2ZAEB

Crystal structure of protein ph1601p in complex with protein ph1771p of archaeal ribonuclease p from pyrococcus horikoshii ot3
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
b'EKKEKKKIAIERIDTLFTLAERVARYSPDLAKRYVELALEIQKKAKVKIPRKWKRRYCKRCHTFLIPGVNARVRLRTKRMPHVVITCLECGYIMRYPY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 1
publication title Structure of an archaeal homolog of the human protein complex Rpp21-Rpp29 that is a key core component for the assembly of active ribonuclease P.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 28
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2007-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2zaeB01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2zaeB02
2JWDA 1H0TB 1Q2NA 1EDKA 2KZJA 1U7MA 1JMBA 1NVOA 2WMMA 1LP1A 4JBZA 5EFWB 2QVAA 2LXCB 2M0BA 2M5AB 2B88A 4HKZH 2KI7B 4IOIH 1BDDA 2LXBA 2LR2A 4WWIA 1U7JA 2KS1B 4ASVA 1EDJA 1SS1A 2B87A 3MZWB 4NPEA 1BDCA 1EC5A 4GODA 2RKLA 4GOFA 1H0TA 4MN4C 2UWJE 1DEEG 2B89A 2K3RA 4EYYQ 4ZNCA 1MFTA 2M5AA 1OVRA 1OVUA 2KZIA 1EDLA 3FXEA 3S1KA 1LT1A 4NPFX 5DJUB 2ZAEB 4CPGA 1LP1B 2OTKE 3ZDMA 2R44A 1S3JA 2KIKA 2I8DA 4BXLA 4K3AA 2SPZA 2QRXA 5CBNA 4NPDA 2HR3A 2KUBA 2Q1KA 4ZMDA 3QWOC 3RGUA 3MHVA 4HJGH 2P58A 2B87B 5CBOA 1ZW0A 1JM0A 5C39A 4ASWA 1ZXGA 3FXDA 5K5GB 4K35A 1Y47A 1EDIA 1X0TA 4KJMA 1OVVA 5DJTB 4HB1A 4GOEA 1FC2C 3PH0A
chains in the Genus database with same CATH superfamily
1BE3G 4I6MC 2KZJA 3CCMZ 2KPIA 2YMYA 2IFNA 2WMMA 2QM8A 1PGJA 1FDIA 3CMA1 1G1JA 2QKDA 2QJYB 1LT9C 4MH4A 2HLOA 3CD6Z 1KZUB 2LXBA 1U7JA 1VQPZ 3S2DI 2JIOA 1URQA 2IDBA 4NFRA 1JY2P 3HKZA 1Q862 2WSCH 5KKZC 2QRDB 1L0NK 2FXMA 4Y99B 4EIJA 1L0LJ 1PGOA 1DEEG 1SQBJ 4QMAA 5AW7B 3VTPC 4HH2A 3GTJI 5APQA 1MKMA 1N7SD 1K732 1PGPA 1IFJA 3CCV1 2N1TB 3AE5C 2E2HI 4DQYB 1G2CA 3H1JD 4R4MA 3H1ID 3L74D 3HD7A 2KSJA 2ZAEB 1SQXK 1T3JA 2Q3IA 3TE5B 1ZLLA 1S721 4RVFA 3TYYA 2W27A 2O53A 1TWFI 2OYHC 1AJYA 1S3JA 3H1LD 4A3LI 2KIKA 1YQ3C 4K3AA 2FFDC 4MD8A 1NGMB 1P84I 2JEEA 3CCM1 3SWKA 2Q5UA 3RBXA 2D2CD 2P58A 2B87B 3L72D 4U3FG 2F4OA 2RHBA 3C1LA 1NU1J 5FLMI 4A3BI 1Z01A 2Q51A 4I7ZC 1KYOH 1FZBA 2JWAA 5KAFH 1VQ5P 2KP8A 1IFNA 2NRGA 4ZNCA 3CD61 4PD4I 3BCCG 1EDKA 4JQ0D 5T67A 3H1JE 3Q2YA 5APYA 5L8RJ 1VQP1 3D2LA 3L74E 3FX0A 2WZ7A 1NTMG 2DE7A 1Q7YQ 4I1LA 2GTHA 4BWNA 1MFZA 3HE4A 3CCEZ 3MP7B 2KI7B 1IK7A 3QH9A 3H1LE 4XFJA 2QJPC 2WQYC 1JOCA 4ASVA 2IPPA 4NBFA 1Q821 3CCQZ 2POHA 3L72E 4RVGA 1OW7A 1M57D 2OYIA 3OW2O 3M4OI 3BG1B 3NH8A 1ZMEC 1ZB9A 1W2BZ 1VF5D 3A2AA 2WSFH 3CC2P 2KOGA 1T3UA 3RL0B 1Q86Q 1SQPJ 1YHQP 3MGNA 3CPWO 3CCLP 2VUGA 1M1K1 3ITKA 3KIHA 1SQQG 1VPCA 3AE6C 1HJBA 1BGYJ 4N3YB 1L4AD 3L37A 3IN6A 2BCCJ 1K73Q 1JY3P 2QEXP 1YJWP 1QVGY 4NPDA 1HJ0A 3CXHH 2KUBA 3TGUG 1VQOP 3PJSK 2VRSA 3MONA 3SFDC 2JUBA 4K35A 3CCE1 1M1JC 2N1TA 2O01J 1U57A 4JYCA 2FYUJ 5KLVG 1SQXD 3BASA 2YO2A 4XA4A 4RVHA 1K8A2 3CX5D 3CCQ1 1OIPA 2OOYB 2Y0DA 2QA4Z 2RN0A 2Q6QA 3H1IG 1SP4A 2XDJA 2VPYA 1YJWZ 1KC81 2V7QJ 3GTQI 2HU9A 1LT9B 1WMKA 2WITA 2YIUB 2B87A 3MZWB 3GHGC 1TWAI 1IZNB 3E1IA 2PFXA 3D70A 1EC5A 5GTIH 1KQSY 2DW3A 4TLFA 5AVUB 1K83I 3VMYA 1BCCG 1ZOYC 3VYIA 3VMHA 5KKZB 3VMIA 2ZT9D 1SQXE 1FOSE 2RT9A 1JMMA 3GTMI 4D6TG 2YKOA 1SQVG 3CX5E 1VQ6P 4MD9A 2WSEJ 2RBLA 2KZIA 4NOZA 3TK1A 2KLUA 3S4RA 4H44C 3H1KG 2PMZA 2YKQA 1SFCB 3CCL1 1FDOA 4OWFA 1YITZ 1NWQA 4CL1A 2OYHB 1GK6A 3G4SZ 1FZGA 2KB7P 3VP9A 1FS0E 1KQGB 2MKVA 1YTZT 3CXHI 3WU2H 3L70D 1ML8A 2QA41 3L71D 3GF7A 5APTA 1KB9H 1RLYA 4A3JI 4L76A 1LWUB 1VQ7P 4HGYA 5CCHD 5T6BA 3S1MI 1JTHB 1YJW1 1FZFA 1N8R2 3E7KA 3AEFC 4I7ZB 1KFNA 3KZIH 1OX3A 4AYBA 1GW3A 1S1CX 2M3BA 2KK7A 3IAOA 3V4QA 4E2YA 1LTTC 2N1TD 3Q5RA 2E5TA 3PO3S 1K8AQ 2A45H 1RF1C 4EI2A 5TISE 1RE4A 2QE7H 1JY2O 1L0NG 1SS1A 5KJ7A 1T6AA 4ZKPA 5FLXb 3L70E 3I07A 5CCGA 3M0DA 3L71E 1NAYA 2V8KA 3A0BH 2E2JI 2I1KA 3EQ2A 2WPSA 1KD12 5AW0B 2HFED 4YXWH 5IT9f 2BJOA 1PP9G 4A3II 3RL0g 2PAJA 4NBDA 2OZKA 1YIT1 3H1HG 3KIFA 3G71Z 3BRTB 3LW5H 3G4S1 1IK9A 2A45G 3H6PA 1LT9A 3LIDA 4BRYB 2B9BA 2C9LY 4A3CI 2YO3A 2FYZA 1DL6A 1KILB 1NTZJ 3M3YI 1NAFA 3HOZI 3M9QA 1VQ61 4BXLA 3RK3C 5AVVB 5CBNA 4NBGA 1JJ2Y 2OTLZ 1QEXA 3OAKA 5C44I 3A0HH 1I6HI 1ZXGA 2E76C 2WPVB 2JR8A 2JJLA 1Y47A 3V2NA 4HYTB 1GL2C 1OVRA 3AECC 3FQMA 1BE3J 5B66E 1FDMA 4WY4B 1RE3C 1Q90D 1WZNA 3VN0A 1LJ2A 3G3ZA 1N8RQ 3D6ZA 2YNYA 2WSSH 2AXTH 1SFCA 3ABVC 2CPBA 2HG5D 1BDDA 3GTGI 5APWA 1L0LK 1QL1A 1T2KC 4QTUA 4AYCA 2OYHA 3SWFA 2O1JA 1SQBK 3V6IA 3CPWZ 3IR9A 4L75A 2JA8I 3C9IA 3RK2C 2B63I 3GF3A 1LWUA 1Y1VS 4XX2A 1PFIA 2H7HA 1JTHA 4DGLA 4QTTA 4H13D 1LNQA 2ZYAA 4EYYQ 1P84E 1M56D 1QVFO 1MFTA 1NKNA 1KQLA 3CC4P 2OGUA 1YBKA 2W8ZA 1KD1Q 4O9BA 1M902 1LGHB 3H0GI 2OTL1 1Q812 5IP7I 1NU1K 3CMEZ 2JIPA 1NO4A 1VQ9P 1NTKG 3L73G 4H44B 3CWBG 2WAQA 4XE5B 4A3KI 5CMZA 3AE3C 1JNMA 1X8YA 1VQ8P 4H0LC 2E75C 1YJNP 3MHVA 4HJGH 2A06G 1WRGA 1ZV8A 4E33A 2WVRA 4NBCA 4U3FJ 4KJMA 2JA6I 4GOEA 2KXPB 1IFIA 1XTGB 3CXCY 3CCVZ 1J1EC 