3PO3I

Arrested rna polymerase ii reactivation intermediate
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3I02
3M4OI 2K5RA 2F4OA 2R92I 1LQLA 4BBSI 1USPB 1ML8A 1RO4A 3GCFA 4A3FI 4BY1I 3Q87A 4BXXI 4BBRI 3K7AI 3PO2I 3HOVI 3S16I 3D6WA 5IP9I 3CQZI 4NBBA 3GTGI 2PK7A 3FKII 1TWCI 3VMHA 3S1MI 2F4MA 3S2HI 1WW9A 3HOUI 3GTQI 2P3YA 3PO3S 1PFTA 3S15I 1NUIA 1ZB8A 4Y7NI 4MH4A 3PO3I 4QTTA 2JR6A 1QYPA 4A93I 3I4NI 5C3EI 2KPIA 3S1NI 4NBHA 5C4JI 2DE6A 1X3WA 3S1RI 1SFOI 2JNYA 3S14I 3HOWI 1RLYA 3S2DI 2JS4A 1Y1VI 3I07A 3HOYI 2NVXI 5C44I 4BY7I 4A3CI 3GTPI 1VLAA 2R93I 4A3JI 1TWAI 4NBGA 3VB9A 1ZB9A 3M3YI 2AKLA 2DE7A 4XX2A 3VMGA 3GKQA 2JA8I 2NVTI 2J6AA 3RZOI 3GTJI 2BJOA 3S17I 1I6HI 3GTOI 3H0GI 1Y1WI 4A3II 3GTMS 3S1QI 4Y52I 2YU9I 1TWGI 4NBFA 2JA6I 2JA7I 4X6AI 3H3VJ 3U50C 2RBLA 2DE5A 1R9TI 2E2HI 1I50I 2JA5I 5CM2M 5FLMI 3HOXI 4NBAA 1L1OC 3VMIA 4A3DI 4A3GI 4NOZA 2E2II 1Y1VS 3EERA 1YUAA 4A3LI 2VUMI 1N2FA 4A3EI 2R7ZI 4A3MI 1TWHI 4NB8A 4NBCA 1TWFI 1TFIA 1USPA 4A3KI 3I4MI 2NVQI 3GTLI 1DL6A 4NBEA 3LUSA 3GTKI 2HF1A 5IP7I 2B63I 3HOZI 3ESWA 4A3BI 1X3ZA 5C4XI 4QTUA 3GTMI 1I3QI 1WCMI 2NVYI 4NB9A 3RZDI 2E2JI 1K83I 4NBDA
chains in the Genus database with same CATH superfamily
2K5RA 2QEX1 2R92I 2KI7B 1Y8CA 2E7ZA 2Q4ZA 3EEDA 2QRCB 3K7AI 3J7A4 4DK1A 1KC81 4E2XA 3G6E1 3GTGI 1M1K1 1TWCI 1YIJ1 2OZKA 3IX0A 1M901 3HKZA 2P3YA 3PO3S 3NH4A 2QLVB 4MONA 2VPWA 2JR6A 4RVFA 3G71Z 1YIJZ 2KPIA 3NH5A 4NBHA 1VQOZ 1QVFZ 1KD11 1X3WA 4NFRA 3S1RI 1M902 3CCU1 1VQK1 1VQ91 3S2DI 2JS4A 4RVDA 5D1OA 5C44I 4BY7I 3GTPI 3CCEZ 2M6NA 4A3JI 3CCJZ 3CC2Z 3D9XA 3IFUA 1VQPZ 1JJ2Z 1WJ2A 2NVTI 3JAMf 3CMEZ 3CCQZ 3S1QI 4Y52I 5IT9f 4NBFA 2JA7I 4X6AI 4DQYB 3CPWY 1QVGZ 2JA5I 3CCE1 3BG0B 3NFZA 3CCQ1 1K9M1 1L1OC 3VMIA 1M1K2 2JMOA 3KIFA 1Q822 4A3GI 1K732 2E2II 1Z02A 1VQNZ 1YI2Z 2VUMI 1N2FA 1K9M2 4NB8A 2RT9A 1TWFI 3I4MI 4A3KI 2NVQI 3G4SZ 2O53A 2Y0SA 1SIWA 3JAMb 1RO0A 4AYBA 2EGTA 3J81f 3HOZI 1YITZ 1S7MA 2OTL1 3GTMI 1I3QI 3I561 2E2JI 1K83I 4NBDA 2GU2A 4E33A 2F4OA 3F3PC 1LQLA 4BBSI 4MD7A 1ML8A 2JIQA 4A3FI 2RIQA 4BBRI 1VQMZ 3CC4Z 2OTJZ 1VQ7Z 4HH4A 3D6WA 2PMZA 5IP9I 4NBBA 3S1MI 3IF8A 1VQ4Z 1WW9A 3VTNA 4S1TA 5T6BA 1VQ51 5FLXb 3MZLB 1P9NA 