2ZAEB

Crystal structure of protein ph1601p in complex with protein ph1771p of archaeal ribonuclease p from pyrococcus horikoshii ot3
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
EKKEKKKIAIERIDTLFTLAERVARYSPDLAKRYVELALEIQKKAKVKIPRKWKRRYCKRCHTFLIPGVNARVRLRTKRMPHVVITCLECGYIMRYPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 1
publication title Structure of an archaeal homolog of the human protein complex Rpp21-Rpp29 that is a key core component for the assembly of active ribonuclease P.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 28
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2007-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2zaeB01
2.20.25.200 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2zaeB02
4NPFX 2B89A 2B88A 3S1KA 4HKZH 2B87B 2OTKE 1Q2NA 1X0TA 1OVVA 1LP1B 4GOEA 2I8DA 1OVRA 2M0BA 2P58A 4GODA 1BDDA 2M5AA 2WMMA 3FXDA 1BDCA 4K3AA 1SS1A 1DEEG 3FXEA 4WWIA 4ZMDA 2UWJE 2JWDA 1NVOA 3ZDMA 2KZJA 2KS1B 1H0TA 2HR3A 2KIKA 2LXCB 4HJGH 2LR2A 2QRXA 1JM0A 5DJTB 1LT1A 1EDKA 4BXLA 4EYYQ 2R44A 4HB1A 4KJMA 4K35A 4NPDA 1FC2C 2RKLA 2ZAEB 1EDIA 1EDLA 1Y47A 1ZXGA 1EC5A 2M5AB 4IOIH 4NPEA 2KZIA 2KUBA 1ZW0A 5EFWB 3MHVA 1S3JA 1H0TB 3MZWB 3QWOC 2Q1KA 4ASWA 1OVUA 5CBOA 5C39A 2QVAA 2B87A 2K3RA 1EDJA 2LXBA 3RGUA 1LP1A 5DJUB 1U7MA 5CBNA 1MFTA 2KI7B 1JMBA 4ZNCA 4CPGA 5K5GB 4JBZA 1U7JA 4ASVA 2SPZA 4MN4C 3PH0A 4GOFA
chains in the Genus database with same CATH superfamily
3T97B 1EXJA 2GUVA 1S1CX 2IZ0A 2FXMA 1OZHA 1RF1C 1BCCE 2OYHA 5IT9b 3Q2YA 1KD12 1FZCB 1X0TA 3Q5PA 2NVYI 2JIPA 2JIQA 1ZLLA 1SQBK 3EFFK 1FZCC 2H85A 3D71A 2JWDA 1P84E 3CCVP 3S16I 3V6IA 1EZVI 1N73B 1UIIA 2LR2A 2CK3H 2YO3A 4RO0A 1NTKK 1FU1A 2QREB 3TGUE 1N73C 3U1AA 1NO4A 3CMEZ 3PO3I 1VQ61 2A45H 2JDIH 3KIHA 3D2LA 1IFNA 1N2DC 4XX2A 1Z03A 3R2PA 2A06G 4ZKPA 1EC5A 3NFQA 2EGTA 1BGYE 1VQOZ 1AFOA 3AECC 3S14I 3C9IA 1VQ7Z 1NWQA 3G6EZ 1YITP 2YU9I 3D6ZA 3BATA 3QWOC 3CCQP 4HH4A 1OVUA 5CBOA 5IP7I 2K3RA 1KYOD 1H89A 1YJ9P 3GTOI 1Y1VS 1S4XA 3CC2Z 2E76D 4UB6H 3M91A 2W04A 1S72P 1K8A2 1DX7A 3VB9A 5K5GB 3WUVA 2JIOA 1R5SA 2KLVA 3MUDA 1QXFA 1AQTA 3TF5A 3GTLI 1QVFO 5B5EE 4R4MA 2ZYGA 4XFJA 1T3JA 1CZQA 1JJ2Y 3CCJZ 1NTZJ 1VQ51 3HD7D 3PO2I 3JAMb 2WMMA 3CPWY 1BDCA 3RBXA 1PPJG 2E76B 3EERA 3HRNA 2N1TD 3V4WA 5AW5B 1HGZA 1H0TA 1VQ81 3RZDI 2HR3A 1Q7Y2 2E76C 3IN6A 1YYCA 1NTZD 4HGZA 2P28A 1SQBG 4N6JA 4OVNF 1EDKA 2CPBA 2K9YA 2KOGA 4W80A 3G711 1VQKZ 1Q862 3MTUE 3CX5H 1FZFA 5KLIB 3VMHA 1BCCG 1NTKG 4AYBA 3IR7A 1QVGY 5CCHA 4BBSI 2GU2A 3HD7B 2BJOA 3AEGC 2KZIA 2ZXEB 5KLIC 2R3CA 1KB9H 4B86A 3U59A 2N1TB 5BVZA 2AXTH 2QVAA 4Z1MH 5KAFE 1FZEA 1ZR2A 3VMAA 1RQFA 5AVUB 1VQ6Z 3CMEP 2N1TC 2G2KA 2P3YA 2H43A 3I55Z 1QL1A 1X8YA 4ZNCA 3L72E 2E42A 5KTBA 2OGUA 5D1PA 2R93I 3F3FC 3CI9A 3A0HE 2BEQD 2WTYA 4EWCA 1VQOP 5T6BA 1RY3A 2GM4A 3TYYA 1S9KE 1VQ7P 4BXXI 3G6EP 1BGYG 2IZ1A 3TE5B 4NBHA 1HF9A 2E2JI 3VP8A 1KILA 3CC2P 4MD7A 4E33A 1LP1B 2JEEA 1JY3N 2WWWA 2O1JA 1OVRA 1BDDA 2N9BA 2W6JH 5B66H 1HJBA 3W67A 3NTNA 2QKDA 3WUUA 1J1EB 2WPSA 2OYIB 1PP9J 1TWAI 3TDKA 5BU8B 4DT0A 1JO5A 2QE7H 4LLHA 2Q5UA 1WW9A 2IBZD 2K1AA 2O4HA 2OYIC 2Q9IA 1FJKA 2JJLA 3SFDC 4TLFA 2OYHB 2E7ZA 1FC2C 2RKLA 3O6QA 1EDLA 1BSHA 2KB7P 2HODA 1PP9D 4BWNA 3VTPC 2OYHC 1JTHB 2Z5IA 2YKQA 1HTLC 3SFEC 2KUBA 4E30A 1ZRTD 1WIIA 5A2Qf 1VQ8Z 1NH4A 2LEXA 4ZKUA 1SQBJ 5GTIE 1NJIQ 2R32A 2V7QJ 2RMZA 3CCLP 2DE6A 1YUAA 4NBGA 4XE5B 2NVTI 2O1KA 1YIJZ 3G71Z 5DJUB 4TNUA 2JO1A 1LT9A 1NTKJ 1VQKP 1OW8A 5CBNA 2RBLA 4HH2A 2FXPA 2WB1A 1KZUB 5KLVJ 3PHLA 2YO2A 2OTL1 3OW2Y 1SQBD 5AVRB 1Z02A 3I4NI 1OXZA 2O01H 1AJYA 1NJI1 2I1JA 3AE9C 2R3SA 3I561 1L0LJ 5FLMI 1KYOE 1NTKD 3BASA 3NMDA 2C9NY 2KPIA 4A3EI 5KLVD 2OQQA 3CCEP 3M06A 1W2BY 2ITAA 2W27A 1JNMA 4E2XA 3I55P 4GIFA 3USSA 4L73A 1FBMA 1I6HI 4L75A 3D70A 1L0LD 4WBAA 1P9NA 1VQNP 3L72G 3GF7A 4NBEA 3FWLA 1I3QI 1KC82 4PJ0E 3MUDC 3Q87A 4DQYB 3HOUI 4YTPC 4E2WA 5AVZB 1LTGC 5CCHD 1TWHI 2Y9YA 2KSEA 2QA4Z 2OYOA 1TWCI 4NFRA 1M57D 3UIAA 1KQSO 1QL2A 1FOSE 4DZOA 1N7SA 1NTZE 1HJ0A 2BCCJ 1H0TB 2MKVA 1VQPZ 5H2FH 1J2JB 2Q3IA 1PV3A 5APXA 3WU2E 2Y9ZA 1YHQ1 3H1KJ 3S4RA 2YXQB 2R5BA 5CJ0A 2KNCA 2MJZA 4EI2A 2QRCB 2BCCD 1NTZK 3AE5C 3B5NA 2PK7A 3PH0A 3AEAC 3IFMA 1JY3O 2Q4ZA 3H1KD 1PFTA 2JUBA 5A2Qb 3CD6Z 1KILD 3M0AA 4HKZH 4JQ0D 2I1KA 2YMYA 2K9JA 1YIJP 3G71P 2K5RA 1NOHA 5AVTB 2M48A 2E2II 2FY8A 3GF3A 4MRIA 1IJDB 3BVHA 1Z56A 1QLED 2PP6A 2OTLZ 2FXOA 4WB4A 2VUGA 3BCCG 2W90A 1YQ3C 1KQLA 2R92I 4A3BI 4QMAA 3I56Z 2QJPB 2LXCB 3F3PC 4HJGH 5TJHA 1WJ2A 4NB9A 2ZVOB 1VDFA 1TU3F 1M1KQ 1MZ9A 5IP9I 2NRGA 3SSUA 1IO4A 1KILB 3AEDC 1T2KD 1KMIZ 3NDJA 4M3LA 3MZKB 4A3JI 3KZIH 1KILC 2M3EA 1ZW0A 5EFWB 4DCKA 4RS4A 1OMIA 2IBZE 3L35A 1NYHA 1M1K1 2G8YA 3PP5A 2GUSA 4MD8A 1U7MA 3CX5D 1FZGA 1PP9E 3RK2D 1H88A 4D6TJ 1RQUA 3O6QB 1PIXA 1GW3A 3I07A 2DW3A 3GHGB 1YI21 2QA4P 2OARA 1ZRTE 2HODB 5D1OA 4RESB 3KXDA 1YJN1 3V2RA 2J5UA 2YXRB 5E79H 1LGHB 3RL0D 1KB9D 3GHGC 2VF1A 5CJ4A 