3CCL1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccl100
3CPWZ 1VQKZ 1QVFY 1YJNZ 1Q822 1W2BY 3CCRZ 3CCQZ 1W2BZ 1Q821 1Q812 2OTLZ 1VQ7Z 1Q861 1VQO1 1Q811 1YIT1 2QA4Z 1K732 1VQ61 3CCM1 1VQ9Z 1VQP1 3CCJZ 1VQNZ 1KC81 3I561 3CCVZ 3CCUZ 3CC7Z 1YIJ1 3G6E1 3CD61 3OW2Y 3CCE1 3OW2Z 1VQM1 3CC21 1YJW1 1VQK1 1K8A2 1KQSZ 1QVGY 3CC4Z 2OTJZ 1QVFZ 3I55Z 1YJN1 3CCR1 3CMEZ 3CCQ1 1QVGZ 1K8A1 1Q862 3G4SZ 1Q7Y2 1NJI2 2QEXZ 2OTL1 1Q7Y1 1VQ71 2QA41 1NJI1 1YJ9Z 3CMAZ 1VQLZ 3G71Z 1KC82 1VQ91 3CCJ1 1VQN1 1YI2Z 1K9M1 3CCV1 3CCS1 1VQ5Z 1M901 1S72Z 3CC41 2OTJ1 3I551 3CME1 3G4S1 3CCLZ 3CCMZ 1VQ8Z 2QEX1 1N8R2 1YHQZ 1VQ4Z 1YIJZ 3CD6Z 1N8R1 1VQL1 3G711 1K9M2 1M902 1YJWZ 1YI21 3CCU1 3CC71 1VQ51 1M1K2 1M1K1 3CXCY 1VQOZ 1KD12 1S721 1YITZ 3CXCZ 1KD11 1VQ6Z 1K731 3CCL1 1VQPZ 1JJ2Y 1VQ81 3I56Z 1JJ2Z 1YHQ1 1VQ41 1YJ91 3CCSZ 3G6EZ 3CMA1 3CCEZ 3CPWY 1VQMZ 3CC2Z 1KQSY
chains in the Genus database with same CATH superfamily
3RZOI 1JWHC 4NBEA 4E32A 3BG0B 1Q821 2V8IA 4A3GI 1NUIA 3GTJI 1Q861 1Y1VS 1YIT1 1K732 2JUBA 2I3CA 1VQ61 2R93I 4BY1I 1RO2A 3HOYI 2Q51A 1KC81 3I561 2PK7A 1WCMI 3OW2Y 1YUAA 4NBHA 3OW2Z 2V8JA 3HOXI 2LEXA 1KQSZ 5A2Qb 1YUKA 3CC4Z 1RLYA 3CCQ1 2JA8I 1Q7Y2 3GTPI 3I4NI 1FDIA 2OTL1 1VQ71 1NJI1 1Q16A 1YJ9Z 2W03A 3S1MI 1Z02A 1VQ91 2P3YA 3CCJ1 1Z01A 1K9M1 4E2WA 2K5RA 4NBAA 2JIRA 5T64A 4AYBA 2QLVB 2O4HA 3RZDI 4NBBA 4NB8A 3FQMA 4E30A 3LUSA 2PMZA 2HU9A 5D1OA 1VQ8Z 4X6AI 3PO2I 1YHQZ 1RNIA 3G711 2KI7B 3M3YI 2JIPA 1YI21 5CM2M 3H3VJ 3VMHA 3CCU1 3CC71 2WAQA 4HH4A 1VQ51 4QTTA 2ZAEB 1PFTA 2V3VA 1KD11 5FLMI 3F3PC 1K731 2E2II 1VQPZ 1JJ2Y 3S15I 1JJ2Z 3CMA1 3G6EZ 2GTHA 1TWAI 3MZKB 3S1RI 1VQMZ 3BG1B 1VQKZ 1QVFY 3PO3I 3QWUA 1Q812 2B63I 1N2FA 1VQO1 4E2ZA 2IZ3A 1I50I 2GTIA 5FLXf 2W04A 2P28A 3J81f 3D6WA 2NVYI 3J81b 1VQNZ 1ZH1A 4NB9A 1NP6A 3CCVZ 4Y7NI 3CCUZ 3CC7Z 2KPIA 3NH5A 5IP7I 2RHBA 1YJW1 3IFUA 1L1OC 4MD8A 1YJN1 3JAMf 3CCR1 1K8A1 4E31A 4RS4A 3JAMb 1LQLA 4NBGA 3G4SZ 5C4JI 1Y8CA 2QEXZ 2QA41 3CMAZ 3S16I 4A3FI 2AYDA 1USPA 1Y1VI 4BBSI 1RO0A 1TWHI 4A3MI 2EGTA 2QR1B 1S72Z 3U50C 2OTJ1 3I551 4RVDA 5T6BA 3CME1 3FQQA 3S2DI 3T4NB 1VQ4Z 2JMOA 