3CCL1

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccl100
1Q7Y1 1NJI1 1K731 2QEXZ 3CPWZ 3OW2Y 3CCQZ 3CCL1 1VQL1 1N8R2 3I56Z 1YJ91 1M901 1VQNZ 1YI21 1W2BY 3CCVZ 3G71Z 3CPWY 3G6E1 1QVGY 1Q822 3CCRZ 3I551 1VQ71 3OW2Z 1KC82 1VQ51 1VQLZ 1YJNZ 1YJ9Z 3CMEZ 1VQ8Z 3CCSZ 1M1K2 1YHQ1 1VQMZ 1W2BZ 3CC21 1VQ41 1VQ91 1S72Z 1QVGZ 3CC71 3CXCY 3G4SZ 2OTJZ 1N8R1 1VQ61 2QA4Z 1YITZ 1YIJ1 1VQO1 1YJW1 1KQSY 3CD61 3CCE1 1VQ9Z 1QVFY 1Q821 3CCLZ 3CXCZ 1KC81 3CMA1 3CCJ1 3CC41 1JJ2Y 1KQSZ 1YI2Z 1M1K1 1VQK1 3G6EZ 3CCU1 2OTL1 3I55Z 3CCEZ 1VQ7Z 1Q812 1QVFZ 2QEX1 1VQ5Z 3CCQ1 3CCJZ 3I561 1JJ2Z 1YHQZ 1K9M2 3CC2Z 1VQ4Z 1VQN1 3CC7Z 3CCM1 3CCV1 3G711 3CCR1 1VQ6Z 1YJWZ 1YIJZ 1VQOZ 3CD6Z 1K8A2 1KD12 1M902 1YJN1 3CME1 1VQP1 1K8A1 1KD11 1VQ81 3CCS1 1VQM1 3CCMZ 1Q811 1S721 3CMAZ 3CC4Z 3G4S1 2OTJ1 1Q862 2QA41 1K9M1 1YIT1 1Q7Y2 1VQPZ 1Q861 3CCUZ 1K732 1NJI2 1VQKZ 2OTLZ
chains in the Genus database with same CATH superfamily
1Q7Y1 3S2HI 3Q87A 4MD7A 4BXXI 2ZAEB 3OW2Y 2HF1A 3CCQZ 3HOVI 2AKLA 1N8R2 3VMGA 4E2ZA 3I56Z 2NVYI 3IFUA 3VMIA 1M901 1YUKA 2V45A 4NOZA 4BY1I 1VQNZ 2WAQA 3GTQI 2QRDB 2Q4ZA 2KI7B 3GTOI 4S1TA 3CCVZ 2M6NA 4E30A 3G6E1 1Q822 1Z03A 4MXUA 3OW2Z 4A3GI 1Z01A 3TE5B 3CMEZ 2NAPA 3GTLI 4AYBA 1FDOA 1VQ41 1LQLA 4A3EI 3P5JB 4BY7I 2GTIA 3G4SZ 3F3FC 1VQ61 1YITZ 2RT9A 1KQSY 2VUMI 1NP6A 2R7ZI 2Q51A 3JAMf 4HGZA 1X3ZA 1KQSZ 2IZ3A 1M1K1 2JIPA 1VQK1 2OTL1 4NBGA 5IP7I 3S1MI 1Q812 5A2Qf 1I50I 2QEX1 2QRCB 2R93I 2LEXA 1Y1VS 1K9M2 1R9TI 3LUSA 4MD8A 2OZKA 3CC7Z 4A3BI 2VUGA 2JNYA 3CCM1 1QF8A 3ESWA 3CQZI 4NBHA 3CCR1 3JAMb 3NH8A 1VQOZ 1M902 2JUBA 4E2WA 1K8A1 4E2YA 4NB9A 1VQ81 3CCS1 3D2LA 1RO0A 1S721 5A2Qb 3S17I 2NVQI 2OTJ1 5D1PA 1Q862 2QA41 3M3YI 3CCUZ 1ZB8A 4NH1C 2JA7I 1K731 2DE7A 4XX2A 3GKQA 4RVDA 3J80f 3CCL1 1Y8CA 3HKZA 1VQL1 2Y0SA 3NFZA 4NFRA 4A3MI 5FLMI 2R6MA 1YI21 4MD9A 1W2BY 3T4NB 5FLXf 1VQ71 3S1RI 3PO3S 1VQ51 1TFIA 1YJNZ 3KIFA 1RNIA 1M1K2 3GTJI 1YHQ1 1W2BZ 1VQ91 2YU9I 3H0GI 5D1OB 3CXCY 2KPIA 3J80b 3PO3I 1USPA 3S16I 5CM2M 1ML8A 4RV9A 5FLXb 1WW9A 3CXCZ 2K5RA 3CMA1 3CCJ1 2JIOA 3M4OI 3VTNA 1ZH1A 2M48A 3S1NI 3PO2I 1KRLA 3KIHA 