2ZAEB

Crystal structure of protein ph1601p in complex with protein ph1771p of archaeal ribonuclease p from pyrococcus horikoshii ot3
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
EKKEKKKIAIERIDTLFTLAERVARYSPDLAKRYVELALEIQKKAKVKIPRKWKRRYCKRCHTFLIPGVNARVRLRTKRMPHVVITCLECGYIMRYPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an archaeal homolog of the human protein complex Rpp21-Rpp29 that is a key core component for the assembly of active ribonuclease P.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 1
total genus 28
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2007-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2zaeB01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2zaeB02
1Y47A 1EDKA 2LXCB 2M0BA 2KZIA 4JBZA 4GOEA 1EDIA 4K3AA 1ZXGA 1EDLA 4K35A 4ASWA 2KZJA 2B87A 4NPFX 4HKZH 4ASVA 2M5AA 5DJTB 3RGUA 2KUBA 2HR3A 2M5AB 5K5GB 5CBNA 4ZNCA 2KS1B 2KIKA 2Q1KA 3PH0A 4IOIH 2B88A 2UWJE 4ZMDA 3FXEA 1H0TA 2I8DA 4NPEA 2QVAA 2RKLA 2B87B 2QRXA 2LXBA 1LP1A 1JMBA 1DEEG 1H0TB 1SS1A 1JM0A 2K3RA 2ZAEB 2LR2A 3MZWB 4NPDA 4CPGA 1MFTA 4GOFA 4MN4C 1EC5A 1EDJA 4HB1A 3QWOC 1OVVA 1NVOA 2SPZA 1LP1B 4HJGH 2JWDA 2P58A 1OVUA 1S3JA 4GODA 1LT1A 2KI7B 5CBOA 5EFWB 1BDCA 4EYYQ 2R44A 2OTKE 1FC2C 4BXLA 4WWIA 3MHVA 5DJUB 1U7JA 1U7MA 1Q2NA 1ZW0A 1X0TA 3ZDMA 2WMMA 1BDDA 2B89A 3S1KA 4KJMA 3FXDA 5C39A 1OVRA
chains in the Genus database with same CATH superfamily
1PP9D 4DQYB 4X6AI 2H43A 2KK7A 3L71D 2WT7A 3CC4P 1RO0A 4H13D 2RIQA 1LWUC 1RF1C 1E5WA 1QVFZ 3RK2D 2QEXP 1GMJA 2IPPA 3F3PC 4DK1A 2JIRA 1MV8A 1PP9J 2OZKA 1X3ZA 3U1AA 5AVXB 3CXCZ 3F89A 1KC8Q 5AW8B 1YIJZ 1KYOH 2N1TA 3CWBD 5IT9b 3CCRZ 1FE6A 1NYHA 3VMHA 3T4NB 1VQ61 3P8MC 3OA7A 1Y1VS 3RK3C 3J7A4 2JA5I 1GL2A 1JO5A 1USEA 1CZQA 1VQLZ 2PRRA 3AE7C 1Q822 4GOFA 2P7JA 1K9MQ 1M1JC 1GTWA 3HOVI 2PMZA 1KD11 2QJKC 1OVVA 4E31A 4HJGH 3E1RA 2AYDA 2Q9IA 3H1KJ 2KLUA 2Q3EA 2IZ1A 3VTPC 3I55Z 4H44D 2C9NY 3H1HD 3AE1C 3ABVC 1KMIZ 2Q3IA 3CCVZ 1PP9E 2Y0SA 5TISH 3HOXI 1TWAI 3GTMI 3M91A 2FY8A 2B63I 3R4YA 1U7MA 3H32A 5CCGD 1Q2NA 1ZW0A 1WJ2A 4NBBA 1JEKA 2W90A 1RLYA 1Q862 4BBSI 3ITKA 3L36A 3AEEC 3NFZA 3PHLA 4NOZA 1URQC 4RVGA 3EQ2A 3TSIA 4JYCA 2NPSC 4C7NB 3G6EZ 4RVDA 4AYBA 5D1OA 1BCCJ 1VPCA 2R93I 1SFCA 1KILB 1YJ9P 2FXOA 2H88C 4PJ0H 3G6E1 3S1QI 1BE3G 4NH1C 4A3CI 3RGUA 2KUBA 1WMKA 1Z56A 1IFDA 1DIPA 3VP9A 5CCHA 1Q7Y1 3L73D 3Q5PA 1PGQA 1SQQE 5TJHA 1QVFY 2Q1KA 2B88A 1YJNP 1N73C 2FBWC 3NDJA 1VQ9P 1N7SD 2OOYB 1KQSY 1VF5C 2R92I 3IFUA 1JY3N 3BRVB 4AQRD 5FLMI 1VQMZ 3I551 1QVGZ 1SS1A 1Y1VI 1KILA 2QG4A 5H2FH 3L70D 4E2XA 2JA8I 5AW4B 2FFDB 1UIXA 2WSEH 5FLXf 2BASA 4BY7I 2M8RA 1LT1A 1JY2P 3B5NB 1FOSF 1EXJA 2NPSB 2R44A 3M4OI 1DH3A 2K9YA 1FC2C 2FXPA 1N7SA 3II6A 1H8AA 2YMYA 1SQVG 3TK1A 1OW8A 1S72P 1SIWA 1YHQP 1FZFA 1SVFA 3PP5A 4H0LD 3FXDA 2E74B 1USPB 4N6JA 4BXXI 2JIOA 1SFCD 2KZIA 1IC2A 1WRGA 1L2PA 1HWTC 1K04A 3CXHI 4A3II 4H13C 3J81f 2P67A 3G711 3CX5D 1M57D 1ZH1A 1YUKA 1XTGB 1ZOYC 1GK4A 1NTZE 3S15I 2JP3A 5K5GB 1VDFA 2BEQD 3CCL1 1L0ND 3GTOI 1H89A 3S2DI 2ZT9D 2KB7P 2LKMA 2NPSD 4I6MC 1J1EB 1NUIA 2O53A 2Y9YA 3OW2Z 1Q7YQ 4C7RA 3MONA 2W04A 3AE5C 3MZLB 2BCCD 3SSUA 5TISE 3CWBJ 3AEBC 1Q81Q 2B87B 1Q86Q 1AJYA 5CCGC 3GTGI 2W6AA 4UB8H 4DCKA 1LTJA 1M1K2 3HD7A 1QX8A 1SQVK 4L76A 5H2FE 3A0HH 2DE7A 5GTHE 5KJ7C 1EC5A 2AXTE 3HOYI 4L75A 3TDKA 3TGUD 3HTKA 2QEXZ 4PD4D 1TFIA 1CW5A 4A93I 2PM9A 2HU9A 2ZJSE 1MFZA 2XDJA 4PV1B 5CBOA 4PD4E 3BASA 1SQXK 2VPYA 1M1K1 4BRYA 1ZB8A 3TE5B 1M56D 3CC2P 1NTKK 1ZMEC 1SQBJ 1NTZJ 5AW7B 2IYOA 5DJUB 1S72Z 2G3AA 3AE8C 1R5LA 1VQ91 1YUAA 3L75J 1RF0C 2GTIA 1PL5A 3CME1 2WMMA 1TWFI 1AVOA 4O9BA 1J1EC 1LWUB 3RL0g 4MRIA 1GL2C 4Y99B 1CI6B 3BCCE 3CD61 1NU1E 1NTKE 2JJLA 2R3CA 2KLVA 3L4FA 2QJPC 3KYQA 1NAFA 3SWKA 3P8CE 3GKQA 2IZ0A 4LGDE 4ZNCA 2CK3H 1S5LX 3A0BE 1X3WA 3TYYA 3I56Z 1YITP 3FXEA 5AW0B 3B4SA 3CX5H 1M1KQ 2OQQA 1LT9C 3MP7B 2OGUA 3V6IA 2QRXA 2LXBA 1K83I 1VF5D 1NO4A 3GTKI 2W27A 3RL0B 4OGQB 3PRJA 2KYVA 3PO3S 4IL6H 3VMYA 2E74D 4A7PA 2WSFJ 3C9IA 3GMAA 3HUSA 2BCCG 3AEDC 1WIIA 3CCUP 2RHBA 2E75C 1S9KD 1GDTA 1KQSO 4HB1A 4D6TG 1IFNA 1RQFA 1CSBA 3QWOC 4IFMA 5APSA 4E33A 1KZUB 3D6WA 3A7OA 4A3JI 2KNCB 1ZB9A 3WUUA 1VQN1 2K9JB 1R8EA 1VQKZ 3CC7Z 4GDOA 2Y0EA 2YU9I 5M1BA 1FU1A 5AVTB 1OWAA 1AQTA 3L71J 4UB6H 3L72E 4L74A 3NXSA 1ZN5A 5FLXb 4E32A 1OW6A 1EZVI 1NHLA 1GD2E 2N9BA 2ZT9B 5KLVD 2B89A 3CCE1 2YIUC 1P84H 4KJMA 1NTZG 5C39A 1KILC 3CPWZ 2JNYA 3D9XA 2EGTA 2K1AA 3C8VA 3CXHH 5C4XI 5AVRB 2OYHA 3NDIA 1RF0A 2QRDB 1NU1J 4C7NA 4D6TJ 4H0LB 3QWUA 2PK7A 1AV1A 1HF9A 1EQ7A 1M7LA 3PH0A 4IOIH 3L72G 5E79H 2VPZA 3OW2Y 2I3CA 2BEZF 2E5YA 3CMAZ 4B86A 3H1KE 3HE4A 3MUDA 5IP7I 1WZNA 1KQLA 1SQVJ 1A02J 1LNQA 2IFMA 1S7MA 1HUCA 2C0XA 3F3FC 3LIEA 3U50C 3P5JB 3MZWB 2W8ZA 3CMEP 4EWCA 4JQ0D 1BCCE 5AW6B 2Y9ZA 3QH9A 1EDJA 2QRCB 3BG0B 3AE9C 3NTNA 1FDMA 2MKVA 3J80f 3B8EB 1EZVE 2W6BA 3C1LA 3A3YB 2Q51A 1Q90D 1OVUA 2ZT9C 2QLVB 3CCVP 3FKII 2DE6A 5CCHD 