA 2BJOA 3CD61 3I55Z 2JA8I 5LL6f 4MN4C 4E31A 3VMHA 1TWGI 2QA41 1KC82 1S72Z 1QVFZ 3P5JB 4E33A 3F3FC 2KZJA 3OW2Y 4RVFA 1Q7Y1 2IZ3A 2E2II 4E2YA 1Q822 2OTJZ 1VQK1 3CC71 3CD6Z 2K5RA 3CCE1 5FLXb 3GTGI 3HOUI 2LFUA 3G4SZ 4NBAA 2HU9A 3VTNA 2P3YA 1YJ91 3GTMS 4BY7I 1LT1A 3CXCY 4MD9A 2JR6A 1NVOA 1YITZ 3EERA 1ZB9A 3MONA 3CCLZ 3HOYI 2QRCB 2EGTA 3CC7Z 4RV9A 4RVGA 5FLMI 1X0TA 1R9TI 1Q821 4XX2A 1JWHC 2WB1A 4A3CI 4A3MI 1VQ81 3HKZA 1M901 1I6HI 4A3DI 4S1TA 3S2DI 4A3BI 3F3PC 2QREB 1M1K2 1VQ61 3GTLI 1U7MA 1Z02A 4MRIA 3CCUZ 1VQNZ 2JS4A 2RT9A 1MFTA 4NB9A 3CMEZ 1YI21 1TWAI 2R44A 1YIJ1 1OVRA 3MZWB 2R92I 1VQ8Z 4EYYQ 1S7MA 2PM9A 1K8A2 1EDIA 1VQ41 4MONA 2J6AA 3FKII 3J81b 1JJ2Y 3Q87A 5D1PA 2P28A 1M1K1 3CPWZ 1YUKA 3CCJ1 2QVAA 4GOFA 3CMA1 1EC5A 4KJMA 2M0BA 3GTKI 1TFIA 1QYPA 4IOIH 1Y1VI 3CCMZ 1VQ4Z 1X3WA 1N2FA 2OTKE 4A3JI 1QVFY 1VQL1 2SPZA 4HJGH 3S1NI 2QKDA 3I551 2PK7A 3HOWI 4DK1A 3FQMA 5IP7I 3QWUA 1BDDA 3CCQZ 2NVXI 3PO3I 5DJTB 5EFWB 1S721 2I3CA 4NBHA 2M6NA 3TDHB 1VQMZ 3NDIA 4E32A 2OTJ1 1Z03A 3NH5A 2B63I 3G4S1 4NFRA 3ESWA 4HH4A 4E2WA 3J80b 2GTIA 3PO2I 1N8R2 1ML8A 5IP9I 1VQ7Z 1KD11 3CCVZ 1H0TB 2E2JI 2YADA 1KQSZ 2KS1B 4NOZA 1YIT1 2JMOA 2Y0SA 3CCL1 5A2Qb 1RNIA 4DQYB 4A3II 2JWDA 3GTQI 4NBFA 2QEXZ 3GTMI 5C3EI 3I4NI 3FXDA 3HOZI 4E2XA 3HOVI 3S1QI 3CC2Z 4BXLA 4BBRI 2KPIA 1KC81 3S15I 4A3FI 2O4HA 4NPDA 4RS4A 2OOXB 4K35A 2K3RA 4JBZA 1VQN1 3CCU1 2OTL1 3GTJI 3CME1 4E30A 1YJNZ 5IT9b 3CPWY 4NH1C 1Q812 1QF8A 1WCMI 2DE7A 1Y1WI 3BG0B 3FXEA 1I3QI 4Y52I 4NPEA 4MD8A 4NBCA 2LXCB 3VB9A 3GTOI 2Q51A 4A93I 1NP6A 1YHQZ 2OTLZ 3D9XA 5CM2M 3I56Z 3M3YI 2P58A 2RPRA 3LUSA 3CCRZ 3JAMb 5T6BA 5CBNA 4MH4A 3NH8A 2HR3A 2B88A 2VF1A 2YU9I 3T4NB 5D1OB 1H0TA 1VQ9Z 2DE5A 3S2HI 2OZKA 2JA6I 1USPB 2Q1KA 3VMIA 3CCM1 1DEEG 1Q811 1PFTA 2RIQA 3ZDMA 2V8IA 4QTUA 1VQ5Z 4RVDA 1W2BZ 1LP1A 3CC4Z 4GOEA 2M48A 4HGYA 2E9HA 1KRLA 2H85A 1ZH1A 5AN9F 1NUIA 1SS1A 3G6EZ 4ASVA 3NDJA 3CCQ1 1RO0A 2KUBA 4MXUA 3PH0A 3TE5B 1ZW0A 2VUMI 2M5AB 4K3AA 1NJI2 3MZLB 3KIHA 5FLXf 4NBEA 2RKLA 3BG1B 2GU2A 3I07A 1K8A1 1VQM1 1WW9A 3S1KA 2GTHA 3I4MI 2JUBA 3M4OI 3CQZI 1KQSY 4E2ZA 2F4MA 2WMMA 2W03A 4CPGA 2QRDB 4AYBA 2JNYA 1K9M2 1VQ71 3NH4A 3CCV1 3GTPI 1VQPZ 4BY1I 1NJI1 5CBOA 2KI7B 1U7JA 1ZB8A 3IFUA 1I50I 1S3JA 1OVVA 5D1OA 2QEX1 4MD7A 4A3GI 2R7ZI 1USPA 4QTTA 1Q7Y2 3CC21 2UWJE 1YJWZ 3RZDI 4TNUA 2V8JA 2DE6A 2KZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZW B;  4EYY Q;  1JM0 A;  4NPF X;  1LP1 B;  1EDI A;  2LXB A;  3FXE A;  4ASW A;  2M5A A;  1Q2N A;  4HKZ H;  4NPE A;  3RGU A;  4ZNC A;  2LXC B;  5C39 A;  1JMB A;  2B87 B;  2QVA A;  4GOF A;  1OVU A;  2P58 A;  1EC5 A;  5CBN A;  1FC2 C;  4KJM A;  2M0B A;  2HR3 A;  2B88 A;  1Y47 A;  4IOI H;  1BDC A;  1H0T A;  2OTK E;  2Q1K A;  1EDJ A;  1DEE G;  4MN4 C;  2SPZ A;  5K5G B;  4HJG H;  3ZDM A;  4WWI A;  4GOD A;  1LP1 A;  1ZXG A;  4GOE A;  1BDD A;  5DJT B;  5EFW B;  5DJU B;  2KZJ A;  4HB1 A;  1SS1 A;  4ASV A;  2KUB A;  3PH0 A;  1ZW0 A;  2M5A B;  4K3A A;  3QWO C;  2RKL A;  3S1K A;  3MHV A;  1LT1 A;  2WMM A;  1NVO A;  4CPG A;  2ZAE B;  1H0T B;  2QRX A;  2KS1 B;  1X0T A;  2B87 A;  2I8D A;  2JWD A;  1EDK A;  5CBO A;  2KI7 B;  2B89 A;  1U7J A;  1S3J A;  1EDL A;  3FXD A;  1OVV A;  4ZMD A;  4BXL A;  1U7M A;  2LR2 A;  4NPD A;  1MFT A;  2UWJ E;  2KIK A;  4K35 A;  2K3R A;  2R44 A;  4JBZ A;  1OVR A;  2KZI A; 