3I55Z 1WJ2A 3I07A 3S1QI 5IT9f 1L1OC 4A3DI 4X6AI 3CCQ1 4MONA 2LIYA 5T6BA 3I561 1RLYA 3CC2Z 1VQN1 3TDHB 4NBFA 2JMOA 3CCV1 2VPXA 1VLAA 4CL1A 2P3YA 1YJWZ 1YIJZ 4NBCA 3S14I 3CD6Z 1TWAI 3BG0B 2VPWA 1PFTA 3CME1 1VQP1 3HOYI 1KD11 1Y1WI 4A3LI 3CCMZ 4NB8A 5IT9b 3QWUA 1WCMI 4RVFA 3CC4Z 3G4S1 3H3VJ 2E7ZA 1JWHC 4MH4A 1YIT1 1Q7Y2 1NJI1 3CPWZ 3D9XA 1Q16A 1YJ91 3J81f 4TNUA 2OOYB 1TWFI 5LL6f 1I3QI 3G71Z 1QVGY 3MONA 1SFOI 5C4JI 2F4MA 1VQLZ 4E33A 2AYDA 3IR7A 5T67A 3BG1B 4A3JI 1WZNA 1VQMZ 3FQQA 1RQFA 1QVGZ 3CC71 1RO2A 2R92I 3J7A4 4HH4A 1I6HI 1RO4A 3HOZI 1QXFA 1VQO1 3RZOI 4RS4A 2VPZA 3J81b 2PMZA 2IV2X 2QREB 2E2JI 2P28A 3CCE1 1VQ9Z 4MRIA 2NVTI 1QVFY 5C3EI 1KC81 2E9HA 3GCFA 1JJ2Y 3I4NI 2WB1A 2V8IA 1X0TA 2J6AA 2RIQA 3G6EZ 3CCU1 1QVFZ 4A3CI 3NH5A 2OOXB 3CCJZ 2VF1A 1QYPA 3GTPI 4NBDA 1JJ2Z 2GTHA 1DL6A 1NUIA 1VQ4Z 2O53A 3NDJA 3MZLB 2HU9A 2DE6A 2QR1B 3HOXI 1P9NA 2H85A 1VQ6Z 2K3RA 5C4XI 4A3FI 2F4OA 1K8A2 1YJN1 4BBRI 2LFUA 3VMHA 2EGTA 1VQPZ 1Q861 1VQKZ 1K732 2E2HI 2OTLZ 1X3WA 3D6WA 4HGYA 3FQMA 4Y7NI 3I4MI 4Y52I 2RPRA 2QEXZ 3EERA 1K83I 4NBAA 4BBSI 5IP9I 4DQYB 2JA8I 4A3II 3NH4A 4E2XA 3U50C 2RHBA 1FDIA 3CPWY 3CCRZ 1ZB9A 3I551 1N2FA 1KC82 4QTTA 1YJ9Z 2B63I 5D1OA 4E31A 1TWCI 1VQ8Z 3CCSZ 2VPYA 5AN9F 2JIMA 5T64A 4E32A 2PM9A 2I3CA 2V3VA 3CC21 1S72Z 2JIQA 2OTJZ 1YUAA 1N8R1 2JA6I 2QA4Z 2NVXI 1YJW1 1YIJ1 1WIIA 3CD61 4DGLA 2DE5A 2W03A 1Q821 2YADA 3CCLZ 1Z02A 4RVHA 1USPB 2QLVB 2JIRA 3S15I 3HOWI 2V8JA 2G2KA 3CC41 4EWCA 4RVGA 3GTMS 1YI2Z 2BJOA 1Y1VI 3EEDA 2JR6A 3F3PC 3MZKB 4QTUA 3HOUI 1VQ7Z 3CCEZ 4A3KI 2V8KA 2RBLA 3FKII 1VQ5Z 2QKDA 2O4HA 3GTMI 1YHQZ 1TWGI 2PK7A 1SIWA 3IX0A 3G711 2JS4A 3S2DI 2W04A 2IZ4A 3K7AI 1TWHI 3VB9A 3GTKI 1KD12 3RZDI 2E2II 4DK1A 3NDIA 1S7MA 1VQM1 1Q811 2JA5I 5C44I 3CMAZ 2GU2A 3GTGI 3IF8A 4NBBA 1AA6A 1K9M1 1NJI2 4A93I 4NBEA
chains in the Genus database with same CATH topology