2JNYA 1N8R1 1VQL1 3H0GI 5C44I 1M902 1X3ZA 1YJWZ 2E2HI 2F4OA 2VUGA 4A3LI 2R6MA 2R7ZI 1M1K2 2K3RA 2R92I 5D1OB 3CXCY 1YITZ 3CXCZ 3EEDA 3IR7A 1WIIA 1VQ6Z 2E7ZA 2VF1A 3HOUI 4MONA 3CCL1 2RBLA 3S2HI 3I56Z 2JS4A 2PM9A 3FKII 1I3QI 3CPWY 1P9NA 2JA6I 3CPWZ 3HKZA 2IZ4A 4BBRI 3HOVI 3K7AI 1Q822 1W2BY 3CCQZ 2QRCB 1W2BZ 2GU2A 2OTLZ 1VQ7Z 2V45A 2VPYA 3NFZA 2JA5I 3CCM1 4RV9A 1VQ9Z 3CCJZ 3GTLI 3M4OI 4NBFA 1YIJ1 3CCE1 4HGZA 4DGLA 3GTMS 2QRDB 2BJOA 3CC21 1SIWA 5D1PA 1QVFZ 3MONA 1Y1WI 4A3BI 3P5JB 1NJI2 4A3KI 1Q7Y1 3I07A 1DL6A 3PO3S 2DE5A 2LFUA 3G71Z 1TWFI 5FLXb 2V8KA 1YI2Z 3D2LA 3NH4A 1TFIA 1ZB9A 2Q4ZA 4HGYA 1K83I 1VQ5Z 5AN9F 1M901 3GTGI 4DQYB 2OOXB 3ESWA 4A3EI 3J80f 1X0TA 3CC41 4BY7I 1TWCI 3J80b 2QKDA 3CCMZ 2NAPA 1I6HI 1USPB 2RIQA 1VLAA 4MD9A 4CL1A 1QYPA 1YIJZ 3EERA 1QXFA 1R9TI 1SFOI 4MD7A 3MZLB 3GTQI 3S14I 2VPXA 2YADA 3NDIA 3NH8A 3J7A4 3I4MI 3IF8A 1VQOZ 4RVHA 2OZKA 1KD12 3IX0A 2JIOA 3KIFA 2WB1A 2E2JI 3VTNA 2JIQA 4E2XA 2H85A 2NVQI 1VQ81 1YHQ1 4E2YA 3S1NI 3CQZI 2NVXI 1S7MA 1AA6A 1WZNA 1KQSY 5A2Qf 2J6AA 1YJNZ 1RQFA 3CCRZ 2QREB 2E9HA 3S1QI 4TNUA 4MRIA 4NH1C 4A3II 1RO4A 4NOZA 2G2KA 4XX2A 1Q811 2QA4Z 4NBDA 4NFRA 4BXXI 2LIYA 4QTUA 1VQP1 4A3DI 5LL6f 2HF1A 2M6NA 3G6E1 4A3JI 3CD61 3TDHB 1VQM1 5T67A 1VQK1 1K8A2 2YU9I 4RVFA 1QVGY 2OTJZ 1FDOA 3I55Z 1QVGZ 3CMEZ 2O53A 1Q862 2Y0SA 1TWGI 1KRLA 3TE5B 1VQLZ 2DE7A 1KC82 1Z03A 2RT9A 1VQN1 4A3CI 2M48A 4RVGA 3CCS1 3CCV1 3S17I 2VPWA 2OOYB 3KIHA 2JIMA 3D9XA 5C4XI 1X3WA 3F3FC 5C3EI 3G4S1 3GTMI 3CCLZ 1ZB8A 4Y52I 4MH4A 2QEX1 5IT9f 1N8R2 1ML8A 3HOZI 5IT9b 2DE6A 3VMIA 3CD6Z 4NBCA 1K9M2 4S1TA 2RPRA 2VUMI 5IP9I 1WW9A 4DK1A 4A93I 2JR6A 1M1K1 4MXUA 2IV2X 4E33A 1QF8A 3NDJA 1S721 1WJ2A 3Q87A 3GKQA 3GCFA 2VPZA 4EWCA 2JA7I 3GTOI 3VB9A 2NVTI 2AKLA 1VQ41 1YJ91 3CCSZ 3VMGA 3CCEZ 3HOWI 3GTKI 3CC2Z 2F4MA
chains in the Genus database with same CATH topology
