3PO3I

Arrested rna polymerase ii reactivation intermediate
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3I02
5IP7I 2E2II 2NVTI 4A3EI 1ZB8A 3S16I 1NUIA 1VLAA 2BJOA 3VB9A 3H0GI 1WCMI 1TWHI 4NBAA 3VMGA 1R9TI 3Q87A 5CM2M 2RBLA 3PO2I 4NBGA 5C4XI 4NBDA 1Y1VI 1WW9A 2P3YA 3I07A 1ZB9A 4A3II 2E2HI 4A93I 4A3LI 1I6HI 4A3CI 1RLYA 1X3WA 3HOUI 2JS4A 4A3MI 4A3KI 4NB8A 2YU9I 2KPIA 3VMHA 3ESWA 4NBBA 3S1MI 1Y1VS 4A3FI 3GTPI 5IP9I 4NBFA 2PK7A 3M4OI 4NBEA 3PO3I 4A3DI 1PFTA 5C4JI 1TFIA 3GTLI 1ML8A 3HOXI 2JR6A 3GTMS 3GTGI 4A3BI 3U50C 4NBCA 4X6AI 1YUAA 3RZDI 1I50I 4NOZA 3H3VJ 2JA5I 1I3QI 3S14I 3GKQA 4MH4A 2R92I 1TWGI 3S2DI 3HOWI 1USPB 4QTTA 1USPA 4BY1I 3GTOI 2R7ZI 1Y1WI 3I4MI 2DE7A 2HF1A 3RZOI 3VMIA 3GTJI 1X3ZA 3I4NI 4BXXI 2K5RA 2JA7I 3S1QI 2DE6A 4NBHA 2NVYI 2AKLA 2B63I 4BBSI 2NVQI 4Y52I 3S17I 3LUSA 3FKII 2R93I 3HOYI 2E2JI 2J6AA 2VUMI 1K83I 4A3JI 3HOVI 3S1RI 4XX2A 3S1NI 3GTMI 1DL6A 3GTKI 1N2FA 5FLMI 3K7AI 2F4OA 1TWCI 1SFOI 1RO4A 4Y7NI 3S2HI 5C3EI 5C44I 4NB9A 1LQLA 2JNYA 1QYPA 3D6WA 1L1OC 4A3GI 3CQZI 2NVXI 3HOZI 1TWAI 2F4MA 2JA6I 2JA8I 3S15I 4BY7I 1TWFI 3PO3S 3M3YI 3GTQI 3EERA 4BBRI 3GCFA 2DE5A 4QTUA
chains in the Genus database with same CATH superfamily
1K731 2V8IA 3D2LA 3S16I 1Q822 2BJOA 2QA41 4RVDA 4NBAA 1VQ8Z 3Q87A 1Q821 3IX0A 2RBLA 5C4XI 4NBDA 3CCR1 4E2YA 1VQL1 4A93I 4A3LI 1RLYA 3QWUA 4E2XA 2JS4A 5A2Qf 4A3MI 3G6EZ 1JJ2Z 1Y1VS 1QVFY 3GTPI 5IP9I 3G6E1 1Q7Y2 4NBEA 1NJI2 5T6BA 2OTLZ 1YJNZ 1ML8A 1P9NA 4NFRA 4NBCA 4X6AI 1YJN1 1KQSY 3RZDI 1I50I 2VUGA 4RVFA 4MONA 1I3QI 3S14I 2RIQA 3GKQA 4MH4A 1YHQZ 3CC7Z 2IZ4A 5D1OB 4QTTA 4BY1I 1WIIA 3I56Z 1Q7Y1 2E9HA 2VPYA 1VQ61 3CMEZ 1YIJZ 3CCQ1 3GTJI 2V8KA 2OOYB 3J81f 2JA7I 2B63I 2NVQI 3CCMZ 3VTNA 3HOYI 1KD11 2E2JI 2VUMI 4A3JI 3FQQA 4S1TA 1FDOA 1YJW1 3GTMI 3GTKI 1N2FA 2OZKA 2QRCB 4CL1A 3K7AI 4RS4A 2F4OA 2QEX1 1RO4A 5C44I 4NB9A 1LQLA 1QVFZ 1QYPA 3HOZI 1TWAI 3J81b 1KD12 1W2BY 2JA8I 4BY7I 1NP6A 3MZKB 1ZH1A 3NDIA 2VF1A 3I551 4EWCA 4A3EI 1VLAA 3TE5B 1Q812 2GU2A 1WCMI 3J80b 2JIQA 5CM2M 4NBGA 2M6NA 4RVGA 2H85A 1WZNA 2IV2X 2P3YA 3CME1 1YHQ1 3G4SZ 1QF8A 1FDIA 5A2Qb 1S721 4A3CI 1X3WA 2RHBA 2O53A 3I561 4MD7A 4A3KI 4NB8A 3VMHA 4NBBA 2OOXB 