1S7MA 3P5JB 4NBBA 1VQPP 2B89A 2WPRA 3QH9A 3H1HJ 2W03A 1FS0E 1T2KC 3CXHI 1VQL1 1YHQZ 1NTZG 4D6TD 4NBAA 4E31A 2M0BA 2P58A 1K9MQ 1SQBE 2KK7A 3H25A 1MKMA 2P7JA 3G3ZA 3RK2B 1LTIC 3H1HD 3GTJI 2C9LY 1BE3J 3WUTA 1NTKE 3MD0A 3RK2C 1OIPA 3CD6P 5KLVE 3RL0B 4A3II 2JIMA 1K9M1 1EDIA 3ABVC 2O3JA 3RL0C 1JY2P 3BCCJ 1L0LE 3Q5SA 1N7SD 1BE3D 4RVDA 1K83I 3P8CD 3Q5RA 4NBFA 3CXCZ 3P8MC 3M9HA 3S1RI 3I56P 1SQXJ 3CCSZ 3CWBJ 5KLVK 3M4OI 1EZVG 1IFMA 1CSBA 3L73G 3GTMS 3S2DI 3TK1A 3BCCD 2KYVA 1L0LK 1MUUA 2HPCA 2QEX1 3VN0A 2AEMA 3B5ND 1AV1A 2V4HA 1SQXD 3CWBD 1S2EA 1VQM1 2O01N 2WSSH 2OTJ1 3GTMI 3A2AA 4E2ZA 1N7SB 2O01J 2NPSA 3S1KA 3CPWO 2IBZG 1FJPA 5B5EH 4A3FI 1N7SC 1JCCA 4OH8B 1Q2NA 1FE6A 2WQYC 3E1IA 4H13D 2I8DA 5M1BA 2KNCB 2E9HA 2Y0SA 2BCCE 4K3AA 3GMAA 1HGVA 1Y1VI 1VQ9Z 3LIDA 1RO2A 3FKII 1PP9G 3H1KE 3CC41 1X3ZA 1FZAA 3B5NB 3TNUA 2H7HA 1KILE 5KAIH 2VPYA 2VUMI 2JMOA 2W6AA 2IYPA 2AXCA 2FKWB 3FWNA 1R5LA 1Y8CA 3VTNA 3AE3C 4UB6E 1AA0A 4BXLA 3B5NC 2PGDA 3AE6C 3KDPB 1DD4A 1QVGO 4NPDA 1GZLA 1NU1J 2K9JB 3K5BA 1USPA 3GTGI 2WSEH 3CCUP 1W5CE 3IF4A 1QVFZ 3NDIA 4IOIH 4RVHA 2NZ2A 4H13B 2JR8A 3V4QA 2R7ZI 2JA8I 2I3CA 4H13C 4H44B 1VLAA 4IFDK 1X22A 4A3LI 2QIWA 1HWTC 1NU1D 3FGAD 4DGLA 1QVFY 5KLVG 1OW6A 4PD4D 1Q812 2FBWC 3HE5A 2E5YA 1RF0C 3MONA 3GW6A 3HD7C 2VPZA 2GA1A 1RO0A 1L0LG 3HUSA 3CCR1 3EQ2A 1KD1Q 3A0BH 3L73J 3A0HH 3CCSP 3U1CA 1P84I 1Q90D 4E2YA 1YTZI 3CX5E 2CPSA 1GU5A 4O9BA 2OOXB 2QEXZ 1R8EA 4NH1C 5AN9F 1NAYA 3HOWI 1EZVD 1KB9E 1SLQA 4BBRI 2UWJE 5D1OB 2KZJA 3L73D 3CC71 4KT0J 1PL5A 3H6PA 1KD11 2AXTE 1RNIA 1SQPK 4D6TE 2BEZF 3G4S1 1OX3A 2R44A 1G1IA 4HB1A 4IL6H 1M1JA 2BASA 4KJMA 1YTZT 4DOJA 1JY2N 3E7KA 1PGOA 1Y47A 2A45G 3H1HE 3L75J 5TISH 4A3GI 3HE4A 3AEEC 1VQ9P 2Q3EA 1J1EC 1SFCA 2IV2X 3GTKI 1USDA 3CC4Z 2BCCG 1NHLA 3A5TA 1WRGA 1LWUA 2V8JA 5T64A 3CCJP 2J6AA 1VQ5Z 1IFIA 2IDBA 3H1KG 3NH4A 1SIWA 1AA6A 1ZB9A 3EFGA 1L4AA 3OW2O 4MXUA 2QG4A 2QM8A 5B66E 1MFTA 2IZ3A 1BE3E 1JMBA 4A7PA 3P8CE 1GK6A 3KPEA 5AW2B 2WT7A 3L71J 3MP7B 4ASVA 2NPSD 4GT1A 5AW4B 1TWGI 4W7YA 4LC1A 1W2BO 1N7LA 3BCCE 1G1JA 4U3FJ 4BY1I 1LTAC 3L71D 1TWFI 1SQXE 1SQVJ 2XZRA 4C46A 1Q7YQ 3CWBE 2HPCB 4DK1A 1IC2A 2PAJA 2Y0CA 3PRJA 2RN0A 1M1K2 3EWKA 5LL6f 3I4MI 1IZNB 3L74J 2QSIA 3CCRZ 3CCV1 1USEA 4W7ZA 1K732 1ZMEC 3BRTB 1JM0A 4U3FD 3T97A 2NPSB 2R5DA 1VQ6P 3KYQA 5APWA 2IZ4A 3S15I 1SQVD 2NPSC 1SQXK 4N3YB 2QEXP 1Q7Y1 1Q16A 3L74D 2D2CD 2HYNA 3TGUJ 1IK7A 4OGQD 1IFPA 3CC7Z 2YADA 1GMJA 3G9RA 3CXHH 1Q861 2JIRA 1XTCC 4ASWA 1YIT1 1DH3A 2W8ZA 2LFUA 1LJ2A 1EDJA 3G4SZ 3CCQ1 4C7NA 1N86A 3RGUA 2M8RA 1YJ91 3R4YA 1WCMI 5GTHH 5APQA 3IAOA 1I50I 4D6TG 1USPB 3WU2H 5C4XI 3CL3D 1S721 4GOFA 1HUCA 1A02F 1Y8AA 1M90Q 4I2LC 3HTKA 3H1HG 3NXSA 1K9M2 1NU1E 2D2CB 2K37A 1R9TI 4OGQB 1VQ5P 1N2FA 2OTKE 3SWKA 4JYCA 1OWAA 3AE4C 3VP9A 2D2CC 4PD4E 1NGMB 5AW7B 4NB8A 4GODA 4OGQC 1KQSZ 2L5GB 3SWYA 2P67A 1KFNA 1ZH1A 3HE5B 1VQ8P 2V3VA 4BY7I 3KIFA 5H2FE 5CCHC 2IFMA 1L2PA 1BE3G 1SQQJ 2QJKB 1H8AA 1M901 1NU1K 1JY2O 3HUSB 3M0DA 3L36A 5CM2M 3ESWA 4TT3H 4H0LD 2QJKC 1EXIA 3H1JJ 5AW1B 1DL6A 2QR1B 1NTMK 1X79B 2Q6QA 3HUSC 4IFMA 1M56D 1K04A 1NP6A 4BRYA 2P10A 1EZVE 3GG2A 2V45A 1SFCD 4NPEA 3L73E 1SQQD 3P7KA 2WSEJ 2ZYDA 2KXPB 3F89A 2ZT9D 3MZWB 1FZBA 4YXDC 1SQXG 3CCVZ 4A3DI 3CWBG 3H1JD 2OOYB 2QJPC 2ZFCA 1L4AD 2Q7CA 2RPRA 1J1DB 2KLUA 2H88C 1SQPJ 3H1LJ 1FDOA 4A3KI 1KYOI 1M1JB 4H0LB 1J1DC 2NVQI 4UB8E 2FYZA 4E32A 1LTJA 2V8KA 2VPXA 5APSA 1HH0A 1M1JC 2PFXA 4H0LC 2P2UA 3HE4B 4IL6X 4NBDA 4Y99B 1VQO1 2XU6A 1SFCB 3EEDA 3AEBC 1S5LH 1SQPD 3H1LD 1YITZ 1VQ71 1LWUB 3T4NB 3H0GI 2XV5A 3CCQZ 4Y99C 1SFCC 2JNYA 2ZT9B 4N78D 1LQLA 5L8RJ 1L1OC 1YJW1 1OVVA 2E74D 1L4AB 3N7NA 1LWUC 3GCFA 1KFMA 3CC21 1DEBA 2M5AA 2YMKA 2JKVA 2ZT9C 1DEEG 2J58A 3GLMA 1S72Z 3AEFC 1IFDA 1L4AC 3ZDMA 3H32A 3JCUH 1KC8Q 2HFED 3PTZA 3RBZA 1JMMA 2WT7B 1SP4A 3M3YI 3GTPI 2JA5I 2E5TA 3NH8A 4HGYA 1YQ4C 2F4MA 2PM9A 2Z5HA 2ZVNB 1LT9B 1PZQA 3CQZI 3L71E 3JC22 1NU1G 2Y0DA 1HVVA 2M6NA 2RH0A 2WSFH 3D6WA 1T3UA 1LT9C 4A3CI 3HOZI 5E79E 1NKNA 2E74B 1VQ41 1KC81 4R4LA 2AKLA 3IF8A 1P84H 4U3FE 4EDFA 5C3EI 2E74C 3O8ZA 2Z4EA 1Q82Q 3VMYA 3VMIA 4S1TA 2RHBA 2RT9A 1PGJA 1SQVE 3CCL1 3V5BA 4X6AI 2N9YB 2RIQA 1UIXA 3K7AI 3D6YA 5AW3B 2OTLP 5CCGA 4MD9A 3L74E 2VRSA 1VQK1 2H89C 5AVQB 4CPGA 1JY3P 2FYUJ 1JTHA 3CLQA 1OW7A 1L0NJ 2SPZA 3MZLB 3PO3S 1HBWA 1ZR4A 1AQ5A 2J59M 1RE4A 1Q821 1GL2A 1SQVK 2V8IA 1KRLA 2NAPA 2JA6I 2H8PD 3CMA1 2HU9A 4C7NB 3RZOI 4WVZA 1AVOA 1KN7A 3CXCY 1A02J 1ZP0C 2FYUD 2Q51A 1RH5B 4XA4A 3FXDA 4GKGA 3CCE1 1L0ND 1N8RQ 4PV1D 3FXEA 1GTWA 3I551 1Y9BA 1NVOA 1VL2A 3IX0A 1SVFA 1RO4A 2OZKA 3B71A 1PFIA 2QRXA 3L70J 1VQN1 3L37A 4I1LA 3HTKB 1X3WA 4MH4A 2GTIA 2IBZI 4NOZA 1X9VA 1YJWZ 1YI2Z 4MONA 1MFZA 4QTTA 1YJNZ 4H44D 1N8R1 3VMXA 2YNYA 3L75G 1JJ2Z 2NVXI 3L70D 1T8ZA 3C8VA 3MHVA 1PGQA 3V2NA 4PV1B 3CPWZ 3F5HA 3L4FA 3ITKA 2QM7A 1VQLZ 2POHA 2LKMA 1YHQP 3V2PA 4PV1C 2E75D 1NJI2 3NH5A 2AEFA 3M0DC 1SQQE 3BG1B 1JCDA 3N4XA 4BRYB 1NTMJ 4OWFA 3H1IJ 1AVYA 