#chains in the Genus database with same CATH topology
 4H0L D;  3AE3 C;  2R6M A;  2AYD A;  1EZV I;  1VQO Z;  2A06 E;  3II6 A;  3A2A A;  1YJN 1;  1HJ0 A;  3H3V J;  1A02 J;  1EQ7 A;  4H44 C;  3O8Z A;  2IZ0 A;  2QLV B;  2OTL P;  2B87 B;  3I56 P;  1N7L A;  4U3F E;  5BVZ A;  3L71 G;  2NPS C;  3GKQ A;  4IFF A;  3SWF A;  1VF5 C;  3BCC J;  1Q86 1;  1Q16 A;  4DGL A;  1SQQ D;  1FJP A;  5T67 A;  3D6Y A;  1K04 A;  1EDJ A;  2QA4 Z;  1KQF B;  1LTB C;  1CI6 B;  1PIX A;  4C7N A;  1NKN A;  2QJY B;  1JNM A;  4A3K I;  1VQ5 1;  1RY3 A;  3HUS B;  1SVF A;  5L8R J;  4PV1 B;  1YYC A;  3FQQ A;  3CI9 A;  2OYH A;  2ZT9 C;  5KLV E;  1GK4 A;  1RQF A;  3BRT B;  1EXI A;  2ZYD A;  1PGQ A;  3CCQ P;  1NKZ B;  3RZO I;  1Z01 A;  5AVZ B;  2KNC B;  3VOP A;  3GHG C;  2B87 A;  2MJZ A;  2QJP C;  4H44 B;  2V8K A;  3D6W A;  4PV1 D;  1RF1 A;  2W04 A;  2JA5 I;  2JA7 I;  4XA4 A;  2NPS B;  3G71 Z;  2RBL A;  1YI2 Z;  5H2F E;  1RE4 A;  1VQ7 P;  1S5L X;  2LR2 A;  5AVV B;  1R8E A;  2NVT I;  2OOY B;  2BCC J;  1CI6 A;  2BEZ F;  1DL6 A;  4NBD A;  3VMA A;  5CCG C;  3CCS 1;  3HUS A;  1BSN A;  4HGZ A;  3WUU A;  3U1A A;  1VQO 1;  1K73 1;  4H44 D;  1Q2N A;  1KD1 2;  3RGU A;  1S5L H;  2IZ1 A;  5AW0 B;  2NAP A;  4C46 A;  1L0N K;  2NPS D;  1L0L J;  1TU3 F;  2ZT9 B;  2M3B A;  3SFD C;  1BCC E;  1SQP G;  2Y0C A;  4JYC A;  4X6A I;  3MZK B;  2BCC D;  4WVZ A;  2WAQ A;  2Q3E A;  1HBW A;  2BJO A;  3CD6 1;  3I55 Z;  1WT6 A;  4YXW H;  2WSE H;  4E31 A;  1OWA A;  1NOH A;  2H8P D;  3F89 A;  5AVT B;  2QA4 1;  1KC8 2;  4E33 A;  1NU1 G;  3F3F C;  2QJP B;  3OW2 Y;  1VQK P;  5AW9 B;  2NPS A;  1R5L A;  2O01 N;  1Q82 2;  1L0L D;  2ZT9 D;  1KIL E;  3RK2 B;  1KYO D;  3L74 E;  1KD1 Q;  1SQV K;  1PP9 G;  2V7Q H;  3H32 B;  2J5U A;  3B5N C;  4R4M A;  4TLF A;  1EZV E;  1YIT Z;  3GLM A;  5KLV J;  2YXQ B;  2ZFC A;  3NTN A;  4RV9 A;  4EIJ A;  1R9T I;  3L73 E;  3AEA C;  3MP7 B;  3OA7 A;  2Y0E A;  1S9K E;  4N3Y B;  4A3M I;  2IFM A;  3M91 A;  3M0D A;  1KC8 Q;  3RK2 D;  1J1D C;  1KB9 D;  1NTK G;  1GMJ A;  4KT0 J;  3SFE C;  3AE7 C;  2QRE B;  5KLI B;  1E79 H;  2FYZ A;  4DCK A;  1EXJ A;  1AA0 A;  4MRI A;  2RT9 A;  1QX8 A;  1Q82 Q;  1YI2 1;  3AEG C;  3S4R A;  1IFN A;  1JO5 A;  1OVR A;  3V2R A;  5CCG D;  1GU5 A;  4AYC A;  1G1I A;  3L70 D;  1VQ8 Z;  1RQU A;  1J1E B;  1BGY E;  2J6A A;  3SSU A;  1KQG B;  2LKM A;  1IFM A;  2P28 A;  1YUK A;  3TGU G;  4GOF A;  3H32 A;  4W7Y A;  3KPE A;  1Y1V I;  3H1K D;  1FOS E;  2OTK E;  1FZB A;  1FU1 A;  2YNY A;  4I7Z B;  2O01 H;  1JY2 O;  5BU8 B;  3I55 1;  2PK7 A;  2OYI B;  5CHX A;  4AUW A;  3QWU A;  1SQX G;  2R5D A;  5GTI H;  5DJT B;  3OW2 O;  5EFW B;  2I3C A;  1L0N J;  2W83 C;  1J1D B;  3A0H E;  3H1J G;  2M6N A;  1LNQ A;  1H89 A;  3MIW A;  1VQM Z;  2Q9I A;  2FFD C;  3N4X A;  3W68 A;  2B63 I;  3MD0 A;  2RMZ A;  3ESW A;  3EFF K;  3PO2 I;  2XND H;  1FE6 A;  3V4Q A;  1H0T B;  2N1T B;  2G8Y A;  1IO4 A;  3L74 J;  1LTJ A;  3CC7 P;  5GTI E;  1KQS Z;  1YIT 1;  1L0N D;  4DQY B;  2K88 A;  2JWD A;  5AW5 B;  