3HKZA 4A3FI 1VQ51 2OTJ1 1VQ6Z 2ZAEB 3M4OI 4MRIA 5FLXb 3GTLI 2HU9A 1M901 3GTMS 1WJ2A 1Z01A 1YUAA 3CCSZ 2NAPA 1VQK1 2R6MA 2P28A 1VQLZ 3S2DI 1Z03A 2RPRA 1YUKA 2GTHA 3G4S1 4BXXI 3CCEZ 2K5RA 3MONA 4NBHA 2AKLA 1S72Z 4Y52I 3S17I 3FKII 1K9M2 3CCU1 2J6AA 5FLXf 1JWHC 3CCRZ 4RV9A 3HOVI 3CMA1 3MZLB 3CCVZ 5IT9b 1N8R2 1DL6A 2V3VA 2W03A 2KI7B 2AYDA 1RO2A 3CD61 3CCV1 4Y7NI 3IFUA 2PM9A 2QRDB 2JNYA 3D6WA 4A3GI 5D1PA 3CQZI 3CCUZ 3KIHA 4E32A 2GTIA 1KRLA 2F4MA 2JA6I 1Y8CA 3GTQI 3EERA 1RO0A 3GCFA 2E7ZA 3CXCY 3CCQZ 3CCM1 4QTUA 1Q16A 1YJWZ 2E2II 1ZB8A 2JIRA 1S7MA 3H0GI 1TWHI 1R9TI 3CPWZ 1KC82 2K3RA 5T64A 1K9M1 1Y1VI 3CC71 2V8JA 3JAMb 4A3II 2E2HI 2I3CA 3IR7A 1YJ9Z 1M1K1 1VQ9Z 2YU9I 1X0TA 2KPIA 1K8A2 1YIJ1 4TNUA 1VQ91 2Y0SA 1QVGY 4HGZA 2LFUA 4A3DI 3BG0B 3TDHB 5C4JI 1TFIA 1YI21 1AA6A 1Q811 4HH4A 1YJ91 4NOZA 3H3VJ 3CXCZ 3OW2Z 2QREB 2JA5I 1TWGI 2OTJZ 2QA4Z 4RVHA 1USPA 3GTOI 1VQOZ 2R7ZI 3F3PC 3NH4A 1NJI1 2W04A 1Y1WI 3I4MI 1VQ5Z 4E30A 1M1K2 1X3ZA 3I4NI 1Q862 3S1QI 2DE6A 4BBSI 1SIWA 1VQP1 3CC41 2WAQA 2YADA 1QVGZ 1K83I 5T67A 4AYBA 3S1RI 4XX2A 4DGLA 3S1NI 4NH1C 4MXUA 5FLMI 3I55Z 2WB1A 1RQFA 1QXFA 4MD8A 1K732 1TWCI 2PMZA 2JIOA 5C3EI 2JIPA 3CMAZ 3NH5A 2VPZA 2NVXI 4E2ZA 3CCJ1 1VQN1 3CCJZ 2RT9A 3NFZA 3PO3S 4MD9A 3CCE1 3CCL1 3CC4Z 3OW2Y 2O4HA 5IP7I 3IF8A 2NVTI 1YIT1 1NUIA 2LIYA 4E2WA 1VQM1 1VQ7Z 2VPWA 1KC81 3VB9A 3VMGA 1VQPZ 3P5JB 4E33A 3T4NB 2QKDA 3CCS1 1VQO1 3NH8A 2JUBA 4E31A 1VQ41 1WW9A 3I07A 1ZB9A 1I6HI 2QR1B 1Q861 3HOUI 3FQMA 3ESWA 3S1MI 2Q4ZA 2QLVB 4NBFA 5AN9F 3CC2Z 2PK7A 1VQKZ 3PO3I 1PFTA 3CC21 3HOXI 2JMOA 2JR6A 4DK1A 3GTGI 2VPXA 3U50C 4A3BI 1YI2Z 3J80f 3CPWY 1RNIA 5IT9f 4DQYB 2R92I 2LEXA 4HGYA 1VQ4Z 1W2BZ 3HOWI 1USPB 2IZ3A 2OTL1 3BG1B 2G2KA 3JAMf 1K8A1 2DE7A 2HF1A 3RZOI 3VMIA 1VQMZ 1JJ2Y 1VQ71 1KQSZ 1Z02A 2NVYI 2Q51A 3LUSA 1VQ81 2R93I 3KIFA 3NDJA 2JIMA 3CCLZ 3G71Z 3D9XA 1YITZ 1SFOI 2QEXZ 1M902 3F3FC 1N8R1 3CD6Z 3S2HI 2M48A 5LL6f 3G711 2V45A 1L1OC 3EEDA 1VQNZ 3J7A4 3S15I 5D1OA 1TWFI 3M3YI 4BBRI 2DE5A 2EGTA 3PO2I
chains in the Genus database with same CATH topology