1VQ4Z 3L71G 4JPZB 5KAIE 4AYCA 1KV4A 3H1JE 1RE3A 2WSCH 1W2EA 3CCM1 3CXHD 1GW4A 1QVGZ 3OA7A 4EOTA 1IK9A 1KQGB 2XKMA 4H44C 4C7RA 2HLOA 5C44I 3CCLZ 3Q1MA 4U3FG 5KAFH 1NTMD 1SQQK 4AQRD 3H1ID 4GOEA 3MGNA 1NAFA 3LW5H 5AW9B 3BG0B 1YIJ1 1SS1A 1SQVG 2E75B 1LTJB 3PLNA 5KKZB 3HOYI 3L74G 1SQPE 2JR6A 2E75C 3H1LE 2KIKA 1QF8A 1LTJC 3D9XA 5CHXA 5KKZC 4N78E 4AUWA 5DJTB 2QLVB 1WZNA 3RK3D 3FQQA 1LNQA 3CMAZ 5FLXf 3TDHB 3J81f 1RHZB 1YBKA 1OFCX 3S1QI 1M7LA 1S5LX 3CCEZ 2WVRA 3AE1C 2M5AB 1CI6A 1VQMZ 3S1NI 2OTJZ 1URQA 3TGUG 1KORA 3A0BE 3H32B 2JA7I 4KHXA 1FAVA 1VQNZ 1E5WA 2B87A 1KTMA 2QRDB 4L76A 5CCGD 2A06D 3QWUA 1YJWP 4EIJA 1YI2P 1M902 3RK3B 1YJNP 1LTBC 2A45I 1ZB8A 2JWAA 4Y28J 1T6AA 2KS1A 4JBZA 2QA41 1GL2D 3RK3C 2HG5D 3WMM0 1K8AQ 2AYDA 3FQMA 5C4JI 1VQLP 5GTIH 2B88A 2C0WA 5AW8B 4IL6E 1VQP1 3L75D 2AEJA 5APTA 1JEKA 1RQVA 3S9OA 3M9BA 3S2HI 5TISE 4U7JA 3AE8C 4WWIA 1K05A 3GHGA 3GTQI 1YUKA 1TFIA 2WITA 1VQ4P 2HF1A 1SFOI 1SQQG 5AVSB 1NUIA 2W6BA 5CCGC 3CCMZ 1K8A1 3A7OA 3AE7C 5KJ7A 4Y7NI 2KSJA 2L91A 3OW2Z 1GL2B 1KYOH 3H1JG 4RJTA 2G3AA 1G2CA 4RKUJ 3CD61 2FYUE 1GU4A 4K35A 2PMZA 1L0NE 1RE4C 1DD3A 1PPJD 2ZAEB 4WY4A 1GL2C 3KQGA 4JYBA 4LGDE 2FFDA 4YPCA 1BCCJ 3U50C 2WZ7A 2IX7C 3E1RA 1RF1A 2ZXXA 2WSFJ 1W2BZ 1Q86Q 3RL0g 1KQFB 3VMGA 3JSVC 4DJGA 4A93I 1JB0J 2XNDH 3PJSK 5AW0B 2WPVB 2FYUK 1FZCA 1SQPG 1Q81Q 2LXBA 1L0NK 3H1LG 3B8EB 3CMAP 4PJ0H 3II6A 1BCCD 2QJYB 5FLXb 2DE5A 3CX5I 3J81b 3L70E 1GK4A 2QJYC 2KP8A 1RLYA 1VQMP 5AVXB 1U7JA 2OTJP 3VOPA 4QTUA 1N73A 3TNUB 4MN4C 2DE7A 2O53A 1P84D 3J80f 4NPFX 1BGYJ 1JOCA 1KB9I 2B63I 2WAQA 1DIPA 3S17I 1Q811 3J7A4 4Y52I 3TGUD 5APUA 2P1JA 3W68A 3HKZA 2C0XA 4ZMDA 4CL1A 1QX8A 3CC4P 4PD4H 1BGYD 3CXHE 5AW6B 2ZYAA 2W83C 1NTME 4A3MI 3H1IE 1QEXA 5GTHE 2GTHA 1RE3C 1WMKA 3TSIA 5T67A 1URQD 3H3VJ 1Q822 3CCU1 3MIWA 2IYOA 3OJAB 2YIUB 2YKOA 1S3JA 2E43A 3CCMP 5IT9f 4YXWH 1JWHC 1KQSY 3RK3E 1FDIA 1PGPA 5C39A 2JP3A 2YIUC 3IFUA 2F4OA 3HOVI 3Q3DA 3M9QA 4I6MC 3SWFA 1U57A 2R6MA 1FOSF 1VPCA 3OAKA 2FYUG 3VMZA 1CI6B 2VPWA 4IFFA 1L0NG 3CCRP 1URQB 5APYA 1LTSC 1MV8A 3BRVB 4UB8H 3LUSA 1JUNA 3HOXI 3VYIA 3FX0A 2Y0EA 1ZOYC 1N8R2 3A3YB 1URQC 2A06E 2WSCJ 2B87B 2IPPA 2IFNA 3CCS1 1M8OB 2M3BA 3CME1 2K88A 1ML8A 5AVYB 1RF0A 2WPQA 1BSNA 2JS4A 3S1MI 1VF5D 2YKPA 3HD7A 1LTTC 4RVFA 3CC7P 1K73Q 3LW5J 4L74A 1WT6A 5KJ7D 2KS1B 4GDOA 3G6E1 2N1TA 3L72J 1GD2E 3L70G 3G4SP 5AVWB 3L75E 3KHUA 1YJ9Z 1NKZB 5CMZA 1LT1A 3C1LA 3I5CA 3J80b 2LIYA 4WY4D 1E79H 1QYPA 3IR9A 4EYYQ 2ZJSE 4RVGA 3KZIE 1GDTA 1ZXGA 3V2QA 1K731 3GKQA 3L72D 1QGKB 2V7QH 2FYNB 1S5LE 1VF5B 2E2HI 3B4SA 4RV9A 1VQ91 4I7ZB 1S9KD 1CW5A 2Q1KA 4JF7A 1IFJA 3P32A 2FYNC 1FDMA 1VF5C 3JAMf 1PPJE 3LIEA 3CCJ1 1LP1A 4I7ZC 5APVA 1Y1WI 3NFZA 1G2CB 1Z01A 5KJ7C 1XTGB 4NBCA 2PRRA 2KI7B 1NTMG 4WY4B 3H1IG 2B9BA 1ZV8A 2XNXA 2FFDB 3JCUE 3CCUZ 3AE2C 1ZN5A 2OYIA 4PD4I 5AVVB 2XDJA 1EQ7A 1RF1B 1D7MA 4WY4C 4HYTB 5BU5A 2FFDC
chains in the Genus database with same CATH topology
2Q4ZA 1QVGZ 1PFTA 2JUBA 5A2Qb 3CD6Z 4HKZH 5IT9b 5C44I 3CCLZ 1KD12 4BY1I 1X0TA 2K5RA 4GOEA 2M48A 2E2II 2NVYI 4MRIA 3BG0B 1YIJ1 1TWFI 1SS1A 4DK1A 2OTLZ 2VUGA 2H85A 2JWDA 1M1K2 3S16I 3HOYI 5LL6f 3I4MI 2R92I 2JR6A 4A3BI 2KIKA 3I56Z 3CCRZ 2LXCB 1QF8A 4HJGH 3F3PC 3CCV1 2LR2A 1K732 3D9XA 1JM0A 5DJTB 2QREB 2QLVB 4NB9A 3FQQA 3CMAZ 5IP9I 3CMEZ 2IZ4A 3S15I 5FLXf 3PO3I 1VQ61 3TDHB 3J81f 3KIHA 4XX2A 1Z03A 3S1QI 3CCEZ 1EC5A 2EGTA 1Q7Y1 3NDJA 2M5AB 1VQMZ 1VQOZ 3S1NI 3MZKB 2OTJZ 4A3JI 1ZW0A 5EFWB 3CC7Z 3S14I 2YADA 1VQ7Z 4RS4A 3G6EZ 2JA7I 1Q861 2YU9I 1VQNZ 3QWOC 4ASWA 4HH4A 1OVUA 5CBOA 1YIT1 2B87A 5IP7I 2K3RA 2LFUA 1EDJA 3G4SZ 2QRDB 1M1K1 1Y1VS 3CCQ1 3GTOI 3RGUA 3CC2Z 3QWUA 1YJ91 1WCMI 4MD8A 1U7MA 1I50I 2W04A 1K8A2 1M902 1USPB 1ZB8A 3I07A 1YI21 3VB9A 5C4XI 5D1OA 1S721 5K5GB 1YJN1 4JBZA 2QA41 3GTLI 4GOFA 2VF1A 1S7MA 3P5JB 4NBBA 2B89A 1K9M2 3FQMA 5C4JI 2B88A 2W03A 1R9TI 1N2FA 1VQP1 2OTKE 1JJ2Y 1VQL1 1YHQZ 3CCJZ 4NBAA 4E31A 1VQ51 3PO2I 4NB8A 2M0BA 4GODA 2P58A 3JAMb 1KQSZ 3S2HI 2WMMA 3CPWY 1BDCA 4WWIA 1ZH1A 3EERA 3GTQI 1YUKA 1TFIA 4BY7I 3KIFA 2HF1A 1H0TA 1SFOI 3GTJI 1VQ81 1NUIA 3RZDI 2HR3A 3CCMZ 1K8A1 1M901 1Q7Y2 4Y7NI 3OW2Z 4HGZA 2P28A 5CM2M 3ESWA 1EDKA 1DL6A 2QR1B 3CD61 3G711 4A3II 1VQKZ 4K35A 1Q862 2PMZA 2ZAEB 1K9M1 1NP6A 1EDIA 3VMHA 4AYBA 3U50C 4NPEA 1QVGY 4BBSI 2GU2A 2BJOA 4RVDA 1K83I 2KZIA 4NBFA 1W2BZ 3CXCZ 3S1RI 3MZWB 3VMGA 3CCVZ 4A3DI 4A93I 3CCSZ 2OOYB 3M4OI 2QVAA 2RPRA 2LXBA 1RQFA 3GTMS 3S2DI 4A3KI 1VQ6Z 2G2KA 2P3YA 3I55Z 2QEX1 2NVQI 5FLXb 2DE5A 4ZNCA 4E32A 5D1PA 3J81b 2R93I 2V8KA 3F3FC 4EWCA 1RLYA 5T6BA 1U7JA 4QTUA 4MN4C 2DE7A 4NBDA 1VQM1 2O53A 1VQO1 4BXXI 2OTJ1 3GTMI 4E2ZA 3J80f 3EEDA 4NPFX 1YITZ 1VQ71 3TE5B 2B63I 3S1KA 2WAQA 3T4NB 3H0GI 3S17I 4NBHA 3CCQZ 1Q811 3J7A4 2JNYA 2E2JI 1LQLA 4A3FI 4Y52I 1L1OC 1YJW1 1Q2NA 4MD7A 1OVVA 4E33A 1LP1B 2I8DA 1OVRA 3GCFA 1BDDA 2E9HA 2M5AA 2Y0SA 3CC21 4K3AA 1DEEG 3HKZA 2QKDA 4ZMDA 1S72Z 1Y1VI 4CL1A 1VQ9Z 3ZDMA 1RO2A 3FKII 1TWAI 