3CCL1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccl100
3CCJ1 3CC7Z 1NJI1 1NJI2 1YJ9Z 1VQP1 1KC81 1KC82 3CCE1 3CCR1 1YIJZ 1VQL1 1YI21 3I56Z 3G6EZ 1Q821 3CCU1 3CCS1 3CCM1 1VQ91 3CC2Z 1YJN1 1K8A2 3CD6Z 3G711 3OW2Y 3CC41 1M1K2 3OW2Z 1Q7Y1 1YITZ 3CCQ1 1VQKZ 3I55Z 3CCLZ 3CCVZ 1VQMZ 2OTJ1 1QVGY 1VQ41 1Q822 1VQO1 1K9M1 1VQNZ 1K9M2 3G4SZ 2OTL1 2QEXZ 3CPWY 1QVGZ 1W2BY 3CCJZ 3CPWZ 1M901 1VQPZ 1YHQ1 3CCEZ 3CCRZ 1VQ51 1W2BZ 3CMA1 1YI2Z 1YJW1 1VQ81 1JJ2Y 1VQ61 2QA41 1JJ2Z 3CCUZ 1Q861 1Q7Y2 1Q862 1VQ71 3CCSZ 3CXCY 3CCMZ 1VQ9Z 1K731 3CME1 1S721 1YJNZ 1QVFY 3CXCZ 3G71Z 3CC71 1YJ91 1QVFZ 3CC4Z 1VQK1 3I551 1YIJ1 3I561 3G6E1 3CCQZ 1M902 1VQLZ 1N8R1 2OTJZ 1N8R2 1VQ4Z 1VQOZ 2OTLZ 1Q811 1Q812 3CC21 3CD61 1KD11 1YHQZ 3CMAZ 1KD12 1VQ5Z 1K732 1YJWZ 1VQ8Z 1VQ6Z 2QA4Z 1YIT1 3CCL1 3CCV1 1KQSY 1VQM1 1K8A1 1VQ7Z 1VQN1 3G4S1 1KQSZ 3CMEZ 1M1K1 1S72Z 2QEX1
chains in the Genus database with same CATH superfamily
3S16I 1NJI1 1NJI2 2HF1A 1KC81 1KC82 3QWUA 3VB9A 4E2ZA 1ZH1A 2P28A 3I56Z 1VQL1 3J7A4 4BY7I 1QYPA 3CQZI 2YU9I 1VQ91 2LIYA 2NVXI 1FDOA 1YJN1 1K8A2 2JS4A 4RVGA 3OW2Y 1I50I 1RO2A 3OW2Z 5C4JI 2OZKA 1L1OC 4NBDA 1VQKZ 3CCVZ 2RIQA 1VQMZ 3BG1B 2OTJ1 2V45A 3NH5A 1VQ41 4NH1C 1K9M1 1VQO1 1K9M2 3RZDI 2I3CA 2OTL1 4A3LI 3BG0B 3S14I 1R9TI 1YHQ1 2GTHA 4MRIA 2EGTA 1YJW1 4MD8A 4AYBA 2F4MA 1NP6A 4E32A 4NBCA 3S1MI 3TE5B 1RQFA 3JAMb 2LEXA 1VQ71 4DGLA 1VQ9Z 4NBGA 1Z03A 1WJ2A 1PFTA 1YJNZ 1LQLA 1QVFY 3P5JB 3MZKB 3CC71 2QRCB 1YJ91 5CM2M 4NOZA 1QVFZ 1QXFA 1SFOI 3VMGA 2E2JI 3GTLI 1JWHC 5C44I 1Y1VS 4A3JI 2OTJZ 1VQ4Z 2RHBA 1VQOZ 2OTLZ 2QRDB 3CC21 2O4HA 3T4NB 3CD61 3NDJA 3GTMS 1YHQZ 1K83I 4E2WA 1K732 2LFUA 1YJWZ 3JAMf 2M6NA 2E9HA 4MD7A 2JA5I 4RVFA 4A3II 4MH4A 1VQ7Z 3PO2I 3G4S1 2K3RA 2DE5A 2PM9A 2E7ZA 2JA7I 2V3VA 4E2XA 2VUMI 3CC7Z 2JA6I 4Y52I 1YJ9Z 2JIOA 3IF8A 3CCE1 4MONA 3Q87A 3I4NI 2IZ3A 1NUIA 3GTJI 3S15I 4E33A 1RNIA 2JMOA 2JUBA 3HOZI 2QKDA 3CCS1 5A2Qb 4BBRI 1I6HI 3CC2Z 1Z02A 4QTUA 2O53A 3F3PC 3CD6Z 4HGZA 2VPYA 4RVHA 1M1K2 2GU2A 1YUAA 2H85A 1YUKA 1Q7Y1 4E30A 2DE6A 3I55Z 3M4OI 3VMHA 2JIPA 3IX0A 2BJOA 3G4SZ 4NFRA 5T67A 1M901 2RT9A 