3CCL1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccl100
1Q7Y1 3CCEZ 1K732 3I561 2OTL1 1Q812 3CC7Z 1K9M1 1YJ91 3CC2Z 1VQNZ 1VQ9Z 3CD61 2OTLZ 1QVGZ 1VQKZ 1VQK1 2QA41 1Q822 3CD6Z 1Q861 3CCJ1 1VQ6Z 1VQPZ 1VQN1 1VQ51 1YHQZ 1YJ9Z 3CXCZ 3CPWZ 1S721 1K9M2 1VQ4Z 3CCE1 1VQ8Z 1VQ41 1VQM1 1YJNZ 1K731 1W2BY 1M1K1 1Q7Y2 1NJI2 3CCJZ 3CPWY 3CCUZ 1YIJZ 3CCV1 3CCVZ 3CCMZ 3CCQ1 1YITZ 1YIJ1 1KC82 3G6E1 1VQ91 1NJI1 3CME1 3CCSZ 3CC21 1K8A1 1M1K2 1YJW1 3I551 3CCL1 1VQMZ 1VQ81 2QEXZ 2QEX1 3CCLZ 1K8A2 1YJWZ 1S72Z 3G71Z 3G4SZ 1KD11 1YHQ1 1VQ71 3CCS1 1VQP1 3CMAZ 3OW2Y 1Q862 1KC81 3G6EZ 1VQL1 2QA4Z 1VQO1 1VQOZ 1VQLZ 3CCU1 1W2BZ 1M902 1JJ2Y 1VQ7Z 3CC71 3G4S1 3G711 1KQSY 3CC4Z 1YJN1 1KD12 3OW2Z 1QVFZ 1JJ2Z 3CC41 3I55Z 2OTJ1 1QVFY 1VQ5Z 3CMEZ 1QVGY 1Q821 1VQ61 3CCR1 1N8R2 1YI2Z 1M901 1KQSZ 3CCM1 3CXCY 3CCQZ 1YIT1 1YI21 1N8R1 3CCRZ 1Q811 3CMA1 2OTJZ 3I56Z
chains in the Genus database with same CATH superfamily
4MH4A 1P9NA 1Q7Y1 4MD8A 1QYPA 4TNUA 3FKII 2NVTI 2ZAEB 4CL1A 2JIMA 3MONA 1LQLA 2Q4ZA 2DE7A 2LIYA 1VQK1 2F4OA 4NBAA 4BY1I 3CPWZ 3GTQI 3P5JB 1X3WA 5FLXf 1VQ8Z 1VQ41 4NH1C 5IP7I 1N2FA 2OOYB 3IFUA 1I50I 2JIPA 3EERA 1RO2A 3CPWY 4XX2A 1YIJZ 3CCV1 2I3CA 3CCMZ 4A3LI 3IR7A 3CCSZ 3CC21 5FLXb 2VPXA 2J6AA 3I551 1L1OC 3CCL1 1VQMZ 3GTGI 2QEXZ 1X0TA 2JIOA 1S72Z 3G4SZ 1KD11 3FQMA 3KIFA 1USPA 3KIHA 1Q862 3M4OI 1Z01A 2NAPA 1TWGI 4A3EI 5C44I 2YU9I 3HOXI 1JJ2Y 2M6NA 3IX0A 1VQ7Z 3CC71 1JWHC 1TWHI 4QTTA 1KD12 1Q16A 5LL6f 3F3FC 3GCFA 3S14I 3CMEZ 1QVGY 1Q821 1VQ61 4E30A 4A3DI 3GTMS 3EEDA 5T67A 2PK7A 2K3RA 2NVQI 1Q811 2OTJZ 3MZKB 4HGZA 2E2JI 2JIQA 2OTLZ 2IZ4A 2F4MA 3CCEZ 5D1PA 4A3KI 4X6AI 3I561 1TWCI 1Q812 5IT9f 1YJ91 4MD9A 3CC2Z 1VQNZ 2M48A 2JIRA 2W03A 3CD61 3MZLB 2E2II 2NVXI 4DQYB 4NBCA 4NFRA 3I4MI 4A3FI 4RVGA 3HOYI 1WJ2A 2R6MA 3CD6Z 4A3GI 1VQPZ 1R9TI 1VQN1 1YJ9Z 2PMZA 5C4XI 3GTJI 3RZDI 2JUBA 2QREB 1VQ4Z 1RO0A 2VUGA 3CCE1 3S16I 3M3YI 4E2ZA 1SIWA 4BY7I 2LEXA 3PO3S 2Q51A 1Q7Y2 2RPRA 3J81b 4E2WA 5IT9b 3VMHA 3H0GI 3FQQA 2GTIA 3CCUZ 3HOWI 1KC82 1I3QI 2RIQA 3TDHB 3G6E1 3CME1 2QRCB 1K8A1 4DK1A 5A2Qf 4BBRI 4E32A 1YHQ1 1VQ71 4HH4A 