1AFOA 1M90Q 3I55P 3CC7P 5CCGA 4WY4B 1Q16A 3CMAP 3RL0D 1WT6A 2E76B 4MONA 2RPRA 4H0LC 3SWFA 1VQ8Z 2WTYA 2L91A 3V5BA 2JIPA 3KHUA 1IJDB 2WPRA 1OVRA 5KLIC 1NH4A 4GOEA 1IFIA 1KB9D 1S2EA 2OTLZ 3IR9A 3CPWO 3EFFK 1KFMA 2E43A 4E2YA 3I4NI 5CJ4A 5C44I 3A0HE 2QKDA 1OW7A 2M5AB 2Z4EA 3L72D 1JOCA 2E2II 1YYCA 1SQPD 2AEMA 3MUDC 3VN0A 1TWCI 2FYUK 1VQ51 3CX5I 3L73E 2FYUD 1N7LA 2DW3A 5GTHH 1Q821 1VQL1 4DOJA 1NKZB 3EERA 4JPZB 3CD6P 3G71P 1YTZI 1NTZD 2H7HA 2ZVNB 4OWFA 3Q5RA 3RK3E 2LR2A 3O8ZA 1NTKJ 1JJ2Y 3PO3I 1DEBA 2J5UA 2OTJP 5B66H 1L0LK 5AW2B 3HOUI 3CXHD 2NVXI 1BGYJ 3H1JD 4I1LA 1N7SB 3FQMA 2QA4Z 3D71A 3GLMA 2KI7B 2VUMI 2A06E 1BSHA 2I1JA 2OTKE 2JA6I 1L0LD 3L75D 1SQVE 3M0AA 2M6NA 1LT9A 1BGYD 1YIJP 3IX0A 3H1JE 3IR7A 2HG5D 5AVWB 1YQ3C 3SFDC 3GTJI 1K9M1 3KXDA 1JWHC 1P84I 4U3FG 3GW6A 1VLAA 3BCCJ 5T64A 4AYCA 1FZCC 1EDKA 2ZYGA 1FJPA 3JCUE 3A0BH 1BGYG 1BE3E 2M5AA 4E30A 2JUBA 1M902 1KYOE 5APUA 2V7QH 3RZDI 2IBZE 2C0WA 4ZMDA 1G2CB 2HPCB 1L0NE 4EDFA 1FOSE 4Y99C 1H0TA 4OVNF 1VQ6Z 5B66E 1YJWZ 2M48A 3G71Z 3FGAD 1Y9BA 5BU8B 4A3EI 4MD7A 2R32A 3OW2O 1GW3A 1HJ0A 2K9JA 3CCJ1 4DJGA 1NJI2 2K88A 2POHA 2E2HI 1KN7A 2OYIB 1WCMI 3M0DA 1L4AC 3FWNA 1YJ9Z 2FKWB 2YKQA 3RL0C 3AEAC 1ZR2A 3RK2C 1LTBC 3V2RA 1SQPG 1KQFB 3S16I 2VRSA 2JS4A 4AUWA 1JY3P 4YTPC 1KB9E 3P8CD 3L37A 1U7JA 1EZVD 3H6PA 1SQXG 3MTUE 2YIUB 1YQ4C 1VQP1 2ZYDA 2WQYC 2GA1A 1EXIA 4A3LI 1QEXA 2P28A 3N7NA 3VMAA 4W7YA 1RF1B 3HKZA 3I07A 1GL2D 5B5EE 1QVFO 3TF5A 1I50I 4JBZA 1AA0A 4EI2A 1ZXGA 2IBZI 1NTZK 3JC22 1RE3C 1EDLA 2KSEA 2KZJA 3GHGA 3M3YI 1AQ5A 2IYPA 1N73A 1SQPE 1LWUA 4HGZA 3G4S1 3CC4Z 2PAJA 2RBLA 2QJYB 5DJTB 2Q5UA 3OJAB 3V4WA 3J80b 3CCQZ 2FFDA 1Z01A 3H1LG 2Z5HA 1YJWP 1P84E 2QVAA 3O6QB 2V4HA 1VQ8P 2YXRB 3V2NA 1QL2A 1FDIA 1J2JB 5AVZB 2AEFA 1H0TB 3H1IJ 2HFED 3AECC 1PGOA 2QJKB 1HBWA 2QIWA 3M9QA 3OAKA 1SQVD 3H1KD 1TWHI 2KNCA 1HJBA 4XX2A 2HPCA 3L74D 4UB8E 3TGUJ 3P32A 1NTME 2WT7B 3PTZA 3PO2I 2OYOA 2VF1A 1YHQ1 3VMZA 2B9BA 1VQ5Z 2WSSH 1SQQJ 4WY4A 5L8RJ 2KPIA 5GTIH 2QJYC 4Y28J 1MUUA 3E7KA 3UIAA 1URQB 3NH8A 1NJIQ 5KLIB 5APTA 3ESWA 1OZHA 3L71E 3L74G 1K731 2OTL1 3BVHA 2WZ7A 3H1HJ 4QTUA 4JF7A 1PPJE 4UB6E 2FYUE 5KLVG 3H1KG 1K8AQ 2R3SA 3CI9A 3E1IA 1N86A 3G6EP 4WY4C 3JCUH 1M8OB 5APYA 4I7ZB 4TT3H 1IZNB 1HH0A 2RT9A 1LTIC 1SQXE 4N78E 4YPCA 1RY3A 1Y8CA 2WB1A 2QE7H 1Q82Q 3H1JJ 3G3ZA 2WPSA 2GM4A 4L73A 1LJ2A 2ZFCA 2G2KA 2V45A 4E2ZA 4BY1I 2M3EA 3A5TA 1LGHB 2ZAEB 1VQ4P 2HLOA 1VQMP 1L4AD 4MN4C 2O4HA 1Q861 1FZCA 1N7SC 4N78D 5AW1B 1OMIA 4RV9A 2ITAA 5A2Qb 1JY2N 1FZAA 1FBMA 2JWDA 3HD7D 2RH0A 3H1HG 4WBAA 2ZYAA 1T8ZA 1T2KD 1VQ5P 2JR6A 5C3EI 1LTAC 1VQ6P 3VMIA 1GZLA 1L4AA 2NRGA 2OARA 3H1HE 3HD7B 1SQBK 3M9BA 2ZXEB 2QREB 2JA7I 1MKMA 5AW3B 1LTGC 2QR1B 3R2PA 2YXQB 1FZCB 1KB9I 3CCRP 2R7ZI 2QA41 1Y1WI 3S1RI 2VPXA 2A45H 4NB9A 4S1TA 3H25A 1PFIA 1EDIA 3TDHB 1WW9A 2YO2A 2IZ3A 1USDA 4NPFX 1PIXA 1BSNA 1OX3A 1OXZA 4TLFA 4HGYA 3L70J 1RNIA 4HH4A 1T6AA 3HUSB 3BRTB 3CC71 1IK7A 1PZQA 3H32B 3VMXA 2FXMA 1N8R1 4R4MA 3TNUA 3CCM1 1VQNZ 3TGUE 2O3JA 2PGDA 1HGZA 1W2BO 1YHQZ 3VMGA 3NH4A 3S2HI 5KAFH 2IV2X 2D2CC 3U1CA 3HE4B 2FYNB 4GIFA 1LQLA 1LTJC 2AXTH 4NBEA 4Y52I 2JO1A 4PD4I 3RK3B 1R9TI 1N8RQ 4NBCA 1X22A 4MH4A 1LP1B 4IL6X 1M1JB 1NJI1 1KILD 4ZKPA 1RE4A 1L0LJ 1PGPA 1NKNA 2HF1A 1HTLC 2GUVA 2Q6QA 3MD0A 1VQ7P 3AE6C 1KQGB 4OGQD 3LW5H 1KORA 3MIWA 3I561 5CJ0A 3L75G 1G2CA 3CC2Z 1JCDA 3N4XA 2AEJA 3NFQA 1YIT1 3CCQ1 1S4XA 4RO0A 1X0TA 4RKUJ 3CCSZ 2KXPB 3L75E 1L4AB 1KRLA 4NBGA 4A3KI 2WVRA 3B5ND 4U7JA 5A2Qf 5AVSB 1K73Q 3WUVA 3S1KA 3K5BA 2P3YA 3H1JG 3CWBE 2K5RA 1Y47A 3RK2B 1Q811 2M0BA 5AN9F 3CMEZ 2NZ2A 3GTQI 4K3AA 5APQA 5IT9f 2WSEJ 5CM2M 3EFGA 2YADA 3CQZI 4U3FJ 2E75D 4PJ0E 4HKZH 1R5SA 5CMZA 3PJSK 2FYNC 5CBNA 1JCCA 1RH5B 2AXCA 3FQQA 4A3BI 4DGLA 4HH2A 1LTJB 2JIMA 1SFCB 2BCCE 2KS1B 1LT9B 4XE5B 5KKZC 1I3QI 2FYUG 5KLVE 1HVVA 2I1KA 2YNYA 3NH5A 1N73B 2F4OA 4NB8A 1X8YA 5KAFE 1BCCD 1ZRTD 3AE4C 3AEFC 3V2PA 3CCS1 2N1TC 3S17I 1NU1G 2C9LY 1SQQG 3BG1B 4PV1D 1S1CX 4MXUA 1RF1A 2O01H 3CCR1 1K8A1 2RMZA 4LC1A 1URQD 2O01N 1GU4A 2IBZD 5AVQB 1YIJ1 1DX7A 3M06A 1PGJA 2PP6A 3CCEZ 5GTIE 3L35A 1YTZT 1BDCA 3MZKB 5C4JI 4NBDA 3KIHA 3LUSA 1IFPA 3LW5J 3MHVA 4TNUA 1P9NA 1QXFA 1RE3A 2BCCJ 3G9RA 2IFNA 2E5TA 2LIYA 3CPWY 3CCLZ 1KB9H 1FJKA 3S4RA 2JR8A 5KKZB 4ZKUA 1NTMD 2A45I 2V8KA 2CPBA 3MGNA 3Q1MA 1AA6A 1AVYA 2E74C 3IFMA 4I7ZC 4NBFA 1NU1K 1MZ9A 2E76D 3VOPA 2E7ZA 4QTTA 2HR3A 3GF3A 5LL6f 3CXHE 3CCEP 2JKVA 2DE5A 4YXDC 1L1OC 2V3VA 1KD12 1VQOZ 2XV5A 1SQQD 3GCFA 4DZOA 1NU1D 1K8A2 3Q3DA 1LP1A 5KAIH 1KTMA 1XTCC 1D7MA 1JY3O 4W7ZA 1DL6A 1JMBA 3JSVC 1VQO1 3CCU1 3S9OA 1Z02A 1SQBG 2QSIA 5BVZA 3B71A 3HOWI 1DD3A 4PD4H 1Y8AA 2GUSA 2JWAA 2WSCH 1IFJA 1NVOA 1USPA 1FZEA 1OFCX 5KTBA 5D1PA 3RBZA 2YMKA 2NVQI 2KP8A 4RVHA 2J58A 1NOHA 1YJNZ 5EFWB 3CCJZ 3HE5A 1VQNP 3CX5E 1SQXJ 1YI21 1VQ9Z 2E76C 3F5HA 2O1KA 4KT0J 3S1MI 2J6AA 1YITZ 1ZR4A 4HYTB 4IL6E 1H88A 3D70A 3RZOI 2XZRA 3TNUB 3L74E 3L71G 5CCHC 2BJOA 1FAVA 3VYIA 1IFMA 