3CCL1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccl100
3CC21 3CMA1 1VQPZ 1YJ9Z 1Q811 3CCRZ 3CCU1 3CCV1 3I56Z 3CCMZ 1QVGY 1VQ41 1Q822 1K9M1 2QA41 3CMEZ 1JJ2Z 1VQ7Z 3CCLZ 3G71Z 3G4SZ 3CXCZ 1VQ9Z 1YJN1 1VQ81 1VQMZ 1VQ5Z 2QEXZ 3CD61 1YI21 1JJ2Y 1Q7Y1 1YJWZ 3CXCY 1S721 1KC82 1K732 1YJ91 1VQ61 1K8A2 3I561 3CPWZ 1N8R2 3CCM1 3CCJ1 3CC71 1VQL1 3CME1 1KD11 3I551 1NJI2 3CC4Z 1VQOZ 3CCL1 3G711 3CCE1 3G4S1 3CPWY 1YITZ 1YIJZ 1M902 3CCSZ 1M1K1 1Q861 3CC2Z 1YHQZ 3CCVZ 1VQK1 1KQSY 2OTJ1 1W2BZ 1VQ4Z 3G6EZ 1Q821 1M1K2 3CCQ1 1VQP1 1Q812 3CCR1 3OW2Z 1W2BY 1YJNZ 1VQ8Z 1K9M2 1QVFY 2OTLZ 1VQNZ 3CD6Z 1YI2Z 1KQSZ 1VQ71 3OW2Y 1S72Z 1KC81 1VQ91 1YIJ1 3CMAZ 1K731 3CCUZ 1YHQ1 1VQM1 1VQ51 2QEX1 1VQ6Z 1K8A1 1Q7Y2 1N8R1 1YJW1 3CCJZ 3CC7Z 2QA4Z 1QVFZ 1VQLZ 3G6E1 3I55Z 1NJI1 3CCEZ 1M901 2OTL1 1VQN1 1KD12 1VQKZ 3CC41 2OTJZ 1VQO1 1QVGZ 1YIT1 3CCS1 1Q862 3CCQZ
chains in the Genus database with same CATH superfamily
3CC21 2QLVB 3HOZI 3I56Z 4MD9A 3S2DI 1P9NA 3NH5A 1QVGY 3D6WA 1RO0A 1RO2A 3S16I 3KIHA 4MONA 3T4NB 2E2JI 3H3VJ 2H85A 2WB1A 4NBCA 4A3MI 1YJN1 2JMOA 5A2Qb 3U50C 2RHBA 1VQ5Z 3M4OI 1YI21 1Q7Y1 4E2WA 1QXFA 2JNYA 3S15I 2EGTA 3S1QI 3QWUA 4QTTA 3HOVI 2IZ4A 3K7AI 4NFRA 1N2FA 1VQ61 1R9TI 4BY7I 3MZLB 3S1NI 1VQOZ 4XX2A 3CCL1 3G4S1 2Y0SA 1TFIA 3IFUA 1NP6A 1Q861 2GU2A 2JIRA 3CCVZ 2E7ZA 1VLAA 3EERA 2YADA 5T67A 2E9HA 4RVDA 2VUGA 1PFTA 3CCQ1 3FQMA 1VQP1 4A3LI 3CCR1 1NUIA 4E2ZA 2O4HA 1VQ8Z 2VUMI 2OTLZ 1RO4A 1ZH1A 3CD6Z 1S72Z 3H0GI 1VQ91 1YIJ1 3PO2I 3CCUZ 1YHQ1 1TWGI 1ML8A 1WW9A 2VPYA 4A3EI 4Y7NI 4DQYB 3CCJZ 3CC7Z 3GTGI 2QA4Z 1VQLZ 5D1OA 5D1OB 2JA6I 5C4XI 2QKDA 3I55Z 2KPIA 3CCEZ 2DE6A 1Y1VI 2R6MA 4E33A 3JAMf 1VQN1 1KD12 1VQKZ 3CC41 3J80f 4NBGA 1DL6A 2DE7A 3CCS1 4NBAA 1M1K1 1LQLA 3CMA1 4NOZA 4Y52I 2YU9I 1I6HI 5CM2M 3GTKI 1VQ41 1K9M1 3MZKB 3CMEZ 2R92I 3BG0B 1JJ2Z 3G71Z 3RZOI 3CQZI 3VB9A 3CXCZ 3NH8A 2W04A 4A3JI 3HOUI 5C44I 3PO3I 1VQMZ 1JWHC 2GTHA 1JJ2Y 3CXCY 1KC82 4A3BI 5FLXf 3P5JB 4MD7A 2V3VA 3I561 3CPWZ 5T6BA 5D1PA 1FDOA 3D9XA 4BY1I 3NDJA 2OZKA 1RLYA 2R7ZI 3CPWY 2O53A 1M902 4A3DI 3CC2Z 2NVQI 1KQSY 1Z03A 3GTPI 2F4OA 3G6EZ 