2ZAEB

Crystal structure of protein ph1601p in complex with protein ph1771p of archaeal ribonuclease p from pyrococcus horikoshii ot3
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
EKKEKKKIAIERIDTLFTLAERVARYSPDLAKRYVELALEIQKKAKVKIPRKWKRRYCKRCHTFLIPGVNARVRLRTKRMPHVVITCLECGYIMRYPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an archaeal homolog of the human protein complex Rpp21-Rpp29 that is a key core component for the assembly of active ribonuclease P.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 1
total genus 28
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2007-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2zaeB01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2zaeB02
2P58A 4ASWA 4JBZA 2M5AB 1ZXGA 1JM0A 1LP1A 1FC2C 2KIKA 5DJTB 2K3RA 4WWIA 1H0TA 2R44A 1Y47A 4HKZH 4CPGA 1LT1A 2B87A 2QRXA 1OVUA 2RKLA 3FXEA 2SPZA 2LXBA 4EYYQ 1H0TB 3MHVA 1EC5A 2WMMA 4GODA 1X0TA 2HR3A 2Q1KA 3MZWB 5DJUB 1Q2NA 1EDJA 5CBNA 4K35A 1OVRA 1BDCA 4ASVA 4NPEA 1S3JA 1EDKA 2JWDA 3FXDA 2LXCB 4HJGH 1NVOA 1U7JA 2I8DA 3PH0A 4IOIH 1DEEG 5C39A 3ZDMA 2M0BA 4NPDA 4GOFA 2KS1B 5CBOA 5EFWB 1ZW0A 4ZNCA 2QVAA 4MN4C 1BDDA 2KUBA 2LR2A 4NPFX 3S1KA 2OTKE 4GOEA 4K3AA 2KZIA 2M5AA 3QWOC 2B88A 2UWJE 1U7MA 2B89A 1OVVA 1MFTA 1SS1A 1EDLA 2KZJA 4KJMA 1LP1B 2B87B 1JMBA 4BXLA 5K5GB 2KI7B 4HB1A 3RGUA 4ZMDA 1EDIA 2ZAEB
chains in the Genus database with same CATH superfamily
1LT9C 2IBZG 1Q822 3TDHB 4JBZA 3V2RA 2K88A 4A3FI 1VDFA 3NH5A 3BCCE 3N4XA 2ZXXA 3U59A 4I6MC 3IFMA 2QEXZ 3RZDI 2K5RA 1YIJ1 2YMKA 1IFJA 3ABVC 1NTKG 4GKGA 3BRTB 1YITZ 1XTGB 3CCJZ 2LFUA 5LL6f 2E76D 3A3YB 2JEEA 2NVYI 5GTHE 3PP5A 2QEX1 4UB8E 3CX5H 5APSA 1MZ9A 1JO5A 3G711 4NBGA 2M48A 1VQKZ 4K35A 1OVRA 5E79H 4WBAA 3CMAP 2QJPB 1SQBE 1BGYJ 3CC2P 1LWUC 1Q7YQ 3CCUZ 3VMGA 1S2EA 2BCCD 4L76A 1LTSC 5M1BA 2BCCG 1NKNA 3WUTA 4A3GI 3A0BE 4PV1C 5E79E 5FLXf 1RLYA 3OJAB 3GCFA 3Q5SA 2YKOA 1JTHB 1L0NE 4H44D 2HPCB 1VQ81 1R5SA 3NFZA 1FU1A 3MUDC 1E79H 1G1IA 1LP1B 1VLAA 1YI21 4DJGA 4E2YA 3S15I 1T6AA 2NPSD 3I561 4A3DI 2RHBA 1YJ9P 1QVFO 1M56D 1L0NG 4DCKA 2QIWA 1LTJA 1LP1A 3CCMP 3CCL1 1SQBD 4A3JI 2V7QJ 4KT0J 3WU2E 3RK3C 4HH2A 2WTYA 1QYPA 1RF0C 1LT1A 5CCGA 1JY3N 2B87A 4GT1A 2E74C 5H2FH 2Y0SA 2N1TA 3H25A 4MD7A 3M9QA 4H0LD 3L70J 1BSNA 1VQ8P 1QLED 1YUAA 2N1TC 2IZ4A 1RF0A 1NHLA 1FZGA 4A3CI 4N78E 4NB8A 3L70D 1W2BO 5KJ7D 2Q1KA 4IL6H 3VTPC 1LTJC 2C0XA 1SQPG 2VPWA 2XU6A 3GKQA 2KSEA 2KP8A 5APQA 4Y99B 1NVOA 3V2PA 4BBRI 5TISH 2JIRA 1SQBK 2O4HA 3H1HE 3H1JG 2M8RA 1IK7A 2IYPA 2HPCA 1WZNA 2WSCH 4L74A 1GW3A 3B5NB 3VMXA 2Y9ZA 3GHGC 1GK4A 1S4XA 2YNYA 2AEMA 4BRYB 2WPSA 3CCSZ 3VTNA 4M3LA 1N73B 3K7AI 1VQ5P 1SS1A 1K9M2 1VQ9P 2G3AA 1YTZI 2GA1A 5B66H 1RQVA 3CCUP 1YHQZ 3GTLI 1EDIA 1VF5B 1DD3A 1AA0A 1LT9A 1USPA 1MKMA 2OARA 4E30A 3L71E 3V6IA 1J1EC 4KHXA 1P84E 2V7QH 2KIKA 3HOXI 2JKVA 3HD7C 3P7KA 3CMEP 1HF9A 2R44A 3N7NA 2O01N 3NDJA 1SQXJ 4X6AI 2JMOA 3QWUA 2I3CA 5CCHA 1L0LG 2YXQB 1Q16A 2Q5UA 2E76B 1GW4A 3CPWY 3RBXA 5AVXB 3VMAA 1P84H 1NU1G 3CD6P 1FZBA 1NWQA 2N9BA 2WPQA 1X0TA 2RBLA 3KZIE 1SQVJ 3F3FC 2VPYA 3D6YA 2IZ3A 2QR1B 3KIFA 3L75D 1M1JA 1Q7Y1 3FQMA 1JCDA 2WAQA 3TSIA 1TU3F 2V8KA 1VL2A 4L75A 3RK2D 4ZKUA 4WVZA 1Q7Y2 3GTMS 3GTKI 1BGYD 2H89C 3MZLB 2JIMA 3PH0A 2YKQA 1RE3A 4NPDA 3BATA 1H88A 1JY2O 1K83I 2FY8A 2R3SA 4ZNCA 3UIAA 1FS0E 4MN4C 1MFZA 3CCQ1 5KTBA 5CJ0A 2KUBA 2JR8A 1HJBA 2FFDA 1OFCX 3D70A 1KQLA 2O53A 1VQMZ 3D6ZA 3RBZA 2OYHB 3IAOA 2UWJE 4ZKPA 1YJNP 2KS1A 1CI6B 2PFXA 1GL2B 1USPB 4AQRD 3GG2A 1K73Q 3L72E 2KI7B 2J5UA 2OOXB 3HE5A 2ZAEB 2RPRA 1S5LX 3B71A 4EIJA 2VUGA 3AE4C 1ZV8A 3RL0D 3CCEZ 3KZIH 1NTZJ 3V5BA 1OX3A 2KXPB 2R6MA 5CHXA 5D1PA 3MP7B 1DL6A 3H1JE 3H1HG 1RO4A 2JP3A 2E42A 2QRXA 1NTMD 1VQK1 1URQA 3TGUD 3VP8A 1SFCD 3CCRZ 2HG5D 3EWKA 4D6TJ 1PP9J 1TWHI 2R5DA 4AYBA 4DQYB 1KC82 2E75D 2JA5I 5CM2M 2AEJA 5FLMI 4RJTA 1JY2P 1OZHA 2R93I 4PV1D 2W6JH 2XNDH 3G4S1 1Q90D 1OMIA 1J1DB 3CC4P 2QREB 4OGQC 3L73G 1EDKA 4B86A 3Q1MA 4RVGA 2WSEH 5APXA 2QJPC 4N3YB 5C4JI 2WSEJ 1YI2Z 3WU2H 1ZW0A 2OYHC 1BGYE 2A06G 1PL5A 3HOYI 5KKZC 1R8EA 1HWTC 1N2DC 2B88A 2YU9I 3L72J 2WWWA 3EFFK 1HBWA 4GIFA 2V8JA 3HTKA 5KJ7A 1K9MQ 1PFTA 1SQVE 1N7SD 2YKPA 1P9NA 3CMAZ 2PP6A 1G2CB 4WY4C 2YIUB 3JSVC 1VQKP 2OTJZ 1Q812 1PP9G 1SQQJ 4ASWA 1VQPP 1NTZG 2J6AA 1IFIA 4O9BA 3T4NB 2VRSA 2NZ2A 1QXFA 1KFMA 3C8VA 1YJN1 4RV9A 2BCCE 5KLIC 3CWBE 3PO3S 3G71P 1QVFZ 2DE5A 2E43A 2QRDB 3E1RA 1NH4A 2VPXA 3CC71 3C1LA 3BASA 1H0TB 2Q51A 4NB9A 1SQQD 1NP6A 1TWGI 4A3LI 2Y0EA 2ZYAA 1PIXA 3L74D 3CPWO 2XV5A 2B9BA 1K731 2JIOA 2MJZA 2IYOA 1AV1A 1Q2NA 1Q82Q 3SWKA 1ZR2A 1NU1K 3SWFA 1N73A 3FKII 2VUMI 3B5NC 2JIQA 2FYUD 3TNUA 5C44I 1X79B 1S5LH 2CPSA 2E9HA 4MRIA 3CC41 2QJKB 1BCCG 4HJGH 3G4SP 4RVDA 2WZ7A 3M9BA 1E5WA 2IZ1A 3A0HH 3L73D 3CD61 2MKVA 1MV8A 3TK1A 3BCCG 1LTGC 1BDDA 4YTPC 3WUVA 4N6JA 2OTKE 3P8MC 1Q821 1DD4A 3NDIA 2BASA 1KQGB 2AXTE 1YBKA 3H1IJ 2HF1A 1AQTA 1OVVA 3TGUE 3FX0A 2AKLA 