3PO3I

Arrested rna polymerase ii reactivation intermediate
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3I02
3PO3S 1TFIA 4NBHA 4QTUA 5C3EI 3PO2I 1DL6A 3S1MI 1RO4A 3D6WA 3GCFA 3S1RI 2YU9I 1ML8A 4Y52I 4NBFA 3GTKI 1PFTA 3GTJI 4A93I 2JR6A 2JA5I 3HOUI 1ZB9A 2P3YA 3LUSA 4NBBA 4NOZA 3FKII 5C4JI 1TWHI 1I3QI 4A3MI 1USPA 3H0GI 2DE7A 3U50C 3HOXI 1I6HI 2VUMI 1ZB8A 4BBRI 3RZDI 4NBGA 4QTTA 3S2HI 1WCMI 1NUIA 3S15I 4BBSI 3VMHA 2PK7A 4NBCA 2R92I 4A3LI 5C4XI 4NB9A 2R93I 1YUAA 3GTMS 3H3VJ 1N2FA 3M3YI 4NBEA 2NVTI 2F4OA 4Y7NI 1TWAI 3I4NI 3HOVI 1Y1VI 2RBLA 3VMIA 1USPB 3VMGA 5FLMI 3I07A 1TWFI 2NVYI 3PO3I 4A3EI 4NBAA 4A3II 1I50I 3GTGI 4XX2A 3S14I 4A3GI 1TWCI 3M4OI 2HF1A 2DE6A 4A3DI 3RZOI 3GTQI 3HOZI 3I4MI 4BXXI 2E2II 2JA6I 3S1NI 3CQZI 1L1OC 5IP9I 1K83I 3K7AI 4A3KI 3S16I 4A3JI 4NB8A 3VB9A 3GTLI 3GTMI 2F4MA 3HOYI 1WW9A 3HOWI 1QYPA 1RLYA 1X3WA 2NVQI 5IP7I 3S2DI 2KPIA 3Q87A 1TWGI 4A3CI 1LQLA 2JA8I 3GTPI 4A3BI 2R7ZI 3GTOI 2BJOA 4MH4A 2NVXI 2E2JI 3S1QI 4NBDA 4BY7I 1X3ZA 3GKQA 1VLAA 4BY1I 3ESWA 4A3FI 2JA7I 4X6AI 3EERA 2K5RA 1SFOI 2E2HI 1R9TI 5CM2M 2B63I 2AKLA 1Y1VS 2JNYA 2JS4A 2J6AA 3S17I 2DE5A 1Y1WI 5C44I
chains in the Genus database with same CATH superfamily
1VQKZ 3CCQZ 1RO2A 1DL6A 3TDHB 3D6WA 3GCFA 3CCS1 1ML8A 2JMOA 4Y52I 4NBFA 2QLVB 1ZB9A 2P3YA 3I561 2JIMA 4NOZA 2RIQA 1K9M2 2DE7A 1K732 3U50C 4E31A 1YJW1 1ZB8A 3MZKB 3D2LA 1M1K1 1SIWA 1K8A2 4NBGA 4QTTA 3S2HI 1M902 4BBSI 3VMHA 1RO0A 1RQFA 1YUAA 3GTMS 3M3YI 1N2FA 3G711 2F4OA 5LL6f 5FLXf 2E9HA 1TWAI 1VQ5Z 2V45A 2RBLA 3KIFA 3I07A 1TWFI 3IFUA 1S72Z 3PO3I 1QXFA 2O53A 1K731 3S14I 2RHBA 3CCEZ 1K8A1 4E30A 1M901 1VQ71 1JWHC 5D1OB 2LIYA 1KD12 2LFUA 2VUGA 3NDIA 3I4MI 3CCRZ 2QRCB 1YJWZ 2E2II 3VTNA 3I551 4CL1A 3CXCZ 3K7AI 4A3KI 4A3JI 2F4MA 3HOYI 4RVDA 1YJ9Z 2GU2A 1YJNZ 2W04A 3D9XA 2JIPA 2V8JA 3G71Z 1VQOZ 1RLYA 1QVGY 