3BCCJ 3I55P 1USPB 4BRYA 2IZ1A 1KMIZ 3M06A 1NTMJ 2QVAA 1KILA 1L2PA 2B88A 5A2Qb 2VPXA 1HTLC 3HUSC 4DCKA 4WWIA 1PV3A 1SQPK 4S1TA 4NPEA 1RF1B 3CQZI 3C8VA 3GW6A 5CHXA 2KNCB 3PP5A 3J81f 3MIWA 1X22A 2IBZD 4EOTA 3CC7P 2QREB 5AW9B 3KPEA 3M0AA 4WY4A 2Y0SA 3VP8A 3CME1 1X9VA 4GKGA 3I55Z 3L75G 4TT3H 1FE6A 1L0LD 2H88C 3S1KA 1SQBD 4A3FI 4MXUA 1SQQJ 3KYQA 4E31A 3TNUB 4IL6E 1X3ZA 1HH0A 1RNIA 5APVA 3B5ND 4E2ZA 3FKII 1N2FA 4MD7A 1R8EA 2XV5A 2I3CA 1IFPA 2FYUK 1Q81Q 2IZ3A 2QM7A 4AUWA 3CC41 3TDKA 4A7PA 2IBZE 3RK3B 2E74D 5AVZB 3TGUJ 2XU6A 3CCUP 1JEKA 4HGZA 2GTIA 2AEJA 1Q7Y1 1OVVA 2QG4A 1EZVG 2NPSD 3E1RA 2W6AA 1L0LE 2JWDA 2E76B 3GTOI 2Y0EA 5CM2M 1OWAA 1NU1D 3I4MI 1JMBA 1LTJC 1OZHA 5KTBA 1GL2B 1SQBE 1NH4A 5KLVJ 2XKMA 1NVOA 4C7NB 1PPJD 1NJI2 1USEA 2P1JA 1VQKP 2K5RA 1VQMP 3CCSP 4R4LA 2E43A 3MZKB 3FWNA 3H1IJ 4PV1D 3I551 1R9TI 4Y7NI 1LTSC 1Q861 3CCUZ 1FZAA 1OFCX 3EFGA 4WVZA 2W6JH 1BCCJ 2HYNA 2E42A 1W2BY 3B71A 1NU1E 1USPA 3H3VJ 1TWGI 5AW6B 2Y9ZA 2Z4EA 4D6TJ 5CJ0A 3USSA 1PPJE 2Q3EA 1SQVJ 5APXA 4IFDK 1N7SC 2IV2X 1SQPD 2R93I 4RVDA 1EZVI 3KXDA 1VQ5Z 3K5BA 2NVTI 4N78D 1QXFA 4WY4D 2JS4A 4OGQD 1N7LA 3ESWA 1RF1A 3H1KJ 2NPSC 5AN9F 1BGYD 1NUIA 5B5EE 3OJAB 1K9M1 1URQD 2KNCA 1RQFA 1IC2A 1KILE 2BCCD 4YPCA 1S9KD 2O01N 3EWKA 1Z02A 2QLVB 2DE5A 4H0LB 3S9OA 2D2CC 1EDIA 4GDOA 2BASA 2QSIA 1Z03A 1KC82 1EXIA 2JDIH 4W80A 1YJ9P 1M8OB 2ZJSE 2JR6A 1RQVA 1X79B 1AFOA 1U7MA 3D71A 1SQPE 2QJKB 1RF0C 1CSBA 4PV1C 4NB9A 2W90A 3HD7D 4N78E 4JBZA 1MZ9A 1VQ4P 2JNYA 3CCU1 1Z56A 1NHLA 1EXJA 1WJ2A 2FYUD 1GZLA 2YXQB 4N6JA 3CC2Z 1USDA 5BU8B 1YHQZ 1VQLP 1BGYE 3CCLZ 2BCCE 2M6NA 1CW5A 1NJIQ 1FZCB 3U1AA 1QVFZ 2KLVA 3F5HA 1S9KE 1KYOI 2FKWB 1L0NJ 1VQK1 4C7RA 4JPZB 2EGTA 3CCS1 4GODA 2BEZF 3H1JG 2QEXZ 3I56P 3IF4A 4NBAA 1FAVA 3L74G 2K3RA 1VQ51 3T97B 5B5EH 3JAMb 1QVGZ 1VF5C 4C7NA 1VQOZ 4RESB 1GMJA 2F4MA 2C9NY 1PP9J 3H1LG 3WUTA 1RE3A 2L91A 2FYUE 2AEMA 1SQXJ 5TJHA 3H1HJ 4RKUJ 1CI6B 3J80b 1L4AC 3L72G 3GTLI 1RHZB 3VMXA 2E2II 2I8DA 2OQQA 2PP6A 3RZOI 3B4SA 4UB6E 3Q3DA 2FYNC 5C39A 4E2XA 1N86A 1RO0A 3CC21 5KAIE 5H2FE 3CCRP 1YHQ1 1P9NA 5AVTB 1YI2P 3H25A 2P10A 3BRVB 3UIAA 1K8A1 3VTNA 1KORA 3LW5J 3MUDA 2IYOA 1KC8Q 3F3PC 3JCUE 2FFDB 2LXCB 2M0BA 2M5AB 4RS4A 2ZVNB 2QEX1 1VQ6Z 1KFMA 1JCDA 2KS1B 1EDJA 3S16I 1KN7A 1VQO1 4PJ0E 1VQ41 3B8EB 4C46A 1KQFB 2WB1A 2P3YA 2YKPA 2H43A 3U50C 2R6MA 2O3JA 4WBAA 3GKQA 3F89A 3CX5H 2ZT9C 3U1CA 3NH5A 3GTKI 1WT6A 3WUUA 2JA7I 4NH1C 2QJPB 5KLIC 3KHUA 3V2PA 1OVUA 2XNXA 4MRIA 1YIJP 3N4XA 2JMOA 1S5LE 2KYVA 3J7A4 3I561 1VQ7Z 1N7SB 5KAIH 2Z5IA 1FZCA 4W7YA 4GT1A 4NB8A 1ZP0C 2ZYDA 2H89C 4Y52I 3JSVC 3G6EP 1NTKJ 1OXZA 3L73J 2MJZA 1YUKA 5M1BA 3CWBJ 5AW8B 3P8MC 1SQXG 2JKVA 3T97A 1BSNA 4BXXI 3PO3I 5T64A 2GUSA 1N8R1 1H0TB 3JC22 3S2HI 5CCHC 1JY2N 3PO2I 4Y99C 2YU9I 1CI6A 1TU3F 2AEFA 3MTUE 5EFWB 4UB8E 3HOYI 3OW2Y 5AVXB 2M3EA 3TSIA 1BE3D 4LGDE 2WPRA 4M3LA 5TISH 2N1TC 1GDTA 3WMM0 2HODB 3Q1MA 1OMIA 3CCJP 1HBWA 1KB9I 2QRCB 2O4HA 1NTZE 5AVQB 2Q4ZA 1M1JB 1P84D 1SFOI 2ZVOB 3CPWY 3HE5B 3HOWI 3F3FC 4A3DI 3RL0D 1J2JB 3NH4A 2J58A 3AE1C 3AEDC 1HVVA 1SQQK 2KSEA 1VQ71 1M7LA 5E79E 3HTKB 1H8AA 2XZRA 1WIIA 1GD2E 1L1OC 1JJ2Z 4PD4D 2FFDA 4X6AI 3Q5SA 1AQTA 1VF5B 2M5AA 3L75J 2A45I 3CX5I 2G2KA 3NTNA 1BE3E 4NPFX 1LQLA 3GHGB 3CMAP 3H32B 1ZB8A 2KS1A 2GA1A 4CPGA 3ZDMA 3FQQA 3L70G 1K05A 3L71G 5KJ7D 1L4AB 2I1JA 5LL6f 3AE9C 5CCGD 3VMZA 4UB8H 3MD0A 5KLVK 1JY3O 2WT7B 5GTHE 5K5GB 4PD4E 3W68A 2J6AA 1QVGO 2FYNB 1TWCI 3NDIA 3G6E1 4RJTA 1AA6A 5B66H 2P7JA 1E79H 2RH0A 1H89A 1QX8A 1N7SA 3IFMA 3VOPA 2WSCJ 2ZYGA 1GU5A 1MV8A 5E79H 1S4XA 2ZXXA 2OTJP 2R92I 1S72P 1LTGC 1GK4A 3G9RA 3II6A 1WCMI 3PTZA 4LC1A 3A3YB 1AQ5A 3CC4Z 4A3GI 1I3QI 4JYBA 1SQVK 1BSHA 3CCMP 2FY8A 4YTPC 2OARA 1JY3N 3CL3D 1PGQA 1J1DC 1PZQA 1H0TA 4E32A 1VQ9Z 2B89A 1P84H 4H13C 1Y8AA 4U3FE 1DH3A 3CD6P 1VQ8Z 1N73C 2CPSA 1YJNZ 1KYOD 1W5CE 1KQSO 1RF0A 1VQPP 2NZ2A 2ZT9B 3M0DC 2NAPA 5AW1B 2OTJZ 3BCCE 1SFCD 3SFEC 2QR1B 2LKMA 1Q811 4PD4H 1DD4A 2HODA 2C0WA 1H88A 1NTME 4DOJA 1Q7Y2 1S7MA 3AEBC 2WTYA 2R44A 1M1JA 2IX7C 3IX0A 3HE5A 2IYPA 3VMAA 1LTAC 1SQQD 1YYCA 2QRXA 3QWOC 2W83C 4A3MI 1ZH1A 3RGUA 1FBMA 3HTKA 5AVYB 3Q5PA 1JM0A 2W03A 2C0XA 4LLHA 2YIUC 2VPWA 2Y0CA 2H8PD 1KYOE 3LIEA 5KAFE 1Q2NA 1PFTA 3TGUD 1M90Q 1FJPA 5AVRB 3GHGA 4GIFA 3H32A 2LEXA 3NXSA 3CC7Z 1TFIA 1ZRTE 3A7OA 4TNUA 3VB9A 4IFMA 2WSFJ 1L4AA 2PK7A 5KLVD 1SQQE 1VQ91 1WW9A 3FWLA 5FLXf 2WT7A 1VQ81 3RZDI 1AVYA 1Q822 1YJN1 4KHXA 4BY7I 1R5LA 2W6BA 3W67A 1SVFA 3KDPB 2RKLA 2RPRA 3CXHD 1SFCC 2OTJ1 1JCCA 2ZFCA 1Q16A 2GM4A 1RQUA 3TGUE 1HF9A 2J59M 3H1JJ 4NBBA 3CCEP 3GLMA 3L74J 1K9M2 5IT9b 1M1K2 1BCCD 1LWUC 1KILD 3BVHA 3H1LJ 3CCQP 1LT1A 5DJUB 5KLVE 4IL6H 3RK2B 3HOXI 4D6TD 1A02F 2N9YB 1SQVD 3IFUA 3AE8C 1RH5B 3L72J 3B5NC 1K731 2SPZA 3H1IE 2RIQA 2JIQA 5D1OB 1FOSF 4BBRI 3BATA 2Q1KA 1VQKZ 3CXHE 1FJKA 1VQMZ 1DEBA 3CCSZ 1HWTC 1QL2A 3H1KD 1MUUA 3CC71 2NVYI 2E74C 2HF1A 2G3AA 1AVOA 5DJTB 4W7ZA 2P67A 3WUVA 4WB4A 5C4JI 2P28A 1BCCE 