1BGYG 1G2CA 2NAPA 2L91A 1K8AQ 3IN6A 1X3ZA 1RE4C 2QM7A 1SQQE 1SQQG 3GTQI 3HRNA 3TGUG 3EEDA 3H3VJ 1NTMG 2DW3A 3CCEP 1QEXA 1VQ7P 1M90Q 2P58A 3HE5B 1HGZA 1RO2A 3M91A 3MIWA 1XTCC 1FC2C 1NGMB 3GTOI 1T3UA 1YJWZ 1VQ91 3Q5RA 2PGDA 2M6NA 5A2Qb 2NVXI 4Y7NI 1DEBA 1X3WA 2HODA 2WB1A 4H13C 1JB0J 2Q6QA 2WSFJ 1YJNZ 2RKLA 2Q3IA 4NBDA 5AW5B 3CWBJ 4C7RA 1SQXD 2ZVOB 5AW7B 2QA4P 3AEFC 3VYIA 5AVYB 1BCCD 5DJUB 1SFCC 2QJYC 4MD9A 4RKUJ 5CMZA 3RZOI 3CCMZ 3KHUA 1ZRTD 5C4XI 3I551 1ZP0C 3BRVB 3NH4A 1YJ9Z 1AVYA 3A2AA 3E1IA 3WUUA 1IC2A 3CCV1 1DEEG 4D6TE 3GTMI 2WSCJ 4WY4D 3L72G 1KYOI 2GUSA 2JWAA 2JA6I 3QWOC 3MTUE 1M1JB 1VQ71 1ZH1A 3CWBD 3CCE1 1OXZA 5TISE 4XX2A 1JWHC 2QLVB 1S721 1X8YA 2KZJA 1HH0A 2WT7A 3L75J 2G8YA 3G4SZ 4N78D 3PO3I 1VQOP 4MH4A 1WJ2A 2PK7A 2OZKA 3L70E 4A7PA 2YADA 1YJ91 4PD4I 1L0NJ 3SSUA 1ZB8A 4HGZA 1ZXGA 4OVNF 1GK6A 3S9OA 1NJIQ 2A45G 3VMZA 4CPGA 1PPJD 1VQ9Z 3KDPB 1FZCB 3A7OA 3CX5D 1P84D 1FAVA 4EDFA 3CCJP 1KB9H 1IO4A 2C9NY 2NVQI 2OTL1 1S72Z 2V3VA 2NRGA 5AVUB 2HR3A 4UB6H 1KQSO 4JYBA 3J80f 1I50I 5KAIE 3S1RI 3CCQZ 1GU5A 3JCUH 2FXMA 3L72D 3MZKB 1PGPA 1N8RQ 1VQ4Z 5AW6B 1QL2A 1L4AD 3A5TA 4E33A 4NBFA 2R92I 1K04A 2OTLZ 2ZVNB 1T8ZA 1N7SB 2YXRB 4YXWH 3CCVZ 5KAIH 5EFWB 4DOJA 4RO0A 2HU9A 1N73C 2IV2X 3H32A 1GTWA 1ZOYC 3F5HA 1KQSZ 2B89A 3H1HD 3J81f 1Y1VI 4LLHA 3I4NI 1FE6A 4YXDC 4I7ZC 4BRYA 4PD4D 1SQXE 3IF4A 2Y0CA 2D2CD 3CC4Z 3AEDC 1YIJP 1DH3A 4JPZB 2AYDA 3OAKA 3S2DI 1JEKA 2K9JB 4I2LC 2Q9IA 5AVWB 4A3BI 5BVZA 2VF1A 2W27A 3P5JB 1NTKD 1TWAI 3W68A 4MONA 2IFNA 3GTJI 1N7LA 1KYOD 2LIYA 1VQ41 3AE1C 1IJDB 3I56P 1LTBC 3B5ND 2FKWB 1N8R2 3P8CE 5KLIB 1NYHA 3QH9A 3D6WA 1Y9BA 2I1JA 2HLOA 2K37A 1Z03A 3IR7A 4NBHA 3BCCD 4LC1A 2E74D 3ESWA 1FZCC 2E75B 3VP9A 1J2JB 2NVTI 4NPEA 3B8EB 3V2QA 5AVTB 1I3QI 2OYHA 1VQLP 2IFMA 1L0LK 3F89A 1PGJA 1JY3O 1NTZE 3CPWZ 4OGQD 4NH1C 1L0NK 4MXUA 5APUA 1T3JA 1M1KQ 1ZB9A 2P28A 3J7A4 1SQVG 3T97B 3RL0g 2LEXA 4QTTA 1H89A 5A2Qf 4A3MI 3S17I 1VQMP 2LR2A 3C9IA 2BCCJ 2RH0A 2O1JA 2K1AA 1VQ8Z 4K3AA 2WSFH 5APTA 1NTMK 1NU1J 4EI2A 5GTHH 3VMYA 1TFIA 2FFDB 4H0LB 3K5BA 1YTZT 2A06E 3USSA 2Z5HA 3P32A 4RVFA 2QEXP 5K5GB 4H13B 4W80A 1VPCA 4XFJA 1M1K1 2RT9A 1JCCA 2OTLP 3CCJ1 1RO0A 3S14I 4NBAA 2KPIA 4EOTA 3RK2B 3AE2C 3HOWI 2JA7I 3H1KG 2N9YB 3CCQP 2Q3EA 3AEEC 1CI6A 2NPSB 2K3RA 2KK7A 4EWCA 1H8AA 3H1IG 1G1JA 3CL3D 2M3EA 3HOZI 1FZFA 2E2JI 5B5EE 3MHVA 1KILC 3II6A 5CJ4A 2W8ZA 3AE9C 3CXHD 1Q86Q 1SLQA 2N1TB 1VQPZ 3G6E1 2H88C 2A45I 1RH5B 3AE8C 5KKZB 4HYTB 1RY3A 3W67A 2ZT9D 3P8CD 2FFDC 2KYVA 1VQO1 1KQSY 1S3JA 1KN7A 2JNYA 3KXDA 3FXDA 2IBZE 1RE3C 5KLVJ 5C39A 1CZQA 1PV3A 2M0BA 2YIUC 1SFOI 4S1TA 3CCSP 1ZN5A 3CME1 1M901 1JY3P 1NTZK 1VQNP 1BE3G 1VQ51 3AECC 5IT9f 2M5AA 3CQZI 3CXCY 3AEBC 2HFED 1ZMEC 2RN0A 1PP9E 4C7NA 1AFOA 2H7HA 3LW5J 5APVA 2OYOA 3HKZA 5C3EI 2XNXA 1L0ND 4NBCA 1WW9A 1IFPA 3CCR1 5APWA 1FZCA 2IBZI 5D1OB 1S9KE 4E32A 3OA7A 1OWAA 3S1QI 3HUSB 1VQM1 1S7MA 3D9XA 4IL6X 1SFCB 2QJYB 4H13D 3G71Z 2P1JA 3A0HE 4BWNA 4W7ZA 1LWUA 3HTKB 1K8A1 3NMDA 1PGOA 1FOSF 2A45H 2JA8I 2QKDA 1K8A2 3CX5I 2GTHA 1AQ5A 1Z56A 2WMMA 2KNCB 2AXTH 4R4LA 1NO4A 5B66E 1GZLA 2OYIC 2OTJP 3IF8A 2O1KA 1M7LA 4JQ0D 3L36A 2FYUJ 1GMJA 3MGNA 2ITAA 1KMIZ 1EDJA 1WIIA 4DGLA 3KPEA 1KFNA 3M0AA 2FXOA 2ZT9C 4E2XA 2KNCA 2DE6A 5IP9I 5CCGD 3M0DC 1VQ4P 3EQ2A 1BCCJ 2H8PD 1GD2E 4R4MA 3EFGA 1L4AA 3H1KJ 1HVVA 3H1IE 3ZDMA 3AEGC 2OYIB 2W83C 3LUSA 1LQLA 2QVAA 3H0GI 4HGYA 3B4SA 2K9JA 3H1KE 3MD0A 1SQQK 2YO2A 4H44B 1LTIC 2E2II 4A93I 1RF1B 1L4AC 1Q861 2CPBA 3CXHI 3M0DA 5AW2B 4E31A 4A3KI 1YHQ1 2IBZD 5CCHC 1A02J 1SQPD 1EZVE 3SFEC 4WB4A 3FWLA 1FJKA 2OYIA 4U3FD 1IZNB 1OW8A 1JM0A 2P67A 3PO2I 2KLVA 1VQ61 1YQ4C 4HKZH 3PJSK 1KILA 1K9M1 2GU2A 2QG4A 5AVZB 1SQPK 1M902 1VF5C 3HOVI 1L1OC 4I7ZB 3CI9A 2GTIA 2D2CC 3GTPI 1FZEA 2K9YA 3ITKA 1CW5A 1OW7A 3Q5PA 3H1LD 5L8RJ 1FDOA 5KAFH 2ZYGA 1VQP1 1Y1VS 2ZT9B 3VMHA 4U7JA 2KLUA 1VF5D 2EGTA 1JY2N 4Y99C 2QE7H 2WPRA 1T2KD 1JJ2Z 5AVRB 1FZAA 4BXXI 1L4AB 3MONA 3H1JD 1Q811 3Q3DA 3LIEA 1KZUB 1NU1E 2IDBA 2LKMA 3NFQA 3L73J 1GL2A 1KTMA 1EXIA 3IFUA 4NBBA 4U3FE 5AVQB 5CBOA 1W5CE 5BU8B 3JCUE 3GLMA 1S9KD 3V4QA 4AYCA 4DK1A 1M8OB 3JAMf 2NPSA 2I1KA 1QGKB 2JO1A 1RF1A 3RK2C 4MD8A 1N8R1 2L5GB 3MUDA 1SQXG 4PD4H 1U57A 4UB6E 3AE3C 1N7SC 4BXLA 3L71J 2O01J 1NAYA 4H0LC 2V8IA 1QVGY 3Q87A 5T64A 3IX0A 1IK9A 2HYNA 2YO3A 2M5AB 2RMZA 4PD4E 2QM8A 1SQBG 1TWCI 3CXCZ 1LTTC 1KILD 3IR9A 2POHA 1OVUA 1KYOH 3I56Z 1ML8A 3GTGI 3RL0C 3KQGA 3PTZA 3I07A 3I55Z 3G9RA 1LWUB 2W90A 2SPZA 3I55P 2E2HI 4IFFA 3J80b 3HE4A 1NJI2 5D1OA 1NTKE 3CC7Z 4BY7I 1SQPE 1RHZB 2P10A 3PRJA 1T2KC 2R32A 4IFMA 2C9LY 5AW1B 1PP9D 4BY1I 3GW6A 2E76C 2OOYB 3H1HJ 4NOZA 2HODB 1PFIA 3FWNA 2JWDA 2GUVA 2D2CB 3D2LA 1Q862 4QMAA 3Q2YA 3D71A 2FXPA 4LGDE 4IFDK 1YYCA 1EZVD 3CCRP 1LJ2A 2KS1B 3H1LJ 1NTKJ 4JF7A 4RESB 5KLVG 1VQN1 2P2UA 4TNUA 5KLVD 2O3JA 1P84I 1S1CX 2Q7CA 2ZJSE 4RS4A 4UB8H 4L73A 1PPJG 1USEA 1YQ3C 2BJOA 1KB9I 2AEFA 3HUSA 3S1MI 3TYYA 4HH4A 2JJLA 1K05A 3FGAD 3O6QA 