4E30A 4MH4A 3CMAZ 1QYPA 3CME1 3I4NI 5C3EI 2V8IA 2DE6A 2E9HA 1SFOI 2JNYA 3HOWI 1RLYA 5A2Qb 3TDHB 3OW2Z 1QXFA 3HOYI 1S72Z 2GTHA 4E2ZA 2K3RA 1YJ91 3VB9A 1Q811 1VQ6Z 2V8KA 3MONA 4XX2A 3NH8A 1KQSZ 4MXUA 1YHQZ 1VQL1 3CC41 1Q16A 1VQM1 2OTJ1 3RZOI 2J6AA 3KIHA 3GTJI 1VQ5Z 2BJOA 2QA4Z 3GTOI 3H0GI 4RV9A 4A3II 2VPZA 2IZ3A 2G2KA 3CMA1 2RBLA 1R9TI 4E31A 3HOXI 4NBAA 3CCSZ 1Y1VS 3EERA 2VF1A 4E32A 3MZKB 1NJI2 1TWHI 5LL6f 3OW2Y 1TFIA 1USPA 2OOYB 3GTLI 1X0TA 3F3FC 4NBEA 5T64A 1VQ71 3NDIA 4CL1A 5IP7I 2B63I 3ESWA 1FDIA 2M48A 5FLXf 1YI21 3J80b 3CPWZ 2WAQA 4MD9A 1Q862 2NVYI 1VQP1 5A2Qf 3S1NI 1Q821 1Z01A 3CCL1 1YHQ1 1VQLZ 2QRDB 1USPB 3QWUA 3BG1B 1RO4A 3GCFA 4RVHA 1N8R2 3CCV1 3Q87A 3CD6Z 4BXXI 3IR7A 3FQMA 4EWCA 3CQZI 4E2YA 2QREB 1VQN1 3HOUI 2NAPA 1VQ41 1VQ61 1PFTA 3S15I 1NUIA 2RHBA 2V3VA 4A93I 2V8JA 2QA41 1NJI1 1KD12 5C4JI 3G711 2OTLZ 1RQFA 3S14I 3T4NB 4DGLA 5T67A 1Y1VI 2P28A 2NVXI 3CCUZ 2PM9A 2R93I 2O4HA 3J80f 4NBGA 1ZB9A 4E2WA 3M3YI 1N8R1 3VMGA 2IV2X 1YJ9Z 1WIIA 2VUGA 3S17I 3CCR1 1Y1WI 1Q812 3GTMS 4NH1C 4RS4A 1WZNA 2YU9I 3H3VJ 3U50C 1Q7Y2 5CM2M 5FLMI 3FQQA 2LIYA 2JUBA 4NOZA 1YUAA 4A3LI 2VPXA 3CXCZ 1VQO1 4A3MI 1Q861 1S721 4NBCA 1Z03A 5D1PA 3G6EZ 2AYDA 1W2BY 2JIMA 3LUSA 1QVFY 3CCVZ 3CD61 2HF1A 2GTIA 2R6MA 1NP6A 1FDOA 2VPYA 1X3ZA 4QTUA 2JIRA 4HGZA 2QEXZ 2JIOA 4HGYA 4TNUA 3CCRZ 1RNIA 1AA6A 3RZDI 3M4OI 3P5JB 4RVGA 1KQSY 2H85A 3J81b 3I551 4BY1I 3PO2I 3HOVI 2W04A 3S16I 1YIT1 3CC7Z 2W03A 2PK7A 3FKII 3VMHA 4MD8A 2F4MA 3S2HI 2Q51A 2QKDA 3GTQI 1YJWZ 3G4S1 1KC82 2QR1B 3TE5B 1ZB8A 4Y7NI 3PO3I 5AN9F 4QTTA 1Q7Y1 1W2BZ 4MRIA 1VQ9Z 3CXCY 1VQ81 3CC21 3I07A 5D1OB 3I55Z 4A3CI 3CCMZ 2ZAEB 1ZH1A 1VLAA 1QVGY 1TWAI 2HU9A 3CC71 2AKLA 2DE7A 1YUKA 2YADA 3GKQA 1K8A2 2JA8I 1JJ2Y 3D2LA 1YJW1 1VQ8Z 1I6HI 2LEXA 2I3CA 1YJN1 1VQKZ 1TWGI 2JA6I 2DE5A 2E2HI 1I50I 3CCM1 3CCS1 2RPRA 3NDJA 1YJNZ 4A3DI 2LFUA 3CCJ1 1K731 3CCLZ 5IT9b 2IZ4A 1QF8A 4A3EI 2R7ZI 1DL6A 1JWHC 1KRLA 1K8A1 2JIPA 3GTKI 3I56Z 4A3BI 2WB1A 2OOXB 2V45A 5C4XI 1WCMI 1RO2A 4NB9A
chains in the Genus database with same CATH topology