2W03A 3JAMb 3VMGA 1RNIA 4E32A 4QTUA 4MH4A 3TDHB 1Q812 1YJNZ 2JIMA 3GTLI 2KI7B 4NB9A 1QVFY 2JIQA 1AA6A 1YI2Z 1VQ71 2IZ3A 3F3PC 2VPZA 1QYPA 2V45A 2BJOA 1Q16A 2QEX1 2G2KA 3GTOI 1VQ6Z 1YJW1 4DGLA 2AKLA 1SFOI 5AN9F 2F4MA 5FLXb 4HGYA 5IT9f 1I3QI 2OTL1 3S2HI 4NBEA 2QR1B 3GCFA 2JA7I 1YIT1 3CCQZ 1VQPZ 3GKQA 4RVHA 1YJ9Z 3CCRZ 1TWFI 3CCU1 4RVGA 3CCMZ 2AYDA 1SIWA 1Y1WI 2NVXI 1Q822 3IF8A 4E2XA 2QA41 3TE5B 2DE5A 2NVTI 3HOYI 2JA5I 4NBFA 2HF1A 4NB8A 1VQ9Z 1TWHI 1X3WA 1Y1VS 4CL1A 3F3FC 4RVFA 2E2II 2VPWA 1K732 3HKZA 3Q87A 3GTMI 2WAQA 1K8A2 1N8R2 3GTMS 2QRDB 2JUBA 4E30A 3HOXI 2PK7A 3CME1 1KD11 2R93I 1NJI2 3CC4Z 2J6AA 3G711 3CCSZ 1I50I 1YUAA 1Z02A 1L1OC 2P28A 2GTIA 2OTJ1 3PO3S 2I3CA 1W2BZ 3HOWI 1VQ4Z 5IT9b 3GTQI 3J7A4 2K5RA 1FDIA 4DK1A 2Q51A 3OW2Z 2JA8I 5T64A 1W2BY 3ESWA 3I4MI 1ZB9A 2M48A 2V8KA 2JR6A 2OOYB 1WJ2A 1KQSZ 3OW2Y 1KC81 3VTNA 4NBHA 4BXXI 1WZNA 1VQ51 2RPRA 4X6AI 3MONA 1Q7Y2 4NBBA 1QVFZ 3G6E1 4EWCA 2LIYA 3J80b 2QRCB 4MRIA 1QF8A 2NVYI 1M901 4AYBA 3S1RI 1WCMI 2HU9A 1VQO1 2VPXA 4E2YA 4BBRI 1USPA 1USPB 1Q862 3J81f 1KRLA 1S7MA 1Q811 1X3ZA 5IP7I 1TWAI 3CCV1 4NH1C 3IX0A 1X0TA 5LL6f 2QREB 2JIPA 2LFUA 1VQ7Z 1K83I 3CCLZ 3D2LA 3G4SZ 2NAPA 4A3II 4RV9A 2RIQA 4A3KI 1VQ81 2M6NA 2Q4ZA 2QEXZ 3CD61 2OOXB 1YJWZ 4BBSI 4HGZA 1S721 3FQQA 5C3EI 3S14I 4A3GI 1ZB8A 3VMHA 1YJ91 4RS4A 3NDIA 3CCM1 2IV2X 3CCJ1 3CC71 1VQL1 3LUSA 2V8JA 3I551 3RZDI 2E2HI 5IP9I 3CCE1 1YITZ 1YIJZ 3VMIA 3GTJI 4MD8A 1YHQZ 2ZAEB 1VQK1 4E31A 3I07A 2LEXA 4NBDA 1Q821 1M1K2 2PM9A 4MXUA 4HH4A 5A2Qf 5C4JI 2VF1A 4A3CI 3I4NI 3M3YI 2PMZA 2P3YA 2K3RA 3J81b 4A93I 1K9M2 1TWCI 1VQNZ 1Y8CA 4TNUA 4S1TA 3KIFA 2RBLA 1RQFA 2V8IA 3CMAZ 1K731 2JS4A 3S1MI 1VQM1 1K8A1 1N8R1 3NFZA 3IR7A 3BG1B 2B63I 3EEDA 3FKII 1NJI1 3S17I 5FLMI 1Z01A 1WIIA 4A3FI 3NH4A 1YUKA 2OTJZ 2JIOA 1QVGZ 2RT9A
chains in the Genus database with same CATH topology