3MUD C;  4NBF A;  2QEX Z;  1YJ9 P;  3IN6 A;  5AW7 B;  2HPC B;  3FXD A;  3I4N I;  2WSS H;  2HFE D;  1SFC B;  2K9Y A;  3S15 I;  2O4H A;  1PL5 A;  4NPD A;  3CME P;  4N78 E;  1FDI A;  2OYI A;  4JBZ A;  4IL6 E;  4A7P A;  1SQQ G;  2Z5H A;  3TSI A;  2N1T D;  3L74 D;  1Y9B A;  1OFC X;  1IK9 A;  2DE7 A;  1Y1W I;  4L75 A;  3CX5 H;  3FXE A;  4Y52 I;  2YO3 A;  2FYU K;  1YHQ Z;  2FFD B;  3D9X A;  2RPR A;  1SFC D;  3LUS A;  4MH4 A;  2HR3 A;  3HE4 B;  3CCM P;  1S9K D;  3BCC G;  1WJ2 A;  5D1O B;  1H0T A;  2DE5 A;  2N1T A;  2OZK A;  2JA6 I;  4L74 A;  4L73 A;  5E79 H;  1DD4 A;  1JY3 N;  3ZDM A;  5KTB A;  2O1K A;  2VPW A;  1K05 A;  4R4L A;  4UB6 H;  2H85 A;  3LID A;  5AN9 F;  2W6A A;  3G6E Z;  2ZXE B;  1RO0 A;  2W27 A;  3KXD A;  1SFC A;  4MXU A;  4ZKP A;  2CK3 H;  1NJI 2;  2YXR B;  2RKL A;  3BG1 B;  4UB8 H;  4WY4 C;  1NTM K;  1K8A 1;  3MGN A;  1VQM 1;  3I4M I;  3HE5 A;  2E5T A;  1S72 P;  1HGV A;  2E5Y A;  2HLO A;  2JNY A;  5B5E H;  1K9M 2;  2KLV A;  5AVQ B;  3GTP I;  2QG4 A;  4UB6 E;  1DH3 A;  1KYO I;  3H1I E;  1IC2 A;  5AVX B;  1JY3 P;  2PRR A;  2C0X A;  3HE4 A;  5D1O A;  1AA6 A;  2QEX 1;  4UB8 E;  3GW6 A;  1SP4 A;  4QTT A;  1Q7Y 2;  1JTH B;  4OGQ C;  1NJI Q;  1QL1 A;  5AVS B;  3P32 A;  5GTH H;  1YJN P;  1JM0 A;  1KB9 I;  1L2P A;  1OW8 A;  1LP1 B;  2Q4Z A;  5C4X I;  1NTZ E;  3TF5 A;  2LXB A;  4TT3 H;  2E76 C;  3H0G I;  2XV5 A;  4HKZ H;  1PGO A;  1T2K C;  4BRY B;  1K9M Q;  1OIP A;  5C39 A;  1QVG Z;  1N8R 1;  3S16 I;  2A06 G;  1P84 H;  4WY4 B;  1ZRT E;  1YHQ 1;  1BDC A;  2YKO A;  1RE3 C;  1LQL A;  3JCU E;  3BVH A;  2NRG A;  1RQV A;  4U3F G;  1Q7Y Q;  1BSH A;  5CCH D;  4N78 D;  2E7Z A;  3E1R A;  5DJU B;  4HB1 A;  1X22 A;  2FYN C;  1PV3 A;  3P8C D;  5KAI H;  1ZOY C;  3AE9 C;  4DOJ A;  3G6E 1;  4WY4 D;  3K7A I;  3AE2 C;  1KQL A;  2IBZ I;  2OYH C;  3AEE C;  3JC2 2;  1WII A;  1NO4 A;  5CCH A;  1AV1 A;  1LGH B;  2QRX A;  2ZJS E;  5KLV G;  3PRJ A;  2QSI A;  2HYN A;  3C8V A;  4BRY A;  2R93 I;  2GM4 A;  2E76 B;  3CXC Z;  2NVY I;  1QVG O;  2CPS A;  5KAI E;  2I8D A;  2QR1 B;  1EDK A;  4WY4 A;  2B89 A;  1QXF A;  3LW5 J;  3U50 C;  1VQ6 Z;  1RF1 C;  3H1I J;  3KIF A;  3CCV P;  2QIW A;  1RE4 C;  1SQB J;  3M06 A;  4EDF A;  2F4O A;  3O6Q B;  1RO2 A;  2E76 D;  2B9B A;  1AJY A;  2BCC E;  1T2K D;  5BU5 A;  2FYN B;  3CCJ Z;  1AVO A;  1CSB A;  2IDB A;  2HF1 A;  3CMA Z;  1NTM D;  2R3S A;  1ZR4 A;  2KK7 A;  2LIY A;  3H1I D;  3NFQ A;  4L76 A;  3PO3 S;  1NTZ J;  1OW7 A;  1FC2 C;  1FAV A;  1N7S B;  1JJ2 Z;  2OGU A;  1FOS F;  1SQB D;  4BBS I;  3CCS Z;  4A3L I;  2W90 A;  1L0L E;  3L4F A;  1KYO E;  2P7J A;  1BCC G;  3L75 D;  5APV A;  5M1B A;  1QVF Z;  1LT9 A;  3P5J B;  2HOD B;  3VMX A;  4E2Y A;  1N2D C;  2FY8 A;  1RF1 B;  2OTJ Z;  3CD6 Z;  3HOU I;  3GTG I;  1N7S D;  1NTZ D;  1RE3 A;  1Y8A A;  1GL2 B;  4NBA A;  2Y0D A;  2HU9 A;  1XTG B;  3O6Q A;  5CJ0 A;  3GTM S;  2E42 A;  4BY7 I;  1FZG A;  1KB9 E;  2RN0 A;  1ZRT D;  3EER A;  3MON A;  3HOY I;  3L74 G;  1AVY A;  1FDO A;  1GW4 A;  4RVG A;  5FLM I;  1Q82 1;  1JCC A;  2FBW C;  2WB1 A;  1EZV G;  2M3E A;  1N7S A;  1M90 1;  3L70 E;  4A3D I;  4S1T A;  3M0D C;  1BE3 E;  5H2F H;  3M9Q