2K5RA 2QEX1 2R92I 2KI7B 2Q4ZA 3EEDA 2QRCB 3K7AI 3J7A4 4DK1A 1KC81 4E2XA 3G6E1 3GTGI 1M1K1 1TWCI 1YIJ1 2OZKA 3IX0A 1M901 3HKZA 2P3YA 3PO3S 3NH4A 2QLVB 4MONA 2JR6A 4RVFA 3G71Z 1YIJZ 2KPIA 3NH5A 4NBHA 1VQOZ 1QVFZ 1KD11 1X3WA 4NFRA 3S1RI 1M902 3CCU1 1VQK1 1VQ91 3S2DI 2JS4A 4RVDA 5D1OA 5C44I 4BY7I 3GTPI 3CCEZ 2M6NA 4A3JI 3CCJZ 3CC2Z 3D9XA 3IFUA 1VQPZ 1JJ2Z 2NVTI 3JAMf 3CMEZ 3CCQZ 3S1QI 4Y52I 5IT9f 4NBFA 2JA7I 4X6AI 4DQYB 3CPWY 1QVGZ 2JA5I 3CCE1 3BG0B 3NFZA 3CCQ1 1K9M1 1L1OC 3VMIA 1M1K2 2JMOA 3KIFA 1Q822 4A3GI 1K732 2E2II 1Z02A 1VQNZ 1YI2Z 2VUMI 1N2FA 1K9M2 4NB8A 2RT9A 1TWFI 3I4MI 4A3KI 2NVQI 3G4SZ 2O53A 2Y0SA 3JAMb 1RO0A 4AYBA 2EGTA 3J81f 3HOZI 1YITZ 1S7MA 2OTL1 3GTMI 1I3QI 3I561 2E2JI 1K83I 4NBDA 2GU2A 4E33A 2F4OA 3F3PC 1LQLA 4BBSI 4MD7A 1ML8A 4A3FI 2RIQA 4BBRI 1VQMZ 3CC4Z 2OTJZ 1VQ7Z 4HH4A 3D6WA 2PMZA 5IP9I 4NBBA 3S1MI 3IF8A 1VQ4Z 1WW9A 3VTNA 4S1TA 5T6BA 1VQ51 5FLXb 3MZLB 1P9NA 4E30A 4MH4A 3CMAZ 1QYPA 3CME1 3I4NI 5C3EI 2V8IA 2DE6A 2E9HA 1SFOI 2JNYA 3HOWI 1RLYA 5A2Qb 3TDHB 3OW2Z 3HOYI 1S72Z 2GTHA 4E2ZA 2K3RA 1YJ91 3VB9A 1Q811 1VQ6Z 2V8KA 3MONA 4XX2A 3NH8A 1KQSZ 4MXUA 1YHQZ 1VQL1 3CC41 1VQM1 2OTJ1 3RZOI 2J6AA 3KIHA 3GTJI 1VQ5Z 2BJOA 2QA4Z 3GTOI 3H0GI 4RV9A 4A3II 2IZ3A 2G2KA 3CMA1 2RBLA 1R9TI 4E31A 3HOXI 4NBAA 3CCSZ 1Y1VS 3EERA 2VF1A 4E32A 3MZKB 1NJI2 1TWHI 5LL6f 3OW2Y 1TFIA 1USPA 2OOYB 3GTLI 1X0TA 3F3FC 4NBEA 5T64A 1VQ71 3NDIA 4CL1A 5IP7I 2B63I 3ESWA 2M48A 5FLXf 1YI21 3J80b 3CPWZ 2WAQA 4MD9A 1Q862 2NVYI 1VQP1 5A2Qf 3S1NI 1Q821 1Z01A 3CCL1 1YHQ1 1VQLZ 2QRDB 1USPB 3QWUA 3BG1B 1RO4A 3GCFA 4RVHA 1N8R2 3CCV1 3Q87A 3CD6Z 4BXXI 3FQMA 4EWCA 3CQZI 4E2YA 2QREB 1VQN1 3HOUI 1VQ41 1VQ61 1PFTA 3S15I 1NUIA 2RHBA 4A93I 2V8JA 2QA41 1NJI1 1KD12 5C4JI 3G711 2OTLZ 1RQFA 3S14I 3T4NB 4DGLA 5T67A 1Y1VI 2P28A 2NVXI 3CCUZ 2PM9A 2R93I 2O4HA 3J80f 4NBGA 1ZB9A 4E2WA 3M3YI 1N8R1 3VMGA 1YJ9Z 1WIIA 2VUGA 3S17I 1Y1WI 3CCR1 1Q812 3GTMS 4NH1C 4RS4A 2YU9I 3H3VJ 3U50C 1Q7Y2 5CM2M 5FLMI 3FQQA 2LIYA 2JUBA 4NOZA 1YUAA 4A3LI 3CXCZ 1VQO1 4A3MI 1Q861 1S721 4NBCA 1Z03A 5D1PA 3G6EZ 1W2BY 3LUSA 1QVFY 3CCVZ 3CD61 2HF1A 2GTIA 2R6MA 1NP6A 1X3ZA 4QTUA 4HGZA 2QEXZ 4HGYA 4TNUA 3CCRZ 1RNIA 3RZDI 3M4OI 3P5JB 4RVGA 1KQSY 2H85A 3J81b 3I551 4BY1I 3PO2I 3HOVI 2W04A 3S16I 1YIT1 3CC7Z 2W03A 2PK7A 3FKII 3VMHA 4MD8A 2F4MA 3S2HI 2Q51A 