2E9HA 3B5NA 1IK9A 2WPVB 2OYHB 1NGMB 1JUNA 4NFRA 2Q7CA 3T97B 3D6ZA 1QLED 4JYBA 1ML8A 4D6TD 4K35A 2LFUA 1KC81 3GG2A 3HUSC 3G4SZ 3CC41 1PPJG 3FWLA 1X79B 3H3VJ 2JEEA 4NBHA 3I5CA 2W83C 2A45G 3PLNA 1BGYE 2QJPB 2WSFH 4R4LA 1GW4A 3V2QA 2UWJE 3L70E 2RN0A 1KFNA 2RKLA 3HRNA 1NP6A 3EEDA 3CCV1 1QF8A 3CCSP 2XU6A 1VQPZ 1VQKP 2M3BA 4A3DI 1ZLLA 2WWWA 3I4MI 2J59M 2H8PD 3IAOA 1W5CE 3CD6Z 2K3RA 4LLHA 4OGQC 5E79E 3RBXA 1SP4A 2W6JH 3SWYA 5D1OB 2LEXA 2YKPA 2E75B 2A06G 1NTMK 3CCMP 1KQSZ 1S5LE 1UIIA 1S3JA 2L5GB 3BCCD 3CL3D 2OYHC 3JAMb 1VQ71 1YI2P 2D2CB 1GK6A 3EWKA 2Y0DA 3M9HA 1JB0J 2XKMA 2QM7A 3KZIE 1RO2A 1G1IA 4D6TE 1SLQA 1NTKG 4BXLA 1S9KE 1W2BY 2V7QJ 1KC82 4E2WA 2VPWA 3GHGB 2XNXA 1TWGI 3IN6A 5B5EH 1Q812 2FYUJ 4XA4A 1KYOD 1YBKA 3CC21 4RVFA 4GT1A 2P1JA 2OTJZ 3CXCY 2LXCB 3TGUG 4MD8A 1N8R2 3WU2H 3GTLI 3IF4A 3L72J 4CL1A 2KSJA 2N9YB 1U57A 2O1JA 4ASWA 4BBRI 2IZ4A 4U3FE 2XNDH 3AEGC 1SFCC 3H1IE 4ASVA 3A2AA 3RK3D 1VQM1 3GTMS 1K9M2 2KIKA 1RQUA 3H1ID 2KS1A 2ZVOB 2WPQA 2YKOA 1QL1A 1NTMJ 2NPSA 2JMOA 1K732 1PPJD 2N1TB 4EOTA 2N1TD 2ZXXA 4MD9A 4BRYB 1NAYA 4M3LA 2O01J 1L0NG 3H1LJ 1TU3F 3W68A 3CLQA 1DEEG 2D2CD 2K37A 1QVGY 2NVYI 1BE3J 4CPGA 1T3JA 1L0LE 2OYIC 2R6MA 1PFTA 5IP9I 1JMMA 2V8JA 2V8IA 1A02F 1YJ91 2Z5IA 2E42A 5APWA 3V4QA 3LIDA 4OH8B 3NMDA 1OIPA 3M0DC 3I56P 3S14I 4C46A 4EYYQ 2PFXA 1VQ7Z 3KDPB 4H44C 4IFFA 3Q5SA 1JNMA 1SQQK 3CMA1 4WVZA 3W67A 3GTPI 3ZDMA 1Z03A 2OTJ1 1SQBD 1KILE 4NBAA 4XFJA 3D6YA 1SQPJ 2HODB 3HOZI 3VP8A 4N3YB 5AVUB 2Q4ZA 5KAIE 1VQ4Z 2QM8A 3L70G 3JAMf 1VF5B 1M1JA 2CPSA 1NWQA 5APVA 5T67A 4W80A 2F4MA 2AKLA 1HGVA 1LTTC 2R5BA 3BATA 4A3MI 2QA4P 3IF8A 1FZGA 5T6BA 3L74J 3L73J 3CCQP 5KJ7A 2I8DA 2WAQA 2FFDC 1VQK1 1KYOI 1QVGO 3WUTA 2P10A 2OYIA 3H1LE 3L73G 2E2JI 3B5NC 1G1JA 3D2LA 1W2BZ 2H85A 1N2DC 1NTMG 1BE3D 1Q7Y2 2QEX1 3H1LD 4H44B 4A3GI 1JTHA 3AE3C 3G4SP 3FX0A 3AE2C 3WU2E 1J1DC 1JJ2Z 1K05A 2SPZA 1SQBE 1VL2A 2P58A 2IDBA 4Y7NI 1GU5A 1I6HI 5AW9B 2FYZA 2JIQA 3P7KA 3H1IG 1PV3A 5KLVJ 1KD1Q 4KHXA 4WWIA 1VQPP 3SFEC 1SFOI 3CCLP 2IBZG 4WB4A 1RHZB 1FZBA 3Q2YA 1L0NK 3USSA 4GKGA 1BDDA 1SQXD 2WSCJ 1KV4A 3S1NI 1EZVG 4Z1MH 5AVYB 2YO3A 4IFDK 2WITA 1ZP0C 3KZIH 1BCCG 1VQ41 4RJTA 5BU5A 1W2EA 3CCMZ 4QMAA 1SQPK 3O6QA 1M901 2JDIH 2H89C 1FS0E 2B87A 1ZRTE 1E79H 5AW5B 3KQGA 1YI2Z 4H13B 1NTKD 1YJN1 1X9VA 1ZV8A 3CWBG 1VQOP 4DT0A 3H0GI 1L0NJ 3T97A 1FDOA 3BCCG 3KPEA 4NPEA 2OOXB 1S721 1J1DB 5AVVB 3U59A 1YJW1 3VB9A 2A06D 2IX7C 4PV1C 1JTHB 1VQ81 2KOGA 3CCUZ 1N2FA 1JM0A 2P2UA 3HE5B 4NPDA 5CHXA 1CI6A 1MFTA 1RE4C 2OTLP 1VQLP 1RO4A 1IO4A 1PP9G 4YXWH 3VTNA 5KJ7D 2Y0CA 3Q87A 2GTHA 1QGKB 4WY4D 1T2KC 1P84D 1T3UA 4GODA 4RESB 2G8YA 2NAPA 3KIFA 2HODA 2W03A 4EIJA 2VUGA 1GL2B 3GHGC 3HD7C 4BWNA 1URQA 3CCJP 4A3FI 2NVTI 2MJZA 3WMM0 5KLVK 3J81b 4U3FD 4I2LC 1RQVA 5APXA 3K7AI 3GF7A 2R5DA 1LTSC 1DD4A 3HTKB 1QYPA 1JY2O 2HYNA 1L0LG 1S5LH 2GU2A 4RS4A
chains in the Genus database with same CATH topology
4NFRA 2JNYA 3D9XA 4DQYB 2EGTA 4X6AI 1ML8A 1RO0A 2RIQA 4K35A 5C4XI 2LFUA 1KC81 1QVFZ 3G4SZ 3NDIA 3CC41 2QRDB 3H3VJ 3F3PC 4DK1A 4NBHA 3QWUA 2PK7A 2RT9A 2OZKA 3PH0A 4IOIH 1X3ZA 3OW2Y 2I3CA 2UWJE 2WB1A 3CXCZ 3CMAZ 1YIJZ 2RKLA 1NP6A 3EEDA 3CCV1 1QF8A 5IP7I 5IT9b 2G2KA 1VQPZ 3CCRZ 4A3DI 4E2ZA 1S7MA 3VMHA 3F3FC 4BY1I 3T4NB 3U50C 1VQ61 3I4MI 1Y1VS 3J7A4 3CD6Z 2K3RA 2JA5I 2ZAEB 3P5JB 3MZWB 4EWCA 1VQLZ 1Q822 4GOFA 4MN4C 1EDJA 2QRCB 2O4HA 3BG0B 3HOVI 1Q861 2PMZA 3J80f 5D1OB 4RV9A 1KD11 1OVVA 5A2Qb 4E31A 4HJGH 2JWDA 1KQSZ 2Q51A 1OVUA 1S3JA 2QLVB 3JAMb 1VQ71 3FKII 2DE6A 3I55Z 3CCVZ 2JR6A 5C3EI 2Y0SA 1RO2A 3HOXI 3VMIA 1W2BY 4BXLA 1TWAI 3GTMI 1KC82 4E2WA 2B63I 1TWGI 1U7MA 4MONA 2QREB 1Q2NA 1ZW0A 2JA7I 2RPRA 4NBBA 2QR1B 1Q812 1VQ8Z 1RLYA 1Q862 4BBSI 3CC21 2R7ZI 2QA41 4RVFA 1Y1WI 3NFZA 4NOZA 3S1RI 4NB9A 2OTJZ 1OVRA 3CXCY 4RVGA 4S1TA 3G6EZ 2LXCB 4MD8A 4RVDA 4AYBA 4GOEA 1N8R2 3GTLI 1EDIA 3TDHB 1WW9A 5D1OA 4CL1A 2R93I 4ASWA 4BBRI 2IZ4A 2OTLZ 2IZ3A 4NPFX 4E2YA 3I4NI 3G6E1 3S1QI 4NH1C 4A3CI 4ASVA 4HGYA 3RGUA 2KUBA 2QKDA 2M5AB 1RNIA 5C44I 4HH4A 2E2II 1Q7Y1 1VQM1 3GTMS 3CC71 1K9M2 2KIKA 1QVFY 2Q1KA 2B88A 1N8R1 1TWCI 2JMOA 3CCM1 1VQ51 1VQNZ 1K732 3NDJA 2OOYB 1Q821 1YHQZ 4MD9A 3VMGA 1KQSY 1VQL1 3EERA 3NH4A 2R92I 3S2HI 3IFUA 5FLMI 1VQMZ 3I551 1DEEG 1QVGZ 1SS1A 1QVGY 1Y1VI 2NVYI 2LR2A 4CPGA 1LQLA 1JJ2Y 3PO3I 4NBEA 4Y52I 1R9TI 4E2XA 3HOUI 2JA8I 2NVXI 2R6MA 4NBCA 1PFTA 5IP9I 4MH4A 1LP1B 2V8JA 1NJI1 5FLXf 2V8IA 1YJ91 3FQMA 4BY7I 2QA4Z 1LT1A 2KI7B 2VUMI 2HF1A 3S14I 4EYYQ 2R44A 3M4OI 2OTKE 3I561 2JA6I 1FC2C 1VQ7Z 3CC2Z 2M6NA 1YIT1 3CCQ1 3IX0A 3CMA1 3GTPI 1X0TA 3ZDMA 1Z03A 2OTJ1 3CCSZ 4NBAA 3GTJI 1KRLA 1K9M1 4NBGA 4A3KI 3HOZI 1JWHC 5A2Qf 3S1KA 3FXDA 2P3YA 1VLAA 1USPB 4BXXI 2K5RA 5T64A 1Y47A 2Q4ZA 1Q811 1VQ4Z 1EDKA 2M0BA 2KZIA 5AN9F 3CMEZ 3GTQI 3JAMf 4K3AA 4A3II 3J81f 3G711 5IT9f 5CM2M 1ZH1A 2YADA 1YUKA 3CQZI 4HKZH 2M5AA 3S15I 5K5GB 5CBNA 5T67A 4E30A 3CCL1 3FQQA 4A3BI 2F4MA 3GTOI 2AKLA 4DGLA 2JUBA 1M902 