3CC21 2QLVB 3HOZI 3I56Z 4MD9A 3S2DI 1P9NA 3NH5A 1QVGY 3D6WA 1RO0A 1RO2A 3S16I 3KIHA 4MONA 3T4NB 2E2JI 3H3VJ 2H85A 2WB1A 4NBCA 4A3MI 1YJN1 2JMOA 5A2Qb 3U50C 2RHBA 1VQ5Z 3M4OI 1YI21 1Q7Y1 4E2WA 2JNYA 3S15I 2EGTA 3S1QI 3QWUA 4QTTA 3HOVI 2IZ4A 3K7AI 4NFRA 1N2FA 1VQ61 1R9TI 4BY7I 3MZLB 3S1NI 1VQOZ 4XX2A 3CCL1 3G4S1 2Y0SA 1TFIA 3IFUA 1NP6A 1Q861 2GU2A 3CCVZ 1VLAA 3EERA 2YADA 5T67A 2E9HA 4RVDA 2VUGA 1PFTA 3CCQ1 3FQMA 1VQP1 4A3LI 3CCR1 1NUIA 4E2ZA 2O4HA 1VQ8Z 2VUMI 2OTLZ 1RO4A 1ZH1A 3CD6Z 1S72Z 3H0GI 1VQ91 1YIJ1 3PO2I 3CCUZ 1YHQ1 1TWGI 1ML8A 1WW9A 4A3EI 4Y7NI 4DQYB 3CCJZ 3CC7Z 3GTGI 2QA4Z 1VQLZ 5D1OA 5D1OB 2JA6I 5C4XI 2QKDA 3I55Z 2KPIA 3CCEZ 2DE6A 1Y1VI 2R6MA 4E33A 3JAMf 1VQN1 1KD12 1VQKZ 3CC41 3J80f 4NBGA 1DL6A 2DE7A 3CCS1 4NBAA 1M1K1 1LQLA 3CMA1 4NOZA 4Y52I 2YU9I 1I6HI 5CM2M 3GTKI 1VQ41 1K9M1 3MZKB 3CMEZ 2R92I 3BG0B 1JJ2Z 3G71Z 3RZOI 3CQZI 3VB9A 3CXCZ 3NH8A 2W04A 4A3JI 3HOUI 5C44I 3PO3I 1VQMZ 1JWHC 2GTHA 1JJ2Y 3CXCY 1KC82 4A3BI 5FLXf 3P5JB 4MD7A 3I561 3CPWZ 5T6BA 5D1PA 3D9XA 4BY1I 3NDJA 2OZKA 1RLYA 2R7ZI 3CPWY 2O53A 1M902 4A3DI 3CC2Z 2NVQI 1KQSY 1Z03A 3GTPI 2F4OA 3G6EZ 2W03A 3JAMb 3VMGA 1RNIA 4E32A 4QTUA 4MH4A 3TDHB 1Q812 1YJNZ 3GTLI 2KI7B 4NB9A 1QVFY 1YI2Z 1VQ71 2IZ3A 3F3PC 1QYPA 2BJOA 2QEX1 2G2KA 3GTOI 1VQ6Z 1YJW1 4DGLA 2AKLA 1SFOI 5AN9F 2F4MA 5FLXb 4HGYA 5IT9f 1I3QI 2OTL1 3S2HI 4NBEA 2QR1B 3GCFA 2JA7I 1YIT1 3CCQZ 1VQPZ 3GKQA 4RVHA 1YJ9Z 3CCRZ 1TWFI 3CCU1 4RVGA 3CCMZ 1Y1WI 2NVXI 1Q822 3IF8A 4E2XA 2QA41 3TE5B 2DE5A 2NVTI 3HOYI 2JA5I 4NBFA 2HF1A 4NB8A 1VQ9Z 1TWHI 1X3WA 1Y1VS 4CL1A 3F3FC 4RVFA 2E2II 1K732 3HKZA 3Q87A 3GTMI 2WAQA 1K8A2 1N8R2 3GTMS 2QRDB 2JUBA 4E30A 3HOXI 2PK7A 3CME1 1KD11 2R93I 1NJI2 3CC4Z 2J6AA 3G711 3CCSZ 1I50I 1YUAA 1Z02A 1L1OC 2P28A 2GTIA 2OTJ1 3PO3S 2I3CA 1W2BZ 3HOWI 1VQ4Z 5IT9b 3GTQI 3J7A4 2K5RA 4DK1A 2Q51A 3OW2Z 2JA8I 5T64A 1W2BY 3ESWA 3I4MI 1ZB9A 2M48A 2V8KA 2JR6A 2OOYB 1KQSZ 3OW2Y 1KC81 3VTNA 4NBHA 4BXXI 1VQ51 2RPRA 4X6AI 3MONA 1Q7Y2 4NBBA 1QVFZ 3G6E1 4EWCA 2LIYA 3J80b 2QRCB 4MRIA 1QF8A 2NVYI 1M901 4AYBA 3S1RI 1WCMI 2HU9A 1VQO1 4E2YA 4BBRI 1USPA 1USPB 1Q862 3J81f 1KRLA 1S7MA 1Q811 1X3ZA 5IP7I 1TWAI 3CCV1 4NH1C 3IX0A 1X0TA 5LL6f 2QREB 2LFUA 1VQ7Z 1K83I 3CCLZ 3G4SZ 4A3II 4RV9A 2RIQA 4A3KI 1VQ81 2M6NA 2Q4ZA 2QEXZ 3CD61 2OOXB 1YJWZ 4BBSI 4HGZA 1S721 3FQQA 5C3EI 3S14I 4A3GI 1ZB8A 3VMHA 1YJ91 4RS4A 