1K731 2V8IA 3S16I 1Q822 2BJOA 2QA41 4RVDA 4NBAA 1VQ8Z 3Q87A 1Q821 3IX0A 2RBLA 5C4XI 4NBDA 3CCR1 4E2YA 1VQL1 4A93I 4A3LI 1RLYA 3QWUA 4E2XA 2JS4A 5A2Qf 4A3MI 3G6EZ 1JJ2Z 1Y1VS 1QVFY 3GTPI 5IP9I 3G6E1 1Q7Y2 4NBEA 1NJI2 5T6BA 2OTLZ 1YJNZ 1ML8A 1P9NA 4NFRA 4NBCA 4X6AI 1YJN1 1KQSY 3RZDI 1I50I 2VUGA 4RVFA 4MONA 1I3QI 3S14I 2RIQA 3GKQA 4MH4A 1YHQZ 3CC7Z 2IZ4A 5D1OB 4QTTA 4BY1I 1WIIA 3I56Z 1Q7Y1 2E9HA 1VQ61 3CMEZ 1YIJZ 3CCQ1 3GTJI 2V8KA 2OOYB 3J81f 2JA7I 2B63I 2NVQI 3CCMZ 3VTNA 3HOYI 1KD11 2E2JI 2VUMI 4A3JI 3FQQA 4S1TA 1YJW1 3GTMI 3GTKI 1N2FA 2OZKA 2QRCB 4CL1A 3K7AI 4RS4A 2F4OA 2QEX1 1RO4A 5C44I 4NB9A 1LQLA 1QVFZ 1QYPA 3HOZI 1TWAI 3J81b 1KD12 1W2BY 2JA8I 4BY7I 1NP6A 3MZKB 1ZH1A 3NDIA 2VF1A 3I551 4EWCA 4A3EI 1VLAA 3TE5B 1Q812 2GU2A 1WCMI 3J80b 5CM2M 4NBGA 2M6NA 4RVGA 2H85A 2P3YA 3CME1 1YHQ1 3G4SZ 1QF8A 5A2Qb 1S721 4A3CI 1X3WA 2RHBA 2O53A 3I561 4MD7A 4A3KI 4NB8A 3VMHA 4NBBA 2OOXB 3HKZA 4A3FI 1VQ51 2OTJ1 1VQ6Z 2ZAEB 3M4OI 4MRIA 5FLXb 3GTLI 2HU9A 1M901 3GTMS 1Z01A 1YUAA 3CCSZ 1VQK1 2R6MA 2P28A 1VQLZ 3S2DI 1Z03A 2RPRA 1YUKA 2GTHA 3G4S1 4BXXI 3CCEZ 2K5RA 3MONA 4NBHA 2AKLA 1S72Z 4Y52I 3S17I 3FKII 1K9M2 3CCU1 2J6AA 5FLXf 1JWHC 3CCRZ 4RV9A 3HOVI 3CMA1 3MZLB 3CCVZ 5IT9b 1N8R2 1DL6A 2W03A 2KI7B 1RO2A 3CD61 3CCV1 4Y7NI 3IFUA 2PM9A 2QRDB 2JNYA 3D6WA 4A3GI 5D1PA 3CQZI 3CCUZ 3KIHA 4E32A 2GTIA 1KRLA 2F4MA 2JA6I 3GTQI 3EERA 1RO0A 3GCFA 1YJWZ 3CXCY 3CCM1 3CCQZ 4QTUA 2E2II 1ZB8A 1S7MA 3H0GI 1TWHI 1R9TI 3CPWZ 1KC82 2K3RA 5T64A 1K9M1 1Y1VI 3CC71 2V8JA 3JAMb 4A3II 2E2HI 2I3CA 1YJ9Z 1M1K1 1VQ9Z 2YU9I 1X0TA 2KPIA 1K8A2 1YIJ1 4TNUA 1VQ91 2Y0SA 1QVGY 4HGZA 2LFUA 4A3DI 3BG0B 3TDHB 5C4JI 1TFIA 1YI21 1Q811 4HH4A 1YJ91 4NOZA 3H3VJ 3CXCZ 3OW2Z 2QREB 2JA5I 1TWGI 2OTJZ 2QA4Z 4RVHA 1USPA 3GTOI 1VQOZ 2R7ZI 3F3PC 3NH4A 1NJI1 2W04A 1Y1WI 3I4MI 1VQ5Z 4E30A 1M1K2 1X3ZA 3I4NI 1Q862 3S1QI 2DE6A 4BBSI 1VQP1 3CC41 2WAQA 2YADA 1QVGZ 1K83I 5T67A 4AYBA 3S1RI 4XX2A 4DGLA 3S1NI 4NH1C 4MXUA 5FLMI 3I55Z 2WB1A 1RQFA 4MD8A 1K732 1TWCI 2PMZA 5C3EI 3CMAZ 3NH5A 2NVXI 4E2ZA 3CCJ1 1VQN1 3CCJZ 2RT9A 3NFZA 3PO3S 4MD9A 3CCE1 3CCL1 3CC4Z 3OW2Y 2O4HA 5IP7I 3IF8A 2NVTI 1YIT1 1NUIA 2LIYA 4E2WA 1VQM1 1VQ7Z 1KC81 3VB9A 3VMGA 1VQPZ 3P5JB 4E33A 3T4NB 2QKDA 3CCS1 1VQO1 3NH8A 2JUBA 4E31A 1VQ41 1WW9A 3I07A 1ZB9A 1I6HI 2QR1B 1Q861 3HOUI 3FQMA 3ESWA 