3CCEZ 1TWFI 3NDIA 1VQ61 2Y0SA 2R92I 5A2Qf 1WW9A 3I4MI 4A3EI 3HOXI 3EERA 1Q861 1Q862 4E31A 3GTPI 3LUSA 4HGYA 3CCSZ 3CXCY 3RZOI 1WIIA 3PO3S 1S721 2WB1A 2KI7B 3CXCZ 3S1QI 3EEDA 2J6AA 2W03A 4BBSI 2R93I 3GCFA 2K5RA 3G6E1 3KIHA 4TNUA 4DQYB 2AKLA 1VQLZ 3K7AI 3IR7A 5FLMI 3S2HI 5IT9b 2PK7A 4HH4A 1Q811 3FQQA 1Q812 2JIMA 2NVTI 1SIWA 4A3GI 2JIRA 1VQ6Z 1N2FA 1YIT1 4MD9A 4A3KI 1X3WA 1WCMI 1TFIA 1KQSY 1USPA 2VPWA 1VQN1 5C4XI 1KQSZ 5D1OB 1S72Z 1USPB 4RVDA 1I3QI 1RO0A 4EWCA 3D6WA 1VQP1 4DK1A 2V8IA 3D9XA 1YI21 1ML8A 3G6EZ 5IT9f 2R7ZI 2HU9A 1Q821 2WAQA 2JA8I 4A3CI 1AA6A 2ZAEB 3CCM1 2VF1A 3S17I 5IP9I 1X3ZA 2NAPA 2YADA 3G711 3NFZA 2RBLA 4A93I 2M48A 1YITZ 3CCQ1 2E2HI 2G2KA 2IZ4A 1QVGY 1RLYA 1VQNZ 1S7MA 3CPWY 1QVGZ 1RO4A 2IV2X 2AYDA 1W2BY 3CPWZ 1VQPZ 1FDIA 3MZLB 1W2BZ 3CMA1 1X0TA 1YI2Z 1VQ81 1JJ2Y 3S1NI 2VPZA 4QTTA 1JJ2Z 3J81b 1Y1WI 1Y1VI 2JR6A 1Q7Y2 1TWHI 3CCMZ 1WZNA 3CME1 2VPXA 4E2YA 1P9NA 3U50C 3VTNA 3G71Z 1ZB9A 1VQK1 1YIJ1 3GTMI 4A3MI 2JNYA 5FLXb 3J80f 3CCQZ 1M902 3GTQI 2PMZA 5T6BA 1TWCI 2V8JA 2KPIA 2VUGA 3GKQA 2NVYI 1KD11 3F3FC 1KD12 1VLAA 3J81f 3CMAZ 2QR1B 1VQ8Z 3D2LA 4A3FI 2OOYB 4NBEA 3GTGI 2P3YA 1KRLA 3CCL1 4NBFA 1K8A1 2RPRA 1DL6A 3HKZA 2F4OA 3ESWA 3H0GI 3CMEZ 4CL1A 4A3DI 2QEX1 1TWGI 3CCJ1 5FLXf 3CCR1 1YIJZ 4BY1I 4XX2A 2R6MA 4BXXI 3FKII 3H3VJ 2Q4ZA 3CCU1 3I07A 3TDHB 2GTIA 3HOWI 4RS4A 1QF8A 5D1OA 3HOYI 3CC41 4RV9A 1Z01A 3IFUA 3CCLZ 1ZB8A 1Q822 3HOVI 5D1PA 2QEXZ 3CCJZ 3PO3I 3VMIA 3NH4A 4A3BI 3KIFA 3CCRZ 1VQ51 2QLVB 2QA41 4Y7NI 3HOUI 2DE7A 3CCUZ 2E2II 2Q51A 1K731 3NH8A 3GTKI 2B63I 4NBAA 3MONA 3J80b 1Q16A 2OOXB 3CC4Z 3I551 3I561 2NVQI 1Y8CA 5T64A 2W04A 4S1TA 5LL6f 1N8R1 4NB8A 3M3YI 1N8R2 3FQMA 5C3EI 4NB9A 1VQ5Z 1TWAI 5AN9F 4NBBA 5IP7I 2QA4Z 3S2DI 4X6AI 2QREB 3CCV1 1VQM1 4NBHA 2JIQA 3GTOI 3S1RI 1M1K1 2V8KA 4MXUA
chains in the Genus database with same CATH topology