3QWUA 2N9BA 2O1KA 2CK3H 1SIWA 5IP9I 4OH8B 3OA7A 3HOUI 1NJI1 4D6TE 2M8RA 2V8IA 1SQVE 1GTWA 2YADA 4HKZH 3CLQA 3BG0B 2E75B 2OOXB 3NDJA 3D6WA 2IBZG 1NYHA 1PL5A 2Y9YA 1W2EA 3LUSA 5C3EI 1KRLA 1AV1A 1GW4A 1BDCA 1QVFY 3H1KE 1K04A 1ZN5A 3IR7A 3TNUA 1L0LG 5GTIE 3AEEC 4DT0A 1J1EB 1KILC 4Y28J 1PIXA 4MN4C 2QA4P 1SQBG 2UWJE 1JWHC 3V2QA 2XNDH 1L0ND 1Q82Q 1J1DB 2AKLA 3P7KA 5CCHA 1KB9D 4H13B 3HUSB 1KTMA 1NTKK 1N73B 4H44D 1T8ZA 2ITAA 3P5JB 4DJGA 1VQM1 1K9MQ 1FZEA 1X3WA 1YJ9Z 1PP9D 2PRRA 2OYOA 1M1KQ 5AW4B 3HRNA 3S1RI 3GTMS 4WY4C 4A3EI 1GL2A 3AE2C 3PHLA 4OGQC 1EQ7A 1A02J 3H1HD 3P32A 1NTZK 4MONA 1VQ4Z 1URQC 2E7ZA 4ZMDA 1JUNA 4KT0J 1NU1G 4DK1A 1VQLZ 4I2LC 3CI9A 2IBZI 1L0NE 3IF8A 3L36A 3I5CA 3FXDA 1PPJG 3WU2E 1VLAA 2K9JB 2NVXI 1YUAA 1KB9E 3VMGA 3R4YA 4IL6X 5C4XI 2NVQI 2WPQA 3SWYA 3KZIE 2Q7CA 3AE4C 1XTCC 1YITP 5A2Qf 3I56Z 2V45A 4EWCA 1PP9E 3G4SP 3HD7C 3L35A 1SLQA 2R3CA 2GUVA 1JO5A 3HOVI 3H1HE 3AEGC 5D1OA 2QIWA 1RY3A 1DD3A 1KQSZ 3O8ZA 2E5YA 3GTPI 3RBZA 2K37A 1G1IA 3N7NA 3V5BA 1LTJB 3S1NI 5AVWB 4DZOA 4GOFA 4ZKUA 3A0BE 1IJDB 1SQPG 3M9BA 3J81b 4AQRD 2BEQD 1YJ91 2PGDA 2RMZA 5BVZA 2O01H 3D9XA 2R3SA 4U7JA 3D6YA 1BGYG 1TWHI 5AW3B 4RO0A 1EDLA 2BCCG 3FXEA 1RO4A 1NOHA 3CCRZ 4BBSI 1VQL1 1LTIC 1LP1B 1YI2Z 2R32A 3RK3D 4YXDC 1D7MA 2V7QH 5APSA 3L70J 3L71J 5APUA 2DE6A 2HR3A 4Z1MH 3L4FA 4UB6H 2OYIC 3B5NB 1I50I 2E76D 3KQGA 5CBOA 2K88A 4OVNF 3O6QB 4IFFA 1R5SA 4L74A 4ASWA 2PM9A 1HGVA 3A0HE 1NTKD 3L73D 3SSUA 1GL2D 3G71P 5H2FH 3S14I 3CWBD 1X0TA 1VQNP 2FYUG 3HUSA 2E74B 2L5GB 3NFQA 5AW5B 1N73A 2AYDA 2IFMA 2A06D 5AVSB 2FBWC 3EEDA 2QJYC 3JCUH 3M91A 1KV4A 2NPSB 2WSEH 1NTZD 1RO2A 1QF8A 2OTLP 1T2KD 3RK3E 1NTMK 4NBEA 2AXTE 3NFZA 3MZLB 2K1AA 2HPCB 1DIPA 2WWWA 3P8CD 2D2CB 3RK2D 1YIJZ 4PJ0H 3NMDA 2W04A 1VL2A 1E5WA 2K9JA 1NTKE 3AE7C 3L73E 3S1QI 3CWBE 1VQNZ 2Z5HA 1IFMA 3A5TA 4PV1B 3V4WA 3I4NI 2J5UA 2G8YA 3CCR1 3G6EZ 1QLED 2R5DA 2A06E 1YI21 2JP3A 3AEAC 1LTBC 4L73A 3GCFA 3M9HA 1JB0J 3GMAA 1Y8CA 2AXCA 3TDHB 1UIIA 2YMKA 1S5LH 1ZR4A 1Y9BA 1W2BO 2R7ZI 2OTKE 3L75D 3P8CE 4B86A 1IO4A 4E30A 3T4NB 4E2WA 1KD11 1YQ4C 2R5BA 2Q9IA 4H0LD 1QYPA 2E75D 2V3VA 1LTJA 3R2PA 4OGQB 4HH4A 3OW2Z 1DX7A 2FXPA 3EFFK 2E9HA 1URQB 2GU2A 2JIMA 5CJ4A 3CCJZ 3S15I 3CMEP 2IZ4A 3EERA 1HGZA 4EDFA 4A93I 3Q87A 2K9YA 3FGAD 3U59A 5BU5A 1IFDA 3S17I 1YIJ1 3PRJA 1LP1A 4NBHA 3PLNA 3L75E 3G711 1EZVD 1Y1WI 1VQN1 1G2CB 4IOIH 2JA5I 3HD7B 2LR2A 5AW2B 5D1PA 3B5NA 4RV9A 2ZXEB 1NP6A 3O6QA 2VF1A 4JF7A 4U3FD 3MUDC 3CCVP 3CMAZ 1NKZB 2LFUA 1CZQA 3RL0C 1Y1VI 3JAMf 3BCCD 1ZR2A 2NPSA 1NTMD 1UIXA 3V2RA 2JO1A 1S2EA 2IZ0A 1EZVE 3J80f 1OW6A 2P2UA 1GU4A 2HPCA 3GG2A 1NTZG 2LIYA 1HUCA 2QJKC 1N2DC 1AA0A 1OW8A 2V4HA 3HE4B 3CCJ1 1RE4C 1QGKB 3K7AI 5KJ7C 2VUMI 2YXRB 2M48A 3TF5A 2JIRA 1VDFA 2V8JA 5CCGC 1M901 2VPZA 1ZW0A 5GTHH 1S72Z 5KLIB 2FXOA 1FZCC 2OYIB 2H85A 1FU1A 1ZRTD 3CXCZ 1YTZI 4HB1A 4BY1I 1S5LX 1FC2C 3PH0A
chains in the Genus database with same CATH topology
5C4JI 2P28A 2KZJA 3QWUA 3FQMA 3CCMZ 1K8A1 2KPIA 5IP9I 3VTNA 3HOUI 2WMMA 1NJI1 3F3PC 2V8IA 3CMA1 2LXCB 2M0BA 2M5AB 2QKDA 2YADA 4RS4A 4HKZH 3BG0B 4MH4A 1BDDA 3GTGI 3CD6Z 2OOXB 2QEX1 3NDJA 2LXBA 3D6WA 4QTUA 1VQ6Z 1U7JA 1VQPZ 2KS1B 3LUSA 5C3EI 1EDJA 1KRLA 3S16I 3S2DI 3CPWZ 1BDCA 2JA8I 1QVFY 4NFRA 1VQO1 1VQ41 2B63I 3HKZA 1Q862 1Y1VS 2WB1A 4XX2A 2QRDB 2P3YA 4DGLA 3U50C 4MN4C 2R6MA 4QTTA 2UWJE 1JWHC 1DEEG 4EYYQ 3GKQA 2AKLA 3GTJI 3NH5A 3GTKI 1MFTA 1K732 2JA7I 4NH1C 3CCV1 2E2HI 1OVUA 4DQYB 4MRIA 3P5JB 1M902 2JMOA 3H0GI 3J7A4 3I561 1VQM1 1VQ7Z 2OTL1 1X3WA 1Q812 2ZAEB 3TE5B 5IP7I 3CMEZ 1YJ9Z 1S721 4RVFA 2O53A 4NB8A 1TWFI 3S1RI 3GTMS 4A3EI 4Y52I 1S3JA 4A3LI 2WAQA 2KIKA 4K3AA 4A3KI 4MD8A 4MONA 1YUKA 1VQ4Z 4ZMDA 3CCM1 3MHVA 4HJGH 2P58A 2B87B 2F4OA 2RHBA 4DK1A 1VQLZ 4BXXI 4E33A 3IF8A 5FLMI 4NBCA 3FXDA 4A3BI 1Z01A 1VLAA 2Q51A 2NVXI 1YUAA 4KJMA 3PO3I 5T64A 2JA6I 4GOEA 1N8R1 3VMGA 4ZNCA 3CD61 3CXCY 1H0TB 1EDKA 5T67A 3S2HI 3CCVZ 5C4XI 2NVQI 1VQP1 3PO2I 2YU9I 1USPB 2DE7A 5A2Qf 3I56Z 5EFWB 2GTHA 4EWCA 2QVAA 3HOYI 3OW2Y 2B88A 5A2Qb 3CCEZ 2KI7B 3HOVI 5D1OA 4WWIA 4S1TA 4ASVA 2QRCB 4NBFA 4NPEA 2O4HA 1KQSZ 1Q821 3CCQZ 4RVGA 2Q4ZA 3CPWY 1SFOI 3CQZI 3HOWI 3F3FC 4A3DI 3GTPI 3J81f 3M4OI 3BG1B 3NH8A 3S1NI 3NH4A 1ZB9A 2QREB 4GOFA 3J81b 1W2BZ 1VQ71 1WIIA 2Y0SA 3CME1 1YJ91 1L1OC 3I55Z 1JJ2Z 3D9XA 2VUGA 1M1K1 3KIHA 4X6AI 2M5AA 1TWHI 1EDLA 2G2KA 3FXEA 3S1KA 4A3FI 4NPFX 1RO4A 1LQLA 4MXUA 3CCRZ 1ZB8A 4E31A 4BBSI 1VQL1 4CPGA 1LP1B 1YI2Z 1X3ZA 3ZDMA 3FQQA 1RNIA 4E2ZA 3FKII 1N2FA 4MD7A 1QVGY 2I3CA 5LL6f 4NPDA 2DE6A 2IZ3A 3CC41 2HR3A 2KUBA 1I50I 5CBOA 3MONA 2JUBA 4ASWA 2PM9A 4HGZA 2GTIA 5K5GB 4K35A 3S14I 1X0TA 1Q7Y1 1OVVA 3CCE1 2J6AA 2JWDA 1TWCI 3GTOI 3NDIA 3G6E1 5CM2M 3I4MI 1JMBA 3EEDA 4RVHA 1K8A2 1NVOA 3CCQ1 2OOYB 2QA4Z 1NJI2 2K5RA 1RO2A 1QF8A 4NBEA 2R92I 1YJWZ 3MZKB 1KC81 3NFZA 3GTQI 3MZLB 2HU9A 1WCMI 3CC4Z 4A3GI 1I3QI 2B87A 3MZWB 3I551 1YIJZ 1TWAI 1R9TI 4Y7NI 1Q861 3CCUZ 1EC5A 2W04A 1KQSY 3S1QI 