3S2DI 3RZDI 2KS1B 4A3MI 3IF8A 1NUIA 2O53A 5T6BA 3OW2Z 4ZMDA 1I3QI 3MONA 2W04A 1H0TA 2I8DA 2WAQA 3MZLB 3NH5A 1VQK1 1VQ6Z 1YJWZ 2B87B 2F4OA 2M48A 4NB8A 3G71Z 4A3EI 4MD7A 3CCS1 3GTGI 2E2JI 3S17I 3CCJ1 1W2BZ 2H85A 1M1K2 3BG1B 1NJI2 1Q7Y2 2QEX1 4MXUA 2DE7A 3CCR1 1K8A1 1EC5A 4A3GI 3HOYI 2E2HI 1YIJ1 2QEXZ 1TFIA 4A93I 1JJ2Z 2PM9A 2HU9A 2SPZA 1WCMI 2P58A 4Y7NI 1YJ9Z 1I6HI 3CCEZ 5CBOA 1BDCA 1M1K1 3MZKB 1ZB8A 3TE5B 5C4JI 4NBDA 2JS4A 3S16I 3KIHA 3LUSA 4WWIA 3MHVA 4TNUA 5DJUB 1S72Z 1U7JA 1P9NA 1SFOI 1VQP1 1VQ91 2LIYA 1YUAA 3CPWY 3CCLZ 2GTIA 3CME1 2WMMA 4A3LI 2P28A 1BDDA 1TWFI 3S1NI 2V8KA 3HKZA 3I07A 4MRIA 1I50I 1VQ41 4JBZA 3CD61 3CCMZ 1ZXGA 1EDLA 1M901 2KZJA 3M3YI 2B87A 4NBFA 4HGZA 3G4S1 3CC4Z 2RBLA 4QTTA 5DJTB 1YI2Z 2HR3A 5LL6f 3GKQA 4ZNCA 1YJN1 3J80b 3CCQZ 1Z01A 3H0GI 2DE5A 1X3WA 3I56Z 3FXEA 1L1OC 1KD12 4NPEA 1VQOZ 2QVAA 2OOXB 1S721 3GCFA 1YJW1 1K8A2 3VB9A 2QRXA 2LXBA 1K83I 1LP1A 3GTKI 1VQ81 1DL6A 1JMBA 3PO3S 1H0TB 1VQO1 3CCUZ 3CCU1 1N2FA 1JM0A 4NPDA 1WIIA 1Z02A 2RHBA 1MFTA 3HOWI 4HB1A 1TWHI 1RO4A 1RQFA 3QWOC 3VTNA 3Q87A 1NVOA 4XX2A 4E33A 2GTHA 1USPA 3D6WA 5D1PA 4GODA 3KIFA 2NVQI 4RVHA 1YJNZ 2W03A 3PO2I 5EFWB 3CCJZ 2VUGA 4A3JI 1ZB9A 2VF1A 1YHQ1 1YI21 1VQ9Z 4A3FI 2NVTI 1VQ5Z 1VQN1 3S1MI 3J81b 1VQKZ 2J6AA 3CC7Z 2KPIA 1YITZ 2YU9I 3RZOI 3NH8A 3K7AI 5FLXb 4E32A 2BJOA 3ESWA 2E9HA 2B89A 3CCE1 1K731 1QYPA 2OTL1 4KJMA 5C39A 3CPWZ 4QTUA 2GU2A 4RS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y47 A;  1EDK A;  2LXC B;  2M0B A;  2KZI A;  4JBZ A;  4GOE A;  1EDI A;  4K3A A;  1ZXG A;  1EDL A;  4K35 A;  4ASW A;  2KZJ A;  2B87 A;  4NPF X;  4HKZ H;  4ASV A;  2M5A A;  5DJT B;  3RGU A;  2KUB A;  2HR3 A;  2M5A B;  5K5G B;  5CBN A;  4ZNC A;  2KS1 B;  2KIK A;  2Q1K A;  3PH0 A;  4IOI H;  2B88 A;  2UWJ E;  4ZMD A;  3FXE A;  1H0T A;  2I8D A;  4NPE A;  2QVA A;  2RKL A;  2B87 B;  2QRX A;  2LXB A;  1LP1 A;  1JMB A;  1DEE G;  1H0T B;  1SS1 A;  1JM0 A;  2K3R A;  2ZAE B;  2LR2 A;  3MZW B;  4NPD A;  4CPG A;  1MFT A;  4GOF A;  4MN4 C;  1EC5 A;  1EDJ A;  4HB1 A;  3QWO C;  1OVV A;  1NVO A;  2SPZ A;  1LP1 B;  4HJG H;  2JWD A;  2P58 A;  1OVU A;  1S3J A;  4GOD A;  1LT1 A;  2KI7 B;  5CBO A;  5EFW B;  1BDC A;  4EYY Q;  2R44 A;  2OTK E;  1FC2 C;  4BXL A;  4WWI A;  3MHV A;  5DJU B;  1U7J A;  1U7M A;  1Q2N A;  1ZW0 A;  1X0T A;  3ZDM A;  2WMM A;  1BDD A;  2B89 A;  3S1K A;  4KJM A;  3FXD A;  5C39 A;  1OVR A; 
#chains in the Genus database with same CATH topology
 1PP9 D;  4DQY B;  4X6A I;  2H43 A;  2KK7 A;  3L71 D;  2WT7 A;  3CC4 P;  1RO0 A;  4H13 D;  2RIQ A;  1LWU C;  1RF1 C;  1E5W A;  1QVF Z;  3RK2 D;  2QEX P;  1GMJ A;  2IPP A;  3F3P C;  4DK1 A;  2JIR A;  1MV8 A;  1PP9 J;  2OZK A;  1X3Z A;  3U1A A;  5AVX B;  3CXC Z;  3F89 A;  1KC8 Q;  5AW8 B;  1YIJ Z;  1KYO H;  2N1T A;  3CWB D;  5IT9 b;  3CCR Z;  1FE6 A;  1NYH A;  3VMH A;  3T4N B;  1VQ6 1;  3P8M C;  3OA7 A;  1Y1V S;  3RK3 C;  3J7A 4;  2JA5 I;  1GL2 A;  1JO5 A;  1USE A;  1CZQ A;  1VQL Z;  2PRR A;  3AE7 C;  1Q82 2;  4GOF A;  2P7J A;  1K9M Q;  1M1J C;  1GTW A;  3HOV I;  2PMZ A;  1KD1 1;  2QJK C;  1OVV A;  4E31 A;  4HJG H;  3E1R A;  2AYD A;  2Q9I A;  3H1K J;  2KLU A;  2Q3E A;  2IZ1 A;  3VTP C;  3I55 Z;  4H44 D;  2C9N Y;  3H1H D;  3AE1 C;  3ABV C;  1KMI Z;  2Q3I A;  3CCV Z;  1PP9 E;  2Y0S A;  5TIS H;  3HOX I;  1TWA I;  3GTM I;  3M91 A;  2FY8 A;  2B63 I;  3R4Y A;  1U7M A;  3H32 A;  5CCG D;  1Q2N A;  1ZW0 A;  1WJ2 A;  4NBB A;  1JEK A;  2W90 A;  1RLY A;  1Q86 2;  4BBS I;  3ITK A;  3L36 A;  3AEE C;  3NFZ A;  3PHL A;  4NOZ A;  1URQ C;  4RVG A;  3EQ2 A;  3TSI A;  4JYC A;  2NPS C;  4C7N B;  3G6E Z;  4RVD A;  4AYB A;  5D1O A;  1BCC J;  1VPC A;  2R93 I;  1SFC A;  1KIL B;  1YJ9 P;  2FXO A;  2H88 C;  4PJ0 H;  3G6E 1;  3S1Q I;  1BE3 G;  4NH1 C;  4A3C I;  3RGU A;  2KUB A;  1WMK A;  1Z56 A;  1IFD A;  1DIP A;  3VP9 A;  5CCH A;  1Q7Y 1;  3L73 D;  3Q5P A;  1PGQ A;  1SQQ E;  5TJH A;  1QVF Y;  2Q1K A;  2B88 A;  1YJN P;  1N73 C;  2FBW C;  3NDJ A;  1VQ9 P;  1N7S D;  2OOY B;  1KQS Y;  1VF5 C;  2R92 I;  3IFU A;  1JY3 N;  3BRV B;  4AQR D;  5FLM I;  1VQM Z;  3I55 1;  1QVG Z;  1SS1 A;  1Y1V I;  1KIL A;  2QG4 A;  5H2F H;  3L70 D;  4E2X A;  2JA8 I;  5AW4 B;  2FFD B;  1UIX A;  2WSE H;  5FLX f;  2BAS A;  4BY7 I;  2M8R A;  1LT1 A;  1JY2 P;  3B5N B;  1FOS F;  1EXJ A;  2NPS B;  2R44 A;  3M4O I;  1DH3 A;  2K9Y A;  1FC2 C;  2FXP A;  1N7S A;  3II6 A;  1H8A A;  2YMY A;  1SQV G;  3TK1 A;  1OW8 A;  1S72 P;  1SIW A;  1YHQ P;  1FZF A;  1SVF A;  3PP5 A;  4H0L D;  3FXD A;  2E74 B;  1USP B;  4N6J A;  4BXX I;  2JIO A;  1SFC D;  2KZI A;  1IC2 A;  1WRG A;  1L2P A;  1HWT C;  1K04 A;  3CXH I;  4A3I I;  4H13 C;  3J81 f;  2P67 A;  3G71 1;  3CX5 D;  1M57 D;  1ZH1 A;  1YUK A;  1XTG B;  1ZOY C;  1GK4 A;  1NTZ E;  3S15 I;  2JP3 A;  5K5G B;  1VDF A;  2BEQ D;  3CCL 1;  1L0N D;  3GTO I;  1H89 A;  3S2D I;  2ZT9 D;  2KB7 P;  2LKM A;  2NPS D;  4I6M