1Q7Y1 3S2HI 3Q87A 4MD7A 4BXXI 2ZAEB 3OW2Y 2HF1A 3CCQZ 3HOVI 2AKLA 1N8R2 3VMGA 4E2ZA 3I56Z 2NVYI 3IFUA 3VMIA 1M901 1YUKA 4NOZA 4BY1I 1VQNZ 2WAQA 3GTQI 2QRDB 2Q4ZA 2KI7B 3GTOI 4S1TA 3CCVZ 2M6NA 4E30A 3G6E1 1Q822 1Z03A 4MXUA 3OW2Z 4A3GI 1Z01A 3TE5B 3CMEZ 3GTLI 4AYBA 1VQ41 1LQLA 4A3EI 3P5JB 4BY7I 2GTIA 3G4SZ 3F3FC 1VQ61 1YITZ 2RT9A 1KQSY 2VUMI 1NP6A 2R7ZI 2Q51A 3JAMf 4HGZA 1X3ZA 1KQSZ 2IZ3A 1M1K1 1VQK1 2OTL1 4NBGA 5IP7I 3S1MI 1Q812 5A2Qf 1I50I 2QEX1 2QRCB 2R93I 1Y1VS 1K9M2 1R9TI 3LUSA 4MD8A 2OZKA 3CC7Z 4A3BI 2VUGA 2JNYA 3CCM1 1QF8A 3ESWA 3CQZI 4NBHA 3CCR1 3JAMb 3NH8A 1VQOZ 1M902 2JUBA 4E2WA 1K8A1 4E2YA 4NB9A 1VQ81 3CCS1 1RO0A 1S721 5A2Qb 3S17I 2NVQI 2OTJ1 5D1PA 1Q862 2QA41 3M3YI 3CCUZ 1ZB8A 4NH1C 2JA7I 1K731 2DE7A 4XX2A 3GKQA 4RVDA 3J80f 3CCL1 3HKZA 1VQL1 2Y0SA 3NFZA 4NFRA 4A3MI 5FLMI 2R6MA 1YI21 4MD9A 1W2BY 3T4NB 5FLXf 1VQ71 3S1RI 3PO3S 1VQ51 1TFIA 1YJNZ 3KIFA 1RNIA 1M1K2 3GTJI 1YHQ1 1W2BZ 1VQ91 2YU9I 3H0GI 5D1OB 3CXCY 2KPIA 3J80b 3PO3I 1USPA 3S16I 5CM2M 1ML8A 4RV9A 5FLXb 1WW9A 3CXCZ 2K5RA 3CMA1 3CCJ1 3M4OI 3VTNA 1ZH1A 2M48A 3S1NI 3PO2I 1KRLA 3KIHA 3I55Z 3I07A 3S1QI 5IT9f 1L1OC 4A3DI 4X6AI 3CCQ1 4MONA 2LIYA 5T6BA 3I561 1RLYA 3CC2Z 1VQN1 3TDHB 4NBFA 2JMOA 3CCV1 1VLAA 4CL1A 2P3YA 1YJWZ 1YIJZ 4NBCA 3S14I 3CD6Z 1TWAI 3BG0B 1PFTA 3CME1 1VQP1 3HOYI 1KD11 1Y1WI 4A3LI 3CCMZ 4NB8A 5IT9b 3QWUA 1WCMI 4RVFA 3CC4Z 3G4S1 3H3VJ 1JWHC 4MH4A 1YIT1 1Q7Y2 1NJI1 3CPWZ 3D9XA 1YJ91 3J81f 4TNUA 2OOYB 1TWFI 5LL6f 1I3QI 3G71Z 1QVGY 3MONA 1SFOI 5C4JI 2F4MA 1VQLZ 4E33A 5T67A 3BG1B 4A3JI 1VQMZ 3FQQA 1RQFA 1QVGZ 3CC71 1RO2A 2R92I 3J7A4 4HH4A 1I6HI 1RO4A 3HOZI 1VQO1 3RZOI 4RS4A 3J81b 2PMZA 2QREB 2E2JI 2P28A 3CCE1 1VQ9Z 4MRIA 2NVTI 1QVFY 5C3EI 1KC81 2E9HA 3GCFA 1JJ2Y 3I4NI 2WB1A 2V8IA 1X0TA 2J6AA 2RIQA 3G6EZ 3CCU1 1QVFZ 4A3CI 3NH5A 2OOXB 3CCJZ 2VF1A 1QYPA 3GTPI 4NBDA 1JJ2Z 2GTHA 1DL6A 1NUIA 1VQ4Z 2O53A 3NDJA 3MZLB 2HU9A 2DE6A 2QR1B 3HOXI 1P9NA 2H85A 1VQ6Z 2K3RA 5C4XI 4A3FI 2F4OA 1K8A2 1YJN1 4BBRI 2LFUA 3VMHA 2EGTA 1VQPZ 1Q861 1VQKZ 1K732 2E2HI 2OTLZ 1X3WA 3D6WA 4HGYA 3FQMA 4Y7NI 3I4MI 4Y52I 2RPRA 2QEXZ 3EERA 1K83I 4NBAA 4BBSI 5IP9I 4DQYB 2JA8I 4A3II 3NH4A 4E2XA 3U50C 2RHBA 3CPWY 3CCRZ 1ZB9A 3I551 1N2FA 1KC82 4QTTA 1YJ9Z 2B63I 5D1OA 4E31A 1TWCI 1VQ8Z 3CCSZ 5AN9F 5T64A 4E32A 2PM9A 2I3CA 3CC21 1S72Z 2OTJZ 1YUAA 1N8R1 2JA6I 2QA4Z 2NVXI 1YJW1 1YIJ1 