3S1MI 2Q4ZA 2QLVB 4NBFA 5AN9F 3CC2Z 2PK7A 1VQKZ 3PO3I 1PFTA 3CC21 3HOXI 2JMOA 2JR6A 4DK1A 3GTGI 4A3BI 3U50C 1YI2Z 3J80f 3CPWY 1RNIA 5IT9f 4DQYB 2R92I 4HGYA 1VQ4Z 1W2BZ 3HOWI 1USPB 2IZ3A 2OTL1 3BG1B 2G2KA 3JAMf 1K8A1 2DE7A 2HF1A 3RZOI 3VMIA 1VQMZ 1JJ2Y 1VQ71 1KQSZ 1Z02A 2NVYI 2Q51A 3LUSA 1VQ81 2R93I 3KIFA 3NDJA 3CCLZ 3G71Z 3D9XA 1YITZ 1SFOI 2QEXZ 1M902 3F3FC 1N8R1 3CD6Z 3S2HI 2M48A 5LL6f 3G711 1L1OC 3EEDA 1VQNZ 3J7A4 3S15I 5D1OA 1TWFI 3M3YI 4BBRI 2DE5A 2EGTA 3PO2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 I;  2E2I I;  2NVT I;  4A3E I;  1ZB8 A;  3S16 I;  1NUI A;  1VLA A;  2BJO A;  3VB9 A;  3H0G I;  1WCM I;  1TWH I;  4NBA A;  3VMG A;  1R9T I;  3Q87 A;  5CM2 M;  2RBL A;  3PO2 I;  4NBG A;  5C4X I;  4NBD A;  1Y1V I;  1WW9 A;  2P3Y A;  3I07 A;  1ZB9 A;  4A3I I;  2E2H I;  4A93 I;  4A3L I;  1I6H I;  4A3C I;  1RLY A;  1X3W A;  3HOU I;  2JS4 A;  4A3M I;  4A3K I;  4NB8 A;  2YU9 I;  2KPI A;  3VMH A;  3ESW A;  4NBB A;  3S1M I;  1Y1V S;  4A3F I;  3GTP I;  5IP9 I;  4NBF A;  2PK7 A;  3M4O I;  4NBE A;  3PO3 I;  4A3D I;  1PFT A;  5C4J I;  1TFI A;  3GTL I;  1ML8 A;  3HOX I;  2JR6 A;  3GTM S;  3GTG I;  4A3B I;  3U50 C;  4NBC A;  4X6A I;  1YUA A;  3RZD I;  1I50 I;  4NOZ A;  3H3V J;  2JA5 I;  1I3Q I;  3S14 I;  3GKQ A;  4MH4 A;  2R92 I;  1TWG I;  3S2D I;  3HOW I;  1USP B;  4QTT A;  1USP A;  4BY1 I;  3GTO I;  2R7Z I;  1Y1W I;  3I4M I;  2DE7 A;  2HF1 A;  3RZO I;  3VMI A;  3GTJ I;  1X3Z A;  3I4N I;  4BXX I;  2K5R A;  2JA7 I;  3S1Q I;  2DE6 A;  4NBH A;  2NVY I;  2AKL A;  2B63 I;  4BBS I;  2NVQ I;  4Y52 I;  3S17 I;  3LUS A;  3FKI I;  2R93 I;  3HOY I;  2E2J I;  2J6A A;  2VUM I;  1K83 I;  4A3J I;  3HOV I;  3S1R I;  4XX2 A;  3S1N I;  3GTM I;  1DL6 A;  3GTK I;  1N2F A;  5FLM I;  3K7A I;  2F4O A;  1TWC I;  1SFO I;  1RO4 A;  4Y7N I;  3S2H I;  5C3E I;  5C44 I;  4NB9 A;  1LQL A;  2JNY A;  1QYP A;  3D6W A;  1L1O C;  4A3G I;  3CQZ I;  2NVX I;  3HOZ I;  1TWA I;  2F4M A;  2JA6 I;  2JA8 I;  3S15 I;  4BY7 I;  1TWF I;  3PO3 S;  3M3Y I;  3GTQ I;  3EER A;  4BBR I;  3GCF A;  2DE5 A;  4QTU A; 
#chains in the Genus database with same CATH topology