1VQNZ 1K83I 1H0TA 3VMHA 4E32A 1VQ9Z 3I4NI 2B89A 3VMIA 2RT9A 3CCR1 1W2BY 3G6EZ 3GTMI 1USPA 1YI21 3H3VJ 1TWGI 1VQ8Z 3GCFA 1YJNZ 4MD9A 3TDHB 2RBLA 2KZIA 4NOZA 2R93I 2OTJZ 2QR1B 4RVDA 1Q811 1VQ5Z 2NVTI 2R7ZI 2JS4A 2PMZA 2OTKE 4E30A 3ESWA 1Q7Y2 1S7MA 3T4NB 4E2WA 1KD11 2R44A 3IX0A 5AN9F 1NUIA 3CCL1 1K9M1 1RQFA 1YITZ 1QYPA 2QRXA 4CL1A 3G4SZ 4HH4A 3QWOC 4A3MI 1ZH1A 3OW2Z 3RGUA 1Z02A 2QLVB 2E9HA 2GU2A 2DE5A 1JM0A 2W03A 1ML8A 2QA41 1RLYA 1EDIA 4A3JI 3CCJZ 1Z03A 4HGYA 1KC82 5T6BA 3S1MI 3S15I 1YJW1 3EERA 2IZ4A 1N8R2 1Q2NA 1PFTA 2JR6A 1U7MA 4A93I 3Q87A 4NB9A 4AYBA 3S17I 1YIJ1 1LP1A 1TFIA 4JBZA 4NBHA 3CC7Z 2JNYA 3CCU1 3G711 4E2YA 3CC2Z 4TNUA 3VB9A 1Y1WI 1YHQZ 1VQN1 2PK7A 4IOIH 2JA5I 3PO3S 1VQ91 2LR2A 1WW9A 3CCLZ 2M6NA 5D1PA 5FLXf 1QVFZ 4RV9A 1SS1A 1NP6A 1VQ81 3RZDI 2VF1A 5FLXb 1Q822 1YJN1 3CMAZ 3I07A 4BY7I 2V8KA 1VQK1 2LFUA 2EGTA 3CCS1 1Y1VI 4GODA 2RPRA 2RKLA 3JAMf 2E2JI 2QEXZ 2OTJ1 4NBAA 2K3RA 1VQ51 3JAMb 4NBBA 1QVGZ 1KD12 5IT9f 2BJOA 4A3II 1K9M2 1VQOZ 4NBDA 2F4MA 5IT9b 1M1K2 2OZKA 1YIT1 3KIFA 3J80f 3G71Z 1LT1A 3G4S1 5DJUB 3HOXI 3J80b 4A3CI 2LIYA 3IFUA 3GTLI 1DL6A 3M3YI 3CCJ1 3HOZI 2E2II 1VQ61 2I8DA 4BXLA 3K7AI 1K731 2SPZA 5CBNA 2VUMI 2RIQA 4NBGA 2M48A 1JJ2Y 5D1OB 4BBRI 2Q1KA 1VQKZ 3RZOI 2V8JA 1VQMZ 2OTLZ 3CCSZ 1M901 5C44I 1ZW0A 3CC71 5C39A 4E2XA 2NVYI 1S72Z 1I6HI 1ZXGA 2H85A 2HF1A 1RO0A 1Y47A 3CC21 5DJTB 1FC2C 3CXCZ 4HB1A 4BY1I 1YHQ1 1P9NA 1OVRA 3PH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWD A;  1H0T B;  1Q2N A;  1EDK A;  2KZJ A;  1U7M A;  1JMB A;  1NVO A;  2WMM A;  1LP1 A;  4JBZ A;  5EFW B;  2QVA A;  2LXC B;  2M0B A;  2M5A B;  2B88 A;  4HKZ H;  2KI7 B;  4IOI H;  1BDD A;  2LXB A;  2LR2 A;  4WWI A;  1U7J A;  2KS1 B;  4ASV A;  1EDJ A;  1SS1 A;  2B87 A;  3MZW B;  4NPE A;  1BDC A;  1EC5 A;  4GOD A;  2RKL A;  4GOF A;  1H0T A;  4MN4 C;  2UWJ E;  1DEE G;  2B89 A;  2K3R A;  4EYY Q;  4ZNC A;  1MFT A;  2M5A A;  1OVR A;  1OVU A;  2KZI A;  1EDL A;  3FXE A;  3S1K A;  1LT1 A;  4NPF X;  5DJU B;  2ZAE B;  4CPG A;  1LP1 B;  2OTK E;  3ZDM A;  2R44 A;  1S3J A;  2KIK A;  2I8D A;  4BXL A;  4K3A A;  2SPZ A;  2QRX A;  5CBN A;  4NPD A;  2HR3 A;  2KUB A;  2Q1K A;  4ZMD A;  3QWO C;  3RGU A;  3MHV A;  4HJG H;  2P58 A;  2B87 B;  5CBO A;  1ZW0 A;  1JM0 A;  5C39 A;  4ASW A;  1ZXG A;  3FXD A;  5K5G B;  4K35 A;  1Y47 A;  1EDI A;  1X0T A;  4KJM A;  1OVV A;  5DJT B;  4HB1 A;  4GOE A;  1FC2 C;  3PH0 A; 
#chains in the Genus database with same CATH topology
 1BE3 G;  4I6M C;  2KZJ A;  3CCM Z;  2KPI A;  2YMY A;  2IFN A;  2WMM A;  2QM8 A;  1PGJ A;  1FDI A;  3CMA 1;  1G1J A;  2QKD A;  2QJY B;  1LT9 C;  4MH4 A;  2HLO A;  3CD6 Z;  1KZU B;  2LXB A;  1U7J A;  1VQP Z;  3S2D I;  2JIO A;  1URQ A;  2IDB A;  4NFR A;  1JY2 P;  3HKZ A;  1Q86 2;  2WSC H;  5KKZ C;  2QRD B;  1L0N K;  2FXM A;  4Y99 B;  4EIJ A;  1L0L J;  1PGO A;  1DEE G;  1SQB J;  4QMA A;  5AW7 B;  3VTP C;  4HH2 A;  3GTJ I;  5APQ A;  1MKM A;  1N7S D;  1K73 2;  1PGP A;  1IFJ A;  3CCV 1;  2N1T B;  3AE5 C;  2E2H I;  4DQY B;  1G2C A;  3H1J D;  4R4M A;  3H1I D;  3L74 D;  3HD7 A;  2KSJ A;  2ZAE B;  1SQX K;  1T3J A;  2Q3I A;  3TE5 B;  1ZLL A;  1S72 1;  4RVF A;  3TYY A;  2W27 A;  2O53 A;  1TWF I;  2OYH C;  1AJY A;  1S3J A;  3H1L D;  4A3L I;  2KIK A;  1YQ3 C;  4K3A A;  2FFD C;  4MD8 A;  1NGM B;  1P84 I;  2JEE A;  3CCM 1;  3SWK A;  2Q5U A;  3RBX A;  2D2C D;  2P58 A;  2B87 B;  3L72 D;  4U3F G;  2F4O A;  2RHB A;  3C1L A;  1NU1 J;  5FLM I;  4A3B I;  1Z01 A;  2Q51 A;  4I7Z C;  1KYO H;  1FZB A;  2JWA A;  5KAF H;  1VQ5 P;  2KP8 A;  1IFN A;  2NRG A;  4ZNC A;  3CD6 1;  4PD4 I;  3BCC G;  1EDK A;  4JQ0 D;  5T67 A;  3H1J E;  3Q2Y A;  5APY A;  5L8R J;  1VQP 1;  3D2L A;  3L74 E;  3FX0 A;  2WZ7 A;  1NTM G;  2DE7 A;  1Q7Y Q;  4I1L A;  2GTH A;  4BWN A;  1MFZ A;  3HE4 A;  3CCE Z;  3MP7 B;  2KI7 B;  1IK7 A;  3QH9 A;  3H1L E;  4XFJ A;  2QJP C;  2WQY C;  1JOC A;  4ASV A;  2IPP A;  4NBF A;  1Q82 1;  3CCQ Z;  2POH A;  3L72 E;  4RVG A;  1OW7 A;  1M57 D;  2OYI A;  3OW2 O;  3M4O I;  3BG1 B;  3NH8 A;  1ZME C;  1ZB9 A;  1W2B Z;  1VF5 D;  3A2A A;  2WSF H;  3CC2 P;  2KOG A;  1T3U A;  3RL0 B;  1Q86 Q;  1SQP J;  1YHQ P;  3MGN A;  3CPW O;  3CCL P;  2VUG A;  1M1K 1;  3ITK A;  3KIH A;  1SQQ G;  1VPC A;  3AE6 C;  1HJB A;  1BGY J;  4N3Y B;  1L4A D;  3L37 A;  3IN6 A;  2BCC J;  1K73 Q;  1JY3 P;  2QEX P;  1YJW P;  1QVG Y;  4NPD A;  1HJ0 A;  3CXH H;  2KUB A;  3TGU G;  1VQO P;  3PJS K;  2VRS A;  3MON A;  3SFD C;  2JUB A;  4K35 A;  3CCE 1;  1M1J C;  2N1T A;  2O01 J;  1U57 A;  4JYC A;  2FYU J;  5KLV G;  1SQX D;  3BAS A;  2YO2 A;  4XA4 A;  4RVH A;  1K8A 2;  3CX5 D;  3CCQ 1;  1OIP A;  2OOY B;  2Y0D A;  2QA4 Z;  2RN0 A;  2Q6Q A;  3H1I G;  1SP4 A;  2XDJ A;  2VPY A;  1YJW Z;  1KC8 1;  2V7Q J;  3GTQ I;  2HU9 A;  1LT9 B;  1WMK A;  2WIT A;  2YIU B;  2B87 A;  3MZW B;  3GHG C;  1TWA I;  1IZN B;  3E1I A;  2PFX A;  3D70 A;  1EC5 A;  5GTI