3S16I 1NJI1 1NJI2 2HF1A 1KC81 1KC82 3QWUA 3VB9A 4E2ZA 1ZH1A 2P28A 3I56Z 1VQL1 3J7A4 4BY7I 1QYPA 3CQZI 2YU9I 1VQ91 2LIYA 2NVXI 1YJN1 1K8A2 2JS4A 4RVGA 3OW2Y 1I50I 1RO2A 3OW2Z 5C4JI 2OZKA 1L1OC 4NBDA 1VQKZ 3CCVZ 2RIQA 1VQMZ 3BG1B 2OTJ1 3NH5A 1VQ41 4NH1C 1K9M1 1VQO1 1K9M2 3RZDI 2I3CA 2OTL1 4A3LI 3BG0B 3S14I 1R9TI 1YHQ1 2GTHA 4MRIA 2EGTA 1YJW1 4MD8A 4AYBA 2F4MA 1NP6A 4E32A 4NBCA 3S1MI 3TE5B 1RQFA 3JAMb 1VQ71 4DGLA 1VQ9Z 4NBGA 1Z03A 1PFTA 1YJNZ 1LQLA 1QVFY 3P5JB 3MZKB 3CC71 2QRCB 1YJ91 5CM2M 4NOZA 1QVFZ 1SFOI 3VMGA 2E2JI 3GTLI 1JWHC 5C44I 1Y1VS 4A3JI 2OTJZ 1VQ4Z 2RHBA 1VQOZ 2OTLZ 2QRDB 3CC21 2O4HA 3T4NB 3CD61 3NDJA 3GTMS 1YHQZ 1K83I 4E2WA 1K732 2LFUA 1YJWZ 3JAMf 2M6NA 2E9HA 4MD7A 2JA5I 4RVFA 4A3II 4MH4A 1VQ7Z 3PO2I 3G4S1 2K3RA 2DE5A 2PM9A 2JA7I 4E2XA 2VUMI 3CC7Z 2JA6I 4Y52I 1YJ9Z 3IF8A 3CCE1 4MONA 3Q87A 3I4NI 2IZ3A 1NUIA 3GTJI 3S15I 4E33A 1RNIA 2JMOA 2JUBA 3HOZI 2QKDA 3CCS1 5A2Qb 4BBRI 1I6HI 3CC2Z 1Z02A 4QTUA 2O53A 3F3PC 3CD6Z 4HGZA 4RVHA 1M1K2 2GU2A 1YUAA 2H85A 1YUKA 1Q7Y1 4E30A 2DE6A 3I55Z 3M4OI 3VMHA 3IX0A 2BJOA 3G4SZ 4NFRA 5T67A 1M901 2RT9A 3CCEZ 1TWFI 3NDIA 1VQ61 2Y0SA 2R92I 5A2Qf 1WW9A 3I4MI 4A3EI 3HOXI 3EERA 1Q861 1Q862 4E31A 3GTPI 3LUSA 4HGYA 3CCSZ 3CXCY 3RZOI 1WIIA 3PO3S 1S721 2WB1A 2KI7B 3CXCZ 3S1QI 3EEDA 2J6AA 2W03A 4BBSI 2R93I 3GCFA 2K5RA 3G6E1 3KIHA 4TNUA 4DQYB 2AKLA 1VQLZ 3K7AI 5FLMI 3S2HI 5IT9b 2PK7A 4HH4A 1Q811 3FQQA 1Q812 2NVTI 4A3GI 1VQ6Z 1N2FA 1YIT1 4MD9A 4A3KI 1X3WA 1WCMI 1TFIA 1KQSY 1USPA 1VQN1 5C4XI 1KQSZ 5D1OB 1S72Z 1USPB 4RVDA 1I3QI 1RO0A 4EWCA 3D6WA 1VQP1 4DK1A 2V8IA 3D9XA 1YI21 1ML8A 3G6EZ 5IT9f 2R7ZI 2HU9A 1Q821 2WAQA 2JA8I 4A3CI 2ZAEB 3CCM1 2VF1A 3S17I 5IP9I 1X3ZA 2YADA 3G711 3NFZA 2RBLA 4A93I 2M48A 1YITZ 3CCQ1 2E2HI 2G2KA 2IZ4A 1QVGY 1RLYA 1VQNZ 1S7MA 3CPWY 1QVGZ 1RO4A 1W2BY 3CPWZ 1VQPZ 3MZLB 1W2BZ 3CMA1 1X0TA 1YI2Z 1VQ81 1JJ2Y 3S1NI 4QTTA 1JJ2Z 3J81b 1Y1WI 1Y1VI 2JR6A 1Q7Y2 1TWHI 3CCMZ 3CME1 4E2YA 1P9NA 3U50C 3VTNA 3G71Z 1ZB9A 1VQK1 1YIJ1 3GTMI 4A3MI 2JNYA 5FLXb 3J80f 3CCQZ 1M902 3GTQI 2PMZA 5T6BA 1TWCI 2V8JA 2KPIA 2VUGA 3GKQA 2NVYI 1KD11 3F3FC 1KD12 1VLAA 3J81f 3CMAZ 2QR1B 1VQ8Z 4A3FI 2OOYB 4NBEA 3GTGI 2P3YA 1KRLA 3CCL1 4NBFA 1K8A1 2RPRA 1DL6A 3HKZA 2F4OA 3ESWA 3H0GI 4CL1A 3CMEZ 4A3DI 2QEX1 1TWGI 3CCJ1 5FLXf 3CCR1 1YIJZ 4BY1I 4XX2A 2R6MA 4BXXI 3FKII 3H3VJ 2Q4ZA 3CCU1 3I07A 3TDHB 2GTIA 