3CC41 1X3ZA 3M3YI 2VUMI 3GTPI 1WW9A 2JMOA 2JA5I 3NH8A 4HGYA 2O4HA 3VTNA 2F4MA 2PM9A 4A3MI 4BXLA 2GTHA 3CQZI 4NPDA 1FC2C 2RKLA 1USPA 3GTGI 1EDLA 5T67A 2M6NA 3H3VJ 3D6WA 1QVFZ 3NDIA 4A3CI 4IOIH 1Q822 3HOZI 3CCU1 4RVHA 1VQ41 1KC81 2KUBA 4E30A 1WIIA 5A2Qf 1VQ8Z 1S3JA 2AKLA 3IF8A 2R7ZI 2JA8I 2I3CA 5IT9f 5C3EI 1VLAA 1JWHC 1KQSY 5C39A 2DE6A 3VMIA 4S1TA 2RHBA 2RT9A 1YUAA 3IFUA 4NBGA 4A3LI 3CCL1 4X6AI 2NVTI 2F4OA 2RIQA 1YIJZ 3G71Z 3HOVI 5DJUB 4TNUA 4DGLA 3K7AI 1QVFY 5CBNA 2RBLA 4MD9A 2WB1A 1VQK1 1Q812 2R6MA 4CPGA 2OTL1 3OW2Y 3MONA 1Z02A 3I4NI 2SPZA 3MZLB 3PO3S 1RO0A 1NJI1 3LUSA 3HOXI 3I561 3CCR1 5FLMI 1Q821 1N8R2 2V8IA 1KRLA 4E2YA 2JA6I 2B87B 3CCS1 3CMA1 2HU9A 2KPIA 3CME1 4A3EI 3RZOI 1ML8A 1W2BY 3CXCY 2OOXB 2Q51A 2QEXZ 3FXDA 4E2XA 3CCE1 2JS4A 4NH1C 3S1MI 5AN9F 3FXEA 4RVFA 3HOWI 1I6HI 3I551 4BBRI 2UWJE 5D1OB 1NVOA 2KZJA 3IX0A 2KS1B 3CC71 1P9NA 1RO4A 3G6E1 2OZKA 1KD11 1RNIA 4NBEA 2QRXA 1VQN1 1X3WA 1I3QI 1KC82 1YJ9Z 4MH4A 1LT1A 2GTIA 3Q87A 3G4S1 3J80b 4DQYB 3HOUI 2LIYA 1QYPA 4NOZA 4EYYQ 2R44A 4E2WA 4HB1A 4KJMA 4RVGA 1YJWZ 1YI2Z 1TWHI 4MONA 4QTTA 1YJNZ 1N8R1 1Y47A 1ZXGA 2QA4Z 1JJ2Z 1K731 2NVXI 3GKQA 1TWCI 4A3GI 4NFRA 3MHVA 3GTKI 3CC4Z 2E2HI 3CPWZ 1H0TB 4RV9A 1VQ91 1VQPZ 2V8JA 5T64A 1VQLZ 2Q1KA 2J6AA 1VQ5Z 3JAMf 3NH4A 1YHQ1 3CCJ1 3NH5A 1ZB9A 1NJI2 1LP1A 1Y1WI 3NFZA 4MXUA 1Z01A 1MFTA 4NBCA 3BG1B 2KI7B 2IZ3A 1JMBA 2QRCB 3CCUZ 1VQ4Z 4ASVA 2PK7A 3PH0A 1TWGI 3CCM1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPF X;  2B89 A;  2B88 A;  3S1K A;  4HKZ H;  2B87 B;  2OTK E;  1Q2N A;  1X0T A;  1OVV A;  1LP1 B;  4GOE A;  2I8D A;  1OVR A;  2M0B A;  2P58 A;  4GOD A;  1BDD A;  2M5A A;  2WMM A;  3FXD A;  1BDC A;  4K3A A;  1SS1 A;  1DEE G;  3FXE A;  4WWI A;  4ZMD A;  2UWJ E;  2JWD A;  1NVO A;  3ZDM A;  2KZJ A;  2KS1 B;  1H0T A;  2HR3 A;  2KIK A;  2LXC B;  4HJG H;  2LR2 A;  2QRX A;  1JM0 A;  5DJT B;  1LT1 A;  1EDK A;  4BXL A;  4EYY Q;  2R44 A;  4HB1 A;  4KJM A;  4K35 A;  4NPD A;  1FC2 C;  2RKL A;  2ZAE B;  1EDI A;  1EDL A;  1Y47 A;  1ZXG A;  1EC5 A;  2M5A B;  4IOI H;  4NPE A;  2KZI A;  2KUB A;  1ZW0 A;  5EFW B;  3MHV A;  1S3J A;  1H0T B;  3MZW B;  3QWO C;  2Q1K A;  4ASW A;  1OVU A;  5CBO A;  5C39 A;  2QVA A;  2B87 A;  2K3R A;  1EDJ A;  2LXB A;  3RGU A;  1LP1 A;  5DJU B;  1U7M A;  5CBN A;  1MFT A;  2KI7 B;  1JMB A;  4ZNC A;  4CPG A;  5K5G B;  4JBZ A;  1U7J A;  4ASV A;  2SPZ A;  4MN4 C;  3PH0 A;  4GOF A; 
#chains in the Genus database with same CATH topology
 3T97 B;  1EXJ A;  2GUV A;  1S1C X;  2IZ0 A;  2FXM A;  1OZH A;  1RF1 C;  1BCC E;  2OYH A;  5IT9 b;  3Q2Y A;  1KD1 2;  1FZC B;  1X0T A;  3Q5P A;  2NVY I;  2JIP A;  2JIQ A;  1ZLL A;  1SQB K;  3EFF K;  1FZC C;  2H85 A;  3D71 A;  2JWD A;  1P84 E;  3CCV P;  3S16 I;  3V6I A;  1EZV I;  1N73 B;  1UII A;  2LR2 A;  2CK3 H;  2YO3 A;  4RO0 A;  1NTK K;  1FU1 A;  2QRE B;  3TGU E;  1N73 C;  3U1A A;  1NO4 A;  3CME Z;  3PO3 I;  1VQ6 1;  2A45 H;  2JDI H;  3KIH A;  3D2L A;  1IFN A;  1N2D C;  4XX2 A;  1Z03 A;  3R2P A;  2A06 G;  4ZKP A;  1EC5 A;  3NFQ A;  2EGT A;  1BGY E;  1VQO Z;  1AFO A;  3AEC C;  3S14 I;  3C9I A;  1VQ7 Z;  1NWQ A;  3G6E Z;  1YIT P;  2YU9 I;  3D6Z A;  3BAT A;  3QWO C;  3CCQ P;  4HH4 A;  1OVU A;  5CBO A;  5IP7 I;  2K3R A;  1KYO D;  1H89 A;  1YJ9 P;  3GTO I;  1Y1V S;  1S4X A;  3CC2 Z;  2E76 D;  4UB6 H;  3M91 A;  2W04 A;  1S72 P;  1K8A 2;  1DX7 A;  3VB9 A;  5K5G B;  3WUV A;  2JIO A;  1R5S A;  2KLV A;  3MUD A;  1QXF A;  1AQT A;  3TF5 A;  3GTL I;  1QVF O;  5B5E E;  4R4M A;  2ZYG A;  4XFJ A;  1T3J A;  1CZQ A;  1JJ2 Y;  3CCJ Z;  1NTZ J;  1VQ5 1;  3HD7 D;  3PO2 I;  3JAM b;  2WMM A;  3CPW Y;  1BDC A;  3RBX A;  1PPJ G;  2E76 B;  3EER A;  3HRN A;  2N1T D;  3V4W A;  5AW5 B;  1HGZ A;  1H0T A;  1VQ8 1;  3RZD I;  2HR3 A;  1Q7Y 2;  2E76 C;  3IN6 A;  1YYC A;  1NTZ D;  4HGZ A;  2P28 A;  1SQB G;  4N6J A;  4OVN F;  1EDK A;  2CPB A;  2K9Y A;  2KOG A;  4W80 A;  3G71 1;  1VQK Z;  1Q86 2;  3MTU E;  3CX5 H;  1FZF A;  5KLI B;  3VMH A;  1BCC G;  1NTK G;  4AYB A;  3IR7 A;  1QVG Y;  5CCH A;  4BBS I;  2GU2 A;  3HD7 B;  2BJO A;  3AEG C;  2KZI A;  2ZXE B;  5KLI C;  2R3C A;  1KB9 H;  4B86 A;  3U59 A;  2N1T B;  5BVZ A;  2AXT H;  2QVA A;  4Z1M H;  5KAF E;  1FZE A;  1ZR2 A;  3VMA A;  1RQF A;  5AVU B;  1VQ6 Z;  3CME P;  2N1T C;  2G2K A;  2P3Y A;  2H43 A;  3I55 Z;  1QL1 A;  1X8Y A;  4ZNC A;  3L72 E;  2E42 A;  5KTB A;  2OGU A;  5D1P A;  2R93 I;  3F3F C;  3CI9 A;  3A0H E;  2BEQ D;  2WTY A;  4EWC A;  1VQO P;  5T6B A;  1RY3 A;  2GM4 A;  3TYY A;  1S9K E;  1VQ7 P;  4BXX I;  3G6E P;  1BGY G;  2IZ1 A;  3TE5 B;  4NBH A;  1HF9 A;  2E2J I;  3VP8 A;  1KIL A;  3CC2 P;  4MD7 A;  4E33 A;  1LP1 B;  2JEE A;  1JY3 N;  2WWW A;  2O1J A;  1OVR A;  1BDD A;  2N9B A;  2W6J H;  5B66 H;  1HJB A;  3W67 A;  3NTN A;  2QKD A;  3WUU A;  1J1E B;  2WPS A;  2OYI B;  1PP9 J;  1TWA I;  3TDK A;  5BU8 B;  4DT0 A;  1JO5 A;  2QE7 H;  4LLH A;  