1LQLA 2JA8I 3GTPI 1VQM1 4NFRA 1KD11 2E2JI 4BY7I 3OW2Y 3NFZA 3GKQA 2JA7I 3CCJZ 3CC21 1QVGZ 1VQ7Z 1VQ81 4X6AI 2K5RA 2OTJZ 4E2ZA 3CCV1 1N8R2 2OZKA 1Q862 1S7MA 5C44I 5C3EI 3PO2I 1RO4A 5D1OA 3J81b 4A93I 3CPWY 1Q812 2JA5I 3LUSA 3CC71 3P5JB 2O4HA 3FKII 5C4JI 1TWHI 1Q7Y1 3H0GI 2V8KA 3CCM1 4BBRI 1X0TA 1WCMI 3QWUA 3KIHA 3CPWZ 4NBCA 1Q861 1VQNZ 4A3LI 3CCL1 5C4XI 1VQ8Z 4NBEA 2NVTI 5A2Qf 2G2KA 1Y1VI 1Q811 1USPB 2Y0SA 2YADA 4EWCA 3CD61 2M6NA 2I3CA 2QA41 1VQ9Z 4A3EI 1YI2Z 2QEXZ 1I50I 3G4SZ 2K3RA 2H85A 4XX2A 1VQLZ 2HF1A 3IF8A 4DK1A 4RVHA 3CC7Z 2DE6A 4A3DI 4MD9A 2VPZA 2GTIA 3CMA1 2W03A 4BXXI 1YIT1 3FQQA 3CQZI 3J81f 1VQ41 1L1OC 3F3PC 4DQYB 1K83I 3S16I 2E7ZA 4NB8A 3VB9A 3GTLI 3GTMI 3NH5A 1VQ61 3TE5B 4TNUA 2OTL1 3CCSZ 1X3WA 2NVQI 5IP7I 3HKZA 3NH8A 3CXCY 4A3CI 1KQSY 3I56Z 4S1TA 2LEXA 2AYDA 2NVXI 5IT9b 3NH4A 4RVFA 1KQSZ 1FDIA 2R6MA 3EERA 1NJI2 1YIJ1 2QREB 4HH4A 2E2HI 1WJ2A 2Q51A 1NP6A 2JS4A 3CME1 1WZNA 1Y1WI 1TFIA 2VPWA 3CC41 2PMZA 3S1RI 1KRLA 2JR6A 3HOUI 2EGTA 4NBBA 1P9NA 1I3QI 4A3MI 1Q7Y2 1NJI1 3G6E1 3RZDI 3I55Z 5D1PA 1Q16A 2PK7A 2R92I 2JIQA 2R93I 3H3VJ 2P28A 1ZH1A 2IZ3A 5IT9f 2JIRA 4Y7NI 3I4NI 1YIJZ 3HOVI 3VMIA 3BG1B 5FLMI 4E2WA 2NVYI 4RV9A 1VQK1 3CCQ1 5T64A 1VQMZ 1Z03A 1TWCI 4MRIA 2PM9A 3M4OI 2HU9A 3CC2Z 4DGLA 3RZOI 3GTQI 2JA6I 5IP9I 3CCVZ 2M48A 1WW9A 3T4NB 1QYPA 3CCU1 1VQ51 2WAQA 4RVGA 3S2DI 2KPIA 1TWGI 4AYBA 1S721 4A3BI 4E2YA 2GTHA 2R7ZI 3GTOI 2BJOA 1RNIA 1YHQ1 3S1QI 3CCE1 3CCMZ 1X3ZA 4E32A 1Z02A 1W2BY 4A3FI 3IR7A 3CCLZ 3NDJA 3CCR1 2KI7B 3F3FC 5AN9F 2JNYA 2IZ4A 1KC81 2JUBA 2OOYB 2IV2X 1W2BZ 1YJ91 3CD6Z 1QVFY 2QA4Z 1YJN1 3PO3S 4NBHA 4QTUA 1VQO1 3S1MI 3CCUZ 2VPXA 2YU9I 3GTKI 1WIIA 1PFTA 3GTJI 4MD8A 1VQP1 1Q822 1K9M1 1AA6A 2QKDA 3CMAZ 1USPA 2VF1A 3J7A4 1QVFZ 3HOXI 1I6HI 1YHQZ 2VUMI 4NH1C 1YITZ 5T67A 1VQ4Z 3CCJ1 1NUIA 3S15I 2WB1A 4NB9A 1Z01A 2OTJ1 1VQ6Z 3FQMA 