H;  1KQS Y;  2DW3 A;  4TLF A;  5AVU B;  1K83 I;  3VMY A;  1BCC G;  1ZOY C;  3VYI A;  3VMH A;  5KKZ B;  3VMI A;  2ZT9 D;  1SQX E;  1FOS E;  2RT9 A;  1JMM A;  3GTM I;  4D6T G;  2YKO A;  1SQV G;  3CX5 E;  1VQ6 P;  4MD9 A;  2WSE J;  2RBL A;  2KZI A;  4NOZ A;  3TK1 A;  2KLU A;  3S4R A;  4H44 C;  3H1K G;  2PMZ A;  2YKQ A;  1SFC B;  3CCL 1;  1FDO A;  4OWF A;  1YIT Z;  1NWQ A;  4CL1 A;  2OYH B;  1GK6 A;  3G4S Z;  1FZG A;  2KB7 P;  3VP9 A;  1FS0 E;  1KQG B;  2MKV A;  1YTZ T;  3CXH I;  3WU2 H;  3L70 D;  1ML8 A;  2QA4 1;  3L71 D;  3GF7 A;  5APT A;  1KB9 H;  1RLY A;  4A3J I;  4L76 A;  1LWU B;  1VQ7 P;  4HGY A;  5CCH D;  5T6B A;  3S1M I;  1JTH B;  1YJW 1;  1FZF A;  1N8R 2;  3E7K A;  3AEF C;  4I7Z B;  1KFN A;  3KZI H;  1OX3 A;  4AYB A;  1GW3 A;  1S1C X;  2M3B A;  2KK7 A;  3IAO A;  3V4Q A;  4E2Y A;  1LTT C;  2N1T D;  3Q5R A;  2E5T A;  3PO3 S;  1K8A Q;  2A45 H;  1RF1 C;  4EI2 A;  5TIS E;  1RE4 A;  2QE7 H;  1JY2 O;  1L0N G;  1SS1 A;  5KJ7 A;  1T6A A;  4ZKP A;  5FLX b;  3L70 E;  3I07 A;  5CCG A;  3M0D A;  3L71 E;  1NAY A;  2V8K A;  3A0B H;  2E2J I;  2I1K A;  3EQ2 A;  2WPS A;  1KD1 2;  5AW0 B;  2HFE D;  4YXW H;  5IT9 f;  2BJO A;  1PP9 G;  4A3I I;  3RL0 g;  2PAJ A;  4NBD A;  2OZK A;  1YIT 1;  3H1H G;  3KIF A;  3G71 Z;  3BRT B;  3LW5 H;  3G4S 1;  1IK9 A;  2A45 G;  3H6P A;  1LT9 A;  3LID A;  4BRY B;  2B9B A;  2C9L Y;  4A3C I;  2YO3 A;  2FYZ A;  1DL6 A;  1KIL B;  1NTZ J;  3M3Y I;  1NAF A;  3HOZ I;  3M9Q A;  1VQ6 1;  4BXL A;  3RK3 C;  5AVV B;  5CBN A;  4NBG A;  1JJ2 Y;  2OTL Z;  1QEX A;  3OAK A;  5C44 I;  3A0H H;  1I6H I;  1ZXG A;  2E76 C;  2WPV B;  2JR8 A;  2JJL A;  1Y47 A;  3V2N A;  4HYT B;  1GL2 C;  1OVR A;  3AEC C;  3FQM A;  1BE3 J;  5B66 E;  1FDM A;  4WY4 B;  1RE3 C;  1Q90 D;  1WZN A;  3VN0 A;  1LJ2 A;  3G3Z A;  1N8R Q;  3D6Z A;  2YNY A;  2WSS H;  2AXT H;  1SFC A;  3ABV C;  2CPB A;  2HG5 D;  1BDD A;  3GTG I;  5APW A;  1L0L K;  1QL1 A;  1T2K C;  4QTU A;  4AYC A;  2OYH A;  3SWF A;  2O1J A;  1SQB K;  3V6I A;  3CPW Z;  3IR9 A;  4L75 A;  2JA8 I;  3C9I A;  3RK2 C;  2B63 I;  3GF3 A;  1LWU A;  1Y1V S;  4XX2 A;  1PFI A;  2H7H A;  1JTH A;  4DGL A;  4QTT A;  4H13 D;  1LNQ A;  2ZYA A;  4EYY Q;  1P84 E;  1M56 D;  1QVF O;  1MFT A;  1NKN A;  1KQL A;  3CC4 P;  2OGU A;  1YBK A;  2W8Z A;  1KD1 Q;  4O9B A;  1M90 2;  1LGH B;  3H0G I;  2OTL 1;  1Q81 2;  5IP7 I;  1NU1 K;  3CME Z;  2JIP A;  1NO4 A;  1VQ9 P;  1NTK G;  3L73 G;  4H44 B;  3CWB G;  2WAQ A;  4XE5 B;  4A3K I;  5CMZ A;  3AE3 C;  1JNM A;  1X8Y A;  1VQ8 P;  4H0L C;  2E75 C;  1YJN P;  3MHV A;  4HJG H;  2A06 G;  1WRG A;  1ZV8 A;  4E33 A;  2WVR A;  4NBC A;  4U3F J;  4KJM A;  2JA6 I;  4GOE A;  2KXP B;  1IFI A;  1XTG B;  3CXC Y;  3CCV Z;  1J1E C;  3BCC J;  3I55 P;  1USP B;  4BRY A;  2IZ1 A;  1KMI Z;  3M06 A;  1NTM J;  2QVA A;  1KIL A;  1L2P A;  2B88 A;  5A2Q b;  2VPX A;  1HTL C;  3HUS C;  4DCK A;  4WWI A;  1PV3 A;  1SQP K;  4S1T A;  4NPE A;  1RF1 B;  3CQZ I;  3C8V A;  3GW6 A;  5CHX A;  2KNC B;  3PP5 A;  3J81 f;  3MIW A;  1X22 A;  2IBZ D;  4EOT A;  3CC7 P;  2QRE B;  5AW9 B;  3KPE A;  3M0A A;  4WY4 A;  2Y0S A;  3VP8 A;  3CME 1;  1X9V A;  4GKG A;  3I55 Z;  3L75 G;  4TT3 H;  1FE6 A;  1L0L D;  2H88 C;  3S1K A;  1SQB D;  4A3F I;  4MXU A;  1SQQ J;  3KYQ A;  4E31 A;  3TNU B;  4IL6 E;  1X3Z A;  1HH0 A;  1RNI A;  5APV A;  3B5N D;  4E2Z A;  3FKI I;  1N2F A;  4MD7 A;  1R8E A;  2XV5 A;  2I3C A;  1IFP A;  2FYU K;  1Q81 Q;  2IZ3 A;  2QM7 A;  4AUW A;  3CC4 1;  3TDK A;  4A7P A;  2IBZ E;  3RK3 B;  2E74 D;  5AVZ B;  3TGU J;  2XU6 A;  3CCU P;  1JEK A;  4HGZ A;  2GTI A;  2AEJ A;  1Q7Y 1;  1OVV A;  2QG4 A;  1EZV G;  2NPS D;  3E1R A;  2W6A A;  1L0L E;  2JWD A;  2E76 B;  3GTO I;  2Y0E A;  5CM2 M;  1OWA A;  1NU1 D;  3I4M I;  1JMB A;  1LTJ C;  1OZH A;  5KTB A;  1GL2 B;  1SQB E;  1NH4 A;  5KLV J;  2XKM A;  1NVO A;  4C7N B;  1PPJ D;  1NJI 2;  1USE A;  2P1J A;  1VQK P;  2K5R A;  1VQM P;  3CCS P;  4R4L A;  2E43 A;  3MZK B;  3FWN A;  3H1I J;  4PV1 D;  3I55 1;  1R9T I;  4Y7N I;  1LTS C;  1Q86 1;  3CCU Z;  1FZA A;  1OFC X;  3EFG A;  4WVZ A;  2W6J H;  1BCC J;  2HYN A;  2E42 A;  1W2B Y;  3B71 A;  1NU1 E;  1USP A;  3H3V J;  1TWG I;  5AW6 B;  2Y9Z A;  2Z4E A;  4D6T J;  5CJ0 A;  3USS A;  1PPJ E;  2Q3E A;  1SQV J;  5APX A;  4IFD K;  1N7S C;  2IV2 X;  1SQP D;  2R93 I;  4RVD A;  1EZV I;  3KXD A;  1VQ5 Z;  3K5B A;  2NVT I;  4N78 D;  1QXF A;  4WY4 D;  2JS4 A;  4OGQ D;  1N7L A;  3ESW A;  1RF1 A;  3H1K J;  2NPS C;  5AN9 F;  1BGY D;  1NUI A;  5B5E E;  3OJA B;  1K9M 1;  1URQ D;  2KNC A;  1RQF A;  1IC2 A;  1KIL E;  2BCC D;  4YPC A;  1S9K D;  2O01 N;  3EWK A;  1Z02 A;  2QLV B;  2DE5 A;  4H0L B;  3S9O A;  2D2C C;  1EDI A;  4GDO A;  2BAS A;  2QSI A;  1Z03 A;  1KC8 2;  1EXI A;  2JDI H;  4W80 A;  1YJ9 P;  1M8O B;  2ZJS E;  2JR6 A;  1RQV A;  1X79 B;  1AFO A;  1U7M A;  3D71 A;  1SQP E;  2QJK B;  1RF0 C;  1CSB A;  4PV1 C;  4NB9 