3RZOI 1JWHC 4NBEA 4E32A 3BG0B 1Q821 2V8IA 4A3GI 1NUIA 3GTJI 1Q861 1Y1VS 1YIT1 1K732 2JUBA 2I3CA 1VQ61 2R93I 4BY1I 1RO2A 3HOYI 2Q51A 1KC81 3I561 2PK7A 1WCMI 3OW2Y 1YUAA 4NBHA 3OW2Z 2V8JA 3HOXI 1KQSZ 5A2Qb 1YUKA 3CC4Z 1RLYA 3CCQ1 2JA8I 1Q7Y2 3GTPI 3I4NI 2OTL1 1VQ71 1NJI1 1YJ9Z 2W03A 3S1MI 1Z02A 1VQ91 2P3YA 3CCJ1 1Z01A 1K9M1 4E2WA 2K5RA 4NBAA 5T64A 4AYBA 2QLVB 2O4HA 3RZDI 4NBBA 4NB8A 3FQMA 4E30A 3LUSA 2PMZA 2HU9A 5D1OA 1VQ8Z 4X6AI 3PO2I 1YHQZ 1RNIA 3G711 2KI7B 3M3YI 1YI21 5CM2M 3H3VJ 3VMHA 3CCU1 3CC71 2WAQA 4HH4A 1VQ51 4QTTA 2ZAEB 1PFTA 1KD11 5FLMI 3F3PC 1K731 2E2II 1VQPZ 1JJ2Y 3S15I 1JJ2Z 3CMA1 3G6EZ 2GTHA 1TWAI 3MZKB 3S1RI 1VQMZ 3BG1B 1VQKZ 1QVFY 3PO3I 3QWUA 1Q812 2B63I 1N2FA 1VQO1 4E2ZA 2IZ3A 1I50I 2GTIA 5FLXf 2W04A 2P28A 3J81f 3D6WA 2NVYI 3J81b 1VQNZ 1ZH1A 4NB9A 1NP6A 3CCVZ 4Y7NI 3CCUZ 3CC7Z 2KPIA 3NH5A 5IP7I 2RHBA 1YJW1 3IFUA 1L1OC 4MD8A 1YJN1 3JAMf 3CCR1 1K8A1 4E31A 4RS4A 3JAMb 1LQLA 4NBGA 3G4SZ 5C4JI 2QEXZ 2QA41 3CMAZ 3S16I 4A3FI 1USPA 1Y1VI 4BBSI 1RO0A 1TWHI 4A3MI 2EGTA 2QR1B 1S72Z 3U50C 2OTJ1 3I551 4RVDA 5T6BA 3CME1 3FQQA 3S2DI 3T4NB 1VQ4Z 2JMOA 2JNYA 1N8R1 1VQL1 3H0GI 5C44I 1M902 1X3ZA 1YJWZ 2E2HI 2F4OA 2VUGA 4A3LI 2R6MA 2R7ZI 1M1K2 2K3RA 2R92I 5D1OB 3CXCY 1YITZ 3CXCZ 3EEDA 1WIIA 1VQ6Z 2VF1A 3HOUI 4MONA 3CCL1 2RBLA 3S2HI 3I56Z 2JS4A 2PM9A 3FKII 1I3QI 3CPWY 1P9NA 2JA6I 3CPWZ 3HKZA 2IZ4A 4BBRI 3HOVI 3K7AI 1Q822 1W2BY 3CCQZ 2QRCB 1W2BZ 2GU2A 2OTLZ 1VQ7Z 3NFZA 2JA5I 3CCM1 4RV9A 1VQ9Z 3CCJZ 3GTLI 3M4OI 4NBFA 1YIJ1 3CCE1 4HGZA 4DGLA 3GTMS 2QRDB 2BJOA 3CC21 5D1PA 1QVFZ 3MONA 1Y1WI 4A3BI 3P5JB 1NJI2 4A3KI 1Q7Y1 3I07A 1DL6A 3PO3S 2DE5A 2LFUA 3G71Z 1TWFI 5FLXb 2V8KA 1YI2Z 3NH4A 1TFIA 1ZB9A 2Q4ZA 4HGYA 1K83I 1VQ5Z 5AN9F 1M901 3GTGI 4DQYB 2OOXB 3ESWA 4A3EI 3J80f 1X0TA 3CC41 4BY7I 1TWCI 3J80b 2QKDA 3CCMZ 1I6HI 1USPB 2RIQA 1VLAA 4MD9A 4CL1A 1QYPA 1YIJZ 3EERA 1R9TI 1SFOI 4MD7A 3MZLB 3GTQI 3S14I 2YADA 3NDIA 3NH8A 3J7A4 3I4MI 3IF8A 1VQOZ 4RVHA 2OZKA 1KD12 3IX0A 3KIFA 2WB1A 2E2JI 3VTNA 4E2XA 2H85A 2NVQI 1VQ81 1YHQ1 4E2YA 3S1NI 3CQZI 2NVXI 1S7MA 1KQSY 5A2Qf 2J6AA 1YJNZ 1RQFA 3CCRZ 2QREB 2E9HA 3S1QI 4TNUA 4MRIA 4NH1C 4A3II 1RO4A 4NOZA 2G2KA 4XX2A 1Q811 2QA4Z 4NBDA 4NFRA 4BXXI 2LIYA 4QTUA 1VQP1 4A3DI 5LL6f 2HF1A 2M6NA 3G6E1 4A3JI 3CD61 3TDHB 1VQM1 5T67A 1VQK1 1K8A2 2YU9I 4RVFA 1QVGY 2OTJZ 3I55Z 1QVGZ 3CMEZ 2O53A 1Q862 2Y0SA 