2QKDA 3GTQI 1YJWZ 3G4S1 1KC82 2QR1B 3TE5B 1ZB8A 4Y7NI 3PO3I 5AN9F 4QTTA 1Q7Y1 1W2BZ 4MRIA 1VQ9Z 3CXCY 1VQ81 3CC21 3I07A 5D1OB 3I55Z 4A3CI 3CCMZ 2ZAEB 1ZH1A 1VLAA 1QVGY 1TWAI 2HU9A 3CC71 2AKLA 2DE7A 1YUKA 2YADA 3GKQA 1K8A2 2JA8I 1JJ2Y 1YJW1 1VQ8Z 1I6HI 2I3CA 1YJN1 1VQKZ 1TWGI 2JA6I 2DE5A 2E2HI 1I50I 3CCM1 3CCS1 2RPRA 3NDJA 1YJNZ 4A3DI 2LFUA 3CCJ1 1K731 3CCLZ 5IT9b 2IZ4A 1QF8A 4A3EI 2R7ZI 1DL6A 1JWHC 1KRLA 1K8A1 3GTKI 3I56Z 4A3BI 2WB1A 2OOXB 5C4XI 1WCMI 1RO2A 4NB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4O I;  2K5R A;  2F4O A;  2R92 I;  1LQL A;  4BBS I;  1USP B;  1ML8 A;  1RO4 A;  3GCF A;  4A3F I;  4BY1 I;  3Q87 A;  4BXX I;  4BBR I;  3K7A I;  3PO2 I;  3HOV I;  3S16 I;  3D6W A;  5IP9 I;  3CQZ I;  4NBB A;  3GTG I;  2PK7 A;  3FKI I;  1TWC I;  3VMH A;  3S1M I;  2F4M A;  3S2H I;  1WW9 A;  3HOU I;  3GTQ I;  2P3Y A;  3PO3 S;  1PFT A;  3S15 I;  1NUI A;  1ZB8 A;  4Y7N I;  4MH4 A;  3PO3 I;  4QTT A;  2JR6 A;  1QYP A;  4A93 I;  3I4N I;  5C3E I;  2KPI A;  3S1N I;  4NBH A;  5C4J I;  2DE6 A;  1X3W A;  3S1R I;  1SFO I;  2JNY A;  3S14 I;  3HOW I;  1RLY A;  3S2D I;  2JS4 A;  1Y1V I;  3I07 A;  3HOY I;  2NVX I;  5C44 I;  4BY7 I;  4A3C I;  3GTP I;  1VLA A;  2R93 I;  4A3J I;  1TWA I;  4NBG A;  3VB9 A;  1ZB9 A;  3M3Y I;  2AKL A;  2DE7 A;  4XX2 A;  3VMG A;  3GKQ A;  2JA8 I;  2NVT I;  2J6A A;  3RZO I;  3GTJ I;  2BJO A;  3S17 I;  1I6H I;  3GTO I;  3H0G I;  1Y1W I;  4A3I I;  3GTM S;  3S1Q I;  4Y52 I;  2YU9 I;  1TWG I;  4NBF A;  2JA6 I;  2JA7 I;  4X6A I;  3H3V J;  3U50 C;  2RBL A;  2DE5 A;  1R9T I;  2E2H I;  1I50 I;  2JA5 I;  5CM2 M;  5FLM I;  3HOX I;  4NBA A;  1L1O C;  3VMI A;  4A3D I;  4A3G I;  4NOZ A;  2E2I I;  1Y1V S;  3EER A;  1YUA A;  4A3L I;  2VUM I;  1N2F A;  4A3E I;  2R7Z I;  4A3M I;  1TWH I;  4NB8 A;  4NBC A;  1TWF I;  1TFI A;  1USP A;  4A3K I;  3I4M I;  2NVQ I;  3GTL I;  1DL6 A;  4NBE A;  3LUS A;  3GTK I;  2HF1 A;  5IP7 I;  2B63 I;  3HOZ I;  3ESW A;  4A3B I;  1X3Z A;  5C4X I;  4QTU A;  3GTM I;  1I3Q I;  1WCM I;  2NVY I;  4NB9 A;  3RZD I;  2E2J I;  1K83 I;  4NBD A; 
#chains in the Genus database with same CATH topology