3NDIA 3CCM1 3CCJ1 3CC71 1VQL1 3LUSA 2V8JA 3I551 3RZDI 2E2HI 5IP9I 3CCE1 1YITZ 1YIJZ 3VMIA 3GTJI 4MD8A 1YHQZ 2ZAEB 1VQK1 4E31A 3I07A 4NBDA 1Q821 1M1K2 2PM9A 4MXUA 4HH4A 5A2Qf 5C4JI 2VF1A 4A3CI 3I4NI 3M3YI 2PMZA 2P3YA 2K3RA 3J81b 4A93I 1K9M2 1TWCI 1VQNZ 4TNUA 4S1TA 3KIFA 2RBLA 1RQFA 2V8IA 3CMAZ 1K731 2JS4A 3S1MI 1VQM1 1K8A1 1N8R1 3NFZA 3BG1B 2B63I 3EEDA 3FKII 1NJI1 3S17I 5FLMI 1Z01A 1WIIA 4A3FI 3NH4A 1YUKA 2OTJZ 1QVGZ 2RT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 1;  3CMA 1;  1VQP Z;  1YJ9 Z;  1Q81 1;  3CCR Z;  3CCU 1;  3CCV 1;  3I56 Z;  3CCM Z;  1QVG Y;  1VQ4 1;  1Q82 2;  1K9M 1;  2QA4 1;  3CME Z;  1JJ2 Z;  1VQ7 Z;  3CCL Z;  3G71 Z;  3G4S Z;  3CXC Z;  1VQ9 Z;  1YJN 1;  1VQ8 1;  1VQM Z;  1VQ5 Z;  2QEX Z;  3CD6 1;  1YI2 1;  1JJ2 Y;  1Q7Y 1;  1YJW Z;  3CXC Y;  1S72 1;  1KC8 2;  1K73 2;  1YJ9 1;  1VQ6 1;  1K8A 2;  3I56 1;  3CPW Z;  1N8R 2;  3CCM 1;  3CCJ 1;  3CC7 1;  1VQL 1;  3CME 1;  1KD1 1;  3I55 1;  1NJI 2;  3CC4 Z;  1VQO Z;  3CCL 1;  3G71 1;  3CCE 1;  3G4S 1;  3CPW Y;  1YIT Z;  1YIJ Z;  1M90 2;  3CCS Z;  1M1K 1;  1Q86 1;  3CC2 Z;  1YHQ Z;  3CCV Z;  1VQK 1;  1KQS Y;  2OTJ 1;  1W2B Z;  1VQ4 Z;  3G6E Z;  1Q82 1;  1M1K 2;  3CCQ 1;  1VQP 1;  1Q81 2;  3CCR 1;  3OW2 Z;  1W2B Y;  1YJN Z;  1VQ8 Z;  1K9M 2;  1QVF Y;  2OTL Z;  1VQN Z;  3CD6 Z;  1YI2 Z;  1KQS Z;  1VQ7 1;  3OW2 Y;  1S72 Z;  1KC8 1;  1VQ9 1;  1YIJ 1;  3CMA Z;  1K73 1;  3CCU Z;  1YHQ 1;  1VQM 1;  1VQ5 1;  2QEX 1;  1VQ6 Z;  1K8A 1;  1Q7Y 2;  1N8R 1;  1YJW 1;  3CCJ Z;  3CC7 Z;  2QA4 Z;  1QVF Z;  1VQL Z;  3G6E 1;  3I55 Z;  1NJI 1;  3CCE Z;  1M90 1;  2OTL 1;  1VQN 1;  1KD1 2;  1VQK Z;  3CC4 1;  2OTJ Z;  1VQO 1;  1QVG Z;  1YIT 1;  3CCS 1;  1Q86 2;  3CCQ Z; 
#chains in the Genus database with same CATH topology
 3CC2 1;  2QLV B;  3HOZ I;  3I56 Z;  4MD9 A;  3S2D I;  1P9N A;  3NH5 A;  1QVG Y;  3D6W A;  1RO0 A;  1RO2 A;  3S16 I;  3KIH A;  4MON A;  3T4N B;  2E2J I;  3H3V J;  2H85 A;  2WB1 A;  4NBC A;  4A3M I;  1YJN 1;  2JMO A;  5A2Q b;  3U50 C;  2RHB A;  1VQ5 Z;  3M4O I;  1YI2 1;  1Q7Y 1;  4E2W A;  1QXF A;  2JNY A;  3S15 I;  2EGT