3H1LE 1R5LA 2N1TD 1VQ7Z 4NFRA 1SQBJ 5CCHD 1URQB 3TDKA 1UIIA 2J59M 1WRGA 1RE4A 1K732 5T67A 1NTZD 1Y47A 1FOSE 4DZOA 1J1DC 4Z1MH 1TWFI 2OQQA 4U3FJ 3CLQA 1S72P 1W2EA 4D6TG 1A02F 1NAFA 3SFDC 3TNUB 1DX7A 1WMKA 1KD1Q 1EQ7A 2FYNC 1SVFA 2W6BA 1QF8A 2QJKC 1RQFA 4CL1A 1W2BZ 3CCU1 4NBEA 1JNMA 2IX7C 4E2ZA 2Y9YA 1M57D 3L4FA 3MZWB 3OW2Y 3BCCJ 3H6PA 1X22A 3M4OI 4I1LA 3TE5B 2QRCB 3S1NI 5AW8B 4ASVA 2BEQD 1SIWA 1NTKK 3I4MI 3GHGB 1Z02A 2IPPA 2FYNB 1VQ6Z 2V45A 2B63I 4A3EI 3EERA 3RK3E 1U7JA 2KB7P 2OGUA 2BEZF 2H43A 2WVRA 1AA6A 3GF7A 3VOPA 2FYUE 1KD12 3CC21 3CC7P 3CMA1 1EXJA 3L74J 2FYUK 2IZ0A 1CSBA 3G3ZA 4OGQB 1OIPA 3L75E 1KB9E 3J81b 4IL6E 4TT3H 1M1K2 3CC2Z 2XZRA 3O8ZA 1NKZB 1VQLZ 2E74B 5KLVE 4A3II 5H2FE 1DIPA 3H1JJ 5B5EH 2DE7A 4OWFA 3PLNA 4RVHA 3M3YI 2NPSC 3L75G 2Q4ZA 1VQ5Z 3L74E 1URQD 5FLXb 1SFCA 3L73E 1GU4A 1S5LE 3AE6C 1JMMA 1KC81 1H0TA 1LTJB 1J1EB 2ZYDA 4W7YA 1Y1WI 3RK3D 1KQFB 3CCM1 2W03A 1Q81Q 1SP4A 2RIQA 1BCCE 2VPZA 2H85A 3VMIA 1BE3D 3OW2O 1QVGZ 3FXEA 1KORA 4EYYQ 3GF3A 1YI2P 3FQQA 3HUSC 2E5YA 3HE4B 3F3PC 3RK3B 3HD7D 1KB9D 5AVVB 1JTHA 2G2KA 2F4MA 5CBNA 3LIDA 3HD7B 1JUNA 2XDJA 1LNQA 2C0WA 2YMYA 4H44C 1NTMJ 2GM4A 2LXCB 1WT6A 2QA4Z 3BVHA 1W2BY 3CWBG 3KIHA 2E5TA 4XE5B 1ZRTE 4PJ0E 3OW2Z 3CD6Z 3H1ID 3CCVP 2WQYC 4D6TD 2OTJ1 3M9HA 3U50C 3CX5E 4BBSI 3L37A 3SWYA 1NUIA 1YJWP 4C46A 4AUWA 1BSHA 3H1LG 3S2HI 5AW3B 3JAMb 3LW5H 3H1KD 4PJ0H 3R4YA 3RGUA 3H32B 2R3CA 2KOGA 1VQ6P 1HGVA 1PPJE 1KRLA 4Y52I 1GDTA 1WCMI 3V4WA 5KLVK 1LGHB 1M1JC 5KJ7C 5DJTB 5AW9B 3U1AA 5GTIE 1JOCA 4C7NB 1YHQP 1Z01A 1VQNZ 2WT7B 3VB9A 1GL2D 1MUUA 3NH8A 3L35A 2J58A 1HTLC 2XKMA 4GDOA 5APYA 2W6AA 5AW4B 1Y8CA 5GTIH 2Z4EA 1BE3J 1SQVD 3CCS1 2AXCA 1N7SA 1N2FA 2W04A 1L0LE 3HD7A 2PAJA 1NJI1 1LTAC 3R2PA 1RF1C 1AJYA 4WY4A 1Y8AA 1HUCA 2R5BA 2WITA 2E75C 1I6HI 3L71G 1YITP 1NTME 3BG0B 2CK3H 2P3YA 1EZVI 4WY4B 4JYCA 1QVGO 1QL1A 3HOUI 2Y0DA 1OW6A 3S1KA 1YIT1 2KZIA 1PGQA 3AE7C 3CCLZ 3L70G 4E2WA 1HJ0A 2FYZA 1MFTA 3U1CA 2KSJA 3G6EZ 2M3BA 2PRRA 4KJMA 1SQXK 3CMEZ 2B87B 1JMBA 3AEAC 4HB1A 1QVFY 3JC22 1D7MA 4ZMDA 2FYUG 3B5NA 2PMZA 1ZLLA 4XA4A 3NTNA 1RQUA 5T6BA 5KAFE 1SQVK 2JDIH 1IFNA 1USDA 4WWIA 1N86A 1GL2C 3KYQA 1LT9B 3TGUJ 5AW0B 3GHGA 4Y28J 2ZXEB 2R7ZI 4QTUA 4U3FG 1ZR4A 1KV4A 3S16I 1AVOA 4TLFA 2WSSH 2QA41 2QSIA 2LXBA 3PHLA 1EC5A 4GODA 2JS4A 1KC8Q 4DT0A 5AN9F 3V2NA 1X9VA 1YUKA 4PV1B 3L71D 5TJHA 4OH8B 2PM9A 1KILB 1VQOZ 1L0LJ 2WPVB 1BDCA 1RNIA 1R9TI 3VN0A 3CXHH 3S4RA 3RL0B 1YJW1 1FDMA 2Z5IA 1FDIA 1FJPA 2FBWC 1FBMA 1QX8A 2JUBA 2I8DA 3E7KA 4IOIH 3I5CA 3TF5A 1IFMA 3NXSA 4GOFA 2P7JA 1VQL1 2E7ZA 5IP7I 3G6EP 1UIXA 3M06A 2JIPA 3BG1B 2A06D 3CXHE 1NU1D 4NPFX 3CCLP 1URQC 4GOEA 2V4HA 1L0LD 1KILE 2ZFCA 4YPCA 1JJ2Y 3L74G 5CCGC 1U7MA 1EZVG 1IFDA 5IT9b 1L2PA 1NOHA 2JR6A 1SQPJ 1YIJZ 1BE3E 3O6QB 1EDLA 1KYOE 5BU5A 3AE5C 2O01H 3T97A 3GMAA 3WMM0 5AVSB 1KD11 2F4OA 3A0BH 1PZQA
chains in the Genus database with same CATH topology
4ASWA 2KPIA 1Q822 3TDHB 4JBZA 4A3FI 2J6AA 3HOWI 3NH5A 2JA7I 1K732 2K3RA 3T4NB 5T67A 1Y47A 2QEXZ 3RZDI 1TWFI 2K5RA 1YIJ1 4EWCA 1YJN1 4RV9A 3PO3S 1QVFZ 2DE5A 2QRDB 3HOZI 1YITZ 2E2JI 3CCJZ 1QF8A 1RQFA 3CC71 4CL1A 1W2BZ 2LFUA 3CCU1 1H0TB 4NBEA 5LL6f 3MHVA 2Q51A 4NB9A 2NVYI 1NP6A 1TWGI 2QEX1 4A3LI 4E2ZA 1VQPZ 3G6E1 3MZWB 3OW2Y 3G711 1K731 4NBGA 3M4OI 2M48A 1VQKZ 1Q2NA 3TE5B 4K35A 2QRCB 3S1NI 1OVRA 4ASVA 3FKII 2VUMI 1VQO1 1KQSY 5C44I 3I4MI 1S3JA 1Z02A 2E9HA 2JNYA 4MRIA 1VQ6Z 3CC41 2B63I 4A3EI 3FXDA 3CCUZ 3EERA 4HJGH 3VMGA 4RVDA 1U7JA 5C39A 2M0BA 1SFOI 4S1TA 4A3GI 1KD12 3CD61 3CC21 3CME1 5FLXf 3CMA1 1RLYA 1M901 3GCFA 1BDDA 2OTKE 1Q821 1VQ51 5IT9f 2M5AA 3NDIA 3CQZI 3CXCY 1VQ81 3J81b 3NFZA 2HF1A 1OVVA 1M1K2 2AKLA 3CC2Z 1LP1B 1VQLZ 1VLAA 1X3ZA 1YI21 3HKZA 3GTQI 5C3EI 4E2YA 3S15I 4A3II 3I561 4NBCA 3EEDA 3H3VJ 4A3DI 1WW9A 2RHBA 3M3YI 2DE7A 4RVHA 3CCR1 2Q4ZA 1VQ5Z 2P58A 5FLXb 5D1OB 4E32A 1RO2A 1LP1A 3CCL1 3S1QI 1FC2C 4A3JI 1VQM1 1KC81 3GTOI 1YJWZ 1S7MA 1VQ91 2M6NA 3D9XA 5A2Qb 2NVXI 1H0TA 1QYPA 4Y7NI 3G71Z 1Y1WI 1LT1A 1X3WA 2WB1A 3CCM1 2B87A 2W03A 2Y0SA 1K8A1 4MD7A 1YJNZ 2RIQA 2RKLA 2H85A 3VMIA 1YUAA 2IZ4A 1QVGZ 3FXEA 4NBDA 2JA8I 2QKDA 1K8A2 4EYYQ 2GTHA 2WMMA 4A3CI 4NB8A 3FQQA 2Q1KA 3F3PC 3IF8A 5DJUB 2G2KA 2F4MA 4MD9A 1EDJA 5CBNA 1WIIA 4DGLA 3RZOI 3CCMZ 3GKQA 4E2XA 2DE6A 5C4XI 5IP9I 3I551 3NH4A 1YJ9Z 2LXCB 1NVOA 2QA4Z 3CCV1 1DEEG 3ZDMA 4BBRI 3KIHA 1W2BY 3GTMI 2O4HA 3LUSA 1LQLA 3OW2Z 2QVAA 3H0GI 3CD6Z 4HGYA 2JA6I 3QWOC 2OTJ1 3U50C 1VQ71 4BBSI 1NUIA 1ZH1A 3CCE1 2E2II 4A93I 3CCSZ 3VTNA 4XX2A 1JWHC 2QLVB 3K7AI 3S2HI 1Q861 3JAMb 1SS1A 1S721 1K9M2 2KZJA 3G4SZ 3RGUA 3GTLI 1YHQZ 3PO3I 4A3KI 4E31A 1YHQ1 1EDIA 1USPA 4MH4A 2PK7A 2OZKA 4E30A 2YADA 1KRLA 1YJ91 4Y52I 1ZB8A 1WCMI 4HGZA 1ZXGA 1JM0A 2KIKA 5DJTB 3HOXI 3PO2I 1VQ61 1Z01A 2R44A 4HKZH 4CPGA 1VQNZ 1VQ9Z 1K9M1 2GU2A 3NDJA 3VB9A 4X6AI 2JMOA 3NH8A 3QWUA 2I3CA 1M902 3HOVI 1L1OC 3CPWY 2NVQI 2GTIA 2OTL1 3GTPI 1S72Z 3CCS1 1X0TA 1N2FA 2HR3A 2RBLA 