A;  1GL2 D;  3G71 P;  1M1K 2;  1VQ6 1;  1YI2 P;  3GTL I;  1U7M A;  3L73 G;  1VQN Z;  4RJT A;  3AEF C;  4H13 C;  5AW3 B;  2R44 A;  1KOR A;  1IFJ A;  3G9R A;  2HOD A;  3JSV C;  1VQ4 1;  3H1K E;  1IK7 A;  4MON A;  2QM7 A;  3RK3 B;  3RK2 C;  2YO2 A;  4I1L A;  1KTM A;  1KFM A;  1GL2 A;  3CPW Z;  2J58 A;  3CCJ 1;  2IBZ E;  2QVA A;  4Y99 C;  1FDM A;  3CMA 1;  1BGY G;  1JY2 N;  1QYP A;  1N2F A;  3I55 P;  1M1K Q;  2SPZ A;  3S1N I;  3AE6 C;  1LTS C;  2QKD A;  1OZH A;  2OAR A;  4JYB A;  3CCQ Z;  4PJ0 H;  2XKM A;  2A45 I;  3RK3 D;  1HTL C;  1IZN B;  3F5H A;  3TYY A;  1MFZ A;  5KLI C;  3KHU A;  2V45 A;  2WPS A;  3NDI A;  4E32 A;  2OTJ 1;  3AEC C;  1M1J B;  1Z03 A;  1L0N E;  3NH5 A;  3CWB J;  4JF7 A;  4H13 B;  4NFR A;  1JMM A;  1OW6 A;  5AVW B;  5B66 E;  2GTI A;  1ML8 A;  1J1E C;  1VQ7 Z;  1DIP A;  2ZYA A;  1YIT P;  2ZXX A;  3WU2 E;  1GU4 A;  1JY2 P;  4AQR D;  4PJ0 E;  2KS1 B;  1LTJ C;  3H25 A;  1RNI A;  1ZV8 A;  4Y99 B;  5C3E I;  4E2X A;  5AVU B;  4WB4 A;  3USS A;  3CWB D;  2KPI A;  4H13 D;  1FBM A;  1LJ2 A;  4RS4 A;  2IX7 C;  4I7Z C;  2V3V A;  3L70 J;  1VQN 1;  1SQV E;  3H6P A;  2OTL 1;  2H88 C;  2OYI C;  3CL3 D;  1BE3 J;  3GTJ I;  3IFM A;  3GF3 A;  1VQ8 P;  2WPQ A;  2IV2 X;  5IT9 b;  1FS0 E;  1Q81 2;  3AEB C;  3V2P A;  1PPJ D;  5APT A;  4U7J A;  2WQY C;  4NPE A;  3Q2Y A;  2P2U A;  1M1J A;  2PAJ A;  5CM2 M;  3WUV A;  3CCR Z;  3H1K J;  3JAM b;  1A02 F;  2B88 A;  3T4N B;  2L5G B;  1VQ9 Z;  1BE3 D;  3OAK A;  3EFG A;  2N1T C;  2KS1 A;  1PFT A;  2Z4E A;  4QTU A;  2VPZ A;  1W2B Z;  3CC4 Z;  2M48 A;  1LTJ B;  1RF0 A;  1JB0 J;  1U57 A;  3A0H H;  3R4Y A;  1SS1 A;  3NDJ A;  3CCQ 1;  1OMI A;  1M8O B;  2KUB A;  1Q81 Q;  3TE5 B;  1ZW0 A;  1SFC C;  2VUM I;  2M5A B;  5AW4 B;  1VQM P;  3MZL B;  2KSJ A;  1LWU A;  2PP6 A;  1WW9 A;  2GTH A;  2WT7 B;  2JUB A;  3M4O I;  4DT0 A;  2VPX A;  1KQS Y;  1KZU B;  4GT1 A;  2IBZ D;  2F4M A;  2C0W A;  2JDI H;  1SQP K;  1ZN5 A;  4W80 A;  4D6T D;  4IL6 X;  1GZL A;  1VQ7 1;  1DD3 A;  3AED C;  1VQP Z;  5APY A;  4EI2 A;  3Q3D A;  4BY1 I;  1HUC A;  1NJI 1;  1XTC C;  3G4S P;  2QEX P;  1U7J A;  1ZB8 A;  2YIU C;  4XFJ A;  3H1L J;  4PD4 I;  4MD7 A;  1NU1 K;  1KV4 A;  1WMK A;  2YKQ A;  3H1I G;  4BWN A;  2XZR A;  1GD2 E;  4IL6 H;  2KSE A;  2LEX A;  1YJW Z;  1SQB G;  1DX7 A;  3L71 J;  2V8J A;  1W2B O;  2KZI A;  3E1I A;  3VMG A;  4DZO A;  4NPF X;  2GUV A;  3D70 A;  3NFZ A;  4NBB A;  2GUS A;  3L72 E;  1M56 D;  2M5A A;  1SQV J;  3S1M I;  3H1L D;  3T97 B;  1YHQ P;  4BXX I;  2WT7 A;  1DEB A;  2PMZ A;  1ZME C;  4NB8 A;  1NAY A;  1NTZ G;  3VP9 A;  1ZLL A;  1Y47 A;  3KQG A;  3CCR 1;  3HE5 B;  2IPP A;  2W6J H;  2PFX A;  3L71 D;  3P8C E;  3KZI E;  3L37 A;  1NTK K;  2JWA A;  4RVH A;  3HRN A;  1VQ9 1;  4WWI A;  1TWH I;  3S17 I;  3R2P A;  2N9Y B;  1SQV D;  3CC4 1;  2JR8 A;  3G6E P;  3CCE Z;  2YIU B;  1FZF A;  3V2Q A;  1YJ9 Z;  5C4J I;  2FYU E;  3AE8 C;  1SFO I;  3PP5 A;  4GIF A;  1KQS O;  3MHV A;  3LW5 H;  1TWC I;  3TK1 A;  3AE5 C;  2AKL A;  5CCH C;  1HVV A;  1P9N A;  2Y9Z A;  3AE4 C;  3T97 A;  1L4A A;  3U1C A;  1VQP 1;  4JPZ B;  1YQ4 C;  1EDL A;  1SQX K;  1PZQ A;  2WTY A;  3J7A 4;  2IZ4 A;  3HD7 