1WIIA 3CD61 4DGLA 2DE5A 2W03A 1Q821 2YADA 3CCLZ 1Z02A 4RVHA 1USPB 2QLVB 3S15I 3HOWI 2V8JA 2G2KA 3CC41 4EWCA 4RVGA 3GTMS 1YI2Z 2BJOA 1Y1VI 3EEDA 2JR6A 3F3PC 3MZKB 4QTUA 3HOUI 1VQ7Z 3CCEZ 4A3KI 2V8KA 2RBLA 3FKII 1VQ5Z 2QKDA 2O4HA 3GTMI 1YHQZ 1TWGI 2PK7A 3IX0A 3G711 2JS4A 3S2DI 2W04A 2IZ4A 3K7AI 1TWHI 3VB9A 3GTKI 1KD12 3RZDI 2E2II 4DK1A 3NDIA 1S7MA 1VQM1 1Q811 2JA5I 5C44I 3CMAZ 2GU2A 3GTGI 3IF8A 4NBBA 1K9M1 1NJI2 4A93I 4NBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y 1;  1NJI 1;  1K73 1;  2QEX Z;  3CPW Z;  3OW2 Y;  3CCQ Z;  3CCL 1;  1VQL 1;  1N8R 2;  3I56 Z;  1YJ9 1;  1M90 1;  1VQN Z;  1YI2 1;  1W2B Y;  3CCV Z;  3G71 Z;  3CPW Y;  3G6E 1;  1QVG Y;  1Q82 2;  3CCR Z;  3I55 1;  1VQ7 1;  3OW2 Z;  1KC8 2;  1VQ5 1;  1VQL Z;  1YJN Z;  1YJ9 Z;  3CME Z;  1VQ8 Z;  3CCS Z;  1M1K 2;  1YHQ 1;  1VQM Z;  1W2B Z;  3CC2 1;  1VQ4 1;  1VQ9 1;  1S72 Z;  1QVG Z;  3CC7 1;  3CXC Y;  3G4S Z;  2OTJ Z;  1N8R 1;  1VQ6 1;  2QA4 Z;  1YIT Z;  1YIJ 1;  1VQO 1;  1YJW 1;  1KQS Y;  3CD6 1;  3CCE 1;  1VQ9 Z;  1QVF Y;  1Q82 1;  3CCL Z;  3CXC Z;  1KC8 1;  3CMA 1;  3CCJ 1;  3CC4 1;  1JJ2 Y;  1KQS Z;  1YI2 Z;  1M1K 1;  1VQK 1;  3G6E Z;  3CCU 1;  2OTL 1;  3I55 Z;  3CCE Z;  1VQ7 Z;  1Q81 2;  1QVF Z;  2QEX 1;  1VQ5 Z;  3CCQ 1;  3CCJ Z;  3I56 1;  1JJ2 Z;  1YHQ Z;  1K9M 2;  3CC2 Z;  1VQ4 Z;  1VQN 1;  3CC7 Z;  3CCM 1;  3CCV 1;  3G71 1;  3CCR 1;  1VQ6 Z;  1YJW Z;  1YIJ Z;  1VQO Z;  3CD6 Z;  1K8A 2;  1KD1 2;  1M90 2;  1YJN 1;  3CME 1;  1VQP 1;  1K8A 1;  1KD1 1;  1VQ8 1;  3CCS 1;  1VQM 1;  3CCM Z;  1Q81 1;  1S72 1;  3CMA Z;  3CC4 Z;  3G4S 1;  2OTJ 1;  1Q86 2;  2QA4 1;  1K9M 1;  1YIT 1;  1Q7Y 2;  1VQP Z;  1Q86 1;  3CCU Z;  1K73 2;  1NJI 2;  1VQK Z;  2OTL Z; 
#chains in the Genus database with same CATH topology
 1Q7Y 1;  3S2H I;  3Q87 A;  4MD7 A;  4BXX I;  2ZAE B;  3OW2 Y;  2HF1 A;  3CCQ Z;  3HOV I;  2AKL A;  1N8R 2;  3VMG A;  4E2Z A;  3I56 Z;  2NVY I;  3IFU A;  3VMI A;  1M90 1;  1YUK A;  2V45 A;  4NOZ A;  4BY1 I;  1VQN Z;  2WAQ A;  3GTQ I;  2QRD B;  2Q4Z A;  2KI7 B;  3GTO I;  4S1T A;  3CCV Z;  2M6N A;  4E30 A;  3G6E 1;  