2W04A 1VQP1 3F3FC 1NJI1 1Y1VS 3VMHA 2IZ3A 2QR1B 3KIFA 2EGTA 3J80f 1Q7Y1 1I50I 3FQMA 3S1RI 3CCQZ 2WAQA 2V8KA 1JJ2Z 4BXXI 3MONA 3MZKB 1Q811 1VQ4Z 1Q7Y2 3GTMS 3GTKI 2R92I 4E33A 4NBFA 3MZLB 1I6HI 2OTLZ 3IFUA 3PH0A 4NBBA 4NPDA 3BG0B 2P3YA 3CCVZ 5CBOA 5EFWB 1K83I 4ZNCA 4MN4C 3HOUI 3CCQ1 2HU9A 4DK1A 2KUBA 3S1KA 3JAMf 1YIT1 2KZIA 2O53A 1VQMZ 2UWJE 3CCLZ 4MD8A 1KQSZ 2B89A 1N8R1 4E2WA 1MFTA 3J81f 1USPB 1Y1VI 3CMEZ 3G6EZ 4KJMA 3I4NI 2B87B 1JMBA 4BXLA 2KI7B 4HB1A 1QVFY 2OOXB 4ZMDA 2PMZA 2V8IA 2ZAEB 1QVGY 3Q87A 2RPRA 5T64A 2VUGA 3IX0A 3CC4Z 5T6BA 2M5AB 3CCEZ 3S2DI 2R6MA 1TWCI 3CXCZ 5D1PA 4A3BI 1DL6A 4WWIA 1RO4A 2VF1A 3P5JB 2QRXA 1OVUA 1TWAI 2R7ZI 4QTUA 1VQK1 4MONA 3I56Z 3GTJI 1ML8A 3GTGI 3S16I 2LIYA 3I07A 3CCRZ 3I55Z 1VQ41 2QA41 2SPZA 2E2HI 2LXBA 3J80b 1N8R2 1NJI2 1TWHI 5D1OA 1EC5A 4GODA 3D6WA 2JS4A 5AN9F 3CC7Z 4AYBA 4BY7I 4DQYB 1KC82 1YUKA 2JA5I 1Z03A 2PM9A 4BY1I 5CM2M 5FLMI 1VQOZ 4NBHA 2R93I 1BDCA 1RNIA 3ESWA 3G4S1 1R9TI 2NVTI 4NPEA 2QREB 2OOYB 4NOZA 1I3QI 1YJW1 1EDKA 2JWDA 3CPWZ 4RVGA 1Q862 2JUBA 2I8DA 4NH1C 4IOIH 5C4JI 4MXUA 4GOFA 1ZB9A 2KS1B 1VQL1 2P28A 1YI2Z 3J7A4 5IP7I 4QTTA 1ZW0A 3BG1B 5A2Qf 4A3MI 3S17I 1VQN1 4TNUA 2LR2A 4NPFX 4GOEA 1VQ8Z 4K3AA 3HOYI 4RS4A 1JJ2Y 2B88A 1TFIA 2YU9I 1U7MA 5IT9b 2JR6A 2BJOA 1YIJZ 1EDLA 3S1MI 4RVFA 5K5GB 2V8JA 1PFTA 4HH4A 3CMAZ 1P9NA 2RT9A 1M1K1 1KD11 2F4OA 3CCJ1 2OTJZ 1Q812 1VQ7Z 1RO0A 4NFRA 3S14I 4NBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P58 A;  4ASW A;  4JBZ A;  2M5A B;  1ZXG A;  1JM0 A;  1LP1 A;  1FC2 C;  2KIK A;  5DJT B;  2K3R A;  4WWI A;  1H0T A;  2R44 A;  1Y47 A;  4HKZ H;  4CPG A;  1LT1 A;  2B87 A;  2QRX A;  1OVU A;  2RKL A;  3FXE A;  2SPZ A;  2LXB A;  4EYY Q;  1H0T B;  3MHV A;  1EC5 A;  2WMM A;  4GOD A;  1X0T A;  2HR3 A;  2Q1K A;  3MZW B;  5DJU B;  1Q2N A;  1EDJ A;  5CBN A;  4K35 A;  1OVR A;  1BDC A;  4ASV A;  4NPE A;  1S3J A;  1EDK A;  2JWD A;  3FXD A;  2LXC B;  4HJG H;  1NVO A;  1U7J A;  2I8D A;  3PH0 A;  4IOI H;  1DEE G;  5C39 A;  3ZDM A;  2M0B A;  4NPD A;  4GOF A;  2KS1 B;  5CBO A;  5EFW B;  1ZW0 A;  4ZNC A;  2QVA A;  4MN4 C;  1BDD A;  2KUB A;  2LR2 A;  4NPF X;  3S1K A;  2OTK E;  4GOE A;  4K3A A;  2KZI A;  2M5A A;  3QWO C;  2B88 A;  2UWJ E;  1U7M A;  2B89 A;  1OVV A;  1MFT A;  1SS1 A;  1EDL A;  2KZJ A;  4KJM A;  1LP1 B;  2B87 B;  1JMB A;  4BXL A;  5K5G B;  2KI7 B;  4HB1 A;  3RGU A;  4ZMD A;  1EDI A;  2ZAE B; 
#chains in the Genus database with same CATH topology
 1LT9 C;  2IBZ G;  1Q82 2;  3TDH B;  4JBZ A;  3V2R A;  2K88 A;  4A3F I;  1VDF A;  3NH5 A;  3BCC E;  3N4X A;  2ZXX A;  3U59 A;  4I6M C;  3IFM A;  2QEX Z;  3RZD I;  2K5R A;  1YIJ 1;  2YMK A;  1IFJ A;  3ABV C;  1NTK G;  4GKG A;  3BRT B;  1YIT Z;  1XTG B;  3CCJ Z;  2LFU A;  5LL6 f;  2E76 D;  3A3Y B;  2JEE A;  2NVY I;  5GTH E;  3PP5 A;  2QEX 1;  4UB8 E;  3CX5 H;  5APS A;  1MZ9 A;  1JO5 A;  3G71 1;  4NBG A;  2M48 A;  1VQK Z;  4K35 A;  1OVR A;  5E79 H;  4WBA A;  3CMA P;  2QJP B;  1SQB E;  1BGY J;  3CC2 P;  1LWU C;  1Q7Y Q;  3CCU Z;  3VMG A;  1S2E A;  2BCC D;  4L76 A;  1LTS C;  5M1B A;  2BCC G;  1NKN A;  3WUT A;  4A3G I;  3A0B E;  4PV1 C;  5E79 E;  5FLX f;  1RLY A;  3OJA B;  3GCF A;  3Q5S A;  2YKO A;  1JTH B;  1L0N E;  4H44 D;  2HPC B;  1VQ8 1;  1R5S A;  3NFZ A;  1FU1 A;  3MUD C;  1E79 H;  1G1I A;  1LP1 B;  1VLA A;  1YI2 1;  4DJG A;  4E2Y A;  3S15 I;  1T6A A;  2NPS D;  3I56 1;  4A3D I;  2RHB A;  1YJ9 P;  1QVF O;  1M56 D;  1L0N G;  4DCK A;  2QIW A;  1LTJ A;  1LP1 A;  3CCM P;  3CCL 1;  1SQB D;  4A3J I;  2V7Q J;  4KT0 J;  3WU2 E;  3RK3 C;  4HH2 A;  2WTY A;  1QYP A;  1RF0 C;  1LT1 A;  5CCG A;  1JY3 N;  2B87 A;  4GT1 A;  2E74 C;  5H2F H;  2Y0S A;  2N1T A;  3H25 A;  4MD7 A;  3M9Q A;  4H0L D;  3L70 J;  1BSN A;  1VQ8 P;  1QLE D;  1YUA A;  2N1T C;  2IZ4 A;  1RF0 A;  1NHL A;  1FZG A;  4A3C I;  4N78 E;  4NB8 A;  3L70 D;  1W2B O;  5KJ7 D;  2Q1K A;  4IL6 H;  3VTP C;  1LTJ C;  2C0X A;  1SQP G;  2VPW A;  2XU6 A;  3GKQ A;  2KSE A;  2KP8 A;  5APQ A;  4Y99 B;  1NVO A;  3V2P A;  4BBR I;  5TIS H;  2JIR A;  1SQB K;  2O4H A;  3H1H E;  3H1J G;  2M8R A;  1IK7 A;  2IYP A;  2HPC A;  1WZN A;  2WSC H;  4L74 A;  1GW3 A;  3B5N B;  3VMX A;  2Y9Z A;  3GHG C;  1GK4 A;  1S4X A;  2YNY A;  2AEM A;  4BRY B;  2WPS A;  3CCS Z;  3VTN A;  4M3L A;  1N73 B;  3K7A I;  1VQ5 P;  1SS1 A;  1K9M 2;  1VQ9 P;  2G3A A;  1YTZ I;  2GA1 A;  5B66 H;  1RQV A;  3CCU P;  1YHQ Z;  3GTL I;  1EDI A;  1VF5 B;  1DD3 A;  1AA0 A;  1LT9 A;  1USP A;  1MKM A;  2OAR A;  4E30 A;  3L71 E;  3V6I A;  1J1E C;  4KHX A;  1P84 E;  2V7Q H;  2KIK A;  3HOX I;  2JKV A;  3HD7 C;  3P7K A;  3CME P;  1HF9 A;  2R44 A;  3N7N A;  2O01 N;  3NDJ A;  1SQX J;  4X6A I;  2JMO A;  3QWU A;  2I3C A;  5CCH A;  1L0L G;  2YXQ B;  1Q16 A;  2Q5U A;  2E76 B;  1GW4 A;  3CPW Y;  3RBX A;  5AVX B;  3VMA A;  1P84 H;  1NU1 G;  3CD6 P;  1FZB A;  1NWQ A;  2N9B A;  2WPQ A;  1X0T A;  2RBL A;  3KZI