3CMAZ 3OW2Y 1KC81 3I4NI 3G6EZ 4MD7A 2QR1B 2JMOA 2W04A 2QA4Z 1QF8A 1RQFA 5FLMI 2KI7B 3S1RI 3CCU1 4MXUA 1Y1VI 4NBDA 4S1TA 3G4S1 1YUKA 3S1NI 3OW2Z 1WW9A 4A93I 1JJ2Z 4BBSI 1QXFA 3JAMb 1DL6A 3I55Z 3HKZA 2JR6A 1FDOA 3CCR1 1I6HI 4NBEA 1YI2Z 4A3CI 3BG1B 3GTKI 3CCM1 3GTLI 3NDIA 1AA6A 1YI21 2R93I 1USPB 3J80b 3CCRZ 2JS4A 4E31A 2IZ3A 3JAMf 3I56Z 2VPYA 2DE5A 1S7MA 3GTPI 4RVDA 2OTL1 3D9XA 3S17I 1K9M1 4AYBA 1Y8CA 2WAQA 2E2HI 5D1OB 1K83I 1VQKZ 3NH5A 1FDIA 2QA41 1Q822 3PO2I 1ZH1A 1WCMI 4NBBA 1VQ6Z 2WB1A 2GTHA 1Y1WI 1YHQZ 2EGTA 3CXCZ 3J80f 1WZNA 1KRLA 1K9M2 2Y0SA 4EWCA 1W2BY 1M1K1 2B63I 2JA8I 1NJI2 3VTNA 3CCJZ 3T4NB 2BJOA 2JNYA 3I07A 2P28A 3RZOI 3CCQ1 1YITZ 3GTOI 2RHBA 4NBFA 1TWAI 1VQ91 1NJI1 2DE6A 2V8KA 3Q87A 2RT9A 2HF1A 1Y1VS 2P3YA 2QEX1 4DGLA 3K7AI 3CCLZ 2IV2X 1YUAA 3G71Z 3J7A4 2NVYI 3VMGA 3CCS1 1VQP1 1ML8A 2OZKA 3HOZI 1VLAA 2VUMI 3LUSA 5CM2M 1VQL1 5C3EI 1VQO1 1TFIA 1M902 3TE5B 2GU2A 2OOXB 3VMIA 2HU9A 3CC4Z 2VPWA 2QKDA 1QVFZ 3CC41 2OTJ1 4MONA 4E33A 1N8R2 2RBLA 1M901 3ESWA 3GKQA 1RO4A 4NBHA 2JA7I 5AN9F 1Z03A 2G2KA 3D2LA 3F3PC 2VF1A 1K732 4MRIA 1WIIA 1X3ZA 1ZB8A 2V45A 3CC7Z 3S15I 1VQ9Z 4NBGA 4BXXI 2K5RA 2R7ZI 2JA6I 3QWUA 1QVGZ 2E7ZA 3U50C 2E9HA 2YADA 2AKLA 1Q861 3CCJ1 4Y52I 1VQ51 4RV9A 2QLVB 2LFUA 5D1OA 1S721 4NB8A 3S1QI 3J81f 1VQM1 1YJNZ 1K731 5T6BA 3H3VJ 1RNIA 3HOUI 2V3VA 2R92I 3D6WA 3CQZI 1Z02A 2JA5I 4Y7NI 2V8JA 3CCVZ 1YIJ1 3S2HI 3NH4A 1ZB9A 2QRDB 1SFOI 5IP9I 1M1K2 4RS4A 1YJW1 4A3BI 3VB9A 3HOVI 1VQ81 5A2Qb 3S2DI 1K8A2 1YJWZ 3BG0B 2V8IA 2O53A 4HGYA 2O4HA 4E2YA 4RVFA 4NOZA 1PFTA 4QTUA 3S1MI 1VQOZ 3NDJA 1VQLZ 1NP6A 1W2BZ 3PO3I 1RLYA 3G711 4NB9A 1KQSY 3IF8A 1YJN1 2VPZA 3NH8A 1NUIA 2KPIA 1QVFY 4A3JI 1VQ5Z 3GTMI 4A3MI 2AYDA 4RVHA 1KQSZ 3CCQZ 3CXCY 1YIT1 2PM9A 4A3II 1N8R1 5C4JI 5T64A 3CMA1 2H85A 3NFZA 4E2XA 1TWFI
chains in the Genus database with same CATH topology