A;  1VLA A;  2Q3I A;  1YIJ Z;  2KIK A;  1SQP J;  3PTZ A;  1NTM E;  1NH4 A;  1YJW 1;  1URQ A;  1Y1V S;  1QVG Y;  1SQB E;  2RHB A;  5IT9 f;  2BEQ D;  1RLY A;  2NVQ I;  4ASW A;  5CJ4 A;  3SWK A;  3MTU E;  3CC2 P;  1MKM A;  3PJS K;  1NU1 J;  1JMB A;  3L75 E;  2C9N Y;  3L72 J;  2BCC G;  3JAM f;  3IR9 A;  1SQP D;  1VQL Z;  4IFD K;  3H1H E;  3JCU H;  2JIR A;  3NXS A;  2YMY A;  2VUG A;  3BRV B;  2JA8 I;  5LL6 f;  5KJ7 A;  3VMH A;  2R5B A;  1YTZ I;  1S72 Z;  3RBX A;  3M0A A;  1SQQ K;  1LT9 C;  1L0L G;  2IZ3 A;  2E2I I;  1NU1 D;  3CC7 1;  2K5R A;  3L72 D;  3CCE 1;  1GDT A;  3FX0 A;  3VTN A;  1VQ5 P;  1YJ9 1;  1D7M A;  3CXC Y;  2W8Z A;  2ZVN B;  2AEJ A;  3CCL Z;  2FYU J;  1G2C B;  1X0T A;  2H7H A;  3EQ2 A;  5KAF E;  4XX2 A;  1JWH C;  2HG5 D;  4ZKU A;  1E5W A;  1I6H I;  1N7S C;  1NHL A;  1NTK D;  2WZ7 A;  1Z02 A;  3AE1 C;  4RES B;  2Q5U A;  3CCU Z;  2Z5I A;  5APQ A;  2J59 M;  1LTA C;  1TWA I;  3M9H A;  3L70 G;  1YIJ 1;  1BE3 G;  2Q6Q A;  3MZW B;  1HJB A;  4EYY Q;  2AXT H;  2FYU D;  1S7M A;  1K8A 2;  1EDI A;  3IF4 A;  1GK6 A;  3OJA B;  1LT9 B;  3I5C A;  3J81 b;  1JUN A;  4GDO A;  1NTM J;  1JJ2 Y;  1VL2 A;  4Y28 J;  5D1P A;  1S4X A;  3W67 A;  3CMA P;  1M1K 1;  1FJK A;  5APU A;  1NAF A;  1GL2 C;  3G3Z A;  2E74 B;  4M3L A;  4HYT B;  5APS A;  2G3A A;  3H1K G;  1YQ3 C;  2M0B A;  3RK3 E;  1PGP A;  1X79 B;  3CCS P;  4IOI H;  1VQ4 Z;  1X3W A;  3KDP B;  1JEK A;  2AEF A;  1QVF Y;  1VQO P;  1KYO H;  1VQL 1;  1G2C A;  3CXH D;  3L75 J;  2IBZ G;  4HJG H;  2AXT E;  1FZC A;  3CX5 D;  2MKV A;  2E43 A;  2Q7C A;  3RL0 C;  3HOW I;  5AW1 B;  5IP7 I;  1BDD A;  3H1H J;  1S72 1;  1IFI A;  1SQX D;  3S9O A;  1K8A Q;  2OTJ P;  2E74 D;  4NBH A;  3CD6 P;  2P10 A;  2H43 A;  1JCD A;  3BAS A;  2JIO A;  2XNX A;  2QA4 P;  3D2L A;  1KB9 H;  2QJK C;  4HH4 A;  3J80 b;  1N8R 2;  5IP9 I;  1KD1 1;  3CCV Z;  1W2E A;  3CWB E;  1NWQ A;  2E2J I;  1L0N G;  3H1H D;  4NOZ A;  3RK3 C;  2JMO A;  2Y0S A;  4O9B A;  3CCL 1;  5A2Q b;  1X9V A;  1HH0 A;  3GTQ I;  1QLE D;  1MZ9 A;  2ZVO B;  2P1J A;  3H1L G;  3B71 A;  4BXL A;  3UIA A;  4BBR I;  1KC8 1;  1VQN P;  4A3F I;  1PPJ E;  2JKV A;  4PD4 D;  4K35 A;  3CCU 1;  1Q90 D;  3GG2 A;  3RL0 B;  4YPC A;  2JIP A;  3CPW Y;  1AQ5 A;  3VMY A;  4NH1 C;  1WCM I;  1N8R Q;  1I3Q I;  1SQV G;  1NGM B;  4KHX A;  2LXC B;  5KLV K;  3GTO I;  1M1J C;  2OTL Z;  3I56 Z;  3FWL A;  2P58 A;  3V5B A;  3PLN A;  1H8A A;  5KKZ B;  2XU6 A;  2QJK B;  1QVF O;  3S2H I;  3ITK A;  1KMI Z;  3BCC D;  2OQQ A;  3RL0 D;  1Q81 1;  3N7N A;  1IJD B;  2RIQ A;  2V8I A;  4GOE A;  4HGY A;  1QEX A;  1ZH1 A;  1RF0 C;  1P84 D;  3B4S A;  2KP8 A;  2WSC J;  3PH0 A;  4D6T E;  3EWK A;  3KIH A;  3V6I A;  2GU2 A;  3I07 A;  2P67 A;  2O1J A;  5B66 H;  3S1K A;  1LWU C;  3CQZ I;  1VF5 B;  4E2Z A;  2WMM A;  3WU2 H;  2W03 A;  2QRD B;  4AYB A;  4I2L C;  2I1J A;  3L36 A;  5AW2 B;  1USE A;  4B86 A;  3CCV 1;  2JIM A;  3IR7 A;  2KB7 P;  3VP8 A;  2KI7 B;  2FXO A;  3GF7 A;  4XE5 B;  2N9B A;  2ITA A;  1OVV A;  2R32 A;  4A3G I;  2R7Z I;  3RBZ A;  1LTT C;  2JJL A;  1VF5 D;  2KYV A;  4TNU A;  3VTP C;  3H1L E;  1Q86 2;  2KLU A;  3CPW O;  1RHZ B;  4OVN F;  2KNC A;  