E;  1SQV J;  3F3F C;  2VPY A;  3D6Y A;  2IZ3 A;  2QR1 B;  3KIF A;  3L75 D;  1M1J A;  1Q7Y 1;  3FQM A;  1JCD A;  2WAQ A;  3TSI A;  1TU3 F;  2V8K A;  1VL2 A;  4L75 A;  3RK2 D;  4ZKU A;  4WVZ A;  1Q7Y 2;  3GTM S;  3GTK I;  1BGY D;  2H89 C;  3MZL B;  2JIM A;  3PH0 A;  2YKQ A;  1RE3 A;  4NPD A;  3BAT A;  1H88 A;  1JY2 O;  1K83 I;  2FY8 A;  2R3S A;  4ZNC A;  3UIA A;  1FS0 E;  4MN4 C;  1MFZ A;  3CCQ 1;  5KTB A;  5CJ0 A;  2KUB A;  2JR8 A;  1HJB A;  2FFD A;  1OFC X;  3D70 A;  1KQL A;  2O53 A;  1VQM Z;  3D6Z A;  3RBZ A;  2OYH B;  3IAO A;  2UWJ E;  4ZKP A;  1YJN P;  2KS1 A;  1CI6 B;  2PFX A;  1GL2 B;  1USP B;  4AQR D;  3GG2 A;  1K73 Q;  3L72 E;  2KI7 B;  2J5U A;  2OOX B;  3HE5 A;  2ZAE B;  2RPR A;  1S5L X;  3B71 A;  4EIJ A;  2VUG A;  3AE4 C;  1ZV8 A;  3RL0 D;  3CCE Z;  3KZI H;  1NTZ J;  3V5B A;  1OX3 A;  2KXP B;  2R6M A;  5CHX A;  5D1P A;  3MP7 B;  1DL6 A;  3H1J E;  3H1H G;  1RO4 A;  2JP3 A;  2E42 A;  2QRX A;  1NTM D;  1VQK 1;  1URQ A;  3TGU D;  3VP8 A;  1SFC D;  3CCR Z;  2HG5 D;  3EWK A;  4D6T J;  1PP9 J;  1TWH I;  2R5D A;  4AYB A;  4DQY B;  1KC8 2;  2E75 D;  2JA5 I;  5CM2 M;  2AEJ A;  5FLM I;  4RJT A;  1JY2 P;  1OZH A;  2R93 I;  4PV1 D;  2W6J H;  2XND H;  3G4S 1;  1Q90 D;  1OMI A;  1J1D B;  3CC4 P;  2QRE B;  4OGQ C;  3L73 G;  1EDK A;  4B86 A;  3Q1M A;  4RVG A;  2WSE H;  5APX A;  2QJP C;  4N3Y B;  5C4J I;  2WSE J;  1YI2 Z;  3WU2 H;  1ZW0 A;  2OYH C;  1BGY E;  2A06 G;  1PL5 A;  3HOY I;  5KKZ C;  1R8E A;  1HWT C;  1N2D C;  2B88 A;  2YU9 I;  3L72 J;  2WWW A;  3EFF K;  1HBW A;  4GIF A;  2V8J A;  3HTK A;  5KJ7 A;  1K9M Q;  1PFT A;  1SQV E;  1N7S D;  2YKP A;  1P9N A;  3CMA Z;  2PP6 A;  1G2C B;  4WY4 C;  2YIU B;  3JSV C;  1VQK P;  2OTJ Z;  1Q81 2;  1PP9 G;  1SQQ J;  4ASW A;  1VQP P;  1NTZ G;  2J6A A;  1IFI A;  4O9B A;  3T4N B;  2VRS A;  2NZ2 A;  1QXF A;  1KFM A;  3C8V A;  1YJN 1;  4RV9 A;  2BCC E;  5KLI C;  3CWB E;  3PO3 S;  3G71 P;  1QVF Z;  2DE5 A;  2E43 A;  2QRD B;  3E1R A;  1NH4 A;  2VPX A;  3CC7 1;  3C1L A;  3BAS A;  1H0T B;  2Q51 A;  4NB9 A;  1SQQ D;  1NP6 A;  1TWG I;  4A3L I;  2Y0E A;  2ZYA A;  1PIX A;  3L74 D;  3CPW O;  2XV5 A;  2B9B A;  1K73 1;  2JIO A;  2MJZ A;  2IYO A;  1AV1 A;  1Q2N A;  1Q82 Q;  3SWK A;  1ZR2 A;  1NU1 K;  3SWF A;  1N73 A;  3FKI I;  2VUM I;  3B5N C;  2JIQ A;  2FYU D;  3TNU A;  5C44 I;  1X79 B;  1S5L H;  2CPS A;  2E9H A;  4MRI A;  3CC4 1;  2QJK B;  1BCC G;  4HJG H;  3G4S P;  4RVD A;  2WZ7 A;  3M9B A;  1E5W A;  2IZ1 A;  3A0H H;  3L73 D;  3CD6 1;  2MKV A;  1MV8 A;  3TK1 A;  3BCC G;  1LTG C;  1BDD A;  4YTP C;  3WUV A;  4N6J A;  2OTK E;  3P8M C;  1Q82 1;  1DD4 A;  3NDI A;  2BAS A;  1KQG B;  2AXT E;  1YBK A;  3H1I J;  2HF1 A;  1AQT A;  1OVV A;  3TGU E;  3FX0 A;  2AKL A;  1BGY G;  1G2C A;  2NAP A;  2L91 A;  1K8A Q;  3IN6 A;  1X3Z A;  1RE4 C;  2QM7 A;  1SQQ E;  1SQQ G;  3GTQ I;  3HRN A;  3TGU G;  3EED A;  3H3V J;  1NTM G;  2DW3 A;  3CCE P;  1QEX A;  1VQ7 P;  1M90 Q;  2P58 A;  3HE5 B;  1HGZ A;  1RO2 A;  3M91 A;  3MIW A;  1XTC C;  1FC2 C;  1NGM B;  3GTO I;  1T3U A;  1YJW Z;  1VQ9 1;  3Q5R A;  2PGD A;  2M6N A;  5A2Q b;  2NVX I;  4Y7N I;  1DEB A;  1X3W A;  2HOD A;  2WB1 A;  4H13 C;  1JB0 J;  2Q6Q A;  2WSF J;  1YJN Z;  2RKL A;  2Q3I A;  4NBD A;  5AW5 B;  3CWB J;  4C7R A;  1SQX D;  2ZVO B;  5AW7 B;  2QA4 P;  3AEF C;  3VYI A;  5AVY B;  1BCC D;  5DJU B;  1SFC C;  2QJY C;  4MD9 A;  4RKU J;  5CMZ A;  3RZO I;  3CCM Z;  3KHU A;  1ZRT D;  5C4X I;  3I55 1;  1ZP0 C;  3BRV B;  3NH4 A;  1YJ9 Z;  1AVY A;  3A2A A;  3E1I A;  3WUU A;  1IC2 A;  3CCV 1;  1DEE G;  4D6T E;  3GTM I;  2WSC J;  4WY4 D;  3L72 G;  1KYO I;  2GUS A;  2JWA A;  2JA6 I;  3QWO C;  3MTU E;  1M1J B;  1VQ7 1;  1ZH1 A;  3CWB D;  3CCE 1;  1OXZ A;  5TIS E;  4XX2 A;  1JWH C;  2QLV B;  1S72 1;  1X8Y A;  2KZJ A;  1HH0 A;  2WT7 A;  3L75 J;  2G8Y A;  3G4S Z;  4N78 D;  3PO3 I;  1VQO P;  4MH4 A;  1WJ2 A;  2PK7 A;  2OZK A;  3L70 E;  4A7P A;  2YAD A;  1YJ9 1;  4PD4 I;  1L0N J;  3SSU A;  1ZB8 A;  4HGZ A;  1ZXG A;  4OVN F;  1GK6 A;  3S9O A;  1NJI Q;  2A45 G;  3VMZ A;  4CPG A;  1PPJ D;  1VQ9 Z;  3KDP B;  1FZC B;  3A7O A;  3CX5 D;  1P84 D;  1FAV A;  4EDF A;  3CCJ P;  1KB9 H;  1IO4 A;  2C9N Y;  2NVQ I;  2OTL 1;  1S72 Z;  2V3V A;  2NRG A;  5AVU B;  2HR3 A;  4UB6 H;  1KQS O;  4JYB A;  3J80 f;  1I50 I;  5KAI E;  3S1R I;  3CCQ Z;  1GU5 A;  3JCU H;  2FXM A;  3L72 D;  3MZK B;  1PGP A;  1N8R Q;  1VQ4 Z;  5AW6 B;  1QL2 A;  1L4A D;  3A5T A;  4E33 A;  4NBF A;  2R92 I;  1K04 A;  2OTL Z;  2ZVN B;  1T8Z A;  1N7S B;  2YXR B;  4YXW H;  3CCV Z;  5KAI H;  5EFW B;  4DOJ A;  4RO0 A;  2HU9 A;  1N73 C;  2IV2 X;  3H32 A;  1GTW A;  1ZOY C;  3F5H A;  1KQS Z;  2B89 A;  3H1H D;  3J81 f;  1Y1V I;  4LLH A;  3I4N I;  1FE6 A;  4YXD C;  4I7Z C;  4BRY A;  4PD4 D;  1SQX E;  3IF4 A;  2Y0C A;  2D2C D;  3CC4 Z;  3AED C;  1YIJ P;  1DH3 A;  4JPZ B;  2AYD A;  3OAK A;  3S2D I;  1JEK A;  2K9J