4MH4A 1P9NA 1Q7Y1 4MD8A 1QYPA 4TNUA 3FKII 2NVTI 2ZAEB 4CL1A 3MONA 1LQLA 2Q4ZA 2DE7A 2LIYA 1VQK1 2F4OA 4NBAA 4BY1I 3CPWZ 3GTQI 3P5JB 1X3WA 5FLXf 1VQ8Z 1VQ41 4NH1C 5IP7I 1N2FA 2OOYB 3IFUA 1I50I 3EERA 1RO2A 3CPWY 4XX2A 1YIJZ 3CCV1 2I3CA 3CCMZ 4A3LI 3CCSZ 3CC21 5FLXb 2J6AA 3I551 1L1OC 3CCL1 1VQMZ 3GTGI 2QEXZ 1X0TA 1S72Z 3G4SZ 1KD11 3FQMA 3KIFA 1USPA 3KIHA 1Q862 3M4OI 1Z01A 1TWGI 4A3EI 5C44I 2YU9I 3HOXI 1JJ2Y 2M6NA 3IX0A 1VQ7Z 3CC71 1JWHC 1TWHI 4QTTA 1KD12 5LL6f 3F3FC 3GCFA 3S14I 3CMEZ 1QVGY 1Q821 1VQ61 4E30A 4A3DI 3GTMS 3EEDA 5T67A 2PK7A 2K3RA 2NVQI 1Q811 2OTJZ 3MZKB 4HGZA 2E2JI 2OTLZ 2IZ4A 2F4MA 3CCEZ 5D1PA 4A3KI 4X6AI 3I561 1TWCI 1Q812 5IT9f 1YJ91 4MD9A 3CC2Z 1VQNZ 2M48A 2W03A 3CD61 3MZLB 2E2II 2NVXI 4DQYB 4NBCA 4NFRA 3I4MI 4A3FI 4RVGA 3HOYI 2R6MA 3CD6Z 4A3GI 1VQPZ 1R9TI 1VQN1 1YJ9Z 2PMZA 5C4XI 3GTJI 3RZDI 2JUBA 2QREB 1VQ4Z 1RO0A 2VUGA 3CCE1 3S16I 3M3YI 4E2ZA 4BY7I 3PO3S 2Q51A 1Q7Y2 2RPRA 3J81b 4E2WA 5IT9b 3VMHA 3H0GI 3FQQA 2GTIA 3CCUZ 3HOWI 1KC82 1I3QI 2RIQA 3TDHB 3G6E1 3CME1 2QRCB 1K8A1 4DK1A 5A2Qf 4BBRI 1YHQ1 4E32A 1VQ71 4HH4A 3CMAZ 1KC81 3OW2Y 3I4NI 3G6EZ 4MD7A 2QR1B 2JMOA 2W04A 2QA4Z 1QF8A 1RQFA 5FLMI 2KI7B 3S1RI 3CCU1 4MXUA 1Y1VI 4NBDA 4S1TA 3G4S1 1YUKA 3S1NI 3OW2Z 1WW9A 4A93I 1JJ2Z 4BBSI 3JAMb 1DL6A 3I55Z 3HKZA 2JR6A 3CCR1 1I6HI 4NBEA 1YI2Z 4A3CI 3BG1B 3GTKI 3CCM1 3GTLI 3NDIA 1YI21 2R93I 1USPB 3J80b 3CCRZ 2JS4A 4E31A 2IZ3A 3JAMf 3I56Z 2DE5A 1S7MA 3GTPI 4RVDA 2OTL1 3D9XA 3S17I 1K9M1 4AYBA 2WAQA 2E2HI 5D1OB 1K83I 1VQKZ 3NH5A 2QA41 1Q822 3PO2I 1ZH1A 1WCMI 4NBBA 1VQ6Z 2WB1A 2GTHA 1Y1WI 1YHQZ 2EGTA 3CXCZ 3J80f 1KRLA 1K9M2 2Y0SA 4EWCA 1W2BY 1M1K1 2B63I 2JA8I 1NJI2 3VTNA 3CCJZ 3T4NB 2BJOA 2JNYA 3I07A 2P28A 3RZOI 3CCQ1 1YITZ 3GTOI 2RHBA 4NBFA 1TWAI 1VQ91 1NJI1 2DE6A 2V8KA 3Q87A 2RT9A 2HF1A 1Y1VS 2P3YA 2QEX1 4DGLA 3K7AI 3CCLZ 3J7A4 1YUAA 3G71Z 2NVYI 3VMGA 3CCS1 1VQP1 1ML8A 2OZKA 3HOZI 1VLAA 2VUMI 3LUSA 5CM2M 1VQL1 5C3EI 1VQO1 1TFIA 1M902 3TE5B 2GU2A 2OOXB 3VMIA 2HU9A 3CC4Z 2QKDA 1QVFZ 3CC41 2OTJ1 4MONA 4E33A 1N8R2 2RBLA 1M901 3ESWA 3GKQA 1RO4A 4NBHA 2JA7I 5AN9F 1Z03A 2G2KA 3F3PC 2VF1A 1K732 4MRIA 1WIIA 1X3ZA 1ZB8A 3CC7Z 3S15I 1VQ9Z 4NBGA 4BXXI 2K5RA 2R7ZI 2JA6I 3QWUA 1QVGZ 3U50C 2E9HA 2YADA 2AKLA 1Q861 3CCJ1 4Y52I 1VQ51 4RV9A 2QLVB 2LFUA 5D1OA 1S721 4NB8A 3S1QI 3J81f 1VQM1 1YJNZ 1K731 5T6BA 3H3VJ 1RNIA 3HOUI 2R92I 3D6WA 