1Q82 2;  1Z03 A;  4MXU A;  3OW2 Z;  4A3G I;  1Z01 A;  3TE5 B;  3CME Z;  2NAP A;  3GTL I;  4AYB A;  1FDO A;  1VQ4 1;  1LQL A;  4A3E I;  3P5J B;  4BY7 I;  2GTI A;  3G4S Z;  3F3F C;  1VQ6 1;  1YIT Z;  2RT9 A;  1KQS Y;  2VUM I;  1NP6 A;  2R7Z I;  2Q51 A;  3JAM f;  4HGZ A;  1X3Z A;  1KQS Z;  2IZ3 A;  1M1K 1;  2JIP A;  1VQK 1;  2OTL 1;  4NBG A;  5IP7 I;  3S1M I;  1Q81 2;  5A2Q f;  1I50 I;  2QEX 1;  2QRC B;  2R93 I;  2LEX A;  1Y1V S;  1K9M 2;  1R9T I;  3LUS A;  4MD8 A;  2OZK A;  3CC7 Z;  4A3B I;  2VUG A;  2JNY A;  3CCM 1;  1QF8 A;  3ESW A;  3CQZ I;  4NBH A;  3CCR 1;  3JAM b;  3NH8 A;  1VQO Z;  1M90 2;  2JUB A;  4E2W A;  1K8A 1;  4E2Y A;  4NB9 A;  1VQ8 1;  3CCS 1;  3D2L A;  1RO0 A;  1S72 1;  5A2Q b;  3S17 I;  2NVQ I;  2OTJ 1;  5D1P A;  1Q86 2;  2QA4 1;  3M3Y I;  3CCU Z;  1ZB8 A;  4NH1 C;  2JA7 I;  1K73 1;  2DE7 A;  4XX2 A;  3GKQ A;  4RVD A;  3J80 f;  3CCL 1;  1Y8C A;  3HKZ A;  1VQL 1;  2Y0S A;  3NFZ A;  4NFR A;  4A3M I;  5FLM I;  2R6M A;  1YI2 1;  4MD9 A;  1W2B Y;  3T4N B;  5FLX f;  1VQ7 1;  3S1R I;  3PO3 S;  1VQ5 1;  1TFI A;  1YJN Z;  3KIF A;  1RNI A;  1M1K 2;  3GTJ I;  1YHQ 1;  1W2B Z;  1VQ9 1;  2YU9 I;  3H0G I;  5D1O B;  3CXC Y;  2KPI A;  3J80 b;  3PO3 I;  1USP A;  3S16 I;  5CM2 M;  1ML8 A;  4RV9 A;  5FLX b;  1WW9 A;  3CXC Z;  2K5R A;  3CMA 1;  3CCJ 1;  2JIO A;  3M4O I;  3VTN A;  1ZH1 A;  2M48 A;  3S1N I;  3PO2 I;  1KRL A;  3KIH A;  3I55 Z;  1WJ2 A;  3I07 A;  3S1Q I;  5IT9 f;  1L1O C;  4A3D I;  4X6A I;  3CCQ 1;  4MON A;  2LIY A;  5T6B A;  3I56 1;  1RLY A;  3CC2 Z;  1VQN 1;  3TDH B;  4NBF A;  2JMO A;  3CCV 1;  2VPX A;  1VLA A;  4CL1 A;  2P3Y A;  1YJW Z;  1YIJ Z;  4NBC A;  3S14 I;  3CD6 Z;  1TWA I;  3BG0 B;  2VPW A;  1PFT A;  3CME 1;  1VQP 1;  3HOY I;  1KD1 1;  1Y1W I;  4A3L I;  3CCM Z;  4NB8 A;  5IT9 b;  3QWU A;  1WCM I;  4RVF A;  3CC4 Z;  3G4S 1;  3H3V J;  2E7Z A;  1JWH C;  4MH4 A;  1YIT 1;  1Q7Y 2;  1NJI 1;  3CPW Z;  3D9X A;  1Q16 A;  1YJ9 1;  3J81 f;  4TNU A;  2OOY B;  1TWF I;  5LL6 f;  1I3Q I;  3G71 Z;  1QVG Y;  3MON A;  1SFO I;  5C4J I;  2F4M A;  1VQL Z;  4E33 A;  2AYD A;  3IR7 A;  