A;  3S1Q I;  3QWU A;  4QTT A;  3HOV I;  2IZ4 A;  3K7A I;  4NFR A;  1N2F A;  1VQ6 1;  1R9T I;  4BY7 I;  3MZL B;  3S1N I;  1VQO Z;  4XX2 A;  3CCL 1;  3G4S 1;  2Y0S A;  1TFI A;  3IFU A;  1NP6 A;  1Q86 1;  2GU2 A;  2JIR A;  3CCV Z;  2E7Z A;  1VLA A;  3EER A;  2YAD A;  5T67 A;  2E9H A;  4RVD A;  2VUG A;  1PFT A;  3CCQ 1;  3FQM A;  1VQP 1;  4A3L I;  3CCR 1;  1NUI A;  4E2Z A;  2O4H A;  1VQ8 Z;  2VUM I;  2OTL Z;  1RO4 A;  1ZH1 A;  3CD6 Z;  1S72 Z;  3H0G I;  1VQ9 1;  1YIJ 1;  3PO2 I;  3CCU Z;  1YHQ 1;  1TWG I;  1ML8 A;  1WW9 A;  2VPY A;  4A3E I;  4Y7N I;  4DQY B;  3CCJ Z;  3CC7 Z;  3GTG I;  2QA4 Z;  1VQL Z;  5D1O A;  5D1O B;  2JA6 I;  5C4X I;  2QKD A;  3I55 Z;  2KPI A;  3CCE Z;  2DE6 A;  1Y1V I;  2R6M A;  4E33 A;  3JAM f;  1VQN 1;  1KD1 2;  1VQK Z;  3CC4 1;  3J80 f;  4NBG A;  1DL6 A;  2DE7 A;  3CCS 1;  4NBA A;  1M1K 1;  1LQL A;  3CMA 1;  4NOZ A;  4Y52 I;  2YU9 I;  1I6H I;  5CM2 M;  3GTK I;  1VQ4 1;  1K9M 1;  3MZK B;  3CME Z;  2R92 I;  3BG0 B;  1JJ2 Z;  3G71 Z;  3RZO I;  3CQZ I;  3VB9 A;  3CXC Z;  3NH8 A;  2W04 A;  4A3J I;  3HOU I;  5C44 I;  3PO3 I;  1VQM Z;  1JWH C;  2GTH A;  1JJ2 Y;  3CXC Y;  1KC8 2;  4A3B I;  5FLX f;  3P5J B;  4MD7 A;  2V3V A;  3I56 1;  3CPW Z;  5T6B A;  5D1P A;  1FDO A;  3D9X A;  4BY1 I;  3NDJ A;  2OZK A;  1RLY A;  2R7Z I;  3CPW Y;  2O53 A;  1M90 2;  4A3D I;  3CC2 Z;  2NVQ I;  1KQS Y;  1Z03 A;  3GTP I;  2F4O A;  3G6E Z;  2W03 A;  3JAM b;  3VMG A;  1RNI A;  4E32 A;  4QTU A;  4MH4 A;  3TDH B;  1Q81 2;  1YJN Z;  2JIM A;  3GTL I;  2KI7 B;  4NB9 A;  1QVF Y;  2JIQ A;  1AA6 A;  1YI2 Z;  1VQ7 1;  2IZ3 A;  3F3P C;  2VPZ A;  1QYP A;  2V45 A;  2BJO A;  1Q16 A;  2QEX 1;  2G2K A;  3GTO I;  1VQ6 Z;  1YJW 1;  4DGL A;  2AKL A;  1SFO I;  5AN9 F;  2F4M A;  5FLX b;  4HGY A;  5IT9 f;  1I3Q I;  2OTL 1;  3S2H I;  4NBE A;  2QR1 B;  3GCF A;  2JA7 I;  1YIT 1;  3CCQ Z;  1VQP Z;  3GKQ A;  4RVH A;  1YJ9 Z;  3CCR Z;  1TWF I;  3CCU 1;  4RVG A;  3CCM Z;  2AYD A;  1SIW A;  1Y1W I;  2NVX I;  1Q82 2;  3IF8 A;  4E2X A;  2QA4 1;  3TE5 B;  2DE5 A;  2NVT I;  3HOY I;  2JA5 I;  4NBF A;  2HF1 A;  4NB8 A;  