3CQZI 1Z02A 2JA5I 4Y7NI 2V8JA 3CCVZ 1YIJ1 3S2HI 3NH4A 1ZB9A 2QRDB 1SFOI 5IP9I 1M1K2 4RS4A 1YJW1 4A3BI 3VB9A 3HOVI 1VQ81 5A2Qb 3S2DI 1K8A2 1YJWZ 3BG0B 2V8IA 2O53A 4HGYA 2O4HA 4E2YA 4RVFA 4NOZA 1PFTA 4QTUA 3S1MI 1VQOZ 3NDJA 1VQLZ 1NP6A 1W2BZ 3PO3I 1RLYA 3G711 4NB9A 1KQSY 3IF8A 1YJN1 3NH8A 1NUIA 2KPIA 1QVFY 4A3JI 1VQ5Z 3GTMI 4A3MI 4RVHA 1KQSZ 3CCQZ 3CXCY 1YIT1 2PM9A 4A3II 1N8R1 5C4JI 5T64A 3CMA1 2H85A 3NFZA 4E2XA 1TWFI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y 1;  3CCE Z;  1K73 2;  3I56 1;  2OTL 1;  1Q81 2;  3CC7 Z;  1K9M 1;  1YJ9 1;  3CC2 Z;  1VQN Z;  1VQ9 Z;  3CD6 1;  2OTL Z;  1QVG Z;  1VQK Z;  1VQK 1;  2QA4 1;  1Q82 2;  3CD6 Z;  1Q86 1;  3CCJ 1;  1VQ6 Z;  1VQP Z;  1VQN 1;  1VQ5 1;  1YHQ Z;  1YJ9 Z;  3CXC Z;  3CPW Z;  1S72 1;  1K9M 2;  1VQ4 Z;  3CCE 1;  1VQ8 Z;  1VQ4 1;  1VQM 1;  1YJN Z;  1K73 1;  1W2B Y;  1M1K 1;  1Q7Y 2;  1NJI 2;  3CCJ Z;  3CPW Y;  3CCU Z;  1YIJ Z;  3CCV 1;  3CCV Z;  3CCM Z;  3CCQ 1;  1YIT Z;  1YIJ 1;  1KC8 2;  3G6E 1;  1VQ9 1;  1NJI 1;  3CME 1;  3CCS Z;  3CC2 1;  1K8A 1;  1M1K 2;  1YJW 1;  3I55 1;  3CCL 1;  1VQM Z;  1VQ8 1;  2QEX Z;  2QEX 1;  3CCL Z;  1K8A 2;  1YJW Z;  1S72 Z;  3G71 Z;  3G4S Z;  1KD1 1;  1YHQ 1;  1VQ7 1;  3CCS 1;  1VQP 1;  3CMA Z;  3OW2 Y;  1Q86 2;  1KC8 1;  3G6E Z;  1VQL 1;  2QA4 Z;  1VQO 1;  1VQO Z;  1VQL Z;  3CCU 1;  1W2B Z;  1M90 2;  1JJ2 Y;  1VQ7 Z;  3CC7 1;  3G4S 1;  3G71 1;  1KQS Y;  3CC4 Z;  1YJN 1;  1KD1 2;  3OW2 Z;  1QVF Z;  1JJ2 Z;  3CC4 1;  3I55 Z;  2OTJ 1;  1QVF Y;  1VQ5 Z;  3CME Z;  1QVG Y;  1Q82 1;  1VQ6 1;  3CCR 1;  1N8R 2;  1YI2 Z;  1M90 1;  1KQS Z;  3CCM 1;  3CXC Y;  3CCQ Z;  1YIT 1;  1YI2 1;  1N8R 1;  3CCR Z;  1Q81 1;  3CMA 1;  2OTJ Z;  3I56 Z; 
#chains in the Genus database with same CATH topology
 4MH4 A;  1P9N A;  1Q7Y 1;  4MD8 A;  1QYP A;  4TNU A;  3FKI I;  2NVT I;  2ZAE B;  4CL1 A;  2JIM A;  3MON A;  1LQL A;  2Q4Z A;  2DE7 A;  2LIY A;  1VQK 1;  2F4O A;  4NBA A;  4BY1 I;  3CPW Z;  3GTQ I;  3P5J B;  1X3W A;  5FLX f;  1VQ8 Z;  1VQ4 1;  4NH1 C;  5IP7 I;  1N2F A;  2OOY B;  3IFU A;  1I50 I;  2JIP A;  3EER A;  1RO2 