C;  1J1E B;  1NUI A;  2O53 A;  2Y9Y A;  3OW2 Z;  1Q7Y Q;  4C7R A;  3MON A;  2W04 A;  3AE5 C;  3MZL B;  2BCC D;  3SSU A;  5TIS E;  3CWB J;  3AEB C;  1Q81 Q;  2B87 B;  1Q86 Q;  1AJY A;  5CCG C;  3GTG I;  2W6A A;  4UB8 H;  4DCK A;  1LTJ A;  1M1K 2;  3HD7 A;  1QX8 A;  1SQV K;  4L76 A;  5H2F E;  3A0H H;  2DE7 A;  5GTH E;  5KJ7 C;  1EC5 A;  2AXT E;  3HOY I;  4L75 A;  3TDK A;  3TGU D;  3HTK A;  2QEX Z;  4PD4 D;  1TFI A;  1CW5 A;  4A93 I;  2PM9 A;  2HU9 A;  2ZJS E;  1MFZ A;  2XDJ A;  4PV1 B;  5CBO A;  4PD4 E;  3BAS A;  1SQX K;  2VPY A;  1M1K 1;  4BRY A;  1ZB8 A;  3TE5 B;  1M56 D;  3CC2 P;  1NTK K;  1ZME C;  1SQB J;  1NTZ J;  5AW7 B;  2IYO A;  5DJU B;  1S72 Z;  2G3A A;  3AE8 C;  1R5L A;  1VQ9 1;  1YUA A;  3L75 J;  1RF0 C;  2GTI A;  1PL5 A;  3CME 1;  2WMM A;  1TWF I;  1AVO A;  4O9B A;  1J1E C;  1LWU B;  3RL0 g;  4MRI A;  1GL2 C;  4Y99 B;  1CI6 B;  3BCC E;  3CD6 1;  1NU1 E;  1NTK E;  2JJL A;  2R3C A;  2KLV A;  3L4F A;  2QJP C;  3KYQ A;  1NAF A;  3SWK A;  3P8C E;  3GKQ A;  2IZ0 A;  4LGD E;  4ZNC A;  2CK3 H;  1S5L X;  3A0B E;  1X3W A;  3TYY A;  3I56 Z;  1YIT P;  3FXE A;  5AW0 B;  3B4S A;  3CX5 H;  1M1K Q;  2OQQ A;  1LT9 C;  3MP7 B;  2OGU A;  3V6I A;  2QRX A;  2LXB A;  1K83 I;  1VF5 D;  1NO4 A;  3GTK I;  2W27 A;  3RL0 B;  4OGQ B;  3PRJ A;  2KYV A;  3PO3 S;  4IL6 H;  3VMY A;  2E74 D;  4A7P A;  2WSF J;  3C9I A;  3GMA A;  3HUS A;  2BCC G;  3AED C;  1WII A;  3CCU P;  2RHB A;  2E75 C;  1S9K D;  1GDT A;  1KQS O;  4HB1 A;  4D6T G;  1IFN A;  1RQF A;  1CSB A;  3QWO C;  4IFM A;  5APS A;  4E33 A;  1KZU B;  3D6W A;  3A7O A;  4A3J I;  2KNC B;  1ZB9 A;  3WUU A;  1VQN 1;  2K9J B;  1R8E A;  1VQK Z;  3CC7 Z;  4GDO A;  2Y0E A;  2YU9 I;  5M1B A;  1FU1 A;  5AVT B;  1OWA A;  1AQT A;  3L71 J;  4UB6 H;  3L72 E;  4L74 A;  3NXS A;  1ZN5 A;  5FLX b;  4E32 A;  1OW6 A;  1EZV I;  1NHL A;  1GD2 E;  2N9B A;  2ZT9 B;  5KLV D;  2B89 A;  3CCE 1;  2YIU C;  1P84 H;  4KJM A;  1NTZ G;  5C39 A;  1KIL C;  3CPW Z;  2JNY A;  3D9X A;  2EGT A;  2K1A A;  3C8V A;  3CXH H;  5C4X I;  5AVR B;  2OYH A;  3NDI A;  1RF0 A;  2QRD B;  1NU1 J;  4C7N A;  4D6T J;  4H0L B;  3QWU A;  2PK7 A;  1AV1 A;  1HF9 A;  1EQ7 A;  1M7L A;  3PH0 A;  4IOI H;  3L72 G;  5E79 H;  2VPZ A;  3OW2 Y;  2I3C A;  2BEZ F;  2E5Y A;  3CMA Z;  4B86 A;  3H1K E;  3HE4 A;  3MUD A;  5IP7 I;  1WZN A;  1KQL A;  1SQV J;  1A02 J;  1LNQ A;  2IFM A;  1S7M A;  1HUC A;  2C0X A;  3F3F C;  3LIE A;  3U50 C;  3P5J B;  3MZW B;  2W8Z A;  3CME P;  4EWC A;  4JQ0 D;  1BCC E;  5AW6 B;  2Y9Z A;  3QH9 A;  1EDJ A;  2QRC B;  3BG0 B;  3AE9 C;  3NTN A;  1FDM A;  2MKV A;  3J80 f;  3B8E B;  1EZV E;  2W6B A;  3C1L A;  3A3Y B;  2Q51 A;  1Q90 D;  1OVU A;  2ZT9 C;  2QLV B;  3CCV P;  3FKI I;  2DE6 A;  5CCH D;  1AFO A;  1M90 Q;  3I55 P;  3CC7 P;  5CCG A;  4WY4 B;  1Q16 A;  3CMA P;  3RL0 D;  1WT6 A;  2E76 B;  4MON A;  2RPR A;  4H0L C;  3SWF A;  1VQ8 Z;  2WTY A;  2L91 A;  3V5B A;  2JIP A;  3KHU A;  1IJD B;  2WPR A;  1OVR A;  5KLI C;  1NH4 A;  4GOE A;  1IFI A;  1KB9 D;  1S2E A;  2OTL Z;  3IR9 A;  3CPW O;  3EFF K;  1KFM A;  2E43 A;  4E2Y A;  3I4N I;  5CJ4 A;  5C44 I;  3A0H E;  2QKD A;  1OW7 A;  2M5A B;  2Z4E A;  3L72 D;  1JOC A;  2E2I I;  1YYC A;  1SQP D;  2AEM A;  3MUD C;  3VN0 A;  1TWC I;  2FYU K;  1VQ5 1;  3CX5 I;  3L73 E;  2FYU D;  1N7L A;  2DW3 A;  5GTH H;  1Q82 1;  1VQL 1;  4DOJ A;  1NKZ B;  3EER A;  4JPZ B;  3CD6 P;  3G71 P;  1YTZ I;  1NTZ D;  2H7H A;  2ZVN B;  4OWF A;  3Q5R A;  3RK3 E;  2LR2 A;  3O8Z A;  1NTK J;  1JJ2 Y;  3PO3 I;  1DEB A;  2J5U A;  2OTJ P;  5B66 H;  1L0L K;  5AW2 B;  3HOU I;  3CXH D;  2NVX I;  1BGY J;  3H1J D;  4I1L A;  1N7S B;  3FQM A;  2QA4 Z;  3D71 A;  3GLM A;  2KI7 B;  2VUM I;  2A06 E;  1BSH A;  2I1J A;  2OTK E;  2JA6 I;  1L0L D;  3L75 D;  1SQV E;  3M0A A;  2M6N A;  1LT9 A;  1BGY D;  1YIJ P;  3IX0 A;  3H1J E;  3IR7 A;  2HG5 D;  5AVW B;  1YQ3 C;  3SFD C;  3GTJ I;  1K9M 1;  3KXD A;  1JWH C;  1P84 I;  4U3F G;  3GW6 A;  1VLA A;  3BCC J;  5T64 A;  4AYC A;  1FZC C;  1EDK A;  2ZYG A;  1FJP A;  3JCU E;  3A0B H;  1BGY G;  1BE3 E;  2M5A A;  4E30 A;  2JUB A;  1M90 2;  1KYO E;  5APU A;  2V7Q H;  3RZD I;  2IBZ E;  2C0W A;  4ZMD A;  1G2C B;  2HPC B;  1L0N E;  4EDF A;  1FOS E;  4Y99 C;  1H0T A;  4OVN F;  1VQ6 Z;  5B66 E;  1YJW Z;  2M48 A;  3G71 Z;  3FGA D;  1Y9B A;  5BU8 B;  4A3E I;  4MD7 A;  2R32 A;  3OW2 O;  1GW3 A;  1HJ0 A;  2K9J A;  3CCJ 1;  4DJG A;  1NJI 2;  2K88 A;  2POH A;  2E2H I;  1KN7 A;  2OYI B;  1WCM I;  3M0D A;  1L4A C;  3FWN A;  1YJ9 Z;  2FKW B;  2YKQ A;  3RL0 C;  3AEA C;  1ZR2 A;  3RK2 C;  1LTB C;  3V2R A;  1SQP G;  1KQF B;  3S16 I;  2VRS A;  2JS4 A;  4AUW A;  1JY3 P;  4YTP C;  1KB9 E;  3P8C D;  3L37 A;  1U7J A;  1EZV D;  3H6P A;  1SQX G;  3MTU E;  2YIU B;  1YQ4 C;  1VQP 1;  2ZYD A;  2WQY C;  2GA1 A;  1EXI A;  4A3L I;  1QEX A;  2P28 A;  3N7N A;  3VMA A;  4W7Y A;  1RF1 B;  3HKZ A;  3I07 A;  1GL2 