A;  2W90 A;  3HD7 D;  4N78 E;  4JBZ A;  1MZ9 A;  1VQ4 P;  2JNY A;  3CCU 1;  1Z56 A;  1NHL A;  1EXJ A;  1WJ2 A;  2FYU D;  1GZL A;  2YXQ B;  4N6J A;  3CC2 Z;  1USD A;  5BU8 B;  1YHQ Z;  1VQL P;  1BGY E;  3CCL Z;  2BCC E;  2M6N A;  1CW5 A;  1NJI Q;  1FZC B;  3U1A A;  1QVF Z;  2KLV A;  3F5H A;  1S9K E;  1KYO I;  2FKW B;  1L0N J;  1VQK 1;  4C7R A;  4JPZ B;  2EGT A;  3CCS 1;  4GOD A;  2BEZ F;  3H1J G;  2QEX Z;  3I56 P;  3IF4 A;  4NBA A;  1FAV A;  3L74 G;  2K3R A;  1VQ5 1;  3T97 B;  5B5E H;  3JAM b;  1QVG Z;  1VF5 C;  4C7N A;  1VQO Z;  4RES B;  1GMJ A;  2F4M A;  2C9N Y;  1PP9 J;  3H1L G;  3WUT A;  1RE3 A;  2L91 A;  2FYU E;  2AEM A;  1SQX J;  5TJH A;  3H1H J;  4RKU J;  1CI6 B;  3J80 b;  1L4A C;  3L72 G;  3GTL I;  1RHZ B;  3VMX A;  2E2I I;  2I8D A;  2OQQ A;  2PP6 A;  3RZO I;  3B4S A;  4UB6 E;  3Q3D A;  2FYN C;  5C39 A;  4E2X A;  1N86 A;  1RO0 A;  3CC2 1;  5KAI E;  5H2F E;  3CCR P;  1YHQ 1;  1P9N A;  5AVT B;  1YI2 P;  3H25 A;  2P10 A;  3BRV B;  3UIA A;  1K8A 1;  3VTN A;  1KOR A;  3LW5 J;  3MUD A;  2IYO A;  1KC8 Q;  3F3P C;  3JCU E;  2FFD B;  2LXC B;  2M0B A;  2M5A B;  4RS4 A;  2ZVN B;  2QEX 1;  1VQ6 Z;  1KFM A;  1JCD A;  2KS1 B;  1EDJ A;  3S16 I;  1KN7 A;  1VQO 1;  4PJ0 E;  1VQ4 1;  3B8E B;  4C46 A;  1KQF B;  2WB1 A;  2P3Y A;  2YKP A;  2H43 A;  3U50 C;  2R6M A;  2O3J A;  4WBA A;  3GKQ A;  3F89 A;  3CX5 H;  2ZT9 C;  3U1C A;  3NH5 A;  3GTK I;  1WT6 A;  3WUU A;  2JA7 I;  4NH1 C;  2QJP B;  5KLI C;  3KHU A;  3V2P A;  1OVU A;  2XNX A;  4MRI A;  1YIJ P;  3N4X A;  2JMO A;  1S5L E;  2KYV A;  3J7A 4;  3I56 1;  1VQ7 Z;  1N7S B;  5KAI H;  2Z5I A;  1FZC A;  4W7Y A;  4GT1 A;  4NB8 A;  1ZP0 C;  2ZYD A;  2H89 C;  4Y52 I;  3JSV C;  3G6E P;  1NTK J;  1OXZ A;  3L73 J;  2MJZ A;  1YUK A;  5M1B A;  3CWB J;  5AW8 B;  3P8M C;  1SQX G;  2JKV A;  3T97 A;  1BSN A;  4BXX I;  3PO3 I;  5T64 A;  2GUS A;  1N8R 1;  1H0T B;  3JC2 2;  3S2H I;  5CCH C;  1JY2 N;  3PO2 I;  4Y99 C;  2YU9 I;  1CI6 A;  1TU3 F;  2AEF A;  3MTU E;  5EFW B;  4UB8 E;  3HOY I;  3OW2 Y;  5AVX B;  2M3E A;  3TSI A;  1BE3 D;  4LGD E;  2WPR A;  4M3L A;  5TIS H;  2N1T C;  1GDT A;  3WMM 0;  2HOD B;  3Q1M A;  1OMI A;  3CCJ P;  1HBW A;  1KB9 I;  2QRC B;  2O4H A;  1NTZ E;  5AVQ B;  2Q4Z A;  1M1J B;  1P84 D;  1SFO I;  2ZVO B;  3CPW Y;  3HE5 B;  3HOW I;  3F3F C;  4A3D I;  3RL0 D;  1J2J B;  3NH4 A;  2J58 A;  3AE1 C;  3AED C;  1HVV A;  1SQQ K;  2KSE A;  1VQ7 1;  1M7L A;  5E79 E;  3HTK B;  1H8A A;  2XZR A;  1WII A;  1GD2 E;  1L1O C;  1JJ2 Z;  4PD4 D;  2FFD A;  4X6A I;  3Q5S A;  1AQT A;  1VF5 B;  2M5A A;  3L75 J;  2A45 I;  3CX5 I;  2G2K A;  3NTN A;  1BE3 E;  4NPF X;  1LQL A;  3GHG B;  3CMA P;  3H32 B;  1ZB8 A;  2KS1 A;  2GA1 A;  4CPG A;  3ZDM A;  3FQQ A;  3L70 G;  1K05 A;  3L71 G;  5KJ7 D;  1L4A B;  2I1J A;  5LL6 f;  3AE9 C;  5CCG D;  3VMZ A;  4UB8 H;  3MD0 A;  5KLV K;  1JY3 O;  2WT7 B;  5GTH E;  5K5G B;  4PD4 E;  3W68 A;  2J6A A;  1QVG O;  2FYN B;  1TWC I;  3NDI A;  3G6E 1;  4RJT A;  1AA6 A;  5B66 H;  2P7J A;  1E79 H;  2RH0 A;  1H89 A;  1QX8 A;  1N7S A;  3IFM A;  3VOP A;  2WSC J;  2ZYG A;  1GU5 A;  1MV8 A;  5E79 H;  1S4X A;  2ZXX A;  2OTJ P;  2R92 I;  1S72 P;  1LTG C;  1GK4 A;  3G9R A;  3II6 A;  1WCM I;  3PTZ A;  4LC1 A;  3A3Y B;  1AQ5 A;  3CC4 Z;  4A3G I;  1I3Q I;  4JYB A;  1SQV K;  1BSH A;  3CCM P;  2FY8 A;  4YTP C;  2OAR A;  1JY3 N;  3CL3 D;  1PGQ A;  1J1D C;  1PZQ A;  1H0T A;  4E32 A;  1VQ9 Z;  2B89 A;  1P84 H;  4H13 C;  1Y8A A;  4U3F E;  1DH3 A;  3CD6 P;  1VQ8 Z;  1N73 C;  2CPS A;  1YJN Z;  1KYO D;  1W5C E;  1KQS O;  1RF0 A;  1VQP P;  2NZ2 A;  2ZT9 B;  3M0D C;  2NAP A;  5AW1 B;  2OTJ Z;  3BCC E;  1SFC D;  3SFE C;  2QR1 B;  2LKM A;  1Q81 1;  4PD4 H;  1DD4 A;  2HOD A;  2C0W A;  1H88 A;  1NTM E;  4DOJ A;  1Q7Y 2;  1S7M A;  3AEB C;  2WTY A;  2R44 A;  1M1J A;  2IX7 C;  3IX0 A;  3HE5 A;  2IYP A;  3VMA A;  1LTA C;  1SQQ D;  1YYC A;  2QRX A;  3QWO C;  2W83 C;  4A3M I;  1ZH1 A;  3RGU A;  1FBM A;  3HTK A;  5AVY B;  3Q5P A;  1JM0 A;  2W03 A;  2C0X A;  4LLH A;  2YIU C;  2VPW A;  2Y0C A;  2H8P D;  1KYO E;  3LIE A;  5KAF E;  1Q2N A;  1PFT A;  3TGU D;  1M90 Q;  1FJP A;  5AVR B;  3GHG A;  4GIF A;  3H32 A;  2LEX A;  3NXS A;  3CC7 Z;  1TFI A;  1ZRT E;  3A7O A;  4TNU A;  3VB9 A;  4IFM A;  2WSF J;  1L4A A;  2PK7 A;  5KLV D;  1SQQ E;  1VQ9 1;  1WW9 A;  3FWL A;  5FLX f;  2WT7 A;  1VQ8 1;  3RZD I;  1AVY A;  1Q82 2;  1YJN 1;  4KHX A;  4BY7 I;  1R5L A;  2W6B A;  3W67 A;  1SVF A;  3KDP B;  2RKL A;  2RPR A;  3CXH D;  1SFC C;  2OTJ 1;  1JCC A;  2ZFC A;  1Q16 A;  2GM4 A;  1RQU A;  3TGU E;  1HF9 A;  2J59 M;  3H1J J;  4NBB A;  3CCE P;  3GLM A;  3L74 J;  1K9M 2;  5IT9 b;  1M1K 2;  1BCC D;  1LWU C;  1KIL D;  3BVH A;  3H1L J;  3CCQ P;  1LT1 A;  5DJU B;  5KLV E;  4IL6 H;  3RK2 B;  3HOX I;  4D6T D;  1A02 F;  2N9Y B;  1SQV D;  3IFU A;  3AE8 C;  1RH5 B;  3L72 J;  3B5N C;  1K73 1;  2SPZ A;  3H1I E;  2RIQ A;  