1TWGI 1KRLA 3TE5B 1VQLZ 2DE7A 1KC82 1Z03A 2RT9A 1VQN1 4A3CI 2M48A 4RVGA 3CCS1 3CCV1 3S17I 2OOYB 3KIHA 3D9XA 5C4XI 1X3WA 3F3FC 5C3EI 3G4S1 3GTMI 3CCLZ 1ZB8A 4Y52I 4MH4A 2QEX1 5IT9f 1N8R2 1ML8A 3HOZI 5IT9b 2DE6A 3VMIA 3CD6Z 4NBCA 1K9M2 4S1TA 2RPRA 2VUMI 5IP9I 1WW9A 4DK1A 4A93I 2JR6A 1M1K1 4MXUA 4E33A 1QF8A 3NDJA 1S721 3Q87A 3GKQA 3GCFA 4EWCA 2JA7I 3GTOI 3VB9A 2NVTI 2AKLA 1VQ41 1YJ91 3CCSZ 3VMGA 3CCEZ 3HOWI 3GTKI 3CC2Z 2F4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW Z;  1VQK Z;  1QVF Y;  1YJN Z;  1Q82 2;  1W2B Y;  3CCR Z;  3CCQ Z;  1W2B Z;  1Q82 1;  1Q81 2;  2OTL Z;  1VQ7 Z;  1Q86 1;  1VQO 1;  1Q81 1;  1YIT 1;  2QA4 Z;  1K73 2;  1VQ6 1;  3CCM 1;  1VQ9 Z;  1VQP 1;  3CCJ Z;  1VQN Z;  1KC8 1;  3I56 1;  3CCV Z;  3CCU Z;  3CC7 Z;  1YIJ 1;  3G6E 1;  3CD6 1;  3OW2 Y;  3CCE 1;  3OW2 Z;  1VQM 1;  3CC2 1;  1YJW 1;  1VQK 1;  1K8A 2;  1KQS Z;  1QVG Y;  3CC4 Z;  2OTJ Z;  1QVF Z;  3I55 Z;  1YJN 1;  3CCR 1;  3CME Z;  3CCQ 1;  1QVG Z;  1K8A 1;  1Q86 2;  3G4S Z;  1Q7Y 2;  1NJI 2;  2QEX Z;  2OTL 1;  1Q7Y 1;  1VQ7 1;  2QA4 1;  1NJI 1;  1YJ9 Z;  3CMA Z;  1VQL Z;  3G71 Z;  1KC8 2;  1VQ9 1;  3CCJ 1;  1VQN 1;  1YI2 Z;  1K9M 1;  3CCV 1;  3CCS 1;  1VQ5 Z;  1M90 1;  1S72 Z;  3CC4 1;  2OTJ 1;  3I55 1;  3CME 1;  3G4S 1;  3CCL Z;  3CCM Z;  1VQ8 Z;  2QEX 1;  1N8R 2;  1YHQ Z;  1VQ4 Z;  1YIJ Z;  3CD6 Z;  1N8R 1;  1VQL 1;  3G71 1;  1K9M 2;  1M90 2;  1YJW Z;  1YI2 1;  3CCU 1;  3CC7 1;  1VQ5 1;  1M1K 2;  1M1K 1;  3CXC Y;  1VQO Z;  1KD1 2;  1S72 1;  1YIT Z;  3CXC Z;  1KD1 1;  1VQ6 Z;  1K73 1;  3CCL 1;  1VQP Z;  1JJ2 Y;  1VQ8 1;  3I56 Z;  1JJ2 Z;  1YHQ 1;  1VQ4 1;  1YJ9 1;  3CCS Z;  3G6E Z;  3CMA 1;  3CCE Z;  3CPW Y;  1VQM Z;  3CC2 Z;  1KQS Y; 
#chains in the Genus database with same CATH topology
 3RZO I;  1JWH C;  4NBE A;  4E32 A;  3BG0 B;  1Q82 1;  2V8I A;  4A3G I;  1NUI A;  3GTJ I;  1Q86 1;  1Y1V S;  1YIT 1;  1K73 2;  2JUB A;  2I3C A;  1VQ6 1;  2R93 I;  4BY1 I;  1RO2 A;  3HOY I;  2Q51 A;  1KC8 1;  3I56 1;  2PK7 A;  1WCM I;  3OW2 Y;  1YUA A;  4NBH A;  3OW2 Z;  2V8J A;  3HOX I;  2LEX A;  1KQS Z;  5A2Q b;  1YUK