3PHL A;  3L71 E;  4U3F J;  2WPR A;  3J81 f;  1LTG C;  1WZN A;  3KYQ A;  3GHG B;  3A5T A;  1TWF I;  3S14 I;  1RH5 B;  1S5L E;  2A45 G;  1OVU A;  1X8Y A;  4LC1 A;  3CCR P;  3L72 G;  1UII A;  1WRG A;  1LWU B;  2A06 D;  3I56 1;  2QM8 A;  1W2B Y;  4I6M C;  1VQ9 P;  1RO4 A;  1M90 2;  4YTP C;  3IX0 A;  1HGZ A;  1H88 A;  5K5G B;  4W7Z A;  3BAT A;  4GOD A;  2NZ2 A;  3CC4 P;  1ZXG A;  3VMZ A;  2IFN A;  1VPC A;  1M7L A;  1CZQ A;  2PGD A;  2I1K A;  2WIT A;  4U3F D;  2ZYG A;  1Q86 Q;  1YUA A;  4WBA A;  1MUU A;  1VQK Z;  2E2H I;  1K83 I;  3CXH I;  3GMA A;  3CX5 I;  3QWO C;  1S1C X;  3OW2 Z;  3VYI A;  1OXZ A;  1QL2 A;  1CW5 A;  2C9L Y;  4D6T J;  3J80 f;  3G71 1;  2ZAE B;  2E75 C;  3QH9 A;  3Q5S A;  3EED A;  5C44 I;  1S2E A;  3GCF A;  2DW3 A;  2FYU G;  1M90 Q;  1VQP P;  2G2K A;  2D2C C;  3GHG A;  5KLV D;  1KIL C;  4CL1 A;  4A3E I;  1ZR2 A;  2QE7 H;  1L4A C;  1G1J A;  5A2Q f;  1K73 2;  3WMM 0;  3RL0 g;  3S1R I;  4NBG A;  5T64 A;  4ZMD A;  1FZA A;  2CPB A;  1N73 C;  3HD7 C;  1AFO A;  3CLQ A;  4JQ0 D;  1L1O C;  1YJW P;  4Y7N I;  3V4W A;  4GKG A;  2A45 H;  5CCG A;  2Y9Y A;  2WVR A;  3L35 A;  2O53 A;  4HH2 A;  3B5N B;  5AVY B;  1X3Z A;  2IYP A;  3U59 A;  3HOX I;  1URQ C;  1SQP E;  3IF8 A;  1BCC J;  1NTM G;  4EWC A;  4ZNC A;  3FWN A;  4EOT A;  2R3C A;  1K9M 1;  3KZI H;  1NU1 E;  3SWY A;  1K73 Q;  4MN4 C;  2E75 B;  3L75 G;  3B5N D;  2VRS A;  1TWG I;  2WPV B;  5KJ7 C;  3A0B H;  2D2C B;  1KIL B;  1BCC D;  1Y8C A;  1PP9 E;  3H1H G;  5APX A;  1L4A B;  2KZJ A;  3FGA D;  4RVF A;  1Q7Y 1;  3CCE P;  1OX3 A;  1HWT C;  1VQK 1;  3A3Y B;  2WSE J;  2BAS A;  3P7K A;  5FLX b;  2OYO A;  1HF9 A;  2LFU A;  3G4S Z;  1N73 B;  3HD7 B;  3B8E B;  2P3Y A;  3B5N A;  3L73 J;  1P84 I;  2E75 D;  1LT1 A;  5AW8 B;  1IFD A;  2JR6 A;  4MD9 A;  1NVO A;  2IYO A;  3A0B E;  1ZB9 A;  2D2C D;  1NTK E;  1KIL D;  1URQ B;  2QRC B;  2EGT A;  3CC7 Z;  1VDF A;  1L4A D;  2V7Q J;  3ABV C;  4C7R A;  2KXP B;  4A3C I;  2WWW A;  1VQ8 1;  3HKZ A;  3CXH H;  1UIX A;  1J2J B;  3IAO A;  3S2D I;  4A3B I;  3F3P C;  1EZV D;  1ZP0 C;  2AXC A;  3HD7 D;  2V4H A;  2WSF H;  1YIJ P;  5AVR B;  2JS4 A;  1MFT A;  4NB9 A;  1BGY J;  3L73 D;  3CME Z;  1NYH A;  2W6B A;  3TNU B;  1MV8 A;  3V2N A;  1KIL A;  3C9I A;  1FZE A;  1URQ D;  2R92 I;  3TGU E;  2PM9 A;  1W5C E;  1LTI C;  3FKI I;  2YKP A;  3Q87 A;  2K37 A;  3CXH E;  3A7O A;  1N73 A;  3CX5 E;  3TDK A;  2HPC A;  1EC5 A;  4KJM A;  3GTK I;  1TFI A;  3K5B A;  1BGY D;  1VQL P;  3CCM Z;  1QGK B;  1N86 A;  1SQX E;  4LLH A;  2K1A A;  4A3J I;  5KJ7 D;  1Z56 A;  2L91 A;  1T6A A;  3H1J E;  1FZC C;  3D71 A;  5E79 E;  4DK1 A;  1SQB K;  2YMK A;  3FQM A;  3VN0 A;  2NVX I;  3PO3 I;  4PD4 H;  2JP3 A;  5APW A;  2H89 C;  2FFD A;  2O01 J;  3TDH B;  2KOG A;  3TNU A;  5AW6 B;  1T3U A;  1T3J A;  1PP9 J;  1GTW A;  3G4S 1;  4E2W A;  1NTZ K;  3CCL P;  2YAD A;  1AQT A;  5KAF H;  3Q5P A;  4PD4 E;  5B5E E;  3MUD A;  1SIW A;  3M9B A;  3Q1M A;  4A3I I;  2E74 C;  3GTM I;  1SQQ E;  4N6J A;  1NTK J;  3CWB G;  3HOZ I;  2JO1 A;  3HOV I;  3S1Q I;  3Q5R A;  1PP9 D;  3CC2 Z;  1KN7 A;  1R5S A;  2JIQ A;  2XDJ A;  3CCU P;  1IFP A;  2OOX B;  2K3R A;  1USD