5T67 A;  3BG1 B;  4A3J I;  1WZN A;  1VQM Z;  3FQQ A;  1RQF A;  1QVG Z;  3CC7 1;  1RO2 A;  2R92 I;  3J7A 4;  4HH4 A;  1I6H I;  1RO4 A;  3HOZ I;  1QXF A;  1VQO 1;  3RZO I;  4RS4 A;  2VPZ A;  3J81 b;  2PMZ A;  2IV2 X;  2QRE B;  2E2J I;  2P28 A;  3CCE 1;  1VQ9 Z;  4MRI A;  2NVT I;  1QVF Y;  5C3E I;  1KC8 1;  2E9H A;  3GCF A;  1JJ2 Y;  3I4N I;  2WB1 A;  2V8I A;  1X0T A;  2J6A A;  2RIQ A;  3G6E Z;  3CCU 1;  1QVF Z;  4A3C I;  3NH5 A;  2OOX B;  3CCJ Z;  2VF1 A;  1QYP A;  3GTP I;  4NBD A;  1JJ2 Z;  2GTH A;  1DL6 A;  1NUI A;  1VQ4 Z;  2O53 A;  3NDJ A;  3MZL B;  2HU9 A;  2DE6 A;  2QR1 B;  3HOX I;  1P9N A;  2H85 A;  1VQ6 Z;  2K3R A;  5C4X I;  4A3F I;  2F4O A;  1K8A 2;  1YJN 1;  4BBR I;  2LFU A;  3VMH A;  2EGT A;  1VQP Z;  1Q86 1;  1VQK Z;  1K73 2;  2E2H I;  2OTL Z;  1X3W A;  3D6W A;  4HGY A;  3FQM A;  4Y7N I;  3I4M I;  4Y52 I;  2RPR A;  2QEX Z;  3EER A;  1K83 I;  4NBA A;  4BBS I;  5IP9 I;  4DQY B;  2JA8 I;  4A3I I;  3NH4 A;  4E2X A;  3U50 C;  2RHB A;  1FDI A;  3CPW Y;  3CCR Z;  1ZB9 A;  3I55 1;  1N2F A;  1KC8 2;  4QTT A;  1YJ9 Z;  2B63 I;  5D1O A;  4E31 A;  1TWC I;  1VQ8 Z;  3CCS Z;  2VPY A;  5AN9 F;  2JIM A;  5T64 A;  4E32 A;  2PM9 A;  2I3C A;  2V3V A;  3CC2 1;  1S72 Z;  2JIQ A;  2OTJ Z;  1YUA A;  1N8R 1;  2JA6 I;  2QA4 Z;  2NVX I;  1YJW 1;  1YIJ 1;  1WII A;  3CD6 1;  4DGL A;  2DE5 A;  2W03 A;  1Q82 1;  2YAD A;  3CCL Z;  1Z02 A;  4RVH A;  1USP B;  2QLV B;  2JIR A;  3S15 I;  3HOW I;  2V8J A;  2G2K A;  3CC4 1;  4EWC A;  4RVG A;  3GTM S;  1YI2 Z;  2BJO A;  1Y1V I;  3EED A;  2JR6 A;  3F3P C;  3MZK B;  4QTU A;  3HOU I;  1VQ7 Z;  3CCE Z;  4A3K I;  2V8K A;  2RBL A;  3FKI I;  1VQ5 Z;  2QKD A;  2O4H A;  3GTM I;  1YHQ Z;  1TWG I;  2PK7 A;  1SIW A;  3IX0 A;  3G71 1;  2JS4 A;  3S2D I;  2W04 A;  2IZ4 A;  3K7A I;  1TWH I;  3VB9 A;  3GTK I;  1KD1 2;  3RZD I;  2E2I I;  4DK1 A;  3NDI A;  1S7M A;  1VQM 1;  1Q81 1;  2JA5 I;  5C44 I;  3CMA Z;  2GU2 A;  3GTG I;  3IF8 A;  4NBB A;  1AA6 A;  1K9M 1;  1NJI 2;  4A93 I;  4NBE A; 
#chains in the Genus database with same CATH homology