A;  3CPW Y;  4XX2 A;  1YIJ Z;  3CCV 1;  2I3C A;  3CCM Z;  4A3L I;  3IR7 A;  3CCS Z;  3CC2 1;  5FLX b;  2VPX A;  2J6A A;  3I55 1;  1L1O C;  3CCL 1;  1VQM Z;  3GTG I;  2QEX Z;  1X0T A;  2JIO A;  1S72 Z;  3G4S Z;  1KD1 1;  3FQM A;  3KIF A;  1USP A;  3KIH A;  1Q86 2;  3M4O I;  1Z01 A;  2NAP A;  1TWG I;  4A3E I;  5C44 I;  2YU9 I;  3HOX I;  1JJ2 Y;  2M6N A;  3IX0 A;  1VQ7 Z;  3CC7 1;  1JWH C;  1TWH I;  4QTT A;  1KD1 2;  1Q16 A;  5LL6 f;  3F3F C;  3GCF A;  3S14 I;  3CME Z;  1QVG Y;  1Q82 1;  1VQ6 1;  4E30 A;  4A3D I;  3GTM S;  3EED A;  5T67 A;  2PK7 A;  2K3R A;  2NVQ I;  1Q81 1;  2OTJ Z;  3MZK B;  4HGZ A;  2E2J I;  2JIQ A;  2OTL Z;  2IZ4 A;  2F4M A;  3CCE Z;  5D1P A;  4A3K I;  4X6A I;  3I56 1;  1TWC I;  1Q81 2;  5IT9 f;  1YJ9 1;  4MD9 A;  3CC2 Z;  1VQN Z;  2M48 A;  2JIR A;  2W03 A;  3CD6 1;  3MZL B;  2E2I I;  2NVX I;  4DQY B;  4NBC A;  4NFR A;  3I4M I;  4A3F I;  4RVG A;  3HOY I;  1WJ2 A;  2R6M A;  3CD6 Z;  4A3G I;  1VQP Z;  1R9T I;  1VQN 1;  1YJ9 Z;  2PMZ A;  5C4X I;  3GTJ I;  3RZD I;  2JUB A;  2QRE B;  1VQ4 Z;  1RO0 A;  2VUG A;  3CCE 1;  3S16 I;  3M3Y I;  4E2Z A;  1SIW A;  4BY7 I;  2LEX A;  3PO3 S;  2Q51 A;  1Q7Y 2;  2RPR A;  3J81 b;  4E2W A;  5IT9 b;  3VMH A;  3H0G I;  3FQQ A;  2GTI A;  3CCU Z;  3HOW I;  1KC8 2;  1I3Q I;  2RIQ A;  3TDH B;  3G6E 1;  3CME 1;  2QRC B;  1K8A 1;  4DK1 A;  5A2Q f;  4BBR I;  4E32 A;  1YHQ 1;  1VQ7 1;  4HH4 A;  3CMA Z;  3OW2 Y;  1KC8 1;  3I4N I;  3G6E Z;  4MD7 A;  2QR1 B;  2JMO A;  2W04 A;  2QA4 Z;  1QF8 A;  1RQF A;  5FLM I;  2KI7 B;  3S1R I;  3CCU 1;  4MXU A;  1Y1V I;  4NBD A;  4S1T A;  3G4S 1;  1YUK A;  3S1N I;  3OW2 Z;  1WW9 A;  4A93 I;  1JJ2 Z;  4BBS I;  1QXF A;  3JAM b;  1DL6 A;  3I55 Z;  3HKZ A;  2JR6 A;  1FDO A;  3CCR 1;  1I6H I;  4NBE A;  1YI2 Z;  4A3C I;  3BG1 B;  3GTK I;  3CCM 1;  3GTL I;  3NDI A;  1AA6 A;  1YI2 1;  2R93 I;  1USP B;  3J80 b;  3CCR Z;  2JS4 A;  4E31 A;  2IZ3 A;  3JAM f;  3I56 Z;  2VPY A;  2DE5 A;  1S7M A;  3GTP I;  4RVD A;  2OTL 1;  3D9X A;  3S17 I;  1K9M 1;  4AYB A;  1Y8C A;  2WAQ A;  2E2H I;  5D1O B;  1K83 I;  1VQK Z;  3NH5 A;  1FDI