 1K73 1;  2V8I A;  3D2L A;  3S16 I;  1Q82 2;  2BJO A;  2QA4 1;  4RVD A;  4NBA A;  1VQ8 Z;  3Q87 A;  1Q82 1;  3IX0 A;  2RBL A;  5C4X I;  4NBD A;  3CCR 1;  4E2Y A;  1VQL 1;  4A93 I;  4A3L I;  1RLY A;  3QWU A;  4E2X A;  2JS4 A;  5A2Q f;  4A3M I;  3G6E Z;  1JJ2 Z;  1Y1V S;  1QVF Y;  3GTP I;  5IP9 I;  3G6E 1;  1Q7Y 2;  4NBE A;  1NJI 2;  5T6B A;  2OTL Z;  1YJN Z;  1ML8 A;  1P9N A;  4NFR A;  4NBC A;  4X6A I;  1YJN 1;  1KQS Y;  3RZD I;  1I50 I;  2VUG A;  4RVF A;  4MON A;  1I3Q I;  3S14 I;  2RIQ A;  3GKQ A;  4MH4 A;  1YHQ Z;  3CC7 Z;  2IZ4 A;  5D1O B;  4QTT A;  4BY1 I;  1WII A;  3I56 Z;  1Q7Y 1;  2E9H A;  2VPY A;  1VQ6 1;  3CME Z;  1YIJ Z;  3CCQ 1;  3GTJ I;  2V8K A;  2OOY B;  3J81 f;  2JA7 I;  2B63 I;  2NVQ I;  3CCM Z;  3VTN A;  3HOY I;  1KD1 1;  2E2J I;  2VUM I;  4A3J I;  3FQQ A;  4S1T A;  1FDO A;  1YJW 1;  3GTM I;  3GTK I;  1N2F A;  2OZK A;  2QRC B;  4CL1 A;  3K7A I;  4RS4 A;  2F4O A;  2QEX 1;  1RO4 A;  5C44 I;  4NB9 A;  1LQL A;  1QVF Z;  1QYP A;  3HOZ I;  1TWA I;  3J81 b;  1KD1 2;  1W2B Y;  2JA8 I;  4BY7 I;  1NP6 A;  3MZK B;  1ZH1 A;  3NDI A;  2VF1 A;  3I55 1;  4EWC A;  4A3E I;  1VLA A;  3TE5 B;  1Q81 2;  2GU2 A;  1WCM I;  3J80 b;  2JIQ A;  5CM2 M;  4NBG A;  2M6N A;  4RVG A;  2H85 A;  1WZN A;  2IV2 X;  2P3Y A;  3CME 1;  1YHQ 1;  3G4S Z;  1QF8 A;  1FDI A;  5A2Q b;  1S72 1;  4A3C I;  1X3W A;  2RHB A;  2O53 A;  3I56 1;  4MD7 A;  4A3K I;  4NB8 A;  3VMH A;  4NBB A;  2OOX B;  3HKZ A;  4A3F I;  1VQ5 1;  2OTJ 1;  1VQ6 Z;  2ZAE B;  3M4O I;  4MRI A;  5FLX b;  3GTL I;  2HU9 A;  1M90 1;  3GTM S;  1WJ2 A;  1Z01 A;  1YUA A;  3CCS Z;  2NAP A;  1VQK 1;  2R6M A;  2P28 A;  1VQL Z;  3S2D I;  1Z03 A;  2RPR A;  1YUK A;  2GTH A;  3G4S 1;  4BXX I;  3CCE Z;  2K5R A;  3MON A;  4NBH A;  2AKL A;  1S72 Z;  4Y52 I;  3S17 I;  3FKI I;  1K9M 2;  3CCU 1;  2J6A A;  5FLX f;  1JWH C;  3CCR Z;  4RV9 A;  3HOV I;  3CMA 1;  3MZL B;  3CCV Z;  5IT9 b;  1N8R 2;  1DL6 A;  2V3V A;  2W03 A;  2KI7 B;  2AYD A;  1RO2 A;  3CD6 1;  3CCV 1;  4Y7N I;  3IFU A;  2PM9 A;  2QRD B;  2JNY A;  3D6W A;  4A3G I;  5D1P A;  3CQZ I;  3CCU Z;  3KIH A;  4E32 A;  2GTI A;  1KRL A;  2F4M A;  2JA6 I;  1Y8C A;  3GTQ I;  3EER A;  1RO0 A;  3GCF A;  2E7Z A;  3CXC