3HOWI 4RS4A 1QF8A 5D1OA 3HOYI 3CC41 4RV9A 1Z01A 3IFUA 3CCLZ 1ZB8A 1Q822 3HOVI 5D1PA 2QEXZ 3CCJZ 3PO3I 3VMIA 3NH4A 4A3BI 3KIFA 3CCRZ 1VQ51 2QLVB 2QA41 4Y7NI 3HOUI 2DE7A 3CCUZ 2E2II 2Q51A 1K731 3NH8A 3GTKI 2B63I 4NBAA 3MONA 3J80b 2OOXB 3CC4Z 3I551 3I561 2NVQI 5T64A 2W04A 4S1TA 5LL6f 1N8R1 4NB8A 3M3YI 1N8R2 3FQMA 5C3EI 4NB9A 1VQ5Z 1TWAI 5AN9F 4NBBA 5IP7I 2QA4Z 3S2DI 4X6AI 2QREB 3CCV1 1VQM1 4NBHA 3GTOI 3S1RI 1M1K1 2V8KA 4MXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ 1;  3CC7 Z;  1NJI 1;  1NJI 2;  1YJ9 Z;  1VQP 1;  1KC8 1;  1KC8 2;  3CCE 1;  3CCR 1;  1YIJ Z;  1VQL 1;  1YI2 1;  3I56 Z;  3G6E Z;  1Q82 1;  3CCU 1;  3CCS 1;  3CCM 1;  1VQ9 1;  3CC2 Z;  1YJN 1;  1K8A 2;  3CD6 Z;  3G71 1;  3OW2 Y;  3CC4 1;  1M1K 2;  3OW2 Z;  1Q7Y 1;  1YIT Z;  3CCQ 1;  1VQK Z;  3I55 Z;  3CCL Z;  3CCV Z;  1VQM Z;  2OTJ 1;  1QVG Y;  1VQ4 1;  1Q82 2;  1VQO 1;  1K9M 1;  1VQN Z;  1K9M 2;  3G4S Z;  2OTL 1;  2QEX Z;  3CPW Y;  1QVG Z;  1W2B Y;  3CCJ Z;  3CPW Z;  1M90 1;  1VQP Z;  1YHQ 1;  3CCE Z;  3CCR Z;  1VQ5 1;  1W2B Z;  3CMA 1;  1YI2 Z;  1YJW 1;  1VQ8 1;  1JJ2 Y;  1VQ6 1;  2QA4 1;  1JJ2 Z;  3CCU Z;  1Q86 1;  1Q7Y 2;  1Q86 2;  1VQ7 1;  3CCS Z;  3CXC Y;  3CCM Z;  1VQ9 Z;  1K73 1;  3CME 1;  1S72 1;  1YJN Z;  1QVF Y;  3CXC Z;  3G71 Z;  3CC7 1;  1YJ9 1;  1QVF Z;  3CC4 Z;  1VQK 1;  3I55 1;  1YIJ 1;  3I56 1;  3G6E 1;  3CCQ Z;  1M90 2;  1VQL Z;  1N8R 1;  2OTJ Z;  1N8R 2;  1VQ4 Z;  1VQO Z;  2OTL Z;  1Q81 1;  1Q81 2;  3CC2 1;  3CD6 1;  1KD1 1;  1YHQ Z;  3CMA Z;  1KD1 2;  1VQ5 Z;  1K73 2;  1YJW Z;  1VQ8 Z;  1VQ6 Z;  2QA4 Z;  1YIT 1;  3CCL 1;  3CCV 1;  1KQS Y;  1VQM 1;  1K8A 1;  1VQ7 Z;  1VQN 1;  3G4S 1;  1KQS Z;  3CME Z;  1M1K 1;  1S72 Z;  2QEX 1; 
#chains in the Genus database with same CATH topology
 3S16 I;  1NJI 1;  1NJI 2;  2HF1 A;  1KC8 1;  1KC8 2;  3QWU A;  3VB9 A;  4E2Z A;  1ZH1 A;  2P28 A;  3I56 Z;  1VQL 1;  3J7A 4;  4BY7 I;  1QYP A;  3CQZ I;  2YU9 I;  1VQ9 1;  2LIY A;  2NVX I;  1FDO A;  1YJN 1;  1K8A 2;  2JS4 A;  4RVG A;  3OW2 Y;  1I50 I;  1RO2 A;  3OW2 Z;  5C4J I;  2OZK A;  1L1O C;  4NBD A;  1VQK Z;  3CCV