B;  4I2L C;  2Q9I A;  5AVW B;  4A3B I;  5BVZ A;  2VF1 A;  2W27 A;  3P5J B;  1NTK D;  1TWA I;  3W68 A;  4MON A;  2IFN A;  3GTJ I;  1N7L A;  1KYO D;  2LIY A;  1VQ4 1;  3AE1 C;  1IJD B;  3I56 P;  1LTB C;  3B5N D;  2FKW B;  1N8R 2;  3P8C E;  5KLI B;  1NYH A;  3QH9 A;  3D6W A;  1Y9B A;  2I1J A;  2HLO A;  2K37 A;  1Z03 A;  3IR7 A;  4NBH A;  3BCC D;  4LC1 A;  2E74 D;  3ESW A;  1FZC C;  2E75 B;  3VP9 A;  1J2J B;  2NVT I;  4NPE A;  3B8E B;  3V2Q A;  5AVT B;  1I3Q I;  2OYH A;  1VQL P;  2IFM A;  1L0L K;  3F89 A;  1PGJ A;  1JY3 O;  1NTZ E;  3CPW Z;  4OGQ D;  4NH1 C;  1L0N K;  4MXU A;  5APU A;  1T3J A;  1M1K Q;  1ZB9 A;  2P28 A;  3J7A 4;  1SQV G;  3T97 B;  3RL0 g;  2LEX A;  4QTT A;  1H89 A;  5A2Q f;  4A3M I;  3S17 I;  1VQM P;  2LR2 A;  3C9I A;  2BCC J;  2RH0 A;  2O1J A;  2K1A A;  1VQ8 Z;  4K3A A;  2WSF H;  5APT A;  1NTM K;  1NU1 J;  4EI2 A;  5GTH H;  3VMY A;  1TFI A;  2FFD B;  4H0L B;  3K5B A;  1YTZ T;  2A06 E;  3USS A;  2Z5H A;  3P32 A;  4RVF A;  2QEX P;  5K5G B;  4H13 B;  4W80 A;  1VPC A;  4XFJ A;  1M1K 1;  2RT9 A;  1JCC A;  2OTL P;  3CCJ 1;  1RO0 A;  3S14 I;  4NBA A;  2KPI A;  4EOT A;  3RK2 B;  3AE2 C;  3HOW I;  2JA7 I;  3H1K G;  2N9Y B;  3CCQ P;  2Q3E A;  3AEE C;  1CI6 A;  2NPS B;  2K3R A;  2KK7 A;  4EWC A;  1H8A A;  3H1I G;  1G1J A;  3CL3 D;  2M3E A;  3HOZ I;  1FZF A;  2E2J I;  5B5E E;  3MHV A;  1KIL C;  3II6 A;  5CJ4 A;  2W8Z A;  3AE9 C;  3CXH D;  1Q86 Q;  1SLQ A;  2N1T B;  1VQP Z;  3G6E 1;  2H88 C;  2A45 I;  1RH5 B;  3AE8 C;  5KKZ B;  4HYT B;  1RY3 A;  3W67 A;  2ZT9 D;  3P8C D;  2FFD C;  2KYV A;  1VQO 1;  1KQS Y;  1S3J A;  1KN7 A;  2JNY A;  3KXD A;  3FXD A;  2IBZ E;  1RE3 C;  5KLV J;  5C39 A;  1CZQ A;  1PV3 A;  2M0B A;  2YIU C;  1SFO I;  4S1T A;  3CCS P;  1ZN5 A;  3CME 1;  1M90 1;  1JY3 P;  1NTZ K;  1VQN P;  1BE3 G;  1VQ5 1;  3AEC C;  5IT9 f;  2M5A A;  3CQZ I;  3CXC Y;  3AEB C;  2HFE D;  1ZME C;  2RN0 A;  1PP9 E;  4C7N A;  1AFO A;  2H7H A;  3LW5 J;  5APV A;  2OYO A;  3HKZ A;  5C3E I;  2XNX A;  1L0N D;  4NBC A;  1WW9 A;  1IFP A;  3CCR 1;  5APW A;  1FZC A;  2IBZ I;  5D1O B;  1S9K E;  4E32 A;  3OA7 A;  1OWA A;  3S1Q I;  3HUS B;  1VQM 1;  1S7M A;  3D9X A;  4IL6 X;  1SFC B;  2QJY B;  4H13 D;  3G71 Z;  2P1J A;  3A0H E;  4BWN A;  4W7Z A;  1LWU A;  3HTK B;  1K8A 1;  3NMD A;  1PGO A;  1FOS F;  2A45 H;  2JA8 I;  2QKD A;  1K8A 2;  3CX5 I;  2GTH A;  1AQ5 A;  1Z56 A;  2WMM A;  2KNC B;  2AXT H;  4R4L A;  1NO4 A;  5B66 E;  1GZL A;  2OYI C;  2OTJ P;  3IF8 A;  2O1K A;  1M7L A;  4JQ0 D;  3L36 A;  2FYU J;  1GMJ A;  3MGN A;  2ITA A;  1KMI Z;  1EDJ A;  1WII A;  4DGL A;  3KPE A;  1KFN A;  3M0A A;  2FXO A;  2ZT9 C;  4E2X A;  2KNC A;  2DE6 A;  5IP9 I;  5CCG D;  3M0D C;  1VQ4 P;  3EQ2 A;  1BCC J;  2H8P D;  1GD2 E;  4R4M A;  3EFG A;  1L4A A;  3H1K J;  1HVV A;  3H1I E;  3ZDM A;  3AEG C;  2OYI B;  2W83 C;  3LUS A;  1LQL A;  2QVA A;  3H0G I;  4HGY A;  3B4S A;  2K9J A;  3H1K E;  3MD0 A;  1SQQ K;  2YO2 A;  4H44 B;  1LTI C;  2E2I I;  4A93 I;  1RF1 B;  1L4A C;  1Q86 1;  2CPB A;  3CXH I;  3M0D A;  5AW2 B;  4E31 A;  4A3K I;  1YHQ 1;  2IBZ D;  5CCH C;  1A02 J;  1SQP D;  1EZV E;  3SFE C;  4WB4 A;  3FWL A;  1FJK A;  2OYI A;  4U3F D;  1IZN B;  1OW8 A;  1JM0 A;  2P67 A;  3PO2 I;  2KLV A;  1VQ6 1;  1YQ4 C;  4HKZ H;  3PJS K;  1KIL A;  1K9M 1;  2GU2 A;  2QG4 A;  5AVZ B;  1SQP K;  1M90 2;  1VF5 C;  3HOV I;  1L1O C;  4I7Z B;  3CI9 A;  2GTI A;  2D2C C;  3GTP I;  1FZE A;  2K9Y A;  3ITK A;  1CW5 A;  1OW7 A;  3Q5P A;  3H1L D;  5L8R J;  1FDO A;  5KAF H;  2ZYG A;  1VQP 1;  1Y1V S;  2ZT9 B;  3VMH A;  4U7J A;  2KLU A;  1VF5 D;  2EGT A;  1JY2 N;  4Y99 C;  2QE7 H;  2WPR A;  1T2K D;  1JJ2 Z;  5AVR B;  1FZA A;  4BXX I;  1L4A B;  3MON A;  3H1J D;  1Q81 1;  3Q3D A;  3LIE A;  1KZU B;  1NU1 E;  2IDB A;  2LKM A;  3NFQ A;  3L73 J;  1GL2 A;  1KTM A;  1EXI A;  3IFU A;  4NBB A;  4U3F E;  5AVQ B;  5CBO A;  1W5C E;  5BU8 B;  3JCU E;  3GLM A;  1S9K D;  3V4Q A;  4AYC A;  4DK1 A;  1M8O B;  3JAM f;  2NPS A;  2I1K A;  1QGK B;  2JO1 A;  1RF1 A;  3RK2 C;  4MD8 A;  1N8R 1;  2L5G B;  3MUD A;  1SQX G;  4PD4 H;  1U57 A;  4UB6 E;  3AE3 C;  1N7S C;  4BXL A;  3L71 J;  2O01 J;  1NAY A;  4H0L C;  2V8I A;  1QVG Y;  3Q87 A;  5T64 A;  3IX0 A;  1IK9 A;  2HYN A;  2YO3 A;  2M5A B;  2RMZ A;  4PD4 E;  2QM8 A;  1SQB G;  1TWC I;  3CXC Z;  1LTT C;  1KIL D;  3IR9 A;  2POH A;  1OVU A;  1KYO H;  3I56 Z;  1ML8 A;  3GTG I;  3RL0 C;  3KQG A;  3PTZ A;  3I07 A;  3I55 Z;  3G9R A;  1LWU B;  2W90 A;  2SPZ A;  3I55 P;  2E2H I;  4IFF A;  3J80 b;  3HE4 A;  1NJI 2;  5D1O A;  1NTK E;  3CC7 Z;  4BY7 I;  1SQP E;  1RHZ B;  2P10 A;  3PRJ A;  1T2K C;  2R32 A;  4IFM A;  2C9L Y;  5AW1 B;  1PP9 D;  4BY1 I;  3GW6 A;  2E76 C;  2OOY B;  3H1H J;  4NOZ A;  2HOD B;  1PFI A;  3FWN A;  2JWD A;  2GUV A;  2D2C B;  3D2L A;  1Q86 2;  4QMA A;  3Q2Y A;  3D71 A;  2FXP A;  4LGD E;  4IFD K;  1YYC A;  1EZV D;  3CCR P;  1LJ2 