1VQ9 Z;  1TWH I;  1X3W A;  1Y1V S;  4CL1 A;  3F3F C;  4RVF A;  2E2I I;  2VPW A;  1K73 2;  3HKZ A;  3Q87 A;  3GTM I;  2WAQ A;  1K8A 2;  1N8R 2;  3GTM S;  2QRD B;  2JUB A;  4E30 A;  3HOX I;  2PK7 A;  3CME 1;  1KD1 1;  2R93 I;  1NJI 2;  3CC4 Z;  2J6A A;  3G71 1;  3CCS Z;  1I50 I;  1YUA A;  1Z02 A;  1L1O C;  2P28 A;  2GTI A;  2OTJ 1;  3PO3 S;  2I3C A;  1W2B Z;  3HOW I;  1VQ4 Z;  5IT9 b;  3GTQ I;  3J7A 4;  2K5R A;  1FDI A;  4DK1 A;  2Q51 A;  3OW2 Z;  2JA8 I;  5T64 A;  1W2B Y;  3ESW A;  3I4M I;  1ZB9 A;  2M48 A;  2V8K A;  2JR6 A;  2OOY B;  1WJ2 A;  1KQS Z;  3OW2 Y;  1KC8 1;  3VTN A;  4NBH A;  4BXX I;  1WZN A;  1VQ5 1;  2RPR A;  4X6A I;  3MON A;  1Q7Y 2;  4NBB A;  1QVF Z;  3G6E 1;  4EWC A;  2LIY A;  3J80 b;  2QRC B;  4MRI A;  1QF8 A;  2NVY I;  1M90 1;  4AYB A;  3S1R I;  1WCM I;  2HU9 A;  1VQO 1;  2VPX A;  4E2Y A;  4BBR I;  1USP A;  1USP B;  1Q86 2;  3J81 f;  1KRL A;  1S7M A;  1Q81 1;  1X3Z A;  5IP7 I;  1TWA I;  3CCV 1;  4NH1 C;  3IX0 A;  1X0T A;  5LL6 f;  2QRE B;  2JIP A;  2LFU A;  1VQ7 Z;  1K83 I;  3CCL Z;  3D2L A;  3G4S Z;  2NAP A;  4A3I I;  4RV9 A;  2RIQ A;  4A3K I;  1VQ8 1;  2M6N A;  2Q4Z A;  2QEX Z;  3CD6 1;  2OOX B;  1YJW Z;  4BBS I;  4HGZ A;  1S72 1;  3FQQ A;  5C3E I;  3S14 I;  4A3G I;  1ZB8 A;  3VMH A;  1YJ9 1;  4RS4 A;  3NDI A;  3CCM 1;  2IV2 X;  3CCJ 1;  3CC7 1;  1VQL 1;  3LUS A;  2V8J A;  3I55 1;  3RZD I;  2E2H I;  5IP9 I;  3CCE 1;  1YIT Z;  1YIJ Z;  3VMI A;  3GTJ I;  4MD8 A;  1YHQ Z;  2ZAE B;  1VQK 1;  4E31 A;  3I07 A;  2LEX A;  4NBD A;  1Q82 1;  1M1K 2;  2PM9 A;  4MXU A;  4HH4 A;  5A2Q f;  5C4J I;  2VF1 A;  4A3C I;  3I4N I;  3M3Y I;  2PMZ A;  2P3Y A;  2K3R A;  3J81 b;  4A93 I;  1K9M 2;  1TWC I;  1VQN Z;  1Y8C A;  4TNU A;  4S1T A;  3KIF A;  2RBL A;  1RQF A;  2V8I A;  3CMA Z;  1K73 1;  2JS4 A;  3S1M I;  1VQM 1;  1K8A 1;  1N8R 1;  3NFZ A;  3IR7 A;  3BG1 B;  2B63 I;  3EED A;  3FKI I;  1NJI 1;  3S17 I;  5FLM I;  1Z01 A;  1WII A;  4A3F I;  3NH4 A;  1YUK A;  2OTJ Z;  2JIO A;  1QVG Z;  2RT9 A; 
#chains in the Genus database with same CATH homology