A;  2QA4 1;  1Q82 2;  3PO2 I;  1ZH1 A;  1WCM I;  4NBB A;  1VQ6 Z;  2WB1 A;  2GTH A;  1Y1W I;  1YHQ Z;  2EGT A;  3CXC Z;  3J80 f;  1WZN A;  1KRL A;  1K9M 2;  2Y0S A;  4EWC A;  1W2B Y;  1M1K 1;  2B63 I;  2JA8 I;  1NJI 2;  3VTN A;  3CCJ Z;  3T4N B;  2BJO A;  2JNY A;  3I07 A;  2P28 A;  3RZO I;  3CCQ 1;  1YIT Z;  3GTO I;  2RHB A;  4NBF A;  1TWA I;  1VQ9 1;  1NJI 1;  2DE6 A;  2V8K A;  3Q87 A;  2RT9 A;  2HF1 A;  1Y1V S;  2P3Y A;  2QEX 1;  4DGL A;  3K7A I;  3CCL Z;  2IV2 X;  1YUA A;  3G71 Z;  3J7A 4;  2NVY I;  3VMG A;  3CCS 1;  1VQP 1;  1ML8 A;  2OZK A;  3HOZ I;  1VLA A;  2VUM I;  3LUS A;  5CM2 M;  1VQL 1;  5C3E I;  1VQO 1;  1TFI A;  1M90 2;  3TE5 B;  2GU2 A;  2OOX B;  3VMI A;  2HU9 A;  3CC4 Z;  2VPW A;  2QKD A;  1QVF Z;  3CC4 1;  2OTJ 1;  4MON A;  4E33 A;  1N8R 2;  2RBL A;  1M90 1;  3ESW A;  3GKQ A;  1RO4 A;  4NBH A;  2JA7 I;  5AN9 F;  1Z03 A;  2G2K A;  3D2L A;  3F3P C;  2VF1 A;  1K73 2;  4MRI A;  1WII A;  1X3Z A;  1ZB8 A;  2V45 A;  3CC7 Z;  3S15 I;  1VQ9 Z;  4NBG A;  4BXX I;  2K5R A;  2R7Z I;  2JA6 I;  3QWU A;  1QVG Z;  2E7Z A;  3U50 C;  2E9H A;  2YAD A;  2AKL A;  1Q86 1;  3CCJ 1;  4Y52 I;  1VQ5 1;  4RV9 A;  2QLV B;  2LFU A;  5D1O A;  1S72 1;  4NB8 A;  3S1Q I;  3J81 f;  1VQM 1;  1YJN Z;  1K73 1;  5T6B A;  3H3V J;  1RNI A;  3HOU I;  2V3V A;  2R92 I;  3D6W A;  3CQZ I;  1Z02 A;  2JA5 I;  4Y7N I;  2V8J A;  3CCV Z;  1YIJ 1;  3S2H I;  3NH4 A;  1ZB9 A;  2QRD B;  1SFO I;  5IP9 I;  1M1K 2;  4RS4 A;  1YJW 1;  4A3B I;  3VB9 A;  3HOV I;  1VQ8 1;  5A2Q b;  3S2D I;  1K8A 2;  1YJW Z;  3BG0 B;  2V8I A;  2O53 A;  4HGY A;  2O4H A;  4E2Y A;  4RVF A;  4NOZ A;  1PFT A;  4QTU A;  3S1M I;  1VQO Z;  3NDJ A;  1VQL Z;  1NP6 A;  1W2B Z;  3PO3 I;  1RLY A;  3G71 1;  4NB9 A;  1KQS Y;  3IF8 A;  1YJN 1;  2VPZ A;  3NH8 A;  1NUI A;  2KPI A;  1QVF Y;  4A3J I;  1VQ5 Z;  3GTM I;  4A3M I;  2AYD A;  4RVH A;  1KQS Z;  3CCQ Z;  3CXC Y;  1YIT 1;  2PM9 A;  4A3I I;  1N8R 1;  5C4J I;  5T64 A;  3CMA 1;  2H85 A;  3NFZ A;  4E2X A;  1TWF I; 
#chains in the Genus database with same CATH homology