 2K5R A;  2QEX 1;  2R92 I;  2KI7 B;  1Y8C A;  2E7Z A;  2Q4Z A;  3EED A;  2QRC B;  3K7A I;  3J7A 4;  4DK1 A;  1KC8 1;  4E2X A;  3G6E 1;  3GTG I;  1M1K 1;  1TWC I;  1YIJ 1;  2OZK A;  3IX0 A;  1M90 1;  3HKZ A;  2P3Y A;  3PO3 S;  3NH4 A;  2QLV B;  4MON A;  2VPW A;  2JR6 A;  4RVF A;  3G71 Z;  1YIJ Z;  2KPI A;  3NH5 A;  4NBH A;  1VQO Z;  1QVF Z;  1KD1 1;  1X3W A;  4NFR A;  3S1R I;  1M90 2;  3CCU 1;  1VQK 1;  1VQ9 1;  3S2D I;  2JS4 A;  4RVD A;  5D1O A;  5C44 I;  4BY7 I;  3GTP I;  3CCE Z;  2M6N A;  4A3J I;  3CCJ Z;  3CC2 Z;  3D9X A;  3IFU A;  1VQP Z;  1JJ2 Z;  1WJ2 A;  2NVT I;  3JAM f;  3CME Z;  3CCQ Z;  3S1Q I;  4Y52 I;  5IT9 f;  4NBF A;  2JA7 I;  4X6A I;  4DQY B;  3CPW Y;  1QVG Z;  2JA5 I;  3CCE 1;  3BG0 B;  3NFZ A;  3CCQ 1;  1K9M 1;  1L1O C;  3VMI A;  1M1K 2;  2JMO A;  3KIF A;  1Q82 2;  4A3G I;  1K73 2;  2E2I I;  1Z02 A;  1VQN Z;  1YI2 Z;  2VUM I;  1N2F A;  1K9M 2;  4NB8 A;  2RT9 A;  1TWF I;  3I4M I;  4A3K I;  2NVQ I;  3G4S Z;  2O53 A;  2Y0S A;  1SIW A;  3JAM b;  1RO0 A;  4AYB A;  2EGT A;  3J81 f;  3HOZ I;  1YIT Z;  1S7M A;  2OTL 1;  3GTM I;  1I3Q I;  3I56 1;  2E2J I;  1K83 I;  4NBD A;  2GU2 A;  4E33 A;  2F4O A;  3F3P C;  1LQL A;  4BBS I;  4MD7 A;  1ML8 A;  2JIQ A;  4A3F I;  2RIQ A;  4BBR I;  1VQM Z;  3CC4 Z;  2OTJ Z;  1VQ7 Z;  4HH4 A;  3D6W A;  2PMZ A;  5IP9 I;  4NBB A;  3S1M I;  3IF8 A;  1VQ4 Z;  1WW9 A;  3VTN A;  4S1T A;  5T6B A;  1VQ5 1;  5FLX b;  3MZL B;  1P9N A;  4E30 A;  4MH4 A;  3CMA Z;  1QYP A;  3CME 1;  3I4N I;  5C3E I;  2V8I A;  2DE6 A;  2E9H A;  1SFO I;  2JNY A;  3HOW I;  1RLY A;  5A2Q b;  3TDH B;  3OW2 Z;  1QXF A;  3HOY I;  1S72 Z;  2GTH A;  4E2Z A;  2K3R A;  1YJ9 1;  3VB9 A;  1Q81 1;  1VQ6 Z;  2V8K A;  3MON A;  4XX2 A;  3NH8 A;  1KQS Z;  4MXU A;  1YHQ Z;  1VQL 1;  3CC4 1;  1Q16 A;  1VQM 1;  2OTJ 1;  3RZO I;  2J6A A;  3KIH A;  3GTJ I;  1VQ5 Z;  2BJO A;  2QA4 Z;  3GTO I;  3H0G I;  4RV9 A;  4A3I I;  2VPZ A;  2IZ3 A;  2G2K A;  3CMA 1;  2RBL A;  1R9T I;  4E31 A;  3HOX I;  4NBA A;  3CCS Z;  1Y1V S;  3EER A;  2VF1 A;  4E32 A;  3MZK B;  1NJI 2;  1TWH I;  5LL6 f;  3OW2 Y;  1TFI A;  1USP A;  2OOY B;  3GTL I;  1X0T A;  3F3F C;  4NBE A;  5T64 A;  1VQ7 1;  3NDI A;  4CL1 A;  5IP7 I;  2B63 