D;  5B5E E;  1QVF O;  3TF5 A;  1I50 I;  4JBZ A;  1AA0 A;  4EI2 A;  1ZXG A;  2IBZ I;  1NTZ K;  3JC2 2;  1RE3 C;  1EDL A;  2KSE A;  2KZJ A;  3GHG A;  3M3Y I;  1AQ5 A;  2IYP A;  1N73 A;  1SQP E;  1LWU A;  4HGZ A;  3G4S 1;  3CC4 Z;  2PAJ A;  2RBL A;  2QJY B;  5DJT B;  2Q5U A;  3OJA B;  3V4W A;  3J80 b;  3CCQ Z;  2FFD A;  1Z01 A;  3H1L G;  2Z5H A;  1YJW P;  1P84 E;  2QVA A;  3O6Q B;  2V4H A;  1VQ8 P;  2YXR B;  3V2N A;  1QL2 A;  1FDI A;  1J2J B;  5AVZ B;  2AEF A;  1H0T B;  3H1I J;  2HFE D;  3AEC C;  1PGO A;  2QJK B;  1HBW A;  2QIW A;  3M9Q A;  3OAK A;  1SQV D;  3H1K D;  1TWH I;  2KNC A;  1HJB A;  4XX2 A;  2HPC A;  3L74 D;  4UB8 E;  3TGU J;  3P32 A;  1NTM E;  2WT7 B;  3PTZ A;  3PO2 I;  2OYO A;  2VF1 A;  1YHQ 1;  3VMZ A;  2B9B A;  1VQ5 Z;  2WSS H;  1SQQ J;  4WY4 A;  5L8R J;  2KPI A;  5GTI H;  2QJY C;  4Y28 J;  1MUU A;  3E7K A;  3UIA A;  1URQ B;  3NH8 A;  1NJI Q;  5KLI B;  5APT A;  3ESW A;  1OZH A;  3L71 E;  3L74 G;  1K73 1;  2OTL 1;  3BVH A;  2WZ7 A;  3H1H J;  4QTU A;  4JF7 A;  1PPJ E;  4UB6 E;  2FYU E;  5KLV G;  3H1K G;  1K8A Q;  2R3S A;  3CI9 A;  3E1I A;  1N86 A;  3G6E P;  4WY4 C;  3JCU H;  1M8O B;  5APY A;  4I7Z B;  4TT3 H;  1IZN B;  1HH0 A;  2RT9 A;  1LTI C;  1SQX E;  4N78 E;  4YPC A;  1RY3 A;  1Y8C A;  2WB1 A;  2QE7 H;  1Q82 Q;  3H1J J;  3G3Z A;  2WPS A;  2GM4 A;  4L73 A;  1LJ2 A;  2ZFC A;  2G2K A;  2V45 A;  4E2Z A;  4BY1 I;  2M3E A;  3A5T A;  1LGH B;  2ZAE B;  1VQ4 P;  2HLO A;  1VQM P;  1L4A D;  4MN4 C;  2O4H A;  1Q86 1;  1FZC A;  1N7S C;  4N78 D;  5AW1 B;  1OMI A;  4RV9 A;  2ITA A;  5A2Q b;  1JY2 N;  1FZA A;  1FBM A;  2JWD A;  3HD7 D;  2RH0 A;  3H1H G;  4WBA A;  2ZYA A;  1T8Z A;  1T2K D;  1VQ5 P;  2JR6 A;  5C3E I;  1LTA C;  1VQ6 P;  3VMI A;  1GZL A;  1L4A A;  2NRG A;  2OAR A;  3H1H E;  3HD7 B;  1SQB K;  3M9B A;  2ZXE B;  2QRE B;  2JA7 I;  1MKM A;  5AW3 B;  1LTG C;  2QR1 B;  3R2P A;  2YXQ B;  1FZC B;  1KB9 I;  3CCR P;  2R7Z I;  2QA4 1;  1Y1W I;  3S1R I;  2VPX A;  2A45 H;  4NB9 A;  4S1T A;  3H25 A;  1PFI A;  1EDI A;  3TDH B;  1WW9 A;  2YO2 A;  2IZ3 A;  1USD A;  4NPF X;  1PIX A;  1BSN A;  1OX3 A;  1OXZ A;  4TLF A;  4HGY A;  3L70 J;  1RNI A;  4HH4 A;  1T6A A;  3HUS B;  3BRT B;  3CC7 1;  1IK7 A;  1PZQ A;  3H32 B;  3VMX A;  2FXM A;  1N8R 1;  4R4M A;  3TNU A;  3CCM 1;  1VQN Z;  3TGU E;  2O3J A;  2PGD A;  1HGZ A;  1W2B O;  1YHQ Z;  3VMG A;  3NH4 A;  3S2H I;  5KAF H;  2IV2 X;  2D2C C;  3U1C A;  3HE4 B;  2FYN B;  4GIF A;  1LQL A;  1LTJ C;  2AXT H;  4NBE A;  4Y52 I;  2JO1 A;  4PD4 I;  3RK3 B;  1R9T I;  1N8R Q;  4NBC A;  1X22 A;  4MH4 A;  1LP1 B;  4IL6 X;  1M1J B;  1NJI 1;  1KIL D;  4ZKP A;  1RE4 A;  1L0L J;  1PGP A;  1NKN A;  2HF1 A;  1HTL C;  2GUV A;  2Q6Q A;  3MD0 A;  1VQ7 P;  3AE6 C;  1KQG B;  4OGQ D;  3LW5 H;  1KOR A;  3MIW A;  3I56 1;  5CJ0 A;  3L75 G;  1G2C A;  3CC2 Z;  1JCD A;  3N4X A;  2AEJ A;  3NFQ A;  1YIT 1;  3CCQ 1;  1S4X A;  4RO0 A;  1X0T A;  4RKU J;  3CCS Z;  2KXP B;  3L75 E;  1L4A B;  1KRL A;  4NBG A;  4A3K I;  2WVR A;  3B5N D;  4U7J A;  5A2Q f;  5AVS B;  1K73 Q;  3WUV A;  3S1K A;  3K5B A;  2P3Y A;  3H1J G;  3CWB E;  2K5R A;  1Y47 A;  3RK2 B;  1Q81 1;  2M0B A;  5AN9 F;  3CME Z;  2NZ2 A;  3GTQ I;  4K3A A;  5APQ A;  5IT9 f;  2WSE J;  5CM2 M;  3EFG A;  2YAD A;  3CQZ I;  4U3F J;  2E75 D;  4PJ0 E;  4HKZ H;  1R5S A;  5CMZ A;  3PJS K;  2FYN C;  5CBN A;  1JCC A;  1RH5 B;  2AXC A;  3FQQ A;  4A3B I;  4DGL A;  4HH2 A;  1LTJ B;  2JIM A;  1SFC B;  2BCC E;  2KS1 B;  1LT9 B;  4XE5 B;  5KKZ C;  1I3Q I;  2FYU G;  5KLV E;  1HVV A;  2I1K A;  2YNY A;  3NH5 A;  1N73 B;  2F4O A;  4NB8 A;  1X8Y A;  5KAF E;  1BCC D;  1ZRT D;  3AE4 C;  3AEF C;  3V2P A;  3CCS 1;  2N1T C;  3S17 I;  1NU1 G;  2C9L Y;  1SQQ G;  3BG1 B;  4PV1 D;  1S1C X;  4MXU A;  1RF1 A;  2O01 H;  3CCR 1;  1K8A 1;  2RMZ A;  4LC1 A;  1URQ D;  2O01 N;  1GU4 A;  2IBZ D;  5AVQ B;  1YIJ 1;  1DX7 A;  3M06 A;  1PGJ A;  2PP6 A;  3CCE Z;  5GTI E;  3L35 A;  1YTZ T;  1BDC A;  3MZK B;  5C4J I;  4NBD A;  3KIH A;  3LUS A;  1IFP A;  3LW5 J;  3MHV A;  4TNU A;  1P9N A;  1QXF A;  1RE3 A;  2BCC J;  3G9R A;  2IFN A;  2E5T A;  2LIY A;  3CPW Y;  3CCL Z;  1KB9 H;  1FJK A;  3S4R A;  2JR8 A;  5KKZ B;  4ZKU A;  1NTM D;  2A45 I;  2V8K A;  2CPB A;  3MGN A;  3Q1M A;  1AA6 A;  1AVY A;  2E74 C;  3IFM A;  4I7Z C;  4NBF A;  1NU1 K;  1MZ9 A;  2E76 D;  3VOP A;  2E7Z A;  4QTT A;  2HR3 A;  3GF3 A;  5LL6 f;  3CXH E;  3CCE P;  2JKV A;  2DE5 A;  4YXD C;  1L1O C;  2V3V A;  1KD1 2;  1VQO Z;  2XV5 A;  1SQQ D;  3GCF A;  4DZO A;  1NU1 D;  1K8A 2;  3Q3D A;  1LP1 A;  5KAI H;  1KTM A;  1XTC C;  1D7M A;  1JY3 O;  4W7Z A;  1DL6 A;  1JMB A;  3JSV C;  1VQO 1;  3CCU 1;  3S9O A;  1Z02 A;  1SQB G;  2QSI A;  5BVZ A;  3B71 A;  3HOW I;  1DD3 A;  4PD4 H;  1Y8A A;  2GUS A;  2JWA A;  2WSC H;  1IFJ A;  1NVO A;  1USP A;  1FZE A;  1OFC X;  5KTB A;  5D1P A;  3RBZ A;  2YMK A;  2NVQ I;  2KP8 A;  4RVH A;  2J58 