A;  3CC4 Z;  1RLY A;  3CCQ 1;  2JA8 I;  1Q7Y 2;  3GTP I;  3I4N I;  1FDI A;  2OTL 1;  1VQ7 1;  1NJI 1;  1Q16 A;  1YJ9 Z;  2W03 A;  3S1M I;  1Z02 A;  1VQ9 1;  2P3Y A;  3CCJ 1;  1Z01 A;  1K9M 1;  4E2W A;  2K5R A;  4NBA A;  2JIR A;  5T64 A;  4AYB A;  2QLV B;  2O4H A;  3RZD I;  4NBB A;  4NB8 A;  3FQM A;  4E30 A;  3LUS A;  2PMZ A;  2HU9 A;  5D1O A;  1VQ8 Z;  4X6A I;  3PO2 I;  1YHQ Z;  1RNI A;  3G71 1;  2KI7 B;  3M3Y I;  2JIP A;  1YI2 1;  5CM2 M;  3H3V J;  3VMH A;  3CCU 1;  3CC7 1;  2WAQ A;  4HH4 A;  1VQ5 1;  4QTT A;  2ZAE B;  1PFT A;  2V3V A;  1KD1 1;  5FLM I;  3F3P C;  1K73 1;  2E2I I;  1VQP Z;  1JJ2 Y;  3S15 I;  1JJ2 Z;  3CMA 1;  3G6E Z;  2GTH A;  1TWA I;  3MZK B;  3S1R I;  1VQM Z;  3BG1 B;  1VQK Z;  1QVF Y;  3PO3 I;  3QWU A;  1Q81 2;  2B63 I;  1N2F A;  1VQO 1;  4E2Z A;  2IZ3 A;  1I50 I;  2GTI A;  5FLX f;  2W04 A;  2P28 A;  3J81 f;  3D6W A;  2NVY I;  3J81 b;  1VQN Z;  1ZH1 A;  4NB9 A;  1NP6 A;  3CCV Z;  4Y7N I;  3CCU Z;  3CC7 Z;  2KPI A;  3NH5 A;  5IP7 I;  2RHB A;  1YJW 1;  3IFU A;  1L1O C;  4MD8 A;  1YJN 1;  3JAM f;  3CCR 1;  1K8A 1;  4E31 A;  4RS4 A;  3JAM b;  1LQL A;  4NBG A;  3G4S Z;  5C4J I;  1Y8C A;  2QEX Z;  2QA4 1;  3CMA Z;  3S16 I;  4A3F I;  2AYD A;  1USP A;  1Y1V I;  4BBS I;  1RO0 A;  1TWH I;  4A3M I;  2EGT A;  2QR1 B;  1S72 Z;  3U50 C;  2OTJ 1;  3I55 1;  4RVD A;  5T6B A;  3CME 1;  3FQQ A;  3S2D I;  3T4N B;  1VQ4 Z;  2JMO A;  2JNY A;  1N8R 1;  1VQL 1;  3H0G I;  5C44 I;  1M90 2;  1X3Z A;  1YJW Z;  2E2H I;  2F4O A;  2VUG A;  4A3L I;  2R6M A;  2R7Z I;  1M1K 2;  2K3R A;  2R92 I;  5D1O B;  3CXC Y;  1YIT Z;  3CXC Z;  3EED A;  3IR7 A;  1WII A;  1VQ6 Z;  2E7Z A;  2VF1 A;  3HOU I;  4MON A;  3CCL 1;  2RBL A;  3S2H I;  3I56 Z;  2JS4 A;  2PM9 A;  3FKI I;  1I3Q I;  3CPW Y;  1P9N A;  2JA6 I;  3CPW Z;  3HKZ A;  2IZ4 A;  4BBR I;  3HOV I;  3K7A I;  1Q82 2;  1W2B Y;  3CCQ Z;  2QRC B;  1W2B Z;  2GU2 A;  2OTL Z;  1VQ7 Z;  2V45 A;  2VPY A;  3NFZ A;  2JA5 I;  3CCM 1;  4RV9 A;  1VQ9 Z;  3CCJ Z;  3GTL I;  3M4O I;  4NBF A;  1YIJ 1;  3CCE 1;  4HGZ A;  4DGL A;  3GTM S;  2QRD B;  2BJO A;  3CC2 1;  