I;  3ESW A;  1FDI A;  2M48 A;  5FLX f;  1YI2 1;  3J80 b;  3CPW Z;  2WAQ A;  4MD9 A;  1Q86 2;  2NVY I;  1VQP 1;  5A2Q f;  3S1N I;  1Q82 1;  1Z01 A;  3CCL 1;  1YHQ 1;  1VQL Z;  2QRD B;  1USP B;  3QWU A;  3BG1 B;  1RO4 A;  3GCF A;  4RVH A;  1N8R 2;  3CCV 1;  3Q87 A;  3CD6 Z;  4BXX I;  3IR7 A;  3FQM A;  4EWC A;  3CQZ I;  4E2Y A;  2QRE B;  1VQN 1;  3HOU I;  2NAP A;  1VQ4 1;  1VQ6 1;  1PFT A;  3S15 I;  1NUI A;  2RHB A;  2V3V A;  4A93 I;  2V8J A;  2QA4 1;  1NJI 1;  1KD1 2;  5C4J I;  3G71 1;  2OTL Z;  1RQF A;  3S14 I;  3T4N B;  4DGL A;  5T67 A;  1Y1V I;  2P28 A;  2NVX I;  3CCU Z;  2PM9 A;  2R93 I;  2O4H A;  3J80 f;  4NBG A;  1ZB9 A;  4E2W A;  3M3Y I;  1N8R 1;  3VMG A;  2IV2 X;  1YJ9 Z;  1WII A;  2VUG A;  3S17 I;  3CCR 1;  1Y1W I;  1Q81 2;  3GTM S;  4NH1 C;  4RS4 A;  1WZN A;  2YU9 I;  3H3V J;  3U50 C;  1Q7Y 2;  5CM2 M;  5FLM I;  3FQQ A;  2LIY A;  2JUB A;  4NOZ A;  1YUA A;  4A3L I;  2VPX A;  3CXC Z;  1VQO 1;  4A3M I;  1Q86 1;  1S72 1;  4NBC A;  1Z03 A;  5D1P A;  3G6E Z;  2AYD A;  1W2B Y;  2JIM A;  3LUS A;  1QVF Y;  3CCV Z;  3CD6 1;  2HF1 A;  2GTI A;  2R6M A;  1NP6 A;  1FDO A;  2VPY A;  1X3Z A;  4QTU A;  2JIR A;  4HGZ A;  2QEX Z;  2JIO A;  4HGY A;  4TNU A;  3CCR Z;  1RNI A;  1AA6 A;  3RZD I;  3M4O I;  3P5J B;  4RVG A;  1KQS Y;  2H85 A;  3J81 b;  3I55 1;  4BY1 I;  3PO2 I;  3HOV I;  2W04 A;  3S16 I;  1YIT 1;  3CC7 Z;  2W03 A;  2PK7 A;  3FKI I;  3VMH A;  4MD8 A;  2F4M A;  3S2H I;  2Q51 A;  2QKD A;  3GTQ I;  1YJW Z;  3G4S 1;  1KC8 2;  2QR1 B;  3TE5 B;  1ZB8 A;  4Y7N I;  3PO3 I;  5AN9 F;  4QTT A;  1Q7Y 1;  1W2B Z;  4MRI A;  1VQ9 Z;  3CXC Y;  1VQ8 1;  3CC2 1;  3I07 A;  5D1O B;  3I55 Z;  4A3C I;  3CCM Z;  2ZAE B;  1ZH1 A;  1VLA A;  1QVG Y;  1TWA I;  2HU9 A;  3CC7 1;  2AKL A;  2DE7 A;  1YUK A;  2YAD A;  3GKQ A;  1K8A 2;  2JA8 I;  1JJ2 Y;  3D2L A;  1YJW 1;  1VQ8 Z;  1I6H I;  2LEX A;  2I3C A;  1YJN 1;  1VQK Z;  1TWG I;  2JA6 I;  2DE5 A;  2E2H I;  1I50 I;  3CCM 1;  3CCS 1;  2RPR A;  3NDJ A;  1YJN Z;  4A3D I;  2LFU A;  3CCJ 1;  1K73 1;  3CCL Z;  5IT9 b;  2IZ4 A;  1QF8 A;  4A3E I;  2R7Z I;  1DL6 A;  1JWH C;  1KRL A;  1K8A 1;  2JIP A;  3GTK I;  3I56 Z;  4A3B I;  2WB1 A;  2OOX B;  2V45 A;  5C4X I;  1WCM I;  1RO2 A;  4NB9 A; 