 4MH4 A;  1P9N A;  1Q7Y 1;  4MD8 A;  1QYP A;  4TNU A;  3FKI I;  2NVT I;  2ZAE B;  4CL1 A;  3MON A;  1LQL A;  2Q4Z A;  2DE7 A;  2LIY A;  1VQK 1;  2F4O A;  4NBA A;  4BY1 I;  3CPW Z;  3GTQ I;  3P5J B;  1X3W A;  5FLX f;  1VQ8 Z;  1VQ4 1;  4NH1 C;  5IP7 I;  1N2F A;  2OOY B;  3IFU A;  1I50 I;  3EER A;  1RO2 A;  3CPW Y;  4XX2 A;  1YIJ Z;  3CCV 1;  2I3C A;  3CCM Z;  4A3L I;  3CCS Z;  3CC2 1;  5FLX b;  2J6A A;  3I55 1;  1L1O C;  3CCL 1;  1VQM Z;  3GTG I;  2QEX Z;  1X0T A;  1S72 Z;  3G4S Z;  1KD1 1;  3FQM A;  3KIF A;  1USP A;  3KIH A;  1Q86 2;  3M4O I;  1Z01 A;  1TWG I;  4A3E I;  5C44 I;  2YU9 I;  3HOX I;  1JJ2 Y;  2M6N A;  3IX0 A;  1VQ7 Z;  3CC7 1;  1JWH C;  1TWH I;  4QTT A;  1KD1 2;  5LL6 f;  3F3F C;  3GCF A;  3S14 I;  3CME Z;  1QVG Y;  1Q82 1;  1VQ6 1;  4E30 A;  4A3D I;  3GTM S;  3EED A;  5T67 A;  2PK7 A;  2K3R A;  2NVQ I;  1Q81 1;  2OTJ Z;  3MZK B;  4HGZ A;  2E2J I;  2OTL Z;  2IZ4 A;  2F4M A;  3CCE Z;  5D1P A;  4A3K I;  4X6A I;  3I56 1;  1TWC I;  1Q81 2;  5IT9 f;  1YJ9 1;  4MD9 A;  3CC2 Z;  1VQN Z;  2M48 A;  2W03 A;  3CD6 1;  3MZL B;  2E2I I;  2NVX I;  4DQY B;  4NBC A;  4NFR A;  3I4M I;  4A3F I;  4RVG A;  3HOY I;  2R6M A;  3CD6 Z;  4A3G I;  1VQP Z;  1R9T I;  1VQN 1;  1YJ9 Z;  2PMZ A;  5C4X I;  3GTJ I;  3RZD I;  2JUB A;  2QRE B;  1VQ4 Z;  1RO0 A;  2VUG A;  3CCE 1;  3S16 I;  3M3Y I;  4E2Z A;  4BY7 I;  3PO3 S;  2Q51 A;  1Q7Y 2;  2RPR A;  3J81 b;  4E2W A;  5IT9 b;  3VMH A;  3H0G I;  3FQQ A;  2GTI A;  3CCU Z;  3HOW I;  1KC8 2;  1I3Q I;  2RIQ A;  3TDH B;  3G6E 1;  3CME 1;  2QRC B;  1K8A 1;  4DK1 A;  5A2Q f;  4BBR I;  1YHQ 1;  4E32 A;  1VQ7 1;  4HH4 A;  3CMA Z;  1KC8 1;  3OW2 Y;  3I4N I;  3G6E Z;  4MD7 A;  2QR1 B;  2JMO A;  2W04 A;  2QA4 Z;  1QF8 A;  1RQF A;  5FLM I;  2KI7 B;  3S1R I;  3CCU 1;  4MXU A;  1Y1V I;  4NBD A;  4S1T A;  3G4S 1;  1YUK A;  3S1N I;  3OW2 Z;  1WW9 A;  4A93 I;  1JJ2 Z;  4BBS I;  3JAM b;  1DL6 A;  3I55 Z;  3HKZ A;  2JR6 A;  3CCR 1;  1I6H I;  4NBE A;  1YI2 Z;  4A3C I;  3BG1 B;  3GTK I;  3CCM 1;  3GTL I;  3NDI A;  1YI2 1;  2R93 I;  1USP B;  3J80 b;  3CCR Z;  2JS4 A;  4E31 A;  2IZ3 A;  3JAM f;  3I56 Z;  2DE5 A;  