 1Q7Y 1;  3S2H I;  3Q87 A;  4MD7 A;  4BXX I;  2ZAE B;  3OW2 Y;  2HF1 A;  3CCQ Z;  3HOV I;  2AKL A;  1N8R 2;  3VMG A;  4E2Z A;  3I56 Z;  2NVY I;  3IFU A;  3VMI A;  1M90 1;  1YUK A;  4NOZ A;  4BY1 I;  1VQN Z;  2WAQ A;  3GTQ I;  2QRD B;  2Q4Z A;  2KI7 B;  3GTO I;  4S1T A;  3CCV Z;  2M6N A;  4E30 A;  3G6E 1;  1Q82 2;  1Z03 A;  4MXU A;  3OW2 Z;  4A3G I;  1Z01 A;  3TE5 B;  3CME Z;  3GTL I;  4AYB A;  1VQ4 1;  1LQL A;  4A3E I;  3P5J B;  4BY7 I;  2GTI A;  3G4S Z;  3F3F C;  1VQ6 1;  1YIT Z;  2RT9 A;  1KQS Y;  2VUM I;  1NP6 A;  2R7Z I;  2Q51 A;  3JAM f;  4HGZ A;  1X3Z A;  1KQS Z;  2IZ3 A;  1M1K 1;  1VQK 1;  2OTL 1;  4NBG A;  5IP7 I;  3S1M I;  1Q81 2;  5A2Q f;  1I50 I;  2QEX 1;  2QRC B;  2R93 I;  1Y1V S;  1K9M 2;  1R9T I;  3LUS A;  4MD8 A;  2OZK A;  3CC7 Z;  4A3B I;  2VUG A;  2JNY A;  3CCM 1;  1QF8 A;  3ESW A;  3CQZ I;  4NBH A;  3CCR 1;  3JAM b;  3NH8 A;  1VQO Z;  1M90 2;  2JUB A;  4E2W A;  1K8A 1;  4E2Y A;  4NB9 A;  1VQ8 1;  3CCS 1;  1RO0 A;  1S72 1;  5A2Q b;  3S17 I;  2NVQ I;  2OTJ 1;  5D1P A;  1Q86 2;  2QA4 1;  3M3Y I;  3CCU Z;  1ZB8 A;  4NH1 C;  2JA7 I;  1K73 1;  2DE7 A;  4XX2 A;  3GKQ A;  4RVD A;  3J80 f;  3CCL 1;  3HKZ A;  1VQL 1;  2Y0S A;  3NFZ A;  4NFR A;  4A3M I;  5FLM I;  2R6M A;  1YI2 1;  4MD9 A;  1W2B Y;  3T4N B;  5FLX f;  1VQ7 1;  3S1R I;  3PO3 S;  1VQ5 1;  1TFI A;  1YJN Z;  3KIF A;  1RNI A;  1M1K 2;  3GTJ I;  1YHQ 1;  1W2B Z;  1VQ9 1;  2YU9 I;  3H0G I;  5D1O B;  3CXC Y;  2KPI A;  3J80 b;  3PO3 I;  1USP A;  3S16 I;  5CM2 M;  1ML8 A;  4RV9 A;  5FLX b;  1WW9 A;  3CXC Z;  2K5R A;  3CMA 1;  3CCJ 1;  3M4O I;  3VTN A;  1ZH1 A;  2M48 A;  3S1N I;  3PO2 I;  1KRL A;  3KIH A;  3I55 Z;  3I07 A;  3S1Q I;  5IT9 f;  1L1O C;  4A3D I;  4X6A I;  3CCQ 1;  4MON A;  2LIY A;  5T6B A;  3I56 1;  1RLY A;  3CC2 Z;  1VQN 1;  3TDH B;  4NBF A;  2JMO A;  3CCV 1;  1VLA A;  4CL1 A;  2P3Y A;  1YJW Z;  1YIJ Z;  4NBC A;  3S14 I;  3CD6 Z;  1TWA I;  3BG0 B;  1PFT A;  3CME 1;  1VQP 1;  3HOY I;  1KD1 1;  1Y1W I;  4A3L I;  3CCM Z;  4NB8 A;  5IT9 b;  3QWU A;  1WCM I;  4RVF A;  3CC4 Z;  3G4S 1;  3H3V J;  1JWH C;  4MH4 A;  1YIT 1;  1Q7Y 2;  1NJI 1;  3CPW