2Q5U A;  1WW9 A;  2IBZ D;  2K1A A;  2O4H A;  2OYI C;  2Q9I A;  1FJK A;  2JJL A;  3SFD C;  4TLF A;  2OYH B;  2E7Z A;  1FC2 C;  2RKL A;  3O6Q A;  1EDL A;  1BSH A;  2KB7 P;  2HOD A;  1PP9 D;  4BWN A;  3VTP C;  2OYH C;  1JTH B;  2Z5I A;  2YKQ A;  1HTL C;  3SFE C;  2KUB A;  4E30 A;  1ZRT D;  1WII A;  5A2Q f;  1VQ8 Z;  1NH4 A;  2LEX A;  4ZKU A;  1SQB J;  5GTI E;  1NJI Q;  2R32 A;  2V7Q J;  2RMZ A;  3CCL P;  2DE6 A;  1YUA A;  4NBG A;  4XE5 B;  2NVT I;  2O1K A;  1YIJ Z;  3G71 Z;  5DJU B;  4TNU A;  2JO1 A;  1LT9 A;  1NTK J;  1VQK P;  1OW8 A;  5CBN A;  2RBL A;  4HH2 A;  2FXP A;  2WB1 A;  1KZU B;  5KLV J;  3PHL A;  2YO2 A;  2OTL 1;  3OW2 Y;  1SQB D;  5AVR B;  1Z02 A;  3I4N I;  1OXZ A;  2O01 H;  1AJY A;  1NJI 1;  2I1J A;  3AE9 C;  2R3S A;  3I56 1;  1L0L J;  5FLM I;  1KYO E;  1NTK D;  3BAS A;  3NMD A;  2C9N Y;  2KPI A;  4A3E I;  5KLV D;  2OQQ A;  3CCE P;  3M06 A;  1W2B Y;  2ITA A;  2W27 A;  1JNM A;  4E2X A;  3I55 P;  4GIF A;  3USS A;  4L73 A;  1FBM A;  1I6H I;  4L75 A;  3D70 A;  1L0L D;  4WBA A;  1P9N A;  1VQN P;  3L72 G;  3GF7 A;  4NBE A;  3FWL A;  1I3Q I;  1KC8 2;  4PJ0 E;  3MUD C;  3Q87 A;  4DQY B;  3HOU I;  4YTP C;  4E2W A;  5AVZ B;  1LTG C;  5CCH D;  1TWH I;  2Y9Y A;  2KSE A;  2QA4 Z;  2OYO A;  1TWC I;  4NFR A;  1M57 D;  3UIA A;  1KQS O;  1QL2 A;  1FOS E;  4DZO A;  1N7S A;  1NTZ E;  1HJ0 A;  2BCC J;  1H0T B;  2MKV A;  1VQP Z;  5H2F H;  1J2J B;  2Q3I A;  1PV3 A;  5APX A;  3WU2 E;  2Y9Z A;  1YHQ 1;  3H1K J;  3S4R A;  2YXQ B;  2R5B A;  5CJ0 A;  2KNC A;  2MJZ A;  4EI2 A;  2QRC B;  2BCC D;  1NTZ K;  3AE5 C;  3B5N A;  2PK7 A;  3PH0 A;  3AEA C;  3IFM A;  1JY3 O;  2Q4Z A;  3H1K D;  1PFT A;  2JUB A;  5A2Q b;  3CD6 Z;  1KIL D;  3M0A A;  4HKZ H;  4JQ0 D;  2I1K A;  2YMY A;  2K9J A;  1YIJ P;  3G71 P;  2K5R A;  1NOH A;  5AVT B;  2M48 A;  2E2I I;  2FY8 A;  3GF3 A;  4MRI A;  1IJD B;  3BVH A;  1Z56 A;  1QLE D;  2PP6 A;  2OTL Z;  2FXO A;  4WB4 A;  2VUG A;  3BCC G;  2W90 A;  1YQ3 C;  1KQL A;  2R92 I;  4A3B I;  4QMA A;  3I56 Z;  2QJP B;  2LXC B;  3F3P C;  4HJG H;  5TJH A;  1WJ2 A;  4NB9 A;  2ZVO B;  1VDF A;  1TU3 F;  1M1K Q;  1MZ9 A;  5IP9 I;  2NRG A;  3SSU A;  1IO4 A;  1KIL B;  3AED C;  1T2K D;  1KMI Z;  3NDJ A;  4M3L A;  3MZK B;  4A3J I;  3KZI H;  1KIL C;  2M3E A;  1ZW0 A;  5EFW B;  4DCK A;  4RS4 A;  1OMI A;  2IBZ E;  3L35 A;  1NYH A;  1M1K 1;  2G8Y A;  3PP5 A;  2GUS A;  4MD8 A;  1U7M A;  3CX5 D;  1FZG A;  1PP9 E;  3RK2 D;  1H88 A;  4D6T J;  1RQU A;  3O6Q B;  1PIX A;  1GW3 A;  3I07 A;  2DW3 A;  3GHG B;  1YI2 1;  2QA4 P;  2OAR A;  1ZRT E;  2HOD B;  5D1O A;  4RES B;  3KXD A;  1YJN 1;  3V2R A;  2J5U A;  2YXR B;  5E79 H;  1LGH B;  3RL0 D;  1KB9 D;  3GHG C;  2VF1 A;  5CJ4 A;  1S7M A;  3P5J B;  4NBB A;  1VQP P;  2B89 A;  2WPR A;  3QH9 A;  3H1H J;  2W03 A;  1FS0 E;  1T2K C;  3CXH I;  1VQL 1;  1YHQ Z;  1NTZ G;  4D6T D;  4NBA A;  4E31 A;  2M0B A;  2P58 A;  1K9M Q;  1SQB E;  2KK7 A;  3H25 A;  1MKM A;  2P7J A;  3G3Z A;  3RK2 B;  1LTI C;  3H1H D;  3GTJ I;  2C9L Y;  1BE3 J;  3WUT A;  1NTK E;  3MD0 A;  3RK2 C;  1OIP A;  3CD6 P;  5KLV E;  3RL0 B;  4A3I I;  2JIM A;  1K9M 1;  1EDI A;  3ABV C;  2O3J A;  3RL0 C;  1JY2 P;  3BCC J;  1L0L E;  3Q5S A;  1N7S D;  1BE3 D;  4RVD A;  1K83 I;  3P8C D;  3Q5R A;  4NBF A;  3CXC Z;  3P8M C;  3M9H A;  3S1R I;  3I56 P;  1SQX J;  3CCS Z;  3CWB J;  5KLV K;  3M4O I;  1EZV G;  1IFM A;  1CSB A;  3L73 G;  3GTM S;  3S2D I;  3TK1 A;  3BCC D;  2KYV A;  1L0L K;  1MUU A;  2HPC A;  2QEX 1;  3VN0 A;  2AEM A;  3B5N D;  1AV1 A;  2V4H A;  1SQX D;  3CWB D;  1S2E A;  1VQM 1;  2O01 N;  2WSS H;  2OTJ 1;  3GTM I;  3A2A A;  4E2Z A;  1N7S B;  2O01 J;  2NPS A;  3S1K A;  3CPW O;  2IBZ G;  1FJP A;  5B5E H;  4A3F I;  1N7S C;  1JCC A;  4OH8 B;  1Q2N A;  1FE6 A;  2WQY C;  3E1I A;  4H13 D;  2I8D A;  5M1B A;  2KNC B;  2E9H A;  2Y0S A;  2BCC E;  4K3A A;  3GMA A;  1HGV A;  1Y1V I;  1VQ9 Z;  3LID A;  1RO2 A;  3FKI I;  1PP9 G;  3H1K E;  3CC4 1;  1X3Z A;  1FZA A;  3B5N B;  3TNU A;  2H7H A;  1KIL E;  5KAI H;  2VPY A;  2VUM I;  2JMO A;  2W6A A;  2IYP A;  2AXC A;  2FKW B;  3FWN A;  1R5L A;  1Y8C A;  3VTN A;  3AE3 C;  4UB6 E;  1AA0 A;  4BXL A;  3B5N C;  2PGD A;  3AE6 C;  3KDP B;  1DD4 A;  1QVG O;  4NPD A;  1GZL A;  1NU1 J;  2K9J B;  3K5B A;  1USP A;  3GTG I;  2WSE H;  3CCU P;  1W5C E;  3IF4 A;  1QVF Z;  3NDI A;  4IOI H;  4RVH A;  2NZ2 A;  4H13 B;  2JR8 A;  3V4Q A;  2R7Z I;  2JA8 I;  2I3C A;  4H13 C;  4H44 B;  1VLA A;  4IFD K;  1X22 A;  4A3L I;  2QIW A;  1HWT C;  1NU1 D;  3FGA D;  4DGL A;  1QVF Y;  5KLV G;  1OW6 A;  4PD4 D;  1Q81 2;  2FBW C;  3HE5 A;  2E5Y A;  1RF0 C;  3MON A;  3GW6 A;  3HD7 C;  2VPZ A;  2GA1 A;  1RO0 A;  1L0L G;  3HUS A;  3CCR 1;  3EQ2 A;  1KD1 Q;  3A0B H;  3L73 J;  3A0H H;  3CCS P;  3U1C A;  1P84 I;  1Q90 D;  4E2Y A;  1YTZ I;  3CX5 E;  2CPS A;  1GU5 A;  4O9B A;  2OOX B;  2QEX Z;  1R8E A;  4NH1 C;  5AN9 F;  1NAY A;  3HOW