2JIQ A;  5D1O B;  1FOS F;  4BBR I;  3BAT A;  2Q1K A;  1VQK Z;  3CXH E;  1FJK A;  1VQM Z;  1DEB A;  3CCS Z;  1HWT C;  1QL2 A;  3H1K D;  1MUU A;  3CC7 1;  2NVY I;  2E74 C;  2HF1 A;  2G3A A;  1AVO A;  5DJT B;  4W7Z A;  2P67 A;  3WUV A;  4WB4 A;  5C4J I;  2P28 A;  1BCC E;  3QWU A;  2N9B A;  2O1K A;  2CK3 H;  1SIW A;  5IP9 I;  4OH8 B;  3OA7 A;  3HOU I;  1NJI 1;  4D6T E;  2M8R A;  2V8I A;  1SQV E;  1GTW A;  2YAD A;  4HKZ H;  3CLQ A;  3BG0 B;  2E75 B;  2OOX B;  3NDJ A;  3D6W A;  2IBZ G;  1NYH A;  1PL5 A;  2Y9Y A;  1W2E A;  3LUS A;  5C3E I;  1KRL A;  1AV1 A;  1GW4 A;  1BDC A;  1QVF Y;  3H1K E;  1K04 A;  1ZN5 A;  3IR7 A;  3TNU A;  1L0L G;  5GTI E;  3AEE C;  4DT0 A;  1J1E B;  1KIL C;  4Y28 J;  1PIX A;  4MN4 C;  2QA4 P;  1SQB G;  2UWJ E;  1JWH C;  3V2Q A;  2XND H;  1L0N D;  1Q82 Q;  1J1D B;  2AKL A;  3P7K A;  5CCH A;  1KB9 D;  4H13 B;  3HUS B;  1KTM A;  1NTK K;  1N73 B;  4H44 D;  1T8Z A;  2ITA A;  3P5J B;  4DJG A;  1VQM 1;  1K9M Q;  1FZE A;  1X3W A;  1YJ9 Z;  1PP9 D;  2PRR A;  2OYO A;  1M1K Q;  5AW4 B;  3HRN A;  3S1R I;  3GTM S;  4WY4 C;  4A3E I;  1GL2 A;  3AE2 C;  3PHL A;  4OGQ C;  1EQ7 A;  1A02 J;  3H1H D;  3P32 A;  1NTZ K;  4MON A;  1VQ4 Z;  1URQ C;  2E7Z A;  4ZMD A;  1JUN A;  4KT0 J;  1NU1 G;  4DK1 A;  1VQL Z;  4I2L C;  3CI9 A;  2IBZ I;  1L0N E;  3IF8 A;  3L36 A;  3I5C A;  3FXD A;  1PPJ G;  3WU2 E;  1VLA A;  2K9J B;  2NVX I;  1YUA A;  1KB9 E;  3VMG A;  3R4Y A;  4IL6 X;  5C4X I;  2NVQ I;  2WPQ A;  3SWY A;  3KZI E;  2Q7C A;  3AE4 C;  1XTC C;  1YIT P;  5A2Q f;  3I56 Z;  2V45 A;  4EWC A;  1PP9 E;  3G4S P;  3HD7 C;  3L35 A;  1SLQ A;  2R3C A;  2GUV A;  1JO5 A;  3HOV I;  3H1H E;  3AEG C;  5D1O A;  2QIW A;  1RY3 A;  1DD3 A;  1KQS Z;  3O8Z A;  2E5Y A;  3GTP I;  3RBZ A;  2K37 A;  1G1I A;  3N7N A;  3V5B A;  1LTJ B;  3S1N I;  5AVW B;  4DZO A;  4GOF A;  4ZKU A;  3A0B E;  1IJD B;  1SQP G;  3M9B A;  3J81 b;  4AQR D;  2BEQ D;  1YJ9 1;  2PGD A;  2RMZ A;  5BVZ A;  2O01 H;  3D9X A;  2R3S A;  4U7J A;  3D6Y A;  1BGY G;  1TWH I;  5AW3 B;  4RO0 A;  1EDL A;  2BCC G;  3FXE A;  1RO4 A;  1NOH A;  3CCR Z;  4BBS I;  1VQL 1;  1LTI C;  1LP1 B;  1YI2 Z;  2R32 A;  3RK3 D;  4YXD C;  1D7M A;  2V7Q H;  5APS A;  3L70 J;  3L71 J;  5APU A;  2DE6 A;  2HR3 A;  4Z1M H;  3L4F A;  4UB6 H;  2OYI C;  3B5N B;  1I50 I;  2E76 D;  3KQG A;  5CBO A;  2K88 A;  4OVN F;  3O6Q B;  4IFF A;  1R5S A;  4L74 A;  4ASW A;  2PM9 A;  1HGV A;  3A0H E;  1NTK D;  3L73 D;  3SSU A;  1GL2 D;  3G71 P;  5H2F H;  3S14 I;  3CWB D;  1X0T A;  1VQN P;  2FYU G;  3HUS A;  2E74 B;  2L5G B;  3NFQ A;  5AW5 B;  1N73 A;  2AYD A;  2IFM A;  2A06 D;  5AVS B;  2FBW C;  3EED A;  2QJY C;  3JCU H;  3M91 A;  1KV4 A;  2NPS B;  2WSE H;  1NTZ D;  1RO2 A;  1QF8 A;  2OTL P;  1T2K D;  3RK3 E;  1NTM K;  4NBE A;  2AXT E;  3NFZ A;  3MZL B;  2K1A A;  2HPC B;  1DIP A;  2WWW A;  3P8C D;  2D2C B;  3RK2 D;  1YIJ Z;  4PJ0 H;  3NMD A;  2W04 A;  1VL2 A;  1E5W A;  2K9J A;  1NTK E;  3AE7 C;  3L73 E;  3S1Q I;  3CWB E;  1VQN Z;  2Z5H A;  1IFM A;  3A5T A;  4PV1 B;  3V4W A;  3I4N I;  2J5U A;  2G8Y A;  3CCR 1;  3G6E Z;  1QLE D;  2R5D A;  2A06 E;  1YI2 1;  2JP3 A;  3AEA C;  1LTB C;  4L73 A;  3GCF A;  3M9H A;  1JB0 J;  3GMA A;  1Y8C A;  2AXC A;  3TDH B;  1UII A;  2YMK A;  1S5L H;  1ZR4 A;  1Y9B A;  1W2B O;  2R7Z I;  2OTK E;  3L75 D;  3P8C E;  4B86 A;  1IO4 A;  4E30 A;  3T4N B;  4E2W A;  1KD1 1;  1YQ4 C;  2R5B A;  2Q9I A;  4H0L D;  1QYP A;  2E75 D;  2V3V A;  1LTJ A;  3R2P A;  4OGQ B;  4HH4 A;  3OW2 Z;  1DX7 A;  2FXP A;  3EFF K;  2E9H A;  1URQ B;  2GU2 A;  2JIM A;  5CJ4 A;  3CCJ Z;  3S15 I;  3CME P;  2IZ4 A;  3EER A;  1HGZ A;  4EDF A;  4A93 I;  3Q87 A;  2K9Y A;  3FGA D;  3U59 A;  5BU5 A;  1IFD A;  3S17 I;  1YIJ 1;  3PRJ A;  1LP1 A;  4NBH A;  3PLN A;  3L75 E;  3G71 1;  1EZV D;  1Y1W I;  1VQN 1;  1G2C B;  4IOI H;  2JA5 I;  3HD7 B;  2LR2 A;  5AW2 B;  5D1P A;  3B5N A;  4RV9 A;  2ZXE B;  1NP6 A;  3O6Q A;  2VF1 A;  4JF7 A;  4U3F D;  3MUD C;  3CCV P;  3CMA Z;  1NKZ B;  2LFU A;  1CZQ A;  3RL0 C;  1Y1V I;  3JAM f;  3BCC D;  1ZR2 A;  2NPS A;  1NTM D;  1UIX A;  3V2R A;  2JO1 A;  1S2E A;  2IZ0 A;  1EZV E;  3J80 f;  1OW6 A;  2P2U A;  1GU4 A;  2HPC A;  3GG2 A;  1NTZ G;  2LIY A;  1HUC A;  2QJK C;  1N2D C;  1AA0 A;  1OW8 A;  2V4H A;  3HE4 B;  3CCJ 1;  1RE4 C;  1QGK B;  3K7A I;  5KJ7 C;  2VUM I;  2YXR B;  2M48 A;  3TF5 A;  2JIR A;  1VDF A;  2V8J A;  5CCG C;  1M90 1;  2VPZ A;  1ZW0 A;  5GTH H;  1S72 Z;  5KLI B;  2FXO A;  1FZC C;  2OYI B;  2H85 A;  1FU1 A;  1ZRT D;  3CXC Z;  1YTZ I;  4HB1 A;  4BY1 I;  1S5L X;  1FC2 C;  3PH0 A; 
#chains in the Genus database with same CATH homology