A;  1YTZ T;  4YXD C;  3CME 1;  4E30 A;  1FZC B;  1SLQ A;  2FXM A;  2K9J B;  1YJN Z;  4DJG A;  4H0L C;  1QF8 A;  5GTH E;  1PPJ G;  1VQ6 P;  3E7K A;  3BG0 B;  3BCC E;  3NMD A;  4RO0 A;  1KFN A;  4MD8 A;  4NBC A;  3VB9 A;  1YBK A;  2Q51 A;  2FXP A;  4OWF A;  4QMA A;  4A93 I;  1NP6 A;  3TGU J;  3HTK B;  3M3Y I;  5T6B A;  5CBN A;  3NH8 A;  2VF1 A;  1P84 E;  2YU9 I;  1VQ4 P;  1JTH A;  2WSC H;  1USP B;  2Q1K A;  3VMI A;  3CCM 1;  1DEE G;  4OGQ B;  2AEM A;  1VQ5 Z;  4RVD A;  2WSF J;  1LP1 A;  3CCJ P;  2GA1 A;  2RH0 A;  1SQX J;  1JY3 O;  2E9H A;  1KRL A;  4LGD E;  1NUI A;  4ASV A;  2VPY A;  3H1J J;  3TGU D;  4OH8 B;  1T8Z A;  4K3A A;  2O3J A;  5FLX f;  4NBE A;  4IFM A;  3WUT A;  2FKW B;  5TIS H;  2K9J A;  4OGQ D;  4D6T G;  4CPG A;  2POH A;  1GW3 A;  1PFI A;  4H0L B;  3NH4 A;  4RKU J;  3P8M C;  2QJY C;  2JEE A;  3C1L A;  1PGJ A;  5TJH A;  3HTK A;  4C7N B;  3H1J D;  5CBO A;  3LIE A;  3HUS C;  3IFU A;  1I50 I;  1S3J A;  4PV1 C;  5KKZ C;  3D6Z A;  1USP A;  5CMZ A;  1L0L K;  5TIS E;  1M57 D;  3CC2 1;  2UWJ E;  3RZD I;  2OYH B;  4Z1M H;  2DE6 A;  2M8R A;  1SQQ J;  1JOC A; 
#chains in the Genus database with same CATH homology
 1Q86 2;  3VMG A;  1JM0 A;  4NPF X;  2R6M A;  3NFZ A;  4NBB A;  1LP1 B;  2Q4Z A;  1VQO Z;  5C4X I;  1YJN 1;  2LXB A;  3H3V J;  3H0G I;  3J81 f;  2M5A A;  4HKZ H;  3S1M I;  3S14 I;  5C39 A;  1TWF I;  1QVG Z;  1N8R 1;  2QLV B;  4BXX I;  2B87 B;  2PMZ A;  3S16 I;  1OVU A;  4NB8 A;  3GKQ A;  1YHQ 1;  3I56 1;  1W2B Y;  1Y47 A;  1BDC A;  3CCR 1;  1Q86 1;  1RO4 A;  4DGL A;  1M90 2;  3IX0 A;  4RVH A;  5T67 A;  1EDJ A;  1LQL A;  2QA4 Z;  5K5G B;  1VQ9 1;  4WWI A;  4GOD A;  1ZXG A;  1TWH I;  3S17 I;  4A3K I;  1VQ5 1;  3CC4 1;  5DJU B;  4HB1 A;  1YUA A;  1VQK Z;  3CCE Z;  2E2H I;  1K83 I;  3G6E 1;  3FQQ A;  3K7A I;  3QWO C;  3OW2 Z;  1YJ9 Z;  5C4J I;  1RQF A;  1SFO I;  3MHV A;  1TWC I;  1WII A;  3J80 f;  3G71 1;  2ZAE B;  2AKL A;  3RZO I;  2QRX A;  3EED A;  5C44 I;  3GCF A;  1Z01 A;  1P9N A;  2R93 I;  2G2K A;  3CXC Z;  4CL1 A;  2NVY I;  4A3E I;  2B87 A;  2I8D A;  2QR1 B;  1VQP 1;  5A2Q f;  1EDK A;  2V8K A;  3D6W A;  2B89 A;  2W04 A;  3U50 C;  1VQ6 Z;  1K73 2;  2JA5 I;  3S1R I;  1EDL A;  2JA7 I;  4NBG A;  5T64 A;  4ZMD A;  3G71 Z;  3J7A 4;  2RBL A;  2IZ4 A;  1YI2 Z;  1VLA A;  3KIF A;  2LR2 A;  1L1O C;  1YIJ Z;  4Y7N I;  2NVT I;  2KIK A;  2OOY B;  1DL6 A;  4NBD A;  1YJW 1;  2F4O A;  2O53 A;  1X3Z A;  1Y1V S;  1RO2 A;  3CCS 1;  2RHB A;  3HOX I;  5IT9 f;  1QVG Y;  4HGZ A;  3IF8 A;  1RLY A;  2NVQ I;  1VQO 1;  1K73 1;  4ASW A;  1Q2N A;  3CCJ Z;  1KD1 2;  3RGU A;  2HF1 A;  4EWC A;  4ZNC A;  3CMA Z;  1JMB A;  2LIY A;  3PO3 S;  1JJ2 Z;  1FC2 C;  1K9M 1;  3JAM f;  1VQL Z;  3CCS Z;  4BBS I;  4A3L I;  4X6A I;  3MZK B;  2WAQ A;  2VUG A;  2BJO A;  3CD6 1;  3I55 Z;  2JA8 I;  5LL6 f;  4MN4 C;  4E31 A;  3VMH A;  1TWG I;  2QA4 1;  1KC8 2;  1S72 Z;  1QVF Z;  3P5J B;  4E33 A;  3F3F C;  2KZJ A;  3OW2 Y;  4RVF A;  1Q7Y 1;  2IZ3 A;  2E2I I;  4E2Y A;  1Q82 2;  2OTJ Z;  1VQK 1;  3CC7 1;  3CD6 Z;  2K5R A;  3CCE 1;  5FLX b;  3GTG I;  3HOU I;  2LFU A;  3G4S Z;  4NBA A;  2HU9 A;  3VTN A;  2P3Y A;  1YJ9 1;  