A;  1NOH A;  1YJN Z;  5EFW B;  3CCJ Z;  3HE5 A;  1VQN P;  3CX5 E;  1SQX J;  1YI2 1;  1VQ9 Z;  2E76 C;  3F5H A;  2O1K A;  4KT0 J;  3S1M I;  2J6A A;  1YIT Z;  1ZR4 A;  4HYT B;  4IL6 E;  1H88 A;  3D70 A;  3RZO I;  2XZR A;  3TNU B;  3L74 E;  3L71 G;  5CCH C;  2BJO A;  1FAV A;  3VYI A;  1IFM A;  2E9H A;  3B5N A;  1IK9 A;  2WPV B;  2OYH B;  1NGM B;  1JUN A;  4NFR A;  2Q7C A;  3T97 B;  3D6Z A;  1QLE D;  4JYB A;  1ML8 A;  4D6T D;  4K35 A;  2LFU A;  1KC8 1;  3GG2 A;  3HUS C;  3G4S Z;  3CC4 1;  1PPJ G;  3FWL A;  1X79 B;  3H3V J;  2JEE A;  4NBH A;  3I5C A;  2W83 C;  2A45 G;  3PLN A;  1BGY E;  2QJP B;  2WSF H;  4R4L A;  1GW4 A;  3V2Q A;  2UWJ E;  3L70 E;  2RN0 A;  1KFN A;  2RKL A;  3HRN A;  1NP6 A;  3EED A;  3CCV 1;  1QF8 A;  3CCS P;  2XU6 A;  1VQP Z;  1VQK P;  2M3B A;  4A3D I;  1ZLL A;  2WWW A;  3I4M I;  2J59 M;  2H8P D;  3IAO A;  1W5C E;  3CD6 Z;  2K3R A;  4LLH A;  4OGQ C;  5E79 E;  3RBX A;  1SP4 A;  2W6J H;  3SWY A;  5D1O B;  2LEX A;  2YKP A;  2E75 B;  2A06 G;  1NTM K;  3CCM P;  1KQS Z;  1S5L E;  1UII A;  1S3J A;  2L5G B;  3BCC D;  3CL3 D;  2OYH C;  3JAM b;  1VQ7 1;  1YI2 P;  2D2C B;  1GK6 A;  3EWK A;  2Y0D A;  3M9H A;  1JB0 J;  2XKM A;  2QM7 A;  3KZI E;  1RO2 A;  1G1I A;  4D6T E;  1SLQ A;  1NTK G;  4BXL A;  1S9K E;  1W2B Y;  2V7Q J;  1KC8 2;  4E2W A;  2VPW A;  3GHG B;  2XNX A;  1TWG I;  3IN6 A;  5B5E H;  1Q81 2;  2FYU J;  4XA4 A;  1KYO D;  1YBK A;  3CC2 1;  4RVF A;  4GT1 A;  2P1J A;  2OTJ Z;  3CXC Y;  2LXC B;  3TGU G;  4MD8 A;  1N8R 2;  3WU2 H;  3GTL I;  3IF4 A;  3L72 J;  4CL1 A;  2KSJ A;  2N9Y B;  1U57 A;  2O1J A;  4ASW A;  4BBR I;  2IZ4 A;  4U3F E;  2XND H;  3AEG C;  1SFC C;  3H1I E;  4ASV A;  3A2A A;  3RK3 D;  1VQM 1;  3GTM S;  1K9M 2;  2KIK A;  1RQU A;  3H1I D;  2KS1 A;  2ZVO B;  2WPQ A;  2YKO A;  1QL1 A;  1NTM J;  2NPS A;  2JMO A;  1K73 2;  1PPJ D;  2N1T B;  4EOT A;  2N1T D;  2ZXX A;  4MD9 A;  4BRY B;  1NAY A;  4M3L A;  2O01 J;  1L0N G;  3H1L J;  1TU3 F;  3W68 A;  3CLQ A;  1DEE G;  2D2C D;  2K37 A;  1QVG Y;  2NVY I;  1BE3 J;  4CPG A;  1T3J A;  1L0L E;  2OYI C;  2R6M A;  1PFT A;  5IP9 I;  1JMM A;  2V8J A;  2V8I A;  1A02 F;  1YJ9 1;  2Z5I A;  2E42 A;  5APW A;  3V4Q A;  3LID A;  4OH8 B;  3NMD A;  1OIP A;  3M0D C;  3I56 P;  3S14 I;  4C46 A;  4EYY Q;  2PFX A;  1VQ7 Z;  3KDP B;  4H44 C;  4IFF A;  3Q5S A;  1JNM A;  1SQQ K;  3CMA 1;  4WVZ A;  3W67 A;  3GTP I;  3ZDM A;  1Z03 A;  2OTJ 1;  1SQB D;  1KIL E;  4NBA A;  4XFJ A;  3D6Y A;  1SQP J;  2HOD B;  3HOZ I;  3VP8 A;  4N3Y B;  5AVU B;  2Q4Z A;  5KAI E;  1VQ4 Z;  2QM8 A;  3L70 G;  3JAM f;  1VF5 B;  1M1J A;  2CPS A;  1NWQ A;  5APV A;  5T67 A;  4W80 A;  2F4M A;  2AKL A;  1HGV A;  1LTT C;  2R5B A;  3BAT A;  4A3M I;  2QA4 P;  3IF8 A;  1FZG A;  5T6B A;  3L74 J;  3L73 J;  3CCQ P;  5KJ7 A;  2I8D A;  2WAQ A;  2FFD C;  1VQK 1;  1KYO I;  1QVG O;  3WUT A;  2P10 A;  2OYI A;  3H1L E;  3L73 G;  2E2J I;  3B5N C;  1G1J A;  3D2L A;  1W2B Z;  2H85 A;  1N2D C;  1NTM G;  1BE3 D;  1Q7Y 2;  2QEX 1;  3H1L D;  4H44 B;  4A3G I;  1JTH A;  3AE3 C;  3G4S P;  3FX0 A;  3AE2 C;  3WU2 E;  1J1D C;  1JJ2 Z;  1K05 A;  2SPZ A;  1SQB E;  1VL2 A;  2P58 A;  2IDB A;  4Y7N I;  1GU5 A;  1I6H I;  5AW9 B;  2FYZ A;  2JIQ A;  3P7K A;  3H1I G;  1PV3 A;  5KLV J;  1KD1 Q;  4KHX A;  4WWI A;  1VQP P;  3SFE C;  1SFO I;  3CCL P;  2IBZ G;  4WB4 A;  1RHZ B;  1FZB A;  3Q2Y A;  1L0N K;  3USS A;  4GKG A;  1BDD A;  1SQX D;  2WSC J;  1KV4 A;  3S1N I;  1EZV G;  4Z1M H;  5AVY B;  2YO3 A;  4IFD K;  2WIT A;  1ZP0 C;  3KZI H;  1BCC G;  1VQ4 1;  4RJT A;  5BU5 A;  1W2E A;  3CCM Z;  4QMA A;  1SQP K;  3O6Q A;  1M90 1;  2JDI H;  2H89 C;  1FS0 E;  2B87 A;  1ZRT E;  1E79 H;  5AW5 B;  3KQG A;  1YI2 Z;  4H13 B;  1NTK D;  1YJN 1;  1X9V A;  1ZV8 A;  3CWB G;  1VQO P;  4DT0 A;  3H0G I;  1L0N J;  3T97 A;  1FDO A;  3BCC G;  3KPE A;  4NPE A;  2OOX B;  1S72 1;  1J1D B;  5AVV B;  3U59 A;  1YJW 1;  3VB9 A;  2A06 D;  2IX7 C;  4PV1 C;  1JTH B;  1VQ8 1;  2KOG A;  3CCU Z;  1N2F A;  1JM0 A;  2P2U A;  3HE5 B;  4NPD A;  5CHX A;  1CI6 A;  1MFT A;  1RE4 C;  2OTL P;  1VQL P;  1RO4 A;  1IO4 A;  1PP9 G;  4YXW H;  3VTN A;  5KJ7 D;  2Y0C A;  3Q87 A;  2GTH A;  1QGK B;  4WY4 D;  1T2K C;  1P84 D;  1T3U A;  4GOD A;  4RES B;  2G8Y A;  2NAP A;  3KIF A;  2HOD A;  2W03 A;  4EIJ A;  2VUG A;  1GL2 B;  3GHG C;  3HD7 C;  4BWN A;  1URQ A;  3CCJ P;  4A3F I;  2NVT I;  2MJZ A;  3WMM 0;  5KLV K;  3J81 b;  4U3F D;  4I2L C;  1RQV A;  5APX A;  3K7A I;  3GF7 A;  2R5D A;  1LTS C;  1DD4 A;  3HTK B;  1QYP A;  1JY2 O;  2HYN A;  1L0L G;  1S5L H;  2GU2 A;  4RS4 A; 
#chains in the Genus database with same CATH homology