 5C4J I;  2P28 A;  2KZJ A;  3QWU A;  3FQM A;  3CCM Z;  1K8A 1;  2KPI A;  5IP9 I;  3VTN A;  3HOU I;  2WMM A;  1NJI 1;  3F3P C;  2V8I A;  3CMA 1;  2LXC B;  2M0B A;  2M5A B;  2QKD A;  2YAD A;  4RS4 A;  4HKZ H;  3BG0 B;  4MH4 A;  1BDD A;  3GTG I;  3CD6 Z;  2OOX B;  2QEX 1;  3NDJ A;  2LXB A;  3D6W A;  4QTU A;  1VQ6 Z;  1U7J A;  1VQP Z;  2KS1 B;  3LUS A;  5C3E I;  1EDJ A;  1KRL A;  3S16 I;  3S2D I;  3CPW Z;  1BDC A;  2JA8 I;  1QVF Y;  4NFR A;  1VQO 1;  1VQ4 1;  2B63 I;  3HKZ A;  1Q86 2;  1Y1V S;  2WB1 A;  4XX2 A;  2QRD B;  2P3Y A;  4DGL A;  3U50 C;  4MN4 C;  2R6M A;  4QTT A;  2UWJ E;  1JWH C;  1DEE G;  4EYY Q;  3GKQ A;  2AKL A;  3GTJ I;  3NH5 A;  3GTK I;  1MFT A;  1K73 2;  2JA7 I;  4NH1 C;  3CCV 1;  2E2H I;  1OVU A;  4DQY B;  4MRI A;  3P5J B;  1M90 2;  2JMO A;  3H0G I;  3J7A 4;  3I56 1;  1VQM 1;  1VQ7 Z;  2OTL 1;  1X3W A;  1Q81 2;  2ZAE B;  3TE5 B;  5IP7 I;  3CME Z;  1YJ9 Z;  1S72 1;  4RVF A;  2O53 A;  4NB8 A;  1TWF I;  3S1R I;  3GTM S;  4A3E I;  4Y52 I;  1S3J A;  4A3L I;  2WAQ A;  2KIK A;  4K3A A;  4A3K I;  4MD8 A;  4MON A;  1YUK A;  1VQ4 Z;  4ZMD A;  3CCM 1;  3MHV A;  4HJG H;  2P58 A;  2B87 B;  2F4O A;  2RHB A;  4DK1 A;  1VQL Z;  4BXX I;  4E33 A;  3IF8 A;  5FLM I;  4NBC A;  3FXD A;  4A3B I;  1Z01 A;  1VLA A;  2Q51 A;  2NVX I;  1YUA A;  4KJM A;  3PO3 I;  5T64 A;  2JA6 I;  4GOE A;  1N8R 1;  3VMG A;  4ZNC A;  3CD6 1;  3CXC Y;  1H0T B;  1EDK A;  5T67 A;  3S2H I;  3CCV Z;  5C4X I;  2NVQ I;  1VQP 1;  3PO2 I;  2YU9 I;  1USP B;  2DE7 A;  5A2Q f;  3I56 Z;  5EFW B;  2GTH A;  4EWC A;  2QVA A;  3HOY I;  3OW2 Y;  2B88 A;  5A2Q b;  3CCE Z;  2KI7 B;  3HOV I;  5D1O A;  4WWI A;  4S1T A;  4ASV A;  2QRC B;  4NBF A;  4NPE A;  2O4H A;  1KQS Z;  1Q82 1;  3CCQ Z;  4RVG A;  2Q4Z A;  3CPW Y;  1SFO I;  3CQZ I;  3HOW I;  3F3F C;  4A3D I;  3GTP I;  3J81 f;  3M4O I;  3BG1 B;  3NH8 A;  3S1N I;  3NH4 A;  1ZB9 A;  2QRE B;  4GOF A;  3J81 b;  1W2B Z;  1VQ7 1;  1WII A;  2Y0S A;  3CME 1;  1YJ9 1;  1L1O C;  3I55 Z;  1JJ2 Z;  3D9X A;  2VUG A;  1M1K 1;  3KIH A;  4X6A I;  2M5A A;  1TWH I;  1EDL A;  2G2K A;  3FXE A;  3S1K A;  4A3F I;  4NPF X;  1RO4 A;  1LQL A;  4MXU A;  3CCR Z;  1ZB8 A;  4E31 A;  4BBS I;  1VQL 1;  4CPG A;  1LP1 B;  1YI2 Z;  1X3Z A;  3ZDM A;  3FQQ A;  1RNI A;  4E2Z A;  3FKI I;  1N2F A;  4MD7 A;  1QVG Y;  2I3C A;  5LL6 f;  4NPD A;  2DE6 A;  2IZ3 A;  3CC4 1;  2HR3 A;  2KUB A;  1I50 I;  5CBO A;  3MON A;  2JUB A;  4ASW A;  2PM9 A;  4HGZ A;  2GTI A;  5K5G B;  4K35 A;  3S14 I;  1X0T A;  1Q7Y 1;  1OVV A;  3CCE 1;  2J6A A;  2JWD A;  1TWC I;  3GTO I;  3NDI A;  3G6E 1;  5CM2 M;  3I4M I;  1JMB A;  3EED A;  4RVH A;  1K8A 2;  1NVO A;  3CCQ 1;  2OOY B;  2QA4 Z;  1NJI 2;  2K5R A;  1RO2 A;  1QF8 A;  4NBE A;  2R92 I;  1YJW Z;  3MZK B;  1KC8 1;  3NFZ A;  3GTQ I;  3MZL B;  2HU9 A;  1WCM I;  3CC4 Z;  4A3G I;  1I3Q I;  2B87 A;  3MZW B;  3I55 1;  1YIJ Z;  1TWA I;  1R9T I;  4Y7N I;  1Q86 1;  3CCU Z;  1EC5 A;  2W04 A;  1KQS Y;  3S1Q I;  1VQN Z;  1K83 I;  1H0T A;  3VMH A;  4E32 A;  1VQ9 Z;  3I4N I;  2B89 A;  3VMI A;  2RT9 A;  3CCR 1;  1W2B Y;  3G6E Z;  3GTM I;  1USP A;  1YI2 1;  3H3V J;  1TWG I;  1VQ8 Z;  3GCF A;  1YJN Z;  4MD9 A;  3TDH B;  2RBL A;  2KZI A;  4NOZ A;  2R93 I;  2OTJ Z;  2QR1 B;  4RVD A;  1Q81 1;  1VQ5 Z;  2NVT I;  2R7Z I;  2JS4 A;  2PMZ A;  2OTK E;  4E30 A;  3ESW A;  1Q7Y 2;  1S7M A;  3T4N B;  4E2W A;  1KD1 1;  2R44 A;  3IX0 A;  5AN9 F;  1NUI A;  3CCL 1;  1K9M 1;  1RQF A;  1YIT Z;  1QYP A;  2QRX A;  4CL1 A;  3G4S Z;  4HH4 A;  3QWO C;  4A3M I;  1ZH1 A;  3OW2 Z;  3RGU A;  1Z02 A;  2QLV B;  2E9H A;  2GU2 A;  2DE5 A;  1JM0 A;  2W03 A;  1ML8 A;  2QA4 1;  1RLY A;  1EDI A;  4A3J I;  3CCJ Z;  1Z03 A;  4HGY A;  1KC8 2;  5T6B A;  3S1M I;  3S15 I;  1YJW 1;  3EER A;  2IZ4 A;  1N8R 2;  1Q2N A;  1PFT A;  2JR6 A;  1U7M A;  4A93 I;  3Q87 A;  4NB9 A;  4AYB A;  3S17 I;  1YIJ 1;  1LP1 A;  1TFI A;  4JBZ A;  4NBH A;  3CC7 Z;  2JNY A;  3CCU 1;  3G71 1;  4E2Y A;  3CC2 Z;  4TNU A;  3VB9 A;  1Y1W I;  1YHQ Z;  1VQN 1;  2PK7 A;  4IOI H;  2JA5 I;  3PO3 S;  1VQ9 1;  2LR2 A;  1WW9 A;  3CCL Z;  2M6N A;  5D1P A;  5FLX f;  1QVF Z;  4RV9 A;  1SS1 A;  1NP6 A;  1VQ8 1;  3RZD I;  2VF1 A;  5FLX b;  1Q82 2;  1YJN 1;  3CMA Z;  3I07 A;  4BY7 I;  2V8K A;  1VQK 1;  2LFU A;  2EGT A;  3CCS 1;  1Y1V I;  4GOD A;  2RPR A;  2RKL A;  3JAM f;  2E2J I;  2QEX Z;  2OTJ 1;  4NBA A;  2K3R A;  1VQ5 1;  3JAM b;  4NBB A;  1QVG Z;  1KD1 2;  5IT9 f;  2BJO A;  4A3I I;  1K9M 2;  1VQO Z;  4NBD A;  2F4M A;  5IT9 b;  1M1K 2;  2OZK A;  1YIT 1;  3KIF A;  3J80 f;  3G71 Z;  1LT1 A;  3G4S 1;  5DJU B;  3HOX I;  3J80 b;  4A3C I;  2LIY A;  3IFU A;  3GTL I;  1DL6 A;  3M3Y I;  3CCJ 1;  3HOZ I;  2E2I I;  1VQ6 1;  2I8D A;  4BXL A;  3K7A I;  1K73 1;  2SPZ A;  5CBN A;  2VUM I;  2RIQ A;  4NBG A;  2M48 A;  1JJ2 Y;  5D1O B;  4BBR I;  2Q1K A;  1VQK Z;  3RZO I;  2V8J A;  1VQM Z;  2OTL Z;  3CCS Z;  1M90 1;  5C44 I;  1ZW0 A;  3CC7 1;  5C39 A;  4E2X A;  2NVY I;  1S72 Z;  1I6H I;  1ZXG A;  2H85 A;  2HF1 A;  1RO0 A;  1Y47 A;  3CC2 1;  5DJT B;  1FC2 C;  3CXC Z;  4HB1 A;  4BY1 I;  1YHQ 1;  1P9N A;  1OVR A;  3PH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...