Y;  3CCQ Z;  3CCM 1;  4QTU A;  1Q16 A;  1YJW Z;  2E2I I;  1ZB8 A;  2JIR A;  1S7M A;  3H0G I;  1TWH I;  1R9T I;  3CPW Z;  1KC8 2;  2K3R A;  5T64 A;  1K9M 1;  1Y1V I;  3CC7 1;  2V8J A;  3JAM b;  4A3I I;  2E2H I;  2I3C A;  3IR7 A;  1YJ9 Z;  1M1K 1;  1VQ9 Z;  2YU9 I;  1X0T A;  2KPI A;  1K8A 2;  1YIJ 1;  4TNU A;  1VQ9 1;  2Y0S A;  1QVG Y;  4HGZ A;  2LFU A;  4A3D I;  3BG0 B;  3TDH B;  5C4J I;  1TFI A;  1YI2 1;  1AA6 A;  1Q81 1;  4HH4 A;  1YJ9 1;  4NOZ A;  3H3V J;  3CXC Z;  3OW2 Z;  2QRE B;  2JA5 I;  1TWG I;  2OTJ Z;  2QA4 Z;  4RVH A;  1USP A;  3GTO I;  1VQO Z;  2R7Z I;  3F3P C;  3NH4 A;  1NJI 1;  2W04 A;  1Y1W I;  3I4M I;  1VQ5 Z;  4E30 A;  1M1K 2;  1X3Z A;  3I4N I;  1Q86 2;  3S1Q I;  2DE6 A;  4BBS I;  1SIW A;  1VQP 1;  3CC4 1;  2WAQ A;  2YAD A;  1QVG Z;  1K83 I;  5T67 A;  4AYB A;  3S1R I;  4XX2 A;  4DGL A;  3S1N I;  4NH1 C;  4MXU A;  5FLM I;  3I55 Z;  2WB1 A;  1RQF A;  1QXF A;  4MD8 A;  1K73 2;  1TWC I;  2PMZ A;  2JIO A;  5C3E I;  2JIP A;  3CMA Z;  3NH5 A;  2VPZ A;  2NVX I;  4E2Z A;  3CCJ 1;  1VQN 1;  3CCJ Z;  2RT9 A;  3NFZ A;  3PO3 S;  4MD9 A;  3CCE 1;  3CCL 1;  3CC4 Z;  3OW2 Y;  2O4H A;  5IP7 I;  3IF8 A;  2NVT I;  1YIT 1;  1NUI A;  2LIY A;  4E2W A;  1VQM 1;  1VQ7 Z;  2VPW A;  1KC8 1;  3VB9 A;  3VMG A;  1VQP Z;  3P5J B;  4E33 A;  3T4N B;  2QKD A;  3CCS 1;  1VQO 1;  3NH8 A;  2JUB A;  4E31 A;  1VQ4 1;  1WW9 A;  3I07 A;  1ZB9 A;  1I6H I;  2QR1 B;  1Q86 1;  3HOU I;  3FQM A;  3ESW A;  3S1M I;  2Q4Z A;  2QLV B;  4NBF A;  5AN9 F;  3CC2 Z;  2PK7 A;  1VQK Z;  3PO3 I;  1PFT A;  3CC2 1;  3HOX I;  2JMO A;  2JR6 A;  4DK1 A;  3GTG I;  2VPX A;  3U50 C;  4A3B I;  1YI2 Z;  3J80 f;  3CPW Y;  1RNI A;  5IT9 f;  4DQY B;  2R92 I;  2LEX A;  4HGY A;  1VQ4 Z;  1W2B Z;  3HOW I;  1USP B;  2IZ3 A;  2OTL 1;  3BG1 B;  2G2K A;  3JAM f;  1K8A 1;  2DE7 A;  2HF1 A;  3RZO I;  3VMI A;  1VQM Z;  1JJ2 Y;  1VQ7 1;  1KQS Z;  1Z02 A;  2NVY I;  2Q51 A;  3LUS A;  1VQ8 1;  2R93 I;  3KIF A;  3NDJ A;  2JIM A;  3CCL Z;  3G71 Z;  3D9X A;  1YIT Z;  1SFO I;  2QEX Z;  1M90 2;  3F3F C;  1N8R 1;  3CD6 Z;  3S2H I;  2M48 A;  5LL6 f;  3G71 1;  2V45 A;  1L1O C;  3EED A;  1VQN Z;  3J7A 4;  3S15 I;  5D1O A;  1TWF I;  3M3Y I;  4BBR I;  2DE5 A;  2EGT A;  3PO2 I; 