1SIW A;  5D1P A;  1QVF Z;  3MON A;  1Y1W I;  4A3B I;  3P5J B;  1NJI 2;  4A3K I;  1Q7Y 1;  3I07 A;  1DL6 A;  3PO3 S;  2DE5 A;  2LFU A;  3G71 Z;  1TWF I;  5FLX b;  2V8K A;  1YI2 Z;  3D2L A;  3NH4 A;  1TFI A;  1ZB9 A;  2Q4Z A;  4HGY A;  1K83 I;  1VQ5 Z;  5AN9 F;  1M90 1;  3GTG I;  4DQY B;  2OOX B;  3ESW A;  4A3E I;  3J80 f;  1X0T A;  3CC4 1;  4BY7 I;  1TWC I;  3J80 b;  2QKD A;  3CCM Z;  2NAP A;  1I6H I;  1USP B;  2RIQ A;  1VLA A;  4MD9 A;  4CL1 A;  1QYP A;  1YIJ Z;  3EER A;  1QXF A;  1R9T I;  1SFO I;  4MD7 A;  3MZL B;  3GTQ I;  3S14 I;  2VPX A;  2YAD A;  3NDI A;  3NH8 A;  3J7A 4;  3I4M I;  3IF8 A;  1VQO Z;  4RVH A;  2OZK A;  1KD1 2;  3IX0 A;  2JIO A;  3KIF A;  2WB1 A;  2E2J I;  3VTN A;  2JIQ A;  4E2X A;  2H85 A;  2NVQ I;  1VQ8 1;  1YHQ 1;  4E2Y A;  3S1N I;  3CQZ I;  2NVX I;  1S7M A;  1AA6 A;  1WZN A;  1KQS Y;  5A2Q f;  2J6A A;  1YJN Z;  1RQF A;  3CCR Z;  2QRE B;  2E9H A;  3S1Q I;  4TNU A;  4MRI A;  4NH1 C;  4A3I I;  1RO4 A;  4NOZ A;  2G2K A;  4XX2 A;  1Q81 1;  2QA4 Z;  4NBD A;  4NFR A;  4BXX I;  2LIY A;  4QTU A;  1VQP 1;  4A3D I;  5LL6 f;  2HF1 A;  2M6N A;  3G6E 1;  4A3J I;  3CD6 1;  3TDH B;  1VQM 1;  5T67 A;  1VQK 1;  1K8A 2;  2YU9 I;  4RVF A;  1QVG Y;  2OTJ Z;  1FDO A;  3I55 Z;  1QVG Z;  3CME Z;  2O53 A;  1Q86 2;  2Y0S A;  1TWG I;  1KRL A;  3TE5 B;  1VQL Z;  2DE7 A;  1KC8 2;  1Z03 A;  2RT9 A;  1VQN 1;  4A3C I;  2M48 A;  4RVG A;  3CCS 1;  3CCV 1;  3S17 I;  2VPW A;  2OOY B;  3KIH A;  2JIM A;  3D9X A;  5C4X I;  1X3W A;  3F3F C;  5C3E I;  3G4S 1;  3GTM I;  3CCL Z;  1ZB8 A;  4Y52 I;  4MH4 A;  2QEX 1;  5IT9 f;  1N8R 2;  1ML8 A;  3HOZ I;  5IT9 b;  2DE6 A;  3VMI A;  3CD6 Z;  4NBC A;  1K9M 2;  4S1T A;  2RPR A;  2VUM I;  5IP9 I;  1WW9 A;  4DK1 A;  4A93 I;  2JR6 A;  1M1K 1;  4MXU A;  2IV2 X;  4E33 A;  1QF8 A;  3NDJ A;  1S72 1;  1WJ2 A;  3Q87 A;  3GKQ A;  3GCF A;  2VPZ A;  4EWC A;  2JA7 I;  3GTO I;  3VB9 A;  2NVT I;  2AKL A;  1VQ4 1;  1YJ9 1;  3CCS Z;  3VMG A;  3CCE Z;  3HOW I;  3GTK I;  3CC2 Z;  2F4M A; 
#chains in the Genus database with same CATH homology