 3CC2 1;  2QLV B;  3HOZ I;  3I56 Z;  4MD9 A;  3S2D I;  1P9N A;  3NH5 A;  1QVG Y;  3D6W A;  1RO0 A;  1RO2 A;  3S16 I;  3KIH A;  4MON A;  3T4N B;  2E2J I;  3H3V J;  2H85 A;  2WB1 A;  4NBC A;  4A3M I;  1YJN 1;  2JMO A;  5A2Q b;  3U50 C;  2RHB A;  1VQ5 Z;  3M4O I;  1YI2 1;  1Q7Y 1;  4E2W A;  2JNY A;  3S15 I;  2EGT A;  3S1Q I;  3QWU A;  4QTT A;  3HOV I;  2IZ4 A;  3K7A I;  4NFR A;  1N2F A;  1VQ6 1;  1R9T I;  4BY7 I;  3MZL B;  3S1N I;  1VQO Z;  4XX2 A;  3CCL 1;  3G4S 1;  2Y0S A;  1TFI A;  3IFU A;  1NP6 A;  1Q86 1;  2GU2 A;  3CCV Z;  1VLA A;  3EER A;  2YAD A;  5T67 A;  2E9H A;  4RVD A;  2VUG A;  1PFT A;  3CCQ 1;  3FQM A;  1VQP 1;  4A3L I;  3CCR 1;  1NUI A;  4E2Z A;  2O4H A;  1VQ8 Z;  2VUM I;  2OTL Z;  1RO4 A;  1ZH1 A;  3CD6 Z;  1S72 Z;  3H0G I;  1VQ9 1;  1YIJ 1;  3PO2 I;  3CCU Z;  1YHQ 1;  1TWG I;  1ML8 A;  1WW9 A;  4A3E I;  4Y7N I;  4DQY B;  3CCJ Z;  3CC7 Z;  3GTG I;  2QA4 Z;  1VQL Z;  5D1O A;  5D1O B;  2JA6 I;  5C4X I;  2QKD A;  3I55 Z;  2KPI A;  3CCE Z;  2DE6 A;  1Y1V I;  2R6M A;  4E33 A;  3JAM f;  1VQN 1;  1KD1 2;  1VQK Z;  3CC4 1;  3J80 f;  4NBG A;  1DL6 A;  2DE7 A;  3CCS 1;  4NBA A;  1M1K 1;  1LQL A;  3CMA 1;  4NOZ A;  4Y52 I;  2YU9 I;  1I6H I;  5CM2 M;  3GTK I;  1VQ4 1;  1K9M 1;  3MZK B;  3CME Z;  2R92 I;  3BG0 B;  1JJ2 Z;  3G71 Z;  3RZO I;  3CQZ I;  3VB9 A;  3CXC Z;  3NH8 A;  2W04 A;  4A3J I;  3HOU I;  5C44 I;  3PO3 I;  1VQM Z;  1JWH C;  2GTH A;  1JJ2 Y;  3CXC Y;  1KC8 2;  4A3B I;  5FLX f;  3P5J B;  4MD7 A;  3I56 1;  3CPW Z;  5T6B A;  5D1P A;  3D9X A;  4BY1 I;  3NDJ A;  2OZK A;  1RLY A;  2R7Z I;  3CPW Y;  2O53 A;  1M90 2;  4A3D I;  3CC2 Z;  2NVQ I;  1KQS Y;  1Z03 A;  3GTP I;  2F4O A;  3G6E Z;  2W03 A;  3JAM b;  3VMG A;  1RNI A;  4E32 A;  4QTU A;  4MH4 A;  3TDH B;  1Q81 2;  1YJN Z;  3GTL I;  2KI7 B;  4NB9 A;  1QVF Y;  1YI2 Z;  1VQ7 1;  2IZ3 A;  3F3P C;  1QYP A;  2BJO A;  2QEX 1;  2G2K A;  3GTO I;  1VQ6 Z;  1YJW 1;  4DGL A;  2AKL A;  1SFO I;  5AN9 F;  2F4M A;  5FLX b;  4HGY A;  5IT9 f;  1I3Q I;  2OTL 1;  3S2H I;  4NBE A;  2QR1 B;  3GCF A;  2JA7 I;  1YIT 1;  3CCQ Z;  1VQP Z;  3GKQ A;  4RVH A;  1YJ9 Z;  3CCR Z;  1TWF