#chains in the Genus database with same CATH homology
 1K73 1;  2V8I A;  3S16 I;  1Q82 2;  2BJO A;  2QA4 1;  4RVD A;  4NBA A;  1VQ8 Z;  3Q87 A;  1Q82 1;  3IX0 A;  2RBL A;  5C4X I;  4NBD A;  3CCR 1;  4E2Y A;  1VQL 1;  4A93 I;  4A3L I;  1RLY A;  3QWU A;  4E2X A;  2JS4 A;  5A2Q f;  4A3M I;  3G6E Z;  1JJ2 Z;  1Y1V S;  1QVF Y;  3GTP I;  5IP9 I;  3G6E 1;  1Q7Y 2;  4NBE A;  1NJI 2;  5T6B A;  2OTL Z;  1YJN Z;  1ML8 A;  1P9N A;  4NFR A;  4NBC A;  4X6A I;  1YJN 1;  1KQS Y;  3RZD I;  1I50 I;  2VUG A;  4RVF A;  4MON A;  1I3Q I;  3S14 I;  2RIQ A;  3GKQ A;  4MH4 A;  1YHQ Z;  3CC7 Z;  2IZ4 A;  5D1O B;  4QTT A;  4BY1 I;  1WII A;  3I56 Z;  1Q7Y 1;  2E9H A;  1VQ6 1;  3CME Z;  1YIJ Z;  3CCQ 1;  3GTJ I;  2V8K A;  2OOY B;  3J81 f;  2JA7 I;  2B63 I;  2NVQ I;  3CCM Z;  3VTN A;  3HOY I;  1KD1 1;  2E2J I;  2VUM I;  4A3J I;  3FQQ A;  4S1T A;  1YJW 1;  3GTM I;  3GTK I;  1N2F A;  2OZK A;  2QRC B;  4CL1 A;  3K7A I;  4RS4 A;  2F4O A;  2QEX 1;  1RO4 A;  5C44 I;  4NB9 A;  1LQL A;  1QVF Z;  1QYP A;  3HOZ I;  1TWA I;  3J81 b;  1KD1 2;  1W2B Y;  2JA8 I;  4BY7 I;  1NP6 A;  3MZK B;  1ZH1 A;  3NDI A;  2VF1 A;  3I55 1;  4EWC A;  4A3E I;  1VLA A;  3TE5 B;  1Q81 2;  2GU2 A;  1WCM I;  3J80 b;  5CM2 M;  4NBG A;  2M6N A;  4RVG A;  2H85 A;  2P3Y A;  3CME 1;  1YHQ 1;  3G4S Z;  1QF8 A;  5A2Q b;  1S72 1;  4A3C I;  1X3W A;  2RHB A;  2O53 A;  3I56 1;  4MD7 A;  4A3K I;  4NB8 A;  3VMH A;  4NBB A;  2OOX B;  3HKZ A;  4A3F I;  1VQ5 1;  2OTJ 1;  1VQ6 Z;  2ZAE B;  3M4O I;  4MRI A;  5FLX b;  3GTL I;  2HU9 A;  1M90 1;  3GTM S;  1Z01 A;  1YUA A;  3CCS Z;  1VQK 1;  2R6M A;  2P28 A;  1VQL Z;  3S2D I;  1Z03 A;  2RPR A;  1YUK A;  2GTH A;  3G4S 1;  4BXX I;  3CCE Z;  2K5R A;  3MON A;  4NBH A;  2AKL A;  1S72 Z;  4Y52 I;  3S17 I;  3FKI I;  1K9M 2;  3CCU 1;  2J6A A;  5FLX f;  1JWH C;  3CCR Z;  4RV9 A;  3HOV I;  3CMA 1;  3MZL B;  3CCV Z;  5IT9 b;  1N8R 2;  1DL6 A;  2W03 A;  2KI7 B;  1RO2 A;  3CD6 1;  3CCV 1;  4Y7N I;  3IFU A;  2PM9 A;  2QRD B;  2JNY A;  3D6W A;  4A3G I;  5D1P A;  3CQZ I;  3CCU Z;  3KIH A;  4E32 A;  2GTI A;  1KRL A;  2F4M A;  2JA6 I;  3GTQ I;  3EER A;  