1S7M A;  3GTP I;  4RVD A;  2OTL 1;  3D9X A;  3S17 I;  1K9M 1;  4AYB A;  2WAQ A;  2E2H I;  5D1O B;  1K83 I;  1VQK Z;  3NH5 A;  2QA4 1;  1Q82 2;  3PO2 I;  1ZH1 A;  1WCM I;  4NBB A;  1VQ6 Z;  2WB1 A;  2GTH A;  1Y1W I;  1YHQ Z;  2EGT A;  3CXC Z;  3J80 f;  1KRL A;  1K9M 2;  2Y0S A;  4EWC A;  1W2B Y;  1M1K 1;  2B63 I;  2JA8 I;  1NJI 2;  3VTN A;  3CCJ Z;  3T4N B;  2BJO A;  2JNY A;  3I07 A;  2P28 A;  3RZO I;  3CCQ 1;  1YIT Z;  3GTO I;  2RHB A;  4NBF A;  1TWA I;  1VQ9 1;  1NJI 1;  2DE6 A;  2V8K A;  3Q87 A;  2RT9 A;  2HF1 A;  1Y1V S;  2P3Y A;  2QEX 1;  4DGL A;  3K7A I;  3CCL Z;  3J7A 4;  1YUA A;  3G71 Z;  2NVY I;  3VMG A;  3CCS 1;  1VQP 1;  1ML8 A;  2OZK A;  3HOZ I;  1VLA A;  2VUM I;  3LUS A;  5CM2 M;  1VQL 1;  5C3E I;  1VQO 1;  1TFI A;  1M90 2;  3TE5 B;  2GU2 A;  2OOX B;  3VMI A;  2HU9 A;  3CC4 Z;  2QKD A;  1QVF Z;  3CC4 1;  2OTJ 1;  4MON A;  4E33 A;  1N8R 2;  2RBL A;  1M90 1;  3ESW A;  3GKQ A;  1RO4 A;  4NBH A;  2JA7 I;  5AN9 F;  1Z03 A;  2G2K A;  3F3P C;  2VF1 A;  1K73 2;  4MRI A;  1WII A;  1X3Z A;  1ZB8 A;  3CC7 Z;  3S15 I;  1VQ9 Z;  4NBG A;  4BXX I;  2K5R A;  2R7Z I;  2JA6 I;  3QWU A;  1QVG Z;  3U50 C;  2E9H A;  2YAD A;  2AKL A;  1Q86 1;  3CCJ 1;  4Y52 I;  1VQ5 1;  4RV9 A;  2QLV B;  2LFU A;  5D1O A;  1S72 1;  4NB8 A;  3S1Q I;  3J81 f;  1VQM 1;  1YJN Z;  1K73 1;  5T6B A;  3H3V J;  1RNI A;  3HOU I;  2R92 I;  3D6W A;  3CQZ I;  1Z02 A;  2JA5 I;  4Y7N I;  2V8J A;  3CCV Z;  1YIJ 1;  3S2H I;  3NH4 A;  1ZB9 A;  2QRD B;  1SFO I;  5IP9 I;  1M1K 2;  4RS4 A;  1YJW 1;  4A3B I;  3VB9 A;  3HOV I;  1VQ8 1;  5A2Q b;  3S2D I;  1K8A 2;  1YJW Z;  3BG0 B;  2V8I A;  2O53 A;  4HGY A;  2O4H A;  4E2Y A;  4RVF A;  4NOZ A;  1PFT A;  4QTU A;  3S1M I;  1VQO Z;  3NDJ A;  1VQL Z;  1NP6 A;  1W2B Z;  3PO3 I;  1RLY A;  3G71 1;  4NB9 A;  1KQS Y;  3IF8 A;  1YJN 1;  3NH8 A;  1NUI A;  2KPI A;  1QVF Y;  4A3J I;  1VQ5 Z;  3GTM I;  4A3M I;  4RVH A;  1KQS Z;  3CCQ Z;  3CXC Y;  1YIT 1;  2PM9 A;  4A3I I;  1N8R 1;  5C4J I;  5T64 A;  3CMA 1;  2H85 A;  3NFZ A;  4E2X A;  1TWF I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...