A;  2KS1 B;  3H1L J;  1NTK J;  4JF7 A;  4RES B;  5KLV G;  1VQN 1;  2P2U A;  4TNU A;  5KLV D;  2O3J A;  1P84 I;  1S1C X;  2Q7C A;  2ZJS E;  4RS4 A;  4UB8 H;  4L73 A;  1PPJ G;  1USE A;  1YQ3 C;  2BJO A;  1KB9 I;  2AEF A;  3HUS A;  3S1M I;  3TYY A;  4HH4 A;  2JJL A;  1K05 A;  3FGA D;  3O6Q A;  3H1L E;  1R5L A;  2N1T D;  1VQ7 Z;  4NFR A;  1SQB J;  5CCH D;  1URQ B;  3TDK A;  1UII A;  2J59 M;  1WRG A;  1RE4 A;  1K73 2;  5T67 A;  1NTZ D;  1Y47 A;  1FOS E;  4DZO A;  1J1D C;  4Z1M H;  1TWF I;  2OQQ A;  4U3F J;  3CLQ A;  1S72 P;  1W2E A;  4D6T G;  1A02 F;  1NAF A;  3SFD C;  3TNU B;  1DX7 A;  1WMK A;  1KD1 Q;  1EQ7 A;  2FYN C;  1SVF A;  2W6B A;  1QF8 A;  2QJK C;  1RQF A;  4CL1 A;  1W2B Z;  3CCU 1;  4NBE A;  1JNM A;  2IX7 C;  4E2Z A;  2Y9Y A;  1M57 D;  3L4F A;  3MZW B;  3OW2 Y;  3BCC J;  3H6P A;  1X22 A;  3M4O I;  4I1L A;  3TE5 B;  2QRC B;  3S1N I;  5AW8 B;  4ASV A;  2BEQ D;  1SIW A;  1NTK K;  3I4M I;  3GHG B;  1Z02 A;  2IPP A;  2FYN B;  1VQ6 Z;  2V45 A;  2B63 I;  4A3E I;  3EER A;  3RK3 E;  1U7J A;  2KB7 P;  2OGU A;  2BEZ F;  2H43 A;  2WVR A;  1AA6 A;  3GF7 A;  3VOP A;  2FYU E;  1KD1 2;  3CC2 1;  3CC7 P;  3CMA 1;  1EXJ A;  3L74 J;  2FYU K;  2IZ0 A;  1CSB A;  3G3Z A;  4OGQ B;  1OIP A;  3L75 E;  1KB9 E;  3J81 b;  4IL6 E;  4TT3 H;  1M1K 2;  3CC2 Z;  2XZR A;  3O8Z A;  1NKZ B;  1VQL Z;  2E74 B;  5KLV E;  4A3I I;  5H2F E;  1DIP A;  3H1J J;  5B5E H;  2DE7 A;  4OWF A;  3PLN A;  4RVH A;  3M3Y I;  2NPS C;  3L75 G;  2Q4Z A;  1VQ5 Z;  3L74 E;  1URQ D;  5FLX b;  1SFC A;  3L73 E;  1GU4 A;  1S5L E;  3AE6 C;  1JMM A;  1KC8 1;  1H0T A;  1LTJ B;  1J1E B;  2ZYD A;  4W7Y A;  1Y1W I;  3RK3 D;  1KQF B;  3CCM 1;  2W03 A;  1Q81 Q;  1SP4 A;  2RIQ A;  1BCC E;  2VPZ A;  2H85 A;  3VMI A;  1BE3 D;  3OW2 O;  1QVG Z;  3FXE A;  1KOR A;  4EYY Q;  3GF3 A;  1YI2 P;  3FQQ A;  3HUS C;  2E5Y A;  3HE4 B;  3F3P C;  3RK3 B;  3HD7 D;  1KB9 D;  5AVV B;  1JTH A;  2G2K A;  2F4M A;  5CBN A;  3LID A;  3HD7 B;  1JUN A;  2XDJ A;  1LNQ A;  2C0W A;  2YMY A;  4H44 C;  1NTM J;  2GM4 A;  2LXC B;  1WT6 A;  2QA4 Z;  3BVH A;  1W2B Y;  3CWB G;  3KIH A;  2E5T A;  4XE5 B;  1ZRT E;  4PJ0 E;  3OW2 Z;  3CD6 Z;  3H1I D;  3CCV P;  2WQY C;  4D6T D;  2OTJ 1;  3M9H A;  3U50 C;  3CX5 E;  4BBS I;  3L37 A;  3SWY A;  1NUI A;  1YJW P;  4C46 A;  4AUW A;  1BSH A;  3H1L G;  3S2H I;  5AW3 B;  3JAM b;  3LW5 H;  3H1K D;  4PJ0 H;  3R4Y A;  3RGU A;  3H32 B;  2R3C A;  2KOG A;  1VQ6 P;  1HGV A;  1PPJ E;  1KRL A;  4Y52 I;  1GDT A;  1WCM I;  3V4W A;  5KLV K;  1LGH B;  1M1J C;  5KJ7 C;  5DJT B;  5AW9 B;  3U1A A;  5GTI E;  1JOC A;  4C7N B;  1YHQ P;  1Z01 A;  1VQN Z;  2WT7 B;  3VB9 A;  1GL2 D;  1MUU A;  3NH8 A;  3L35 A;  2J58 A;  1HTL C;  2XKM A;  4GDO A;  5APY A;  2W6A A;  5AW4 B;  1Y8C A;  5GTI H;  2Z4E A;  1BE3 J;  1SQV D;  3CCS 1;  2AXC A;  1N7S A;  1N2F A;  2W04 A;  1L0L E;  3HD7 A;  2PAJ A;  1NJI 1;  1LTA C;  3R2P A;  1RF1 C;  1AJY A;  4WY4 A;  1Y8A A;  1HUC A;  2R5B A;  2WIT A;  2E75 C;  1I6H I;  3L71 G;  1YIT P;  1NTM E;  3BG0 B;  2CK3 H;  2P3Y A;  1EZV I;  4WY4 B;  4JYC A;  1QVG O;  1QL1 A;  3HOU I;  2Y0D A;  1OW6 A;  3S1K A;  1YIT 1;  2KZI A;  1PGQ A;  3AE7 C;  3CCL Z;  3L70 G;  4E2W A;  1HJ0 A;  2FYZ A;  1MFT A;  3U1C A;  2KSJ A;  3G6E Z;  2M3B A;  2PRR A;  4KJM A;  1SQX K;  3CME Z;  2B87 B;  1JMB A;  3AEA C;  4HB1 A;  1QVF Y;  3JC2 2;  1D7M A;  4ZMD A;  2FYU G;  3B5N A;  2PMZ A;  1ZLL A;  4XA4 A;  3NTN A;  1RQU A;  5T6B A;  5KAF E;  1SQV K;  2JDI H;  1IFN A;  1USD A;  4WWI A;  1N86 A;  1GL2 C;  3KYQ A;  1LT9 B;  3TGU J;  5AW0 B;  3GHG A;  4Y28 J;  2ZXE B;  2R7Z I;  4QTU A;  4U3F G;  1ZR4 A;  1KV4 A;  3S16 I;  1AVO A;  4TLF A;  2WSS H;  2QA4 1;  2QSI A;  2LXB A;  3PHL A;  1EC5 A;  4GOD A;  2JS4 A;  1KC8 Q;  4DT0 A;  5AN9 F;  3V2N A;  1X9V A;  1YUK A;  4PV1 B;  3L71 D;  5TJH A;  4OH8 B;  2PM9 A;  1KIL B;  1VQO Z;  1L0L J;  2WPV B;  1BDC A;  1RNI A;  1R9T I;  3VN0 A;  3CXH H;  3S4R A;  3RL0 B;  1YJW 1;  1FDM A;  2Z5I A;  1FDI A;  1FJP A;  2FBW C;  1FBM A;  1QX8 A;  2JUB A;  2I8D A;  3E7K A;  4IOI H;  3I5C A;  3TF5 A;  1IFM A;  3NXS A;  4GOF A;  2P7J A;  1VQL 1;  2E7Z A;  5IP7 I;  3G6E P;  1UIX A;  3M06 A;  2JIP A;  3BG1 B;  2A06 D;  3CXH E;  1NU1 D;  4NPF X;  3CCL P;  1URQ C;  4GOE A;  2V4H A;  1L0L D;  1KIL E;  2ZFC A;  4YPC A;  1JJ2 Y;  3L74 G;  5CCG C;  1U7M A;  1EZV G;  1IFD A;  5IT9 b;  1L2P A;  1NOH A;  2JR6 A;  1SQP J;  1YIJ Z;  1BE3 E;  3O6Q B;  1EDL A;  1KYO E;  5BU5 A;  3AE5 C;  2O01 H;  3T97 A;  3GMA A;  3WMM 0;  5AVS B;  1KD1 1;  2F4O A;  3A0B H;  1PZQ A; 
#chains in the Genus database with same CATH homology