Z;  2RIQ A;  1VQM Z;  3BG1 B;  2OTJ 1;  2V45 A;  3NH5 A;  1VQ4 1;  4NH1 C;  1K9M 1;  1VQO 1;  1K9M 2;  3RZD I;  2I3C A;  2OTL 1;  4A3L I;  3BG0 B;  3S14 I;  1R9T I;  1YHQ 1;  2GTH A;  4MRI A;  2EGT A;  1YJW 1;  4MD8 A;  4AYB A;  2F4M A;  1NP6 A;  4E32 A;  4NBC A;  3S1M I;  3TE5 B;  1RQF A;  3JAM b;  2LEX A;  1VQ7 1;  4DGL A;  1VQ9 Z;  4NBG A;  1Z03 A;  1WJ2 A;  1PFT A;  1YJN Z;  1LQL A;  1QVF Y;  3P5J B;  3MZK B;  3CC7 1;  2QRC B;  1YJ9 1;  5CM2 M;  4NOZ A;  1QVF Z;  1QXF A;  1SFO I;  3VMG A;  2E2J I;  3GTL I;  1JWH C;  5C44 I;  1Y1V S;  4A3J I;  2OTJ Z;  1VQ4 Z;  2RHB A;  1VQO Z;  2OTL Z;  2QRD B;  3CC2 1;  2O4H A;  3T4N B;  3CD6 1;  3NDJ A;  3GTM S;  1YHQ Z;  1K83 I;  4E2W A;  1K73 2;  2LFU A;  1YJW Z;  3JAM f;  2M6N A;  2E9H A;  4MD7 A;  2JA5 I;  4RVF A;  4A3I I;  4MH4 A;  1VQ7 Z;  3PO2 I;  3G4S 1;  2K3R A;  2DE5 A;  2PM9 A;  2E7Z A;  2JA7 I;  2V3V A;  4E2X A;  2VUM I;  3CC7 Z;  2JA6 I;  4Y52 I;  1YJ9 Z;  2JIO A;  3IF8 A;  3CCE 1;  4MON A;  3Q87 A;  3I4N I;  2IZ3 A;  1NUI A;  3GTJ I;  3S15 I;  4E33 A;  1RNI A;  2JMO A;  2JUB A;  3HOZ I;  2QKD A;  3CCS 1;  5A2Q b;  4BBR I;  1I6H I;  3CC2 Z;  1Z02 A;  4QTU A;  2O53 A;  3F3P C;  3CD6 Z;  4HGZ A;  2VPY A;  4RVH A;  1M1K 2;  2GU2 A;  1YUA A;  2H85 A;  1YUK A;  1Q7Y 1;  4E30 A;  2DE6 A;  3I55 Z;  3M4O I;  3VMH A;  2JIP A;  3IX0 A;  2BJO A;  3G4S Z;  4NFR A;  5T67 A;  1M90 1;  2RT9 A;  3CCE Z;  1TWF I;  3NDI A;  1VQ6 1;  2Y0S A;  2R92 I;  5A2Q f;  1WW9 A;  3I4M I;  4A3E I;  3HOX I;  3EER A;  1Q86 1;  1Q86 2;  4E31 A;  3GTP I;  3LUS A;  4HGY A;  3CCS Z;  3CXC Y;  3RZO I;  1WII A;  3PO3 S;  1S72 1;  2WB1 A;  2KI7 B;  3CXC Z;  3S1Q I;  3EED A;  2J6A A;  2W03 A;  4BBS I;  2R93 I;  3GCF A;  2K5R A;  3G6E 1;  3KIH A;  4TNU A;  4DQY B;  2AKL A;  1VQL Z;  3K7A I;  3IR7 A;  5FLM I;  3S2H I;  5IT9 b;  2PK7 A;  4HH4 A;  1Q81 1;  3FQQ A;  1Q81 2;  2JIM A;  2NVT I;  1SIW A;  4A3G I;  2JIR A;  1VQ6 Z;  1N2F A;  1YIT 1;  4MD9 A;  4A3K I;  1X3W A;  1WCM I;  1TFI A;  1KQS Y;  1USP A;  2VPW A;  1VQN 1;  5C4X I;  1KQS Z;  5D1O B;  1S72 Z;  1USP B;  