I;  1EZV D;  1KB9 E;  1SLQ A;  4BBR I;  2UWJ E;  5D1O B;  2KZJ A;  3L73 D;  3CC7 1;  4KT0 J;  1PL5 A;  3H6P A;  1KD1 1;  2AXT E;  1RNI A;  1SQP K;  4D6T E;  2BEZ F;  3G4S 1;  1OX3 A;  2R44 A;  1G1I A;  4HB1 A;  4IL6 H;  1M1J A;  2BAS A;  4KJM A;  1YTZ T;  4DOJ A;  1JY2 N;  3E7K A;  1PGO A;  1Y47 A;  2A45 G;  3H1H E;  3L75 J;  5TIS H;  4A3G I;  3HE4 A;  3AEE C;  1VQ9 P;  2Q3E A;  1J1E C;  1SFC A;  2IV2 X;  3GTK I;  1USD A;  3CC4 Z;  2BCC G;  1NHL A;  3A5T A;  1WRG A;  1LWU A;  2V8J A;  5T64 A;  3CCJ P;  2J6A A;  1VQ5 Z;  1IFI A;  2IDB A;  3H1K G;  3NH4 A;  1SIW A;  1AA6 A;  1ZB9 A;  3EFG A;  1L4A A;  3OW2 O;  4MXU A;  2QG4 A;  2QM8 A;  5B66 E;  1MFT A;  2IZ3 A;  1BE3 E;  1JMB A;  4A7P A;  3P8C E;  1GK6 A;  3KPE A;  5AW2 B;  2WT7 A;  3L71 J;  3MP7 B;  4ASV A;  2NPS D;  4GT1 A;  5AW4 B;  1TWG I;  4W7Y A;  4LC1 A;  1W2B O;  1N7L A;  3BCC E;  1G1J A;  4U3F J;  4BY1 I;  1LTA C;  3L71 D;  1TWF I;  1SQX E;  1SQV J;  2XZR A;  4C46 A;  1Q7Y Q;  3CWB E;  2HPC B;  4DK1 A;  1IC2 A;  2PAJ A;  2Y0C A;  3PRJ A;  2RN0 A;  1M1K 2;  3EWK A;  5LL6 f;  3I4M I;  1IZN B;  3L74 J;  2QSI A;  3CCR Z;  3CCV 1;  1USE A;  4W7Z A;  1K73 2;  1ZME C;  3BRT B;  1JM0 A;  4U3F D;  3T97 A;  2NPS B;  2R5D A;  1VQ6 P;  3KYQ A;  5APW A;  2IZ4 A;  3S15 I;  1SQV D;  2NPS C;  1SQX K;  4N3Y B;  2QEX P;  1Q7Y 1;  1Q16 A;  3L74 D;  2D2C D;  2HYN A;  3TGU J;  1IK7 A;  4OGQ D;  1IFP A;  3CC7 Z;  2YAD A;  1GMJ A;  3G9R A;  3CXH H;  1Q86 1;  2JIR A;  1XTC C;  4ASW A;  1YIT 1;  1DH3 A;  2W8Z A;  2LFU A;  1LJ2 A;  1EDJ A;  3G4S Z;  3CCQ 1;  4C7N A;  1N86 A;  3RGU A;  2M8R A;  1YJ9 1;  3R4Y A;  1WCM I;  5GTH H;  5APQ A;  3IAO A;  1I50 I;  4D6T G;  1USP B;  3WU2 H;  5C4X I;  3CL3 D;  1S72 1;  4GOF A;  1HUC A;  1A02 F;  1Y8A A;  1M90 Q;  4I2L C;  3HTK A;  3H1H G;  3NXS A;  1K9M 2;  1NU1 E;  2D2C B;  2K37 A;  1R9T I;  4OGQ B;  1VQ5 P;  1N2F A;  2OTK E;  3SWK A;  4JYC A;  1OWA A;  3AE4 C;  3VP9 A;  2D2C C;  4PD4 E;  1NGM B;  5AW7 B;  4NB8 A;  4GOD A;  4OGQ C;  1KQS Z;  2L5G B;  3SWY A;  2P67 A;  1KFN A;  1ZH1 A;  3HE5 B;  1VQ8 P;  2V3V A;  4BY7 I;  3KIF A;  5H2F E;  5CCH C;  2IFM A;  1L2P A;  1BE3 G;  1SQQ J;  2QJK B;  1H8A A;  1M90 1;  1NU1 K;  1JY2 O;  3HUS B;  3M0D A;  3L36 A;  5CM2 M;  3ESW A;  4TT3 H;  4H0L D;  2QJK C;  1EXI A;  3H1J J;  5AW1 B;  1DL6 A;  2QR1 B;  1NTM K;  1X79 B;  2Q6Q A;  3HUS C;  4IFM A;  1M56 D;  1K04 A;  1NP6 A;  4BRY A;  2P10 A;  1EZV E;  3GG2 A;  2V45 A;  1SFC D;  4NPE A;  3L73 E;  1SQQ D;  3P7K A;  2WSE J;  2ZYD A;  2KXP B;  3F89 A;  2ZT9 D;  3MZW B;  1FZB A;  4YXD C;  1SQX G;  3CCV Z;  4A3D I;  3CWB G;  3H1J D;  2OOY B;  2QJP C;  2ZFC A;  1L4A D;  2Q7C A;  2RPR A;  1J1D B;  2KLU A;  2H88 C;  1SQP J;  3H1L J;  1FDO A;  4A3K I;  1KYO I;  1M1J B;  4H0L B;  1J1D C;  2NVQ I;  4UB8 E;  2FYZ A;  4E32 A;  1LTJ A;  2V8K A;  2VPX A;  5APS A;  1HH0 A;  1M1J C;  2PFX A;  4H0L C;  2P2U A;  3HE4 B;  4IL6 X;  4NBD A;  4Y99 B;  1VQO 1;  2XU6 A;  1SFC B;  3EED A;  3AEB C;  1S5L H;  1SQP D;  3H1L D;  1YIT Z;  1VQ7 1;  1LWU B;  3T4N B;  3H0G I;  2XV5 A;  3CCQ Z;  4Y99 C;  1SFC C;  2JNY A;  2ZT9 B;  4N78 D;  1LQL A;  5L8R J;  1L1O C;  1YJW 1;  1OVV A;  2E74 D;  1L4A B;  3N7N A;  1LWU C;  3GCF A;  1KFM A;  3CC2 1;  1DEB A;  2M5A A;  2YMK A;  2JKV A;  2ZT9 C;  1DEE G;  2J58 A;  3GLM A;  1S72 Z;  3AEF C;  1IFD A;  1L4A C;  3ZDM A;  3H32 A;  3JCU H;  1KC8 Q;  2HFE D;  3PTZ A;  3RBZ A;  1JMM A;  2WT7 B;  1SP4 A;  3M3Y I;  3GTP I;  2JA5 I;  2E5T A;  3NH8 A;  4HGY A;  1YQ4 C;  2F4M A;  2PM9 A;  2Z5H A;  2ZVN B;  1LT9 B;  1PZQ A;  3CQZ I;  3L71 E;  3JC2 2;  1NU1 G;  2Y0D A;  1HVV A;  2M6N A;  2RH0 A;  2WSF H;  3D6W A;  1T3U A;  1LT9 C;  4A3C I;  3HOZ I;  5E79 E;  1NKN A;  2E74 B;  1VQ4 1;  1KC8 1;  4R4L A;  2AKL A;  3IF8 A;  1P84 H;  4U3F E;  4EDF A;  5C3E I;  2E74 C;  3O8Z A;  2Z4E A;  1Q82 Q;  3VMY A;  3VMI A;  4S1T A;  2RHB A;  2RT9 A;  1PGJ A;  1SQV E;  3CCL 1;  3V5B A;  4X6A I;  2N9Y B;  2RIQ A;  1UIX A;  3K7A I;  3D6Y A;  5AW3 B;  2OTL P;  5CCG A;  4MD9 A;  3L74 E;  2VRS A;  1VQK 1;  2H89 C;  5AVQ B;  4CPG A;  1JY3 P;  2FYU J;  1JTH A;  3CLQ A;  1OW7 A;  1L0N J;  2SPZ A;  3MZL B;  3PO3 S;  1HBW A;  1ZR4 A;  1AQ5 A;  2J59 M;  1RE4 A;  1Q82 1;  1GL2 A;  1SQV K;  2V8I A;  1KRL A;  2NAP A;  2JA6 I;  2H8P D;  3CMA 1;  2HU9 A;  4C7N B;  3RZO I;  4WVZ A;  1AVO A;  1KN7 A;  3CXC Y;  1A02 J;  1ZP0 C;  2FYU D;  2Q51 A;  1RH5 B;  4XA4 A;  3FXD A;  4GKG A;  3CCE 1;  1L0N D;  1N8R Q;  4PV1 D;  3FXE A;  1GTW A;  3I55 1;  1Y9B A;  1NVO A;  1VL2 A;  3IX0 A;  1SVF A;  1RO4 A;  2OZK A;  3B71 A;  1PFI A;  2QRX A;  3L70 J;  1VQN 1;  3L37 A;  4I1L A;  3HTK B;  1X3W A;  4MH4 A;  2GTI A;  2IBZ I;  4NOZ A;  1X9V A;  1YJW Z;  1YI2 Z;  4MON A;  1MFZ A;  4QTT A;  1YJN Z;  4H44 D;  1N8R 1;  3VMX A;  2YNY A;  3L75 G;  1JJ2 Z;  2NVX I;  3L70 D;  1T8Z A;  3C8V A;  