#chains in the Genus database with same CATH homology
 2K5R A;  2QEX 1;  2R92 I;  2KI7 B;  2Q4Z A;  3EED A;  2QRC B;  3K7A I;  3J7A 4;  4DK1 A;  1KC8 1;  4E2X A;  3G6E 1;  3GTG I;  1M1K 1;  1TWC I;  1YIJ 1;  2OZK A;  3IX0 A;  1M90 1;  3HKZ A;  2P3Y A;  3PO3 S;  3NH4 A;  2QLV B;  4MON A;  2JR6 A;  4RVF A;  3G71 Z;  1YIJ Z;  2KPI A;  3NH5 A;  4NBH A;  1VQO Z;  1QVF Z;  1KD1 1;  1X3W A;  4NFR A;  3S1R I;  1M90 2;  3CCU 1;  1VQK 1;  1VQ9 1;  3S2D I;  2JS4 A;  4RVD A;  5D1O A;  5C44 I;  4BY7 I;  3GTP I;  3CCE Z;  2M6N A;  4A3J I;  3CCJ Z;  3CC2 Z;  3D9X A;  3IFU A;  1VQP Z;  1JJ2 Z;  2NVT I;  3JAM f;  3CME Z;  3CCQ Z;  3S1Q I;  4Y52 I;  5IT9 f;  4NBF A;  2JA7 I;  4X6A I;  4DQY B;  3CPW Y;  1QVG Z;  2JA5 I;  3CCE 1;  3BG0 B;  3NFZ A;  3CCQ 1;  1K9M 1;  1L1O C;  3VMI A;  1M1K 2;  2JMO A;  3KIF A;  1Q82 2;  4A3G I;  1K73 2;  2E2I I;  1Z02 A;  1VQN Z;  1YI2 Z;  2VUM I;  1N2F A;  1K9M 2;  4NB8 A;  2RT9 A;  1TWF I;  3I4M I;  4A3K I;  2NVQ I;  3G4S Z;  2O53 A;  2Y0S A;  3JAM b;  1RO0 A;  4AYB A;  2EGT A;  3J81 f;  3HOZ I;  1YIT Z;  1S7M A;  2OTL 1;  3GTM I;  1I3Q I;  3I56 1;  2E2J I;  1K83 I;  4NBD A;  2GU2 A;  4E33 A;  2F4O A;  3F3P C;  1LQL A;  4BBS I;  4MD7 A;  1ML8 A;  4A3F I;  2RIQ A;  4BBR I;  1VQM Z;  3CC4 Z;  2OTJ Z;  1VQ7 Z;  4HH4 A;  3D6W A;  2PMZ A;  5IP9 I;  4NBB A;  3S1M I;  3IF8 A;  1VQ4 Z;  1WW9 A;  3VTN A;  4S1T A;  5T6B A;  1VQ5 1;  5FLX b;  3MZL B;  1P9N A;  4E30 A;  4MH4 A;  3CMA Z;  1QYP A;  3CME 1;  3I4N I;  5C3E I;  2V8I A;  2DE6 A;  2E9H A;  1SFO I;  2JNY A;  3HOW I;  1RLY A;  5A2Q b;  3TDH B;  3OW2 Z;  3HOY I;  1S72 Z;  2GTH A;  4E2Z A;  2K3R A;  1YJ9 1;  3VB9 A;  1Q81 1;  1VQ6 Z;  2V8K A;  3MON A;  4XX2 A;  3NH8 A;  1KQS Z;  4MXU A;  1YHQ Z;  1VQL 1;  3CC4 1;  1VQM 1;  2OTJ 1;  3RZO I;  2J6A A;  3KIH A;  3GTJ I;  1VQ5 Z;  2BJO A;  2QA4 Z;  3GTO I;  3H0G I;  4RV9 A;  4A3I I;  2IZ3 A;  2G2K A;  3CMA 1;  2RBL A;  1R9T I;  4E31 A;  3HOX I;  4NBA A;  3CCS Z;  1Y1V S;  3EER A;  2VF1 A;  4E32 A;  3MZK B;  1NJI 2;  1TWH I;  5LL6 f;  3OW2 Y;  1TFI A;  1USP A;  2OOY B;  3GTL I;  1X0T A;  3F3F C;  