2OTLZ 2V8IA 1YUKA 3J80b 1Q821 2NAPA 3VMGA 2V3VA 5T6BA 4NBAA 4A3II 3GTGI 2VPYA 4A3GI 1VQPZ 3JAMb 4E2XA 3IX0A 5A2Qb 3HOZI 2Q4ZA 3S1NI 1FDOA 1VQN1 1QF8A 3CMEZ 3HOWI 4RS4A 1JJ2Y 3CC4Z 2QRDB 3OW2Z 3Q87A 4MD7A 1Y8CA 1VQ91 2RPRA 1YI21 2QEX1 3G4S1 4MH4A 3EEDA 5FLXb 3MONA 4NBDA 3BG0B 4E33A 1JJ2Z 1VQL1 2OOXB 2QR1B 3G6EZ 1VLAA 4MONA 2RT9A 3ESWA 3J80f 4BY1I 2JIOA 4HGZA 4MXUA 1M1K2 1SFOI 2ZAEB 1R9TI 5CM2M 1N8R1 2B63I 2AKLA 1Y1VS 3MZLB 1KC82 3JAMf 2J6AA 3S17I 2DE5A 4HGYA
chains in the Genus database with same CATH topology
1VQKZ 3CCQZ 1RO2A 1DL6A 3TDHB 3D6WA 3GCFA 3CCS1 1ML8A 2JMOA 4Y52I 4NBFA 2QLVB 1ZB9A 2P3YA 3I561 4NOZA 2RIQA 1K9M2 2DE7A 1K732 3U50C 4E31A 1YJW1 1ZB8A 3MZKB 1M1K1 1K8A2 4NBGA 4QTTA 3S2HI 1M902 4BBSI 3VMHA 1RO0A 1RQFA 1YUAA 3GTMS 3M3YI 1N2FA 3G711 2F4OA 5LL6f 5FLXf 2E9HA 1TWAI 1VQ5Z 2RBLA 3KIFA 3I07A 1TWFI 3IFUA 1S72Z 3PO3I 2O53A 1K731 3S14I 2RHBA 3CCEZ 1K8A1 4E30A 1M901 1VQ71 1JWHC 5D1OB 2LIYA 1KD12 2LFUA 2VUGA 3NDIA 3I4MI 3CCRZ 2QRCB 1YJWZ 2E2II 3VTNA 3I551 4CL1A 3CXCZ 3K7AI 4A3KI 4A3JI 2F4MA 3HOYI 4RVDA 1YJ9Z 2GU2A 1YJNZ 2W04A 3D9XA 3G71Z 2V8JA 1VQOZ 1RLYA 1QVGY 1LQLA 2JA8I 3GTPI 1VQM1 4NFRA 1KD11 2E2JI 4BY7I 3OW2Y 3NFZA 3GKQA 2JA7I 3CCJZ 3CC21 1QVGZ 1VQ7Z 1VQ81 4X6AI 2K5RA 2OTJZ 4E2ZA 3CCV1 1N8R2 2OZKA 1Q862 1S7MA 5C44I 5C3EI 3PO2I 1RO4A 5D1OA 3J81b 4A93I 3CPWY 1Q812 2JA5I 3LUSA 3CC71 3P5JB 2O4HA 3FKII 5C4JI 1TWHI 1Q7Y1 3H0GI 2V8KA 3CCM1 4BBRI 1X0TA 1WCMI 3QWUA 3KIHA 3CPWZ 4NBCA 1Q861 1VQNZ 4A3LI 3CCL1 5C4XI 1VQ8Z 4NBEA 2NVTI 5A2Qf 2G2KA 1Y1VI 1Q811 1USPB 2Y0SA 2YADA 4EWCA 3CD61 2M6NA 2I3CA 2QA41 1VQ9Z 4A3EI 1YI2Z 2QEXZ 1I50I 3G4SZ 2K3RA 2H85A 4XX2A 1VQLZ 2HF1A 3IF8A 4DK1A 4RVHA 3CC7Z 2DE6A 4A3DI 4MD9A 2GTIA 3CMA1 2W03A 4BXXI 1YIT1 3FQQA 3CQZI 3J81f 1VQ41 1L1OC 3F3PC 4DQYB 1K83I 3S16I 4NB8A 3VB9A 3GTLI 3GTMI 3NH5A 1VQ61 3TE5B 