3MHV A;  1PGQ A;  3V2N A;  4PV1 B;  3CPW Z;  3F5H A;  3L4F A;  3ITK A;  2QM7 A;  1VQL Z;  2POH A;  2LKM A;  1YHQ P;  3V2P A;  4PV1 C;  2E75 D;  1NJI 2;  3NH5 A;  2AEF A;  3M0D C;  1SQQ E;  3BG1 B;  1JCD A;  3N4X A;  4BRY B;  1NTM J;  4OWF A;  3H1I J;  1AVY A;  1VQ4 Z;  3L71 G;  4JPZ B;  5KAI E;  4AYC A;  1KV4 A;  3H1J E;  1RE3 A;  2WSC H;  1W2E A;  3CCM 1;  3CXH D;  1GW4 A;  1QVG Z;  3OA7 A;  4EOT A;  1IK9 A;  1KQG B;  2XKM A;  4H44 C;  4C7R A;  2HLO A;  5C44 I;  3CCL Z;  3Q1M A;  4U3F G;  5KAF H;  1NTM D;  1SQQ K;  4AQR D;  3H1I D;  4GOE A;  3MGN A;  1NAF A;  3LW5 H;  5AW9 B;  3BG0 B;  1YIJ 1;  1SS1 A;  1SQV G;  2E75 B;  1LTJ B;  3PLN A;  5KKZ B;  3HOY I;  3L74 G;  1SQP E;  2JR6 A;  2E75 C;  3H1L E;  2KIK A;  1QF8 A;  1LTJ C;  3D9X A;  5CHX A;  5KKZ C;  4N78 E;  4AUW A;  5DJT B;  2QLV B;  1WZN A;  3RK3 D;  3FQQ A;  1LNQ A;  3CMA Z;  5FLX f;  3TDH B;  3J81 f;  1RHZ B;  1YBK A;  1OFC X;  3S1Q I;  1M7L A;  1S5L X;  3CCE Z;  2WVR A;  3AE1 C;  2M5A B;  1CI6 A;  1VQM Z;  3S1N I;  2OTJ Z;  1URQ A;  3TGU G;  1KOR A;  3A0B E;  3H32 B;  2JA7 I;  4KHX A;  1FAV A;  1VQN Z;  1E5W A;  2B87 A;  1KTM A;  2QRD B;  4L76 A;  5CCG D;  2A06 D;  3QWU A;  1YJW P;  4EIJ A;  1YI2 P;  1M90 2;  3RK3 B;  1YJN P;  1LTB C;  2A45 I;  1ZB8 A;  2JWA A;  4Y28 J;  1T6A A;  2KS1 A;  4JBZ A;  2QA4 1;  1GL2 D;  3RK3 C;  2HG5 D;  3WMM 0;  1K8A Q;  2AYD A;  3FQM A;  5C4J I;  1VQL P;  5GTI H;  2B88 A;  2C0W A;  5AW8 B;  4IL6 E;  1VQP 1;  3L75 D;  2AEJ A;  5APT A;  1JEK A;  1RQV A;  3S9O A;  3M9B A;  3S2H I;  5TIS E;  4U7J A;  3AE8 C;  4WWI A;  1K05 A;  3GHG A;  3GTQ I;  1YUK A;  1TFI A;  2WIT A;  1VQ4 P;  2HF1 A;  1SFO I;  1SQQ G;  5AVS B;  1NUI A;  2W6B A;  5CCG C;  3CCM Z;  1K8A 1;  3A7O A;  3AE7 C;  5KJ7 A;  4Y7N I;  2KSJ A;  2L91 A;  3OW2 Z;  1GL2 B;  1KYO H;  3H1J G;  4RJT A;  2G3A A;  1G2C A;  4RKU J;  3CD6 1;  2FYU E;  1GU4 A;  4K35 A;  2PMZ A;  1L0N E;  1RE4 C;  1DD3 A;  1PPJ D;  2ZAE B;  4WY4 A;  1GL2 C;  3KQG A;  4JYB A;  4LGD E;  2FFD A;  4YPC A;  1BCC J;  3U50 C;  2WZ7 A;  2IX7 C;  3E1R A;  1RF1 A;  2ZXX A;  2WSF J;  1W2B Z;  1Q86 Q;  3RL0 g;  1KQF B;  3VMG A;  3JSV C;  4DJG A;  4A93 I;  1JB0 J;  2XND H;  3PJS K;  5AW0 B;  2WPV B;  2FYU K;  1FZC A;  1SQP G;  1Q81 Q;  2LXB A;  1L0N K;  3H1L G;  3B8E B;  3CMA P;  4PJ0 H;  3II6 A;  1BCC D;  2QJY B;  5FLX b;  2DE5 A;  3CX5 I;  3J81 b;  3L70 E;  1GK4 A;  2QJY C;  2KP8 A;  1RLY A;  1VQM P;  5AVX B;  1U7J A;  2OTJ P;  3VOP A;  4QTU A;  1N73 A;  3TNU B;  4MN4 C;  2DE7 A;  2O53 A;  1P84 D;  3J80 f;  4NPF X;  1BGY J;  1JOC A;  1KB9 I;  2B63 I;  2WAQ A;  1DIP A;  3S17 I;  1Q81 1;  3J7A 4;  4Y52 I;  3TGU D;  5APU A;  2P1J A;  3W68 A;  3HKZ A;  2C0X A;  4ZMD A;  4CL1 A;  1QX8 A;  3CC4 P;  4PD4 H;  1BGY D;  3CXH E;  5AW6 B;  2ZYA A;  2W83 C;  1NTM E;  4A3M I;  3H1I E;  1QEX A;  5GTH E;  2GTH A;  1RE3 C;  1WMK A;  3TSI A;  5T67 A;  1URQ D;  3H3V J;  1Q82 2;  3CCU 1;  3MIW A;  2IYO A;  3OJA B;  2YIU B;  2YKO A;  1S3J A;  2E43 A;  3CCM P;  5IT9 f;  4YXW H;  1JWH C;  1KQS Y;  3RK3 E;  1FDI A;  1PGP A;  5C39 A;  2JP3 A;  2YIU C;  3IFU A;  2F4O A;  3HOV I;  3Q3D A;  3M9Q A;  4I6M C;  3SWF A;  1U57 A;  2R6M A;  1FOS F;  1VPC A;  3OAK A;  2FYU G;  3VMZ A;  1CI6 B;  2VPW A;  4IFF A;  1L0N G;  3CCR P;  1URQ B;  5APY A;  1LTS C;  1MV8 A;  3BRV B;  4UB8 H;  3LUS A;  1JUN A;  3HOX I;  3VYI A;  3FX0 A;  2Y0E A;  1ZOY C;  1N8R 2;  3A3Y B;  1URQ C;  2A06 E;  2WSC J;  2B87 B;  2IPP A;  2IFN A;  3CCS 1;  1M8O B;  2M3B A;  3CME 1;  2K88 A;  1ML8 A;  5AVY B;  1RF0 A;  2WPQ A;  1BSN A;  2JS4 A;  3S1M I;  1VF5 D;  2YKP A;  3HD7 A;  1LTT C;  4RVF A;  3CC7 P;  1K73 Q;  3LW5 J;  4L74 A;  1WT6 A;  5KJ7 D;  2KS1 B;  4GDO A;  3G6E 1;  2N1T A;  3L72 J;  1GD2 E;  3L70 G;  3G4S P;  5AVW B;  3L75 E;  3KHU A;  1YJ9 Z;  1NKZ B;  5CMZ A;  1LT1 A;  3C1L A;  3I5C A;  3J80 b;  2LIY A;  4WY4 D;  1E79 H;  1QYP A;  3IR9 A;  4EYY Q;  2ZJS E;  4RVG A;  3KZI E;  1GDT A;  1ZXG A;  3V2Q A;  1K73 1;  3GKQ A;  3L72 D;  1QGK B;  2V7Q H;  2FYN B;  1S5L E;  1VF5 B;  2E2H I;  3B4S A;  4RV9 A;  1VQ9 1;  4I7Z B;  1S9K D;  1CW5 A;  2Q1K A;  4JF7 A;  1IFJ A;  3P32 A;  2FYN C;  1FDM A;  1VF5 C;  3JAM f;  1PPJ E;  3LIE A;  3CCJ 1;  1LP1 A;  4I7Z C;  5APV A;  1Y1W I;  3NFZ A;  1G2C B;  1Z01 A;  5KJ7 C;  1XTG B;  4NBC A;  2PRR A;  2KI7 B;  1NTM G;  4WY4 B;  3H1I G;  2B9B A;  1ZV8 A;  2XNX A;  2FFD B;  3JCU E;  3CCU Z;  3AE2 C;  1ZN5 A;  2OYI A;  4PD4 I;  5AVV B;  2XDJ A;  1EQ7 A;  1RF1 B;  1D7M A;  4WY4 C;  4HYT B;  5BU5 A;  2FFD C; 
#chains in the Genus database with same CATH homology