 4NFR A;  2JNY A;  3D9X A;  4DQY B;  2EGT A;  4X6A I;  1ML8 A;  1RO0 A;  2RIQ A;  4K35 A;  5C4X I;  2LFU A;  1KC8 1;  1QVF Z;  3G4S Z;  3NDI A;  3CC4 1;  2QRD B;  3H3V J;  3F3P C;  4DK1 A;  4NBH A;  3QWU A;  2PK7 A;  2RT9 A;  2OZK A;  3PH0 A;  4IOI H;  1X3Z A;  3OW2 Y;  2I3C A;  2UWJ E;  2WB1 A;  3CXC Z;  3CMA Z;  1YIJ Z;  2RKL A;  1NP6 A;  3EED A;  3CCV 1;  1QF8 A;  5IP7 I;  5IT9 b;  2G2K A;  1VQP Z;  3CCR Z;  4A3D I;  4E2Z A;  1S7M A;  3VMH A;  3F3F C;  4BY1 I;  3T4N B;  3U50 C;  1VQ6 1;  3I4M I;  1Y1V S;  3J7A 4;  3CD6 Z;  2K3R A;  2JA5 I;  2ZAE B;  3P5J B;  3MZW B;  4EWC A;  1VQL Z;  1Q82 2;  4GOF A;  4MN4 C;  1EDJ A;  2QRC B;  2O4H A;  3BG0 B;  3HOV I;  1Q86 1;  2PMZ A;  3J80 f;  5D1O B;  4RV9 A;  1KD1 1;  1OVV A;  5A2Q b;  4E31 A;  4HJG H;  2JWD A;  1KQS Z;  2Q51 A;  1OVU A;  1S3J A;  2QLV B;  3JAM b;  1VQ7 1;  3FKI I;  2DE6 A;  3I55 Z;  3CCV Z;  2JR6 A;  5C3E I;  2Y0S A;  1RO2 A;  3HOX I;  3VMI A;  1W2B Y;  4BXL A;  1TWA I;  3GTM I;  1KC8 2;  4E2W A;  2B63 I;  1TWG I;  1U7M A;  4MON A;  2QRE B;  1Q2N A;  1ZW0 A;  2JA7 I;  2RPR A;  4NBB A;  2QR1 B;  1Q81 2;  1VQ8 Z;  1RLY A;  1Q86 2;  4BBS I;  3CC2 1;  2R7Z I;  2QA4 1;  4RVF A;  1Y1W I;  3NFZ A;  4NOZ A;  3S1R I;  4NB9 A;  2OTJ Z;  1OVR A;  3CXC Y;  4RVG A;  4S1T A;  3G6E Z;  2LXC B;  4MD8 A;  4RVD A;  4AYB A;  4GOE A;  1N8R 2;  3GTL I;  1EDI A;  3TDH B;  1WW9 A;  5D1O A;  4CL1 A;  2R93 I;  4ASW A;  4BBR I;  2IZ4 A;  2OTL Z;  2IZ3 A;  4NPF X;  4E2Y A;  3I4N I;  3G6E 1;  3S1Q I;  4NH1 C;  4A3C I;  4ASV A;  4HGY A;  3RGU A;  2KUB A;  2QKD A;  2M5A B;  1RNI A;  5C44 I;  4HH4 A;  2E2I I;  1Q7Y 1;  1VQM 1;  3GTM S;  3CC7 1;  1K9M 2;  2KIK A;  1QVF Y;  2Q1K A;  2B88 A;  1N8R 1;  1TWC I;  2JMO A;  3CCM 1;  1VQ5 1;  1VQN Z;  1K73 2;  3NDJ A;  2OOY B;  1Q82 1;  1YHQ Z;  4MD9 A;  3VMG A;  1KQS Y;  1VQL 1;  3EER A;  3NH4 A;  2R92 I;  3S2H I;  3IFU A;  5FLM I;  1VQM Z;  3I55 1;  1DEE G;  1QVG Z;  1SS1 A;  1QVG Y;  1Y1V I;  2NVY I;  2LR2 A;  4CPG A;  1LQL A;  1JJ2 Y;  3PO3 I;  4NBE A;  4Y52 I;  1R9T I;  4E2X A;  3HOU I;  2JA8 I;  2NVX I;  2R6M A;  4NBC A;  1PFT A;  5IP9 I;  4MH4 A;  1LP1 B;  2V8J A;  1NJI 1;  5FLX f;  2V8I A;  1YJ9 1;  3FQM A;  4BY7 I;  2QA4 Z;  1LT1 A;  2KI7 B;  2VUM I;  2HF1 A;  3S14 I;  4EYY Q;  2R44 A;  3M4O I;  2OTK E;  3I56 1;  2JA6 I;  1FC2 C;  1VQ7 Z;  3CC2 Z;  2M6N A;  1YIT 1;  3CCQ 1;  3IX0 A;  3CMA 1;  3GTP I;  1X0T A;  3ZDM A;  1Z03 A;  2OTJ 1;  3CCS Z;  4NBA A;  3GTJ I;  1KRL A;  1K9M 1;  4NBG A;  4A3K I;  3HOZ I;  1JWH C;  5A2Q f;  3S1K A;  3FXD A;  2P3Y A;  1VLA A;  1USP B;  4BXX I;  2K5R A;  5T64 A;  1Y47 A;  2Q4Z A;  1Q81 1;  1VQ4 Z;  1EDK A;  2M0B A;  2KZI A;  5AN9 F;  3CME Z;  3GTQ I;  3JAM f;  4K3A A;  4A3I I;  3J81 f;  3G71 1;  5IT9 f;  5CM2 M;  1ZH1 A;  2YAD A;  1YUK A;  3CQZ I;  4HKZ H;  2M5A A;  3S15 I;  5K5G B;  5CBN A;  5T67 A;  4E30 A;  3CCL 1;  3FQQ A;  4A3B I;  2F4M A;  3GTO I;  2AKL A;  4DGL A;  2JUB A;  1M90 2;  3S2D I;  3RZD I;  2KS1 B;  4A3M I;  3IF8 A;  1NUI A;  2O53 A;  5T6B A;  3OW2 Z;  4ZMD A;  1I3Q I;  3MON A;  2W04 A;  1H0T A;  2I8D A;  2WAQ A;  3MZL B;  3NH5 A;  1VQK 1;  1VQ6 Z;  1YJW Z;  2B87 B;  2F4O A;  2M48 A;  4NB8 A;  3G71 Z;  4A3E I;  4MD7 A;  3CCS 1;  3GTG I;  2E2J I;  3S17 I;  3CCJ 1;  1W2B Z;  2H85 A;  1M1K 2;  3BG1 B;  1NJI 2;  1Q7Y 2;  2QEX 1;  4MXU A;  2DE7 A;  3CCR 1;  1K8A 1;  1EC5 A;  4A3G I;  3HOY I;  2E2H I;  1YIJ 1;  2QEX Z;  1TFI A;  4A93 I;  1JJ2 Z;  2PM9 A;  2HU9 A;  2SPZ A;  1WCM I;  2P58 A;  4Y7N I;  1YJ9 Z;  1I6H I;  3CCE Z;  5CBO A;  1BDC A;  1M1K 1;  3MZK B;  1ZB8 A;  3TE5 B;  5C4J I;  4NBD A;  2JS4 A;  3S16 I;  3KIH A;  3LUS A;  4WWI A;  3MHV A;  4TNU A;  5DJU B;  1S72 Z;  1U7J A;  1P9N A;  1SFO I;  1VQP 1;  1VQ9 1;  2LIY A;  1YUA A;  3CPW Y;  3CCL Z;  2GTI A;  3CME 1;  2WMM A;  4A3L I;  2P28 A;  1BDD A;  1TWF I;  3S1N I;  2V8K A;  3HKZ A;  3I07 A;  4MRI A;  1I50 I;  1VQ4 1;  4JBZ A;  3CD6 1;  3CCM Z;  1ZXG A;  1EDL A;  1M90 1;  2KZJ A;  3M3Y I;  2B87 A;  4NBF A;  4HGZ A;  3G4S 1;  3CC4 Z;  2RBL A;  4QTT A;  5DJT B;  1YI2 Z;  2HR3 A;  5LL6 f;  3GKQ A;  4ZNC A;  1YJN 1;  3J80 b;  3CCQ Z;  1Z01 A;  3H0G I;  2DE5 A;  1X3W A;  3I56 Z;  3FXE A;  1L1O C;  1KD1 2;  4NPE A;  1VQO Z;  2QVA A;  2OOX B;  1S72 1;  3GCF A;  1YJW 1;  1K8A 2;  3VB9 A;  2QRX A;  2LXB A;  1K83 I;  1LP1 A;  3GTK I;  1VQ8 1;  1DL6 A;  1JMB A;  3PO3 S;  1H0T B;  1VQO 1;  3CCU Z;  3CCU 1;  1N2F A;  1JM0 A;  4NPD A;  1WII A;  1Z02 A;  2RHB A;  1MFT A;  3HOW I;  4HB1 A;  1TWH I;  1RO4 A;  1RQF A;  3QWO C;  3VTN A;  3Q87 A;  1NVO A;  4XX2 A;  4E33 A;  2GTH A;  1USP A;  3D6W A;  5D1P A;  4GOD A;  3KIF A;  2NVQ I;  4RVH A;  1YJN Z;  2W03 A;  3PO2 I;  5EFW B;  3CCJ Z;  2VUG A;  4A3J I;  1ZB9 A;  2VF1 A;  1YHQ 1;  1YI2 1;  1VQ9 Z;  4A3F I;  2NVT I;  1VQ5 Z;  1VQN 1;  3S1M I;  3J81 b;  1VQK Z;  2J6A A;  3CC7 Z;  2KPI A;  1YIT Z;  2YU9 I;  3RZO I;  3NH8 A;  3K7A I;  5FLX b;  4E32 A;  2BJO A;  3ESW A;  2E9H A;  2B89 A;  3CCE 1;  1K73 1;  1QYP A;  2OTL 1;  4KJM A;  5C39 A;  3CPW Z;  4QTU A;  2GU2 A;  4RS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...