Z;  3D9X A;  1YJ9 1;  3J81 f;  4TNU A;  2OOY B;  1TWF I;  5LL6 f;  1I3Q I;  3G71 Z;  1QVG Y;  3MON A;  1SFO I;  5C4J I;  2F4M A;  1VQL Z;  4E33 A;  5T67 A;  3BG1 B;  4A3J I;  1VQM Z;  3FQQ A;  1RQF A;  1QVG Z;  3CC7 1;  1RO2 A;  2R92 I;  3J7A 4;  4HH4 A;  1I6H I;  1RO4 A;  3HOZ I;  1VQO 1;  3RZO I;  4RS4 A;  3J81 b;  2PMZ A;  2QRE B;  2E2J I;  2P28 A;  3CCE 1;  1VQ9 Z;  4MRI A;  2NVT I;  1QVF Y;  5C3E I;  1KC8 1;  2E9H A;  3GCF A;  1JJ2 Y;  3I4N I;  2WB1 A;  2V8I A;  1X0T A;  2J6A A;  2RIQ A;  3G6E Z;  3CCU 1;  1QVF Z;  4A3C I;  3NH5 A;  2OOX B;  3CCJ Z;  2VF1 A;  1QYP A;  3GTP I;  4NBD A;  1JJ2 Z;  2GTH A;  1DL6 A;  1NUI A;  1VQ4 Z;  2O53 A;  3NDJ A;  3MZL B;  2HU9 A;  2DE6 A;  2QR1 B;  3HOX I;  1P9N A;  2H85 A;  1VQ6 Z;  2K3R A;  5C4X I;  4A3F I;  2F4O A;  1K8A 2;  1YJN 1;  4BBR I;  2LFU A;  3VMH A;  2EGT A;  1VQP Z;  1Q86 1;  1VQK Z;  1K73 2;  2E2H I;  2OTL Z;  1X3W A;  3D6W A;  4HGY A;  3FQM A;  4Y7N I;  3I4M I;  4Y52 I;  2RPR A;  2QEX Z;  3EER A;  1K83 I;  4NBA A;  4BBS I;  5IP9 I;  4DQY B;  2JA8 I;  4A3I I;  3NH4 A;  4E2X A;  3U50 C;  2RHB A;  3CPW Y;  3CCR Z;  1ZB9 A;  3I55 1;  1N2F A;  1KC8 2;  4QTT A;  1YJ9 Z;  2B63 I;  5D1O A;  4E31 A;  1TWC I;  1VQ8 Z;  3CCS Z;  5AN9 F;  5T64 A;  4E32 A;  2PM9 A;  2I3C A;  3CC2 1;  1S72 Z;  2OTJ Z;  1YUA A;  1N8R 1;  2JA6 I;  2QA4 Z;  2NVX I;  1YJW 1;  1YIJ 1;  1WII A;  3CD6 1;  4DGL A;  2DE5 A;  2W03 A;  1Q82 1;  2YAD A;  3CCL Z;  1Z02 A;  4RVH A;  1USP B;  2QLV B;  3S15 I;  3HOW I;  2V8J A;  2G2K A;  3CC4 1;  4EWC A;  4RVG A;  3GTM S;  1YI2 Z;  2BJO A;  1Y1V I;  3EED A;  2JR6 A;  3F3P C;  3MZK B;  4QTU A;  3HOU I;  1VQ7 Z;  3CCE Z;  4A3K I;  2V8K A;  2RBL A;  3FKI I;  1VQ5 Z;  2QKD A;  2O4H A;  3GTM I;  1YHQ Z;  1TWG I;  2PK7 A;  3IX0 A;  3G71 1;  2JS4 A;  3S2D I;  2W04 A;  2IZ4 A;  3K7A I;  1TWH I;  3VB9 A;  3GTK I;  1KD1 2;  3RZD I;  2E2I I;  4DK1 A;  3NDI A;  1S7M A;  1VQM 1;  1Q81 1;  2JA5 I;  5C44 I;  3CMA Z;  2GU2 A;  3GTG I;  3IF8 A;  4NBB A;  1K9M 1;  1NJI 2;  4A93 I;  4NBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...