 2Q4Z A;  1QVG Z;  1PFT A;  2JUB A;  5A2Q b;  3CD6 Z;  4HKZ H;  5IT9 b;  5C44 I;  3CCL Z;  1KD1 2;  4BY1 I;  1X0T A;  2K5R A;  4GOE A;  2M48 A;  2E2I I;  2NVY I;  4MRI A;  3BG0 B;  1YIJ 1;  1TWF I;  1SS1 A;  4DK1 A;  2OTL Z;  2VUG A;  2H85 A;  2JWD A;  1M1K 2;  3S16 I;  3HOY I;  5LL6 f;  3I4M I;  2R92 I;  2JR6 A;  4A3B I;  2KIK A;  3I56 Z;  3CCR Z;  2LXC B;  1QF8 A;  4HJG H;  3F3P C;  3CCV 1;  2LR2 A;  1K73 2;  3D9X A;  1JM0 A;  5DJT B;  2QRE B;  2QLV B;  4NB9 A;  3FQQ A;  3CMA Z;  5IP9 I;  3CME Z;  2IZ4 A;  3S15 I;  5FLX f;  3PO3 I;  1VQ6 1;  3TDH B;  3J81 f;  3KIH A;  4XX2 A;  1Z03 A;  3S1Q I;  3CCE Z;  1EC5 A;  2EGT A;  1Q7Y 1;  3NDJ A;  2M5A B;  1VQM Z;  1VQO Z;  3S1N I;  3MZK B;  2OTJ Z;  4A3J I;  1ZW0 A;  5EFW B;  3CC7 Z;  3S14 I;  2YAD A;  1VQ7 Z;  4RS4 A;  3G6E Z;  2JA7 I;  1Q86 1;  2YU9 I;  1VQN Z;  3QWO C;  4ASW A;  4HH4 A;  1OVU A;  5CBO A;  1YIT 1;  2B87 A;  5IP7 I;  2K3R A;  2LFU A;  1EDJ A;  3G4S Z;  2QRD B;  1M1K 1;  1Y1V S;  3CCQ 1;  3GTO I;  3RGU A;  3CC2 Z;  3QWU A;  1YJ9 1;  1WCM I;  4MD8 A;  1U7M A;  1I50 I;  2W04 A;  1K8A 2;  1M90 2;  1USP B;  1ZB8 A;  3I07 A;  1YI2 1;  3VB9 A;  5C4X I;  5D1O A;  1S72 1;  5K5G B;  1YJN 1;  4JBZ A;  2QA4 1;  3GTL I;  4GOF A;  2VF1 A;  1S7M A;  3P5J B;  4NBB A;  2B89 A;  1K9M 2;  3FQM A;  5C4J I;  2B88 A;  2W03 A;  1R9T I;  1N2F A;  1VQP 1;  2OTK E;  1JJ2 Y;  1VQL 1;  1YHQ Z;  3CCJ Z;  4NBA A;  4E31 A;  1VQ5 1;  3PO2 I;  4NB8 A;  2M0B A;  4GOD A;  2P58 A;  3JAM b;  1KQS Z;  3S2H I;  2WMM A;  3CPW Y;  1BDC A;  4WWI A;  1ZH1 A;  3EER A;  3GTQ I;  1YUK A;  1TFI A;  4BY7 I;  3KIF A;  2HF1 A;  1H0T A;  1SFO I;  3GTJ I;  1VQ8 1;  1NUI A;  3RZD I;  2HR3 A;  3CCM Z;  1K8A 1;  1M90 1;  1Q7Y 2;  4Y7N I;  3OW2 Z;  4HGZ A;  2P28 A;  5CM2 M;  3ESW A;  1EDK A;  1DL6 A;  2QR1 B;  3CD6 1;  3G71 1;  4A3I I;  1VQK Z;  4K35 A;  1Q86 2;  2PMZ A;  2ZAE B;  1K9M 1;  1NP6 A;  1EDI A;  3VMH A;  4AYB A;  3U50 C;  4NPE A;  1QVG Y;  4BBS I;  2GU2 A;  2BJO A;  4RVD A;  1K83 I;  2KZI A;  4NBF A;  1W2B Z;  3CXC Z;  3S1R I;  3MZW B;  3VMG A;  3CCV Z;  4A3D I;  4A93 I;  3CCS Z;  2OOY B;  3M4O I;  2QVA A;  2RPR A;  2LXB A;  1RQF A;  3GTM S;  3S2D I;  4A3K I;  1VQ6 Z;  2G2K A;  2P3Y A;  3I55 Z;  2QEX 1;  2NVQ I;  5FLX b;  2DE5 A;  4ZNC A;  4E32 A;  5D1P A;  3J81 b;  2R93 I;  2V8K A;  3F3F C;  4EWC A;  1RLY A;  5T6B A;  1U7J A;  4QTU A;  4MN4 C;  2DE7 A;  4NBD A;  1VQM 1;  2O53 A;  1VQO 1;  4BXX I;  2OTJ 1;  3GTM I;  4E2Z A;  3J80 f;  3EED A;  4NPF X;  1YIT Z;  1VQ7 1;  3TE5 B;  2B63 I;  3S1K A;  2WAQ A;  3T4N B;  3H0G I;  3S17 I;  4NBH A;  3CCQ Z;  1Q81 1;  3J7A 4;  2JNY A;  2E2J I;  1LQL A;  4A3F I;  4Y52 I;  1L1O C;  1YJW 1;  1Q2N A;  4MD7 A;  1OVV A;  4E33 A;  1LP1 B;  2I8D A;  1OVR A;  3GCF A;  1BDD A;  2E9H A;  2M5A A;  2Y0S A;  3CC2 1;  4K3A A;  1DEE G;  3HKZ A;  2QKD A;  4ZMD A;  1S72 Z;  1Y1V I;  4CL1 A;  1VQ9 Z;  3ZDM A;  1RO2 A;  3FKI I;  1TWA I;  3CC4 1;  1X3Z A;  3M3Y I;  2VUM I;  3GTP I;  1WW9 A;  2JMO A;  2JA5 I;  3NH8 A;  4HGY A;  2O4H A;  3VTN A;  2F4M A;  2PM9 A;  4A3M I;  4BXL A;  2GTH A;  3CQZ I;  4NPD A;  1FC2 C;  2RKL A;  1USP A;  3GTG I;  1EDL A;  5T67 A;  2M6N A;  3H3V J;  3D6W A;  1QVF Z;  3NDI A;  4A3C I;  4IOI H;  1Q82 2;  3HOZ I;  3CCU 1;  4RVH A;  1VQ4 1;  1KC8 1;  2KUB A;  4E30 A;  1WII A;  5A2Q f;  1VQ8 Z;  1S3J A;  2AKL A;  3IF8 A;  2R7Z I;  2JA8 I;  2I3C A;  5IT9 f;  5C3E I;  1VLA A;  1JWH C;  1KQS Y;  5C39 A;  2DE6 A;  3VMI A;  4S1T A;  2RHB A;  2RT9 A;  1YUA A;  3IFU A;  4NBG A;  4A3L I;  3CCL 1;  4X6A I;  2NVT I;  2F4O A;  2RIQ A;  1YIJ Z;  3G71 Z;  3HOV I;  5DJU B;  4TNU A;  4DGL A;  3K7A I;  1QVF Y;  5CBN A;  2RBL A;  4MD9 A;  2WB1 A;  1VQK 1;  1Q81 2;  2R6M A;  4CPG A;  2OTL 1;  3OW2 Y;  3MON A;  1Z02 A;  3I4N I;  2SPZ A;  3MZL B;  3PO3 S;  1RO0 A;  1NJI 1;  3LUS A;  3HOX I;  3I56 1;  3CCR 1;  5FLM I;  1Q82 1;  1N8R 2;  2V8I A;  1KRL A;  4E2Y A;  2JA6 I;  2B87 B;  3CCS 1;  3CMA 1;  2HU9 A;  2KPI A;  3CME 1;  4A3E I;  3RZO I;  1ML8 A;  1W2B Y;  3CXC Y;  2OOX B;  2Q51 A;  2QEX Z;  3FXD A;  4E2X A;  3CCE 1;  2JS4 A;  4NH1 C;  3S1M I;  5AN9 F;  3FXE A;  4RVF A;  3HOW I;  1I6H I;  3I55 1;  4BBR I;  2UWJ E;  5D1O B;  1NVO A;  2KZJ A;  3IX0 A;  2KS1 B;  3CC7 1;  1P9N A;  1RO4 A;  3G6E 1;  2OZK A;  1KD1 1;  1RNI A;  4NBE A;  2QRX A;  1VQN 1;  1X3W A;  1I3Q I;  1KC8 2;  1YJ9 Z;  4MH4 A;  1LT1 A;  2GTI A;  3Q87 A;  3G4S 1;  3J80 b;  4DQY B;  3HOU I;  2LIY A;  1QYP A;  4NOZ A;  4EYY Q;  2R44 A;  4E2W A;  4HB1 A;  4KJM A;  4RVG A;  1YJW Z;  1YI2 Z;  1TWH I;  4MON A;  4QTT A;  1YJN Z;  1N8R 1;  1Y47 A;  1ZXG A;  2QA4 Z;  1JJ2 Z;  1K73 1;  2NVX I;  3GKQ A;  1TWC I;  4A3G I;  4NFR A;  3MHV A;  3GTK I;  3CC4 Z;  2E2H I;  3CPW Z;  1H0T B;  4RV9 A;  1VQ9 1;  1VQP Z;  2V8J A;  5T64 A;  1VQL Z;  2Q1K A;  2J6A A;  1VQ5 Z;  3JAM f;  3NH4 A;  1YHQ 1;  3CCJ 1;  3NH5 A;  1ZB9 A;  1NJI 2;  1LP1 A;  1Y1W I;  3NFZ A;  4MXU A;  1Z01 A;  1MFT A;  4NBC A;  3BG1 B;  2KI7 B;  2IZ3 A;  1JMB A;  2QRC B;  3CCU Z;  1VQ4 Z;  4ASV A;  2PK7 A;  3PH0 A;  1TWG I;  3CCM 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...