3GTM S;  4BY7 I;  1LT1 A;  3CXC Y;  4MD9 A;  2JR6 A;  1NVO A;  1YIT Z;  3EER A;  1ZB9 A;  3MON A;  3CCL Z;  3HOY I;  2QRC B;  2EGT A;  3CC7 Z;  4RV9 A;  4RVG A;  5FLM I;  1X0T A;  1R9T I;  1Q82 1;  4XX2 A;  1JWH C;  2WB1 A;  4A3C I;  4A3M I;  1VQ8 1;  3HKZ A;  1M90 1;  1I6H I;  4A3D I;  4S1T A;  3S2D I;  4A3B I;  3F3P C;  2QRE B;  1M1K 2;  1VQ6 1;  3GTL I;  1U7M A;  1Z02 A;  4MRI A;  3CCU Z;  1VQN Z;  2JS4 A;  2RT9 A;  1MFT A;  4NB9 A;  3CME Z;  1YI2 1;  1TWA I;  2R44 A;  1YIJ 1;  1OVR A;  3MZW B;  2R92 I;  1VQ8 Z;  4EYY Q;  1S7M A;  2PM9 A;  1K8A 2;  1EDI A;  1VQ4 1;  4MON A;  2J6A A;  3FKI I;  3J81 b;  1JJ2 Y;  3Q87 A;  5D1P A;  2P28 A;  1M1K 1;  3CPW Z;  1YUK A;  3CCJ 1;  2QVA A;  4GOF A;  3CMA 1;  1EC5 A;  4KJM A;  2M0B A;  3GTK I;  1TFI A;  1QYP A;  4IOI H;  1Y1V I;  3CCM Z;  1VQ4 Z;  1X3W A;  1N2F A;  2OTK E;  4A3J I;  1QVF Y;  1VQL 1;  2SPZ A;  4HJG H;  3S1N I;  2QKD A;  3I55 1;  2PK7 A;  3HOW I;  4DK1 A;  3FQM A;  5IP7 I;  3QWU A;  1BDD A;  3CCQ Z;  2NVX I;  3PO3 I;  5DJT B;  5EFW B;  1S72 1;  2I3C A;  4NBH A;  2M6N A;  3TDH B;  1VQM Z;  3NDI A;  4E32 A;  2OTJ 1;  1Z03 A;  3NH5 A;  2B63 I;  3G4S 1;  4NFR A;  3ESW A;  4HH4 A;  4E2W A;  3J80 b;  2GTI A;  3PO2 I;  1N8R 2;  1ML8 A;  5IP9 I;  1VQ7 Z;  1KD1 1;  3CCV Z;  1H0T B;  2E2J I;  2YAD A;  1KQS Z;  2KS1 B;  4NOZ A;  1YIT 1;  2JMO A;  2Y0S A;  3CCL 1;  5A2Q b;  1RNI A;  4DQY B;  4A3I I;  2JWD A;  3GTQ I;  4NBF A;  2QEX Z;  3GTM I;  5C3E I;  3I4N I;  3FXD A;  3HOZ I;  4E2X A;  3HOV I;  3S1Q I;  3CC2 Z;  4BXL A;  4BBR I;  2KPI A;  1KC8 1;  3S15 I;  4A3F I;  2O4H A;  4NPD A;  4RS4 A;  2OOX B;  4K35 A;  2K3R A;  4JBZ A;  1VQN 1;  3CCU 1;  2OTL 1;  3GTJ I;  3CME 1;  4E30 A;  1YJN Z;  5IT9 b;  3CPW Y;  4NH1 C;  1Q81 2;  1QF8 A;  1WCM I;  2DE7 A;  1Y1W I;  3BG0 B;  3FXE A;  1I3Q I;  4Y52 I;  4NPE A;  4MD8 A;  4NBC A;  2LXC B;  3VB9 A;  3GTO I;  2Q51 A;  4A93 I;  1NP6 A;  1YHQ Z;  2OTL Z;  3D9X A;  5CM2 M;  3I56 Z;  3M3Y I;  2P58 A;  2RPR A;  3LUS A;  3CCR Z;  3JAM b;  5T6B A;  5CBN A;  4MH4 A;  3NH8 A;  2HR3 A;  2B88 A;  2VF1 A;  2YU9 I;  3T4N B;  5D1O B;  1H0T A;  1VQ9 Z;  2DE5 A;  3S2H I;  2OZK A;  2JA6 I;  1USP B;  2Q1K A;  3VMI A;  3CCM 1;  1DEE G;  1Q81 1;  1PFT A;  2RIQ A;  3ZDM A;  2V8I A;  4QTU A;  1VQ5 Z;  4RVD A;  1W2B Z;  1LP1 A;  3CC4 Z;  4GOE A;  2M48 A;  4HGY A;  2E9H A;  1KRL A;  2H85 A;  1ZH1 A;  5AN9 F;  1NUI A;  1SS1 A;  3G6E Z;  4ASV A;  3NDJ A;  3CCQ 1;  1RO0 A;  2KUB A;  4MXU A;  3PH0 A;  3TE5 B;  1ZW0 A;  2VUM I;  2M5A B;  4K3A A;  1NJI 2;  3MZL B;  3KIH A;  5FLX f;  4NBE A;  2RKL A;  3BG1 B;  2GU2 A;  3I07 A;  1K8A 1;  1VQM 1;  1WW9 A;  3S1K A;  2GTH A;  3I4M I;  2JUB A;  3M4O I;  3CQZ I;  1KQS Y;  4E2Z A;  2F4M A;  2WMM A;  2W03 A;  4CPG A;  2QRD B;  4AYB A;  2JNY A;  1K9M 2;  1VQ7 1;  3NH4 A;  3CCV 1;  3GTP I;  1VQP Z;  4BY1 I;  1NJI 1;  5CBO A;  2KI7 B;  1U7J A;  1ZB8 A;  3IFU A;  1I50 I;  1S3J A;  1OVV A;  5D1O A;  2QEX 1;  4MD7 A;  4A3G I;  2R7Z I;  1USP A;  4QTT A;  1Q7Y 2;  3CC2 1;  2UWJ E;  1YJW Z;  3RZD I;  4TNU A;  2V8J A;  2DE6 A;  2KZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...