 3RZO I;  1JWH C;  4NBE A;  4E32 A;  3BG0 B;  1Q82 1;  2V8I A;  4A3G I;  1NUI A;  3GTJ I;  1Q86 1;  1Y1V S;  1YIT 1;  1K73 2;  2JUB A;  2I3C A;  1VQ6 1;  2R93 I;  4BY1 I;  1RO2 A;  3HOY I;  2Q51 A;  1KC8 1;  3I56 1;  2PK7 A;  1WCM I;  3OW2 Y;  1YUA A;  4NBH A;  3OW2 Z;  2V8J A;  3HOX I;  1KQS Z;  5A2Q b;  1YUK A;  3CC4 Z;  1RLY A;  3CCQ 1;  2JA8 I;  1Q7Y 2;  3GTP I;  3I4N I;  2OTL 1;  1VQ7 1;  1NJI 1;  1YJ9 Z;  2W03 A;  3S1M I;  1Z02 A;  1VQ9 1;  2P3Y A;  3CCJ 1;  1Z01 A;  1K9M 1;  4E2W A;  2K5R A;  4NBA A;  5T64 A;  4AYB A;  2QLV B;  2O4H A;  3RZD I;  4NBB A;  4NB8 A;  3FQM A;  4E30 A;  3LUS A;  2PMZ A;  2HU9 A;  5D1O A;  1VQ8 Z;  4X6A I;  3PO2 I;  1YHQ Z;  1RNI A;  3G71 1;  2KI7 B;  3M3Y I;  1YI2 1;  5CM2 M;  3H3V J;  3VMH A;  3CCU 1;  3CC7 1;  2WAQ A;  4HH4 A;  1VQ5 1;  4QTT A;  2ZAE B;  1PFT A;  1KD1 1;  5FLM I;  3F3P C;  1K73 1;  2E2I I;  1VQP Z;  1JJ2 Y;  3S15 I;  1JJ2 Z;  3CMA 1;  3G6E Z;  2GTH A;  1TWA I;  3MZK B;  3S1R I;  1VQM Z;  3BG1 B;  1VQK Z;  1QVF Y;  3PO3 I;  3QWU A;  1Q81 2;  2B63 I;  1N2F A;  1VQO 1;  4E2Z A;  2IZ3 A;  1I50 I;  2GTI A;  5FLX f;  2W04 A;  2P28 A;  3J81 f;  3D6W A;  2NVY I;  3J81 b;  1VQN Z;  1ZH1 A;  4NB9 A;  1NP6 A;  3CCV Z;  4Y7N I;  3CCU Z;  3CC7 Z;  2KPI A;  3NH5 A;  5IP7 I;  2RHB A;  1YJW 1;  3IFU A;  1L1O C;  4MD8 A;  1YJN 1;  3JAM f;  3CCR 1;  1K8A 1;  4E31 A;  4RS4 A;  3JAM b;  1LQL A;  4NBG A;  3G4S Z;  5C4J I;  2QEX Z;  2QA4 1;  3CMA Z;  3S16 I;  4A3F I;  1USP A;  1Y1V I;  4BBS I;  1RO0 A;  1TWH I;  4A3M I;  2EGT A;  2QR1 B;  1S72 Z;  3U50 C;  2OTJ 1;  3I55 1;  4RVD A;  5T6B A;  3CME 1;  3FQQ A;  3S2D I;  3T4N B;  1VQ4 Z;  2JMO A;  2JNY A;  1N8R 1;  1VQL 1;  3H0G I;  5C44 I;  1M90 2;  1X3Z A;  1YJW Z;  2E2H I;  2F4O A;  2VUG A;  4A3L I;  2R6M A;  2R7Z I;  1M1K 2;  2K3R A;  2R92 I;  5D1O B;  3CXC Y;  1YIT Z;  3CXC Z;  3EED A;  1WII A;  1VQ6 Z;  2VF1 A;  3HOU I;  4MON A;  3CCL 1;  2RBL A;  3S2H I;  3I56 Z;  2JS4 A;  2PM9 A;  3FKI I;  1I3Q I;  3CPW Y;  1P9N A;  2JA6 I;  3CPW Z;  3HKZ A;  2IZ4 A;  4BBR I;  3HOV I;  3K7A I;  1Q82 2;  1W2B Y;  3CCQ Z;  2QRC B;  1W2B Z;  2GU2 