4TNUA 2OTL1 3CCSZ 1X3WA 2NVQI 5IP7I 3HKZA 3NH8A 3CXCY 4A3CI 1KQSY 3I56Z 4S1TA 2NVXI 5IT9b 3NH4A 4RVFA 1KQSZ 2R6MA 3EERA 1NJI2 1YIJ1 2QREB 4HH4A 2E2HI 2Q51A 1NP6A 2JS4A 3CME1 1Y1WI 1TFIA 3CC41 2PMZA 3S1RI 1KRLA 2JR6A 3HOUI 2EGTA 4NBBA 1P9NA 1I3QI 4A3MI 1Q7Y2 1NJI1 3G6E1 3RZDI 3I55Z 5D1PA 2PK7A 2R92I 2R93I 3H3VJ 2P28A 1ZH1A 2IZ3A 5IT9f 4Y7NI 3I4NI 1YIJZ 3HOVI 3VMIA 3BG1B 5FLMI 4E2WA 2NVYI 4RV9A 1VQK1 3CCQ1 5T64A 1VQMZ 1Z03A 1TWCI 4MRIA 2PM9A 3M4OI 2HU9A 3CC2Z 4DGLA 3RZOI 3GTQI 2JA6I 5IP9I 3CCVZ 2M48A 1WW9A 3T4NB 1QYPA 3CCU1 1VQ51 2WAQA 4RVGA 3S2DI 2KPIA 1TWGI 4AYBA 1S721 4A3BI 4E2YA 2GTHA 2R7ZI 3GTOI 2BJOA 1RNIA 1YHQ1 3S1QI 3CCE1 3CCMZ 1X3ZA 4E32A 1Z02A 1W2BY 4A3FI 3CCLZ 3NDJA 3CCR1 2KI7B 3F3FC 5AN9F 2JNYA 2IZ4A 1KC81 2JUBA 2OOYB 1W2BZ 1YJ91 3CD6Z 1QVFY 2QA4Z 1YJN1 3PO3S 4NBHA 4QTUA 1VQO1 3S1MI 3CCUZ 2YU9I 3GTKI 1WIIA 1PFTA 3GTJI 4MD8A 1VQP1 1Q822 1K9M1 2QKDA 3CMAZ 1USPA 2VF1A 3J7A4 1QVFZ 3HOXI 1I6HI 1YHQZ 2VUMI 4NH1C 1YITZ 5T67A 1VQ4Z 3CCJ1 1NUIA 3S15I 2WB1A 4NB9A 1Z01A 2OTJ1 1VQ6Z 3FQMA 2OTLZ 2V8IA 1YUKA 3J80b 1Q821 3VMGA 5T6BA 4NBAA 4A3II 3GTGI 4A3GI 1VQPZ 3JAMb 4E2XA 3IX0A 5A2Qb 3HOZI 2Q4ZA 3S1NI 1VQN1 1QF8A 3CMEZ 3HOWI 4RS4A 1JJ2Y 3CC4Z 2QRDB 3OW2Z 3Q87A 4MD7A 1VQ91 2RPRA 1YI21 2QEX1 3G4S1 4MH4A 3EEDA 5FLXb 3MONA 4NBDA 3BG0B 4E33A 1JJ2Z 1VQL1 2OOXB 2QR1B 3G6EZ 1VLAA 4MONA 2RT9A 3ESWA 3J80f 4BY1I 4HGZA 4MXUA 1M1K2 1SFOI 2ZAEB 1R9TI 5CM2M 1N8R1 2B63I 2AKLA 1Y1VS 3MZLB 1KC82 3JAMf 2J6AA 3S17I 2DE5A 4HGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO3 S;  1TFI A;  4NBH A;  4QTU A;  5C3E I;  3PO2 I;  1DL6 A;  3S1M I;  1RO4 A;  3D6W A;  3GCF A;  3S1R I;  2YU9 I;  1ML8 A;  4Y52 I;  4NBF A;  3GTK I;  1PFT A;  3GTJ I;  4A93 I;  2JR6 A;  2JA5 I;  3HOU I;  1ZB9 A;  2P3Y A;  3LUS A;  4NBB A;  4NOZ A;  3FKI I;  5C4J I;  1TWH I;  1I3Q I;  4A3M