4NBE A;  5T64 A;  1VQ7 1;  3NDI A;  4CL1 A;  5IP7 I;  2B63 I;  3ESW A;  2M48 A;  5FLX f;  1YI2 1;  3J80 b;  3CPW Z;  2WAQ A;  4MD9 A;  1Q86 2;  2NVY I;  1VQP 1;  5A2Q f;  3S1N I;  1Q82 1;  1Z01 A;  3CCL 1;  1YHQ 1;  1VQL Z;  2QRD B;  1USP B;  3QWU A;  3BG1 B;  1RO4 A;  3GCF A;  4RVH A;  1N8R 2;  3CCV 1;  3Q87 A;  3CD6 Z;  4BXX I;  3FQM A;  4EWC A;  3CQZ I;  4E2Y A;  2QRE B;  1VQN 1;  3HOU I;  1VQ4 1;  1VQ6 1;  1PFT A;  3S15 I;  1NUI A;  2RHB A;  4A93 I;  2V8J A;  2QA4 1;  1NJI 1;  1KD1 2;  5C4J I;  3G71 1;  2OTL Z;  1RQF A;  3S14 I;  3T4N B;  4DGL A;  5T67 A;  1Y1V I;  2P28 A;  2NVX I;  3CCU Z;  2PM9 A;  2R93 I;  2O4H A;  3J80 f;  4NBG A;  1ZB9 A;  4E2W A;  3M3Y I;  1N8R 1;  3VMG A;  1YJ9 Z;  1WII A;  2VUG A;  3S17 I;  1Y1W I;  3CCR 1;  1Q81 2;  3GTM S;  4NH1 C;  4RS4 A;  2YU9 I;  3H3V J;  3U50 C;  1Q7Y 2;  5CM2 M;  5FLM I;  3FQQ A;  2LIY A;  2JUB A;  4NOZ A;  1YUA A;  4A3L I;  3CXC Z;  1VQO 1;  4A3M I;  1Q86 1;  1S72 1;  4NBC A;  1Z03 A;  5D1P A;  3G6E Z;  1W2B Y;  3LUS A;  1QVF Y;  3CCV Z;  3CD6 1;  2HF1 A;  2GTI A;  2R6M A;  1NP6 A;  1X3Z A;  4QTU A;  4HGZ A;  2QEX Z;  4HGY A;  4TNU A;  3CCR Z;  1RNI A;  3RZD I;  3M4O I;  3P5J B;  4RVG A;  1KQS Y;  2H85 A;  3J81 b;  3I55 1;  4BY1 I;  3PO2 I;  3HOV I;  2W04 A;  3S16 I;  1YIT 1;  3CC7 Z;  2W03 A;  2PK7 A;  3FKI I;  3VMH A;  4MD8 A;  2F4M A;  3S2H I;  2Q51 A;  2QKD A;  3GTQ I;  1YJW Z;  3G4S 1;  1KC8 2;  2QR1 B;  3TE5 B;  1ZB8 A;  4Y7N I;  3PO3 I;  5AN9 F;  4QTT A;  1Q7Y 1;  1W2B Z;  4MRI A;  1VQ9 Z;  3CXC Y;  1VQ8 1;  3CC2 1;  3I07 A;  5D1O B;  3I55 Z;  4A3C I;  3CCM Z;  2ZAE B;  1ZH1 A;  1VLA A;  1QVG Y;  1TWA I;  2HU9 A;  3CC7 1;  2AKL A;  2DE7 A;  1YUK A;  2YAD A;  3GKQ A;  1K8A 2;  2JA8 I;  1JJ2 Y;  1YJW 1;  1VQ8 Z;  1I6H I;  2I3C A;  1YJN 1;  1VQK Z;  1TWG I;  2JA6 I;  2DE5 A;  2E2H I;  1I50 I;  3CCM 1;  3CCS 1;  2RPR A;  3NDJ A;  1YJN Z;  4A3D I;  2LFU A;  3CCJ 1;  1K73 1;  3CCL Z;  5IT9 b;  2IZ4 A;  1QF8 A;  4A3E I;  2R7Z I;  1DL6 A;  1JWH C;  1KRL A;  1K8A 1;  3GTK I;  3I56 Z;  4A3B I;  2WB1 A;  2OOX B;  5C4X I;  1WCM I;  1RO2 A;  4NB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...