 4ASW A;  2KPI A;  1Q82 2;  3TDH B;  4JBZ A;  4A3F I;  2J6A A;  3HOW I;  3NH5 A;  2JA7 I;  1K73 2;  2K3R A;  3T4N B;  5T67 A;  1Y47 A;  2QEX Z;  3RZD I;  1TWF I;  2K5R A;  1YIJ 1;  4EWC A;  1YJN 1;  4RV9 A;  3PO3 S;  1QVF Z;  2DE5 A;  2QRD B;  3HOZ I;  1YIT Z;  2E2J I;  3CCJ Z;  1QF8 A;  1RQF A;  3CC7 1;  4CL1 A;  1W2B Z;  2LFU A;  3CCU 1;  1H0T B;  4NBE A;  5LL6 f;  3MHV A;  2Q51 A;  4NB9 A;  2NVY I;  1NP6 A;  1TWG I;  2QEX 1;  4A3L I;  4E2Z A;  1VQP Z;  3G6E 1;  3MZW B;  3OW2 Y;  3G71 1;  1K73 1;  4NBG A;  3M4O I;  2M48 A;  1VQK Z;  1Q2N A;  3TE5 B;  4K35 A;  2QRC B;  3S1N I;  1OVR A;  4ASV A;  3FKI I;  2VUM I;  1VQO 1;  1KQS Y;  5C44 I;  3I4M I;  1S3J A;  1Z02 A;  2E9H A;  2JNY A;  4MRI A;  1VQ6 Z;  3CC4 1;  2B63 I;  4A3E I;  3FXD A;  3CCU Z;  3EER A;  4HJG H;  3VMG A;  4RVD A;  1U7J A;  5C39 A;  2M0B A;  1SFO I;  4S1T A;  4A3G I;  1KD1 2;  3CD6 1;  3CC2 1;  3CME 1;  5FLX f;  3CMA 1;  1RLY A;  1M90 1;  3GCF A;  1BDD A;  2OTK E;  1Q82 1;  1VQ5 1;  5IT9 f;  2M5A A;  3NDI A;  3CQZ I;  3CXC Y;  1VQ8 1;  3J81 b;  3NFZ A;  2HF1 A;  1OVV A;  1M1K 2;  2AKL A;  3CC2 Z;  1LP1 B;  1VQL Z;  1VLA A;  1X3Z A;  1YI2 1;  3HKZ A;  3GTQ I;  5C3E I;  4E2Y A;  3S15 I;  4A3I I;  3I56 1;  4NBC A;  3EED A;  3H3V J;  4A3D I;  1WW9 A;  2RHB A;  3M3Y I;  2DE7 A;  4RVH A;  3CCR 1;  2Q4Z A;  1VQ5 Z;  2P58 A;  5FLX b;  5D1O B;  4E32 A;  1RO2 A;  1LP1 A;  3CCL 1;  3S1Q I;  1FC2 C;  4A3J I;  1VQM 1;  1KC8 1;  3GTO I;  1YJW Z;  1S7M A;  1VQ9 1;  2M6N A;  3D9X A;  5A2Q b;  2NVX I;  1H0T A;  1QYP A;  4Y7N I;  3G71 Z;  1Y1W I;  1LT1 A;  1X3W A;  2WB1 A;  3CCM 1;  2B87 A;  2W03 A;  2Y0S A;  1K8A 1;  4MD7 A;  1YJN Z;  2RIQ A;  2RKL A;  2H85 A;  3VMI A;  1YUA A;  2IZ4 A;  1QVG Z;  3FXE A;  4NBD A;  2JA8 I;  2QKD A;  1K8A 2;  4EYY Q;  2GTH A;  2WMM A;  4A3C I;  4NB8 A;  3FQQ A;  2Q1K A;  3F3P C;  3IF8 A;  5DJU B;  2G2K A;  2F4M A;  4MD9 A;  1EDJ A;  5CBN A;  1WII A;  4DGL A;  3RZO I;  3CCM Z;  3GKQ A;  4E2X A;  2DE6 A;  5C4X I;  5IP9 I;  3I55 1;  3NH4 A;  1YJ9 Z;  2LXC B;  1NVO A;  2QA4 Z;  3CCV 1;  1DEE G;  3ZDM A;  4BBR I;  3KIH A;  1W2B Y;  3GTM I;  2O4H A;  3LUS A;  1LQL A;  3OW2 Z;  2QVA A;  3H0G I;  3CD6 Z;  4HGY A;  2JA6 I;  3QWO C;  2OTJ 1;  3U50 C;  1VQ7 1;  4BBS I;  1NUI A;  1ZH1 A;  3CCE 1;  2E2I I;  4A93 I;  3CCS Z;  3VTN A;  4XX2 A;  1JWH C;  2QLV B;  3K7A I;  3S2H I;  1Q86 1;  3JAM b;  1SS1 A;  1S72 1;  1K9M 2;  2KZJ A;  3G4S Z;  3RGU A;  3GTL I;  1YHQ Z;  3PO3 I;  4A3K I;  4E31 A;  1YHQ 1;  1EDI A;  1USP A;  4MH4 A;  2PK7 A;  2OZK A;  4E30 A;  2YAD A;  1KRL A;  1YJ9 1;  4Y52 I;  1ZB8 A;  1WCM I;  4HGZ A;  1ZXG A;  1JM0 A;  2KIK A;  5DJT B;  3HOX I;  3PO2 I;  1VQ6 1;  1Z01 A;  2R44 A;  4HKZ H;  4CPG A;  1VQN Z;  1VQ9 Z;  1K9M 1;  2GU2 A;  3NDJ A;  3VB9 A;  4X6A I;  2JMO A;  3NH8 A;  3QWU A;  2I3C A;  1M90 2;  3HOV I;  1L1O C;  3CPW Y;  2NVQ I;  2GTI A;  2OTL 1;  3GTP I;  1S72 Z;  3CCS 1;  1X0T A;  1N2F A;  2HR3 A;  2RBL A;  2W04 A;  1VQP 1;  3F3F C;  1NJI 1;  1Y1V S;  3VMH A;  2IZ3 A;  2QR1 B;  3KIF A;  2EGT A;  3J80 f;  1Q7Y 1;  1I50 I;  3FQM A;  3S1R I;  3CCQ Z;  2WAQ A;  2V8K A;  1JJ2 Z;  4BXX I;  3MON A;  3MZK B;  1Q81 1;  1VQ4 Z;  1Q7Y 2;  3GTM S;  3GTK I;  2R92 I;  4E33 A;  4NBF A;  3MZL B;  1I6H I;  2OTL Z;  3IFU A;  3PH0 A;  4NBB A;  4NPD A;  3BG0 B;  2P3Y A;  3CCV Z;  5CBO A;  5EFW B;  1K83 I;  4ZNC A;  4MN4 C;  3HOU I;  3CCQ 1;  2HU9 A;  4DK1 A;  2KUB A;  3S1K A;  3JAM f;  1YIT 1;  2KZI A;  2O53 A;  1VQM Z;  2UWJ E;  3CCL Z;  4MD8 A;  1KQS Z;  2B89 A;  1N8R 1;  4E2W A;  1MFT A;  3J81 f;  1USP B;  1Y1V I;  3CME Z;  3G6E Z;  4KJM A;  3I4N I;  2B87 B;  1JMB A;  4BXL A;  2KI7 B;  4HB1 A;  1QVF Y;  2OOX B;  4ZMD A;  2PMZ A;  2V8I A;  2ZAE B;  1QVG Y;  3Q87 A;  2RPR A;  5T64 A;  2VUG A;  3IX0 A;  3CC4 Z;  5T6B A;  2M5A B;  3CCE Z;  3S2D I;  2R6M A;  1TWC I;  3CXC Z;  5D1P A;  4A3B I;  1DL6 A;  4WWI A;  1RO4 A;  2VF1 A;  3P5J B;  2QRX A;  1OVU A;  1TWA I;  2R7Z I;  4QTU A;  1VQK 1;  4MON A;  3I56 Z;  3GTJ I;  1ML8 A;  3GTG I;  3S16 I;  2LIY A;  3I07 A;  3CCR Z;  3I55 Z;  1VQ4 1;  2QA4 1;  2SPZ A;  2E2H I;  2LXB A;  3J80 b;  1N8R 2;  1NJI 2;  1TWH I;  5D1O A;  1EC5 A;  4GOD A;  3D6W A;  2JS4 A;  5AN9 F;  3CC7 Z;  4AYB A;  4BY7 I;  4DQY B;  1KC8 2;  1YUK A;  2JA5 I;  1Z03 A;  2PM9 A;  4BY1 I;  5CM2 M;  5FLM I;  1VQO Z;  4NBH A;  2R93 I;  1BDC A;  1RNI A;  3ESW A;  3G4S 1;  1R9T I;  2NVT I;  4NPE A;  2QRE B;  2OOY B;  4NOZ A;  1I3Q I;  1YJW 1;  1EDK A;  2JWD A;  3CPW Z;  4RVG A;  1Q86 2;  2JUB A;  2I8D A;  4NH1 C;  4IOI H;  5C4J I;  4MXU A;  4GOF A;  1ZB9 A;  2KS1 B;  1VQL 1;  2P28 A;  1YI2 Z;  3J7A 4;  5IP7 I;  4QTT A;  1ZW0 A;  3BG1 B;  5A2Q f;  4A3M I;  3S17 I;  1VQN 1;  4TNU A;  2LR2 A;  4NPF X;  4GOE A;  1VQ8 Z;  4K3A A;  3HOY I;  4RS4 A;  1JJ2 Y;  2B88 A;  1TFI A;  2YU9 I;  1U7M A;  5IT9 b;  2JR6 A;  2BJO A;  1YIJ Z;  1EDL A;  3S1M I;  4RVF A;  5K5G B;  2V8J A;  1PFT A;  4HH4 A;  3CMA Z;  1P9N A;  2RT9 A;  1M1K 1;  1KD1 1;  2F4O A;  3CCJ 1;  2OTJ Z;  1Q81 2;  1VQ7 Z;  1RO0 A;  4NFR A;  3S14 I;  4NBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...