4RVD A;  1I3Q I;  1RO0 A;  4EWC A;  3D6W A;  1VQP 1;  4DK1 A;  2V8I A;  3D9X A;  1YI2 1;  1ML8 A;  3G6E Z;  5IT9 f;  2R7Z I;  2HU9 A;  1Q82 1;  2WAQ A;  2JA8 I;  4A3C I;  1AA6 A;  2ZAE B;  3CCM 1;  2VF1 A;  3S17 I;  5IP9 I;  1X3Z A;  2NAP A;  2YAD A;  3G71 1;  3NFZ A;  2RBL A;  4A93 I;  2M48 A;  1YIT Z;  3CCQ 1;  2E2H I;  2G2K A;  2IZ4 A;  1QVG Y;  1RLY A;  1VQN Z;  1S7M A;  3CPW Y;  1QVG Z;  1RO4 A;  2IV2 X;  2AYD A;  1W2B Y;  3CPW Z;  1VQP Z;  1FDI A;  3MZL B;  1W2B Z;  3CMA 1;  1X0T A;  1YI2 Z;  1VQ8 1;  1JJ2 Y;  3S1N I;  2VPZ A;  4QTT A;  1JJ2 Z;  3J81 b;  1Y1W I;  1Y1V I;  2JR6 A;  1Q7Y 2;  1TWH I;  3CCM Z;  1WZN A;  3CME 1;  2VPX A;  4E2Y A;  1P9N A;  3U50 C;  3VTN A;  3G71 Z;  1ZB9 A;  1VQK 1;  1YIJ 1;  3GTM I;  4A3M I;  2JNY A;  5FLX b;  3J80 f;  3CCQ Z;  1M90 2;  3GTQ I;  2PMZ A;  5T6B A;  1TWC I;  2V8J A;  2KPI A;  2VUG A;  3GKQ A;  2NVY I;  1KD1 1;  3F3F C;  1KD1 2;  1VLA A;  3J81 f;  3CMA Z;  2QR1 B;  1VQ8 Z;  3D2L A;  4A3F I;  2OOY B;  4NBE A;  3GTG I;  2P3Y A;  1KRL A;  3CCL 1;  4NBF A;  1K8A 1;  2RPR A;  1DL6 A;  3HKZ A;  2F4O A;  3ESW A;  3H0G I;  3CME Z;  4CL1 A;  4A3D I;  2QEX 1;  1TWG I;  3CCJ 1;  5FLX f;  3CCR 1;  1YIJ Z;  4BY1 I;  4XX2 A;  2R6M A;  4BXX I;  3FKI I;  3H3V J;  2Q4Z A;  3CCU 1;  3I07 A;  3TDH B;  2GTI A;  3HOW I;  4RS4 A;  1QF8 A;  5D1O A;  3HOY I;  3CC4 1;  4RV9 A;  1Z01 A;  3IFU A;  3CCL Z;  1ZB8 A;  1Q82 2;  3HOV I;  5D1P A;  2QEX Z;  3CCJ Z;  3PO3 I;  3VMI A;  3NH4 A;  4A3B I;  3KIF A;  3CCR Z;  1VQ5 1;  2QLV B;  2QA4 1;  4Y7N I;  3HOU I;  2DE7 A;  3CCU Z;  2E2I I;  2Q51 A;  1K73 1;  3NH8 A;  3GTK I;  2B63 I;  4NBA A;  3MON A;  3J80 b;  1Q16 A;  2OOX B;  3CC4 Z;  3I55 1;  3I56 1;  2NVQ I;  1Y8C A;  5T64 A;  2W04 A;  4S1T A;  5LL6 f;  1N8R 1;  4NB8 A;  3M3Y I;  1N8R 2;  3FQM A;  5C3E I;  4NB9 A;  1VQ5 Z;  1TWA I;  5AN9 F;  4NBB A;  5IP7 I;  2QA4 Z;  3S2D I;  4X6A I;  2QRE B;  3CCV 1;  1VQM 1;  4NBH A;  2JIQ A;  3GTO I;  3S1R I;  1M1K 1;  2V8K A;  4MXU A; 
#chains in the Genus database with same CATH homology