1RO0 A;  3GCF A;  1YJW Z;  3CXC Y;  3CCM 1;  3CCQ Z;  4QTU A;  2E2I I;  1ZB8 A;  1S7M A;  3H0G I;  1TWH I;  1R9T I;  3CPW Z;  1KC8 2;  2K3R A;  5T64 A;  1K9M 1;  1Y1V I;  3CC7 1;  2V8J A;  3JAM b;  4A3I I;  2E2H I;  2I3C A;  1YJ9 Z;  1M1K 1;  1VQ9 Z;  2YU9 I;  1X0T A;  2KPI A;  1K8A 2;  1YIJ 1;  4TNU A;  1VQ9 1;  2Y0S A;  1QVG Y;  4HGZ A;  2LFU A;  4A3D I;  3BG0 B;  3TDH B;  5C4J I;  1TFI A;  1YI2 1;  1Q81 1;  4HH4 A;  1YJ9 1;  4NOZ A;  3H3V J;  3CXC Z;  3OW2 Z;  2QRE B;  2JA5 I;  1TWG I;  2OTJ Z;  2QA4 Z;  4RVH A;  1USP A;  3GTO I;  1VQO Z;  2R7Z I;  3F3P C;  3NH4 A;  1NJI 1;  2W04 A;  1Y1W I;  3I4M I;  1VQ5 Z;  4E30 A;  1M1K 2;  1X3Z A;  3I4N I;  1Q86 2;  3S1Q I;  2DE6 A;  4BBS I;  1VQP 1;  3CC4 1;  2WAQ A;  2YAD A;  1QVG Z;  1K83 I;  5T67 A;  4AYB A;  3S1R I;  4XX2 A;  4DGL A;  3S1N I;  4NH1 C;  4MXU A;  5FLM I;  3I55 Z;  2WB1 A;  1RQF A;  4MD8 A;  1K73 2;  1TWC I;  2PMZ A;  5C3E I;  3CMA Z;  3NH5 A;  2NVX I;  4E2Z A;  3CCJ 1;  1VQN 1;  3CCJ Z;  2RT9 A;  3NFZ A;  3PO3 S;  4MD9 A;  3CCE 1;  3CCL 1;  3CC4 Z;  3OW2 Y;  2O4H A;  5IP7 I;  3IF8 A;  2NVT I;  1YIT 1;  1NUI A;  2LIY A;  4E2W A;  1VQM 1;  1VQ7 Z;  1KC8 1;  3VB9 A;  3VMG A;  1VQP Z;  3P5J B;  4E33 A;  3T4N B;  2QKD A;  3CCS 1;  1VQO 1;  3NH8 A;  2JUB A;  4E31 A;  1VQ4 1;  1WW9 A;  3I07 A;  1ZB9 A;  1I6H I;  2QR1 B;  1Q86 1;  3HOU I;  3FQM A;  3ESW A;  3S1M I;  2Q4Z A;  2QLV B;  4NBF A;  5AN9 F;  3CC2 Z;  2PK7 A;  1VQK Z;  3PO3 I;  1PFT A;  3CC2 1;  3HOX I;  2JMO A;  2JR6 A;  4DK1 A;  3GTG I;  4A3B I;  3U50 C;  1YI2 Z;  3J80 f;  3CPW Y;  1RNI A;  5IT9 f;  4DQY B;  2R92 I;  4HGY A;  1VQ4 Z;  1W2B Z;  3HOW I;  1USP B;  2IZ3 A;  2OTL 1;  3BG1 B;  2G2K A;  3JAM f;  1K8A 1;  2DE7 A;  2HF1 A;  3RZO I;  3VMI A;  1VQM Z;  1JJ2 Y;  1VQ7 1;  1KQS Z;  1Z02 A;  2NVY I;  2Q51 A;  3LUS A;  1VQ8 1;  2R93 I;  3KIF A;  3NDJ A;  3CCL Z;  3G71 Z;  3D9X A;  1YIT Z;  1SFO I;  2QEX Z;  1M90 2;  3F3F C;  1N8R 1;  3CD6 Z;  3S2H I;  2M48 A;  5LL6 f;  3G71 1;  1L1O C;  3EED A;  1VQN Z;  3J7A 4;  3S15 I;  5D1O A;  1TWF I;  3M3Y I;  4BBR I;  2DE5 A;  2EGT A;  3PO2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...