I;  3CCU 1;  4RVG A;  3CCM Z;  1Y1W I;  2NVX I;  1Q82 2;  3IF8 A;  4E2X A;  2QA4 1;  3TE5 B;  2DE5 A;  2NVT I;  3HOY I;  2JA5 I;  4NBF A;  2HF1 A;  4NB8 A;  1VQ9 Z;  1TWH I;  1X3W A;  1Y1V S;  4CL1 A;  3F3F C;  4RVF A;  2E2I I;  1K73 2;  3HKZ A;  3Q87 A;  3GTM I;  2WAQ A;  1K8A 2;  1N8R 2;  3GTM S;  2QRD B;  2JUB A;  4E30 A;  3HOX I;  2PK7 A;  3CME 1;  1KD1 1;  2R93 I;  1NJI 2;  3CC4 Z;  2J6A A;  3G71 1;  3CCS Z;  1I50 I;  1YUA A;  1Z02 A;  1L1O C;  2P28 A;  2GTI A;  2OTJ 1;  3PO3 S;  2I3C A;  1W2B Z;  3HOW I;  1VQ4 Z;  5IT9 b;  3GTQ I;  3J7A 4;  2K5R A;  4DK1 A;  2Q51 A;  3OW2 Z;  2JA8 I;  5T64 A;  1W2B Y;  3ESW A;  3I4M I;  1ZB9 A;  2M48 A;  2V8K A;  2JR6 A;  2OOY B;  1KQS Z;  3OW2 Y;  1KC8 1;  3VTN A;  4NBH A;  4BXX I;  1VQ5 1;  2RPR A;  4X6A I;  3MON A;  1Q7Y 2;  4NBB A;  1QVF Z;  3G6E 1;  4EWC A;  2LIY A;  3J80 b;  2QRC B;  4MRI A;  1QF8 A;  2NVY I;  1M90 1;  4AYB A;  3S1R I;  1WCM I;  2HU9 A;  1VQO 1;  4E2Y A;  4BBR I;  1USP A;  1USP B;  1Q86 2;  3J81 f;  1KRL A;  1S7M A;  1Q81 1;  1X3Z A;  5IP7 I;  1TWA I;  3CCV 1;  4NH1 C;  3IX0 A;  1X0T A;  5LL6 f;  2QRE B;  2LFU A;  1VQ7 Z;  1K83 I;  3CCL Z;  3G4S Z;  4A3I I;  4RV9 A;  2RIQ A;  4A3K I;  1VQ8 1;  2M6N A;  2Q4Z A;  2QEX Z;  3CD6 1;  2OOX B;  1YJW Z;  4BBS I;  4HGZ A;  1S72 1;  3FQQ A;  5C3E I;  3S14 I;  4A3G I;  1ZB8 A;  3VMH A;  1YJ9 1;  4RS4 A;  3NDI A;  3CCM 1;  3CCJ 1;  3CC7 1;  1VQL 1;  3LUS A;  2V8J A;  3I55 1;  3RZD I;  2E2H I;  5IP9 I;  3CCE 1;  1YIT Z;  1YIJ Z;  3VMI A;  3GTJ I;  4MD8 A;  1YHQ Z;  2ZAE B;  1VQK 1;  4E31 A;  3I07 A;  4NBD A;  1Q82 1;  1M1K 2;  2PM9 A;  4MXU A;  4HH4 A;  5A2Q f;  5C4J I;  2VF1 A;  4A3C I;  3I4N I;  3M3Y I;  2PMZ A;  2P3Y A;  2K3R A;  3J81 b;  4A93 I;  1K9M 2;  1TWC I;  1VQN Z;  4TNU A;  4S1T A;  3KIF A;  2RBL A;  1RQF A;  2V8I A;  3CMA Z;  1K73 1;  2JS4 A;  3S1M I;  1VQM 1;  1K8A 1;  1N8R 1;  3NFZ A;  3BG1 B;  2B63 I;  3EED A;  3FKI I;  1NJI 1;  3S17 I;  5FLM I;  1Z01 A;  1WII A;  4A3F I;  3NH4 A;  1YUK A;  2OTJ Z;  1QVG Z;  2RT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...