 3S16 I;  1NJI 1;  1NJI 2;  2HF1 A;  1KC8 1;  1KC8 2;  3QWU A;  3VB9 A;  4E2Z A;  1ZH1 A;  2P28 A;  3I56 Z;  1VQL 1;  3J7A 4;  4BY7 I;  1QYP A;  3CQZ I;  2YU9 I;  1VQ9 1;  2LIY A;  2NVX I;  1YJN 1;  1K8A 2;  2JS4 A;  4RVG A;  3OW2 Y;  1I50 I;  1RO2 A;  3OW2 Z;  5C4J I;  2OZK A;  1L1O C;  4NBD A;  1VQK Z;  3CCV Z;  2RIQ A;  1VQM Z;  3BG1 B;  2OTJ 1;  3NH5 A;  1VQ4 1;  4NH1 C;  1K9M 1;  1VQO 1;  1K9M 2;  3RZD I;  2I3C A;  2OTL 1;  4A3L I;  3BG0 B;  3S14 I;  1R9T I;  1YHQ 1;  2GTH A;  4MRI A;  2EGT A;  1YJW 1;  4MD8 A;  4AYB A;  2F4M A;  1NP6 A;  4E32 A;  4NBC A;  3S1M I;  3TE5 B;  1RQF A;  3JAM b;  1VQ7 1;  4DGL A;  1VQ9 Z;  4NBG A;  1Z03 A;  1PFT A;  1YJN Z;  1LQL A;  1QVF Y;  3P5J B;  3MZK B;  3CC7 1;  2QRC B;  1YJ9 1;  5CM2 M;  4NOZ A;  1QVF Z;  1SFO I;  3VMG A;  2E2J I;  3GTL I;  1JWH C;  5C44 I;  1Y1V S;  4A3J I;  2OTJ Z;  1VQ4 Z;  2RHB A;  1VQO Z;  2OTL Z;  2QRD B;  3CC2 1;  2O4H A;  3T4N B;  3CD6 1;  3NDJ A;  3GTM S;  1YHQ Z;  1K83 I;  4E2W A;  1K73 2;  2LFU A;  1YJW Z;  3JAM f;  2M6N A;  2E9H A;  4MD7 A;  2JA5 I;  4RVF A;  4A3I I;  4MH4 A;  1VQ7 Z;  3PO2 I;  3G4S 1;  2K3R A;  2DE5 A;  2PM9 A;  2JA7 I;  4E2X A;  2VUM I;  3CC7 Z;  2JA6 I;  4Y52 I;  1YJ9 Z;  3IF8 A;  3CCE 1;  4MON A;  3Q87 A;  3I4N I;  2IZ3 A;  1NUI A;  3GTJ I;  3S15 I;  4E33 A;  1RNI A;  2JMO A;  2JUB A;  3HOZ I;  2QKD A;  3CCS 1;  5A2Q b;  4BBR I;  1I6H I;  3CC2 Z;  1Z02 A;  4QTU A;  2O53 A;  3F3P C;  3CD6 Z;  4HGZ A;  4RVH A;  1M1K 2;  2GU2 A;  1YUA A;  2H85 A;  1YUK A;  1Q7Y 1;  4E30 A;  2DE6 A;  3I55 Z;  3M4O I;  3VMH A;  3IX0 A;  2BJO A;  3G4S Z;  4NFR A;  5T67 A;  1M90 1;  2RT9 A;  3CCE Z;  1TWF I;  3NDI A;  1VQ6 1;  2Y0S A;  2R92 I;  5A2Q f;  1WW9 A;  3I4M I;  4A3E I;  3HOX I;  3EER A;  1Q86 1;  1Q86 2;  4E31 A;  3GTP I;  3LUS A;  4HGY A;  3CCS Z;  3CXC Y;  3RZO I;  1WII A;  3PO3 S;  1S72 1;  2WB1 A;  2KI7 B;  3CXC Z;  3S1Q I;  3EED A;  2J6A A;  2W03 A;  4BBS I;  2R93 I;  3GCF A;  2K5R A;  3G6E 1;  3KIH A;  4TNU A;  4DQY B;  2AKL A;  1VQL Z;  3K7A I;  5FLM I;  3S2H I;  5IT9 b;  2PK7 A;  4HH4 A;  1Q81 1;  3FQQ A;  1Q81 2;  2NVT I;  4A3G