A;  2OTL Z;  1VQ7 Z;  3NFZ A;  2JA5 I;  3CCM 1;  4RV9 A;  1VQ9 Z;  3CCJ Z;  3GTL I;  3M4O I;  4NBF A;  1YIJ 1;  3CCE 1;  4HGZ A;  4DGL A;  3GTM S;  2QRD B;  2BJO A;  3CC2 1;  5D1P A;  1QVF Z;  3MON A;  1Y1W I;  4A3B I;  3P5J B;  1NJI 2;  4A3K I;  1Q7Y 1;  3I07 A;  1DL6 A;  3PO3 S;  2DE5 A;  2LFU A;  3G71 Z;  1TWF I;  5FLX b;  2V8K A;  1YI2 Z;  3NH4 A;  1TFI A;  1ZB9 A;  2Q4Z A;  4HGY A;  1K83 I;  1VQ5 Z;  5AN9 F;  1M90 1;  3GTG I;  4DQY B;  2OOX B;  3ESW A;  4A3E I;  3J80 f;  1X0T A;  3CC4 1;  4BY7 I;  1TWC I;  3J80 b;  2QKD A;  3CCM Z;  1I6H I;  1USP B;  2RIQ A;  1VLA A;  4MD9 A;  4CL1 A;  1QYP A;  1YIJ Z;  3EER A;  1R9T I;  1SFO I;  4MD7 A;  3MZL B;  3GTQ I;  3S14 I;  2YAD A;  3NDI A;  3NH8 A;  3J7A 4;  3I4M I;  3IF8 A;  1VQO Z;  4RVH A;  2OZK A;  1KD1 2;  3IX0 A;  3KIF A;  2WB1 A;  2E2J I;  3VTN A;  4E2X A;  2H85 A;  2NVQ I;  1VQ8 1;  1YHQ 1;  4E2Y A;  3S1N I;  3CQZ I;  2NVX I;  1S7M A;  1KQS Y;  5A2Q f;  2J6A A;  1YJN Z;  1RQF A;  3CCR Z;  2QRE B;  2E9H A;  3S1Q I;  4TNU A;  4MRI A;  4NH1 C;  4A3I I;  1RO4 A;  4NOZ A;  2G2K A;  4XX2 A;  1Q81 1;  2QA4 Z;  4NBD A;  4NFR A;  4BXX I;  2LIY A;  4QTU A;  1VQP 1;  4A3D I;  5LL6 f;  2HF1 A;  2M6N A;  3G6E 1;  4A3J I;  3CD6 1;  3TDH B;  1VQM 1;  5T67 A;  1VQK 1;  1K8A 2;  2YU9 I;  4RVF A;  1QVG Y;  2OTJ Z;  3I55 Z;  1QVG Z;  3CME Z;  2O53 A;  1Q86 2;  2Y0S A;  1TWG I;  1KRL A;  3TE5 B;  1VQL Z;  2DE7 A;  1KC8 2;  1Z03 A;  2RT9 A;  1VQN 1;  4A3C I;  2M48 A;  4RVG A;  3CCS 1;  3CCV 1;  3S17 I;  2OOY B;  3KIH A;  3D9X A;  5C4X I;  1X3W A;  3F3F C;  5C3E I;  3G4S 1;  3GTM I;  3CCL Z;  1ZB8 A;  4Y52 I;  4MH4 A;  2QEX 1;  5IT9 f;  1N8R 2;  1ML8 A;  3HOZ I;  5IT9 b;  2DE6 A;  3VMI A;  3CD6 Z;  4NBC A;  1K9M 2;  4S1T A;  2RPR A;  2VUM I;  5IP9 I;  1WW9 A;  4DK1 A;  4A93 I;  2JR6 A;  1M1K 1;  4MXU A;  4E33 A;  1QF8 A;  3NDJ A;  1S72 1;  3Q87 A;  3GKQ A;  3GCF A;  4EWC A;  2JA7 I;  3GTO I;  3VB9 A;  2NVT I;  2AKL A;  1VQ4 1;  1YJ9 1;  3CCS Z;  3VMG A;  3CCE Z;  3HOW I;  3GTK I;  3CC2 Z;  2F4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...