I;  1VQ6 Z;  1N2F A;  1YIT 1;  4MD9 A;  4A3K I;  1X3W A;  1WCM I;  1TFI A;  1KQS Y;  1USP A;  1VQN 1;  5C4X I;  1KQS Z;  5D1O B;  1S72 Z;  1USP B;  4RVD A;  1I3Q I;  1RO0 A;  4EWC A;  3D6W A;  1VQP 1;  4DK1 A;  2V8I A;  3D9X A;  1YI2 1;  1ML8 A;  3G6E Z;  5IT9 f;  2R7Z I;  2HU9 A;  1Q82 1;  2WAQ A;  2JA8 I;  4A3C I;  2ZAE B;  3CCM 1;  2VF1 A;  3S17 I;  5IP9 I;  1X3Z A;  2YAD A;  3G71 1;  3NFZ A;  2RBL A;  4A93 I;  2M48 A;  1YIT Z;  3CCQ 1;  2E2H I;  2G2K A;  2IZ4 A;  1QVG Y;  1RLY A;  1VQN Z;  1S7M A;  3CPW Y;  1QVG Z;  1RO4 A;  1W2B Y;  3CPW Z;  1VQP Z;  3MZL B;  1W2B Z;  3CMA 1;  1X0T A;  1YI2 Z;  1VQ8 1;  1JJ2 Y;  3S1N I;  4QTT A;  1JJ2 Z;  3J81 b;  1Y1W I;  1Y1V I;  2JR6 A;  1Q7Y 2;  1TWH I;  3CCM Z;  3CME 1;  4E2Y A;  1P9N A;  3U50 C;  3VTN A;  3G71 Z;  1ZB9 A;  1VQK 1;  1YIJ 1;  3GTM I;  4A3M I;  2JNY A;  5FLX b;  3J80 f;  3CCQ Z;  1M90 2;  3GTQ I;  2PMZ A;  5T6B A;  1TWC I;  2V8J A;  2KPI A;  2VUG A;  3GKQ A;  2NVY I;  1KD1 1;  3F3F C;  1KD1 2;  1VLA A;  3J81 f;  3CMA Z;  2QR1 B;  1VQ8 Z;  4A3F I;  2OOY B;  4NBE A;  3GTG I;  2P3Y A;  1KRL A;  3CCL 1;  4NBF A;  1K8A 1;  2RPR A;  1DL6 A;  3HKZ A;  2F4O A;  3ESW A;  3H0G I;  4CL1 A;  3CME Z;  4A3D I;  2QEX 1;  1TWG I;  3CCJ 1;  5FLX f;  3CCR 1;  1YIJ Z;  4BY1 I;  4XX2 A;  2R6M A;  4BXX I;  3FKI I;  3H3V J;  2Q4Z A;  3CCU 1;  3I07 A;  3TDH B;  2GTI A;  3HOW I;  4RS4 A;  1QF8 A;  5D1O A;  3HOY I;  3CC4 1;  4RV9 A;  1Z01 A;  3IFU A;  3CCL Z;  1ZB8 A;  1Q82 2;  3HOV I;  5D1P A;  2QEX Z;  3CCJ Z;  3PO3 I;  3VMI A;  3NH4 A;  4A3B I;  3KIF A;  3CCR Z;  1VQ5 1;  2QLV B;  2QA4 1;  4Y7N I;  3HOU I;  2DE7 A;  3CCU Z;  2E2I I;  2Q51 A;  1K73 1;  3NH8 A;  3GTK I;  2B63 I;  4NBA A;  3MON A;  3J80 b;  2OOX B;  3CC4 Z;  3I55 1;  3I56 1;  2NVQ I;  5T64 A;  2W04 A;  4S1T A;  5LL6 f;  1N8R 1;  4NB8 A;  3M3Y I;  1N8R 2;  3FQM A;  5C3E I;  4NB9 A;  1VQ5 Z;  1TWA I;  5AN9 F;  4NBB A;  5IP7 I;  2QA4 Z;  3S2D I;  4X6A I;  2QRE B;  3CCV 1;  1VQM 1;  4NBH A;  3GTO I;  3S1R I;  1M1K 1;  2V8K A;  4MXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...