I;  1USP A;  3H0G I;  2DE7 A;  3U50 C;  3HOX I;  1I6H I;  2VUM I;  1ZB8 A;  4BBR I;  3RZD I;  4NBG A;  4QTT A;  3S2H I;  1WCM I;  1NUI A;  3S15 I;  4BBS I;  3VMH A;  2PK7 A;  4NBC A;  2R92 I;  4A3L I;  5C4X I;  4NB9 A;  2R93 I;  1YUA A;  3GTM S;  3H3V J;  1N2F A;  3M3Y I;  4NBE A;  2NVT I;  2F4O A;  4Y7N I;  1TWA I;  3I4N I;  3HOV I;  1Y1V I;  2RBL A;  3VMI A;  1USP B;  3VMG A;  5FLM I;  3I07 A;  1TWF I;  2NVY I;  3PO3 I;  4A3E I;  4NBA A;  4A3I I;  1I50 I;  3GTG I;  4XX2 A;  3S14 I;  4A3G I;  1TWC I;  3M4O I;  2HF1 A;  2DE6 A;  4A3D I;  3RZO I;  3GTQ I;  3HOZ I;  3I4M I;  4BXX I;  2E2I I;  2JA6 I;  3S1N I;  3CQZ I;  1L1O C;  5IP9 I;  1K83 I;  3K7A I;  4A3K I;  3S16 I;  4A3J I;  4NB8 A;  3VB9 A;  3GTL I;  3GTM I;  2F4M A;  3HOY I;  1WW9 A;  3HOW I;  1QYP A;  1RLY A;  1X3W A;  2NVQ I;  5IP7 I;  3S2D I;  2KPI A;  3Q87 A;  1TWG I;  4A3C I;  1LQL A;  2JA8 I;  3GTP I;  4A3B I;  2R7Z I;  3GTO I;  2BJO A;  4MH4 A;  2NVX I;  2E2J I;  3S1Q I;  4NBD A;  4BY7 I;  1X3Z A;  3GKQ A;  1VLA A;  4BY1 I;  3ESW A;  4A3F I;  2JA7 I;  4X6A I;  3EER A;  2K5R A;  1SFO I;  2E2H I;  1R9T I;  5CM2 M;  2B63 I;  2AKL A;  1Y1V S;  2JNY A;  2JS4 A;  2J6A A;  3S17 I;  2DE5 A;  1Y1W I;  5C44 I; 
#chains in the Genus database with same CATH topology
 1VQK Z;  3CCQ Z;  1RO2 A;  1DL6 A;  3TDH B;  3D6W A;  3GCF A;  3CCS 1;  1ML8 A;  2JMO A;  4Y52 I;  4NBF A;  2QLV B;  1ZB9 A;  2P3Y A;  3I56 1;  2JIM A;  4NOZ A;  2RIQ A;  1K9M 2;  2DE7 A;  1K73 2;  3U50 C;  4E31 A;  1YJW 1;  1ZB8 A;  3MZK B;  3D2L A;  1M1K 1;  1SIW A;  1K8A 2;  4NBG A;  4QTT A;  3S2H I;  1M90 2;  4BBS I;  3VMH A;  1RO0 A;  1RQF A;  1YUA A;  3GTM S;  3M3Y I;  1N2F A;  3G71 1;  2F4O A;  5LL6 f;  5FLX f;  2E9H A;  1TWA I;  1VQ5 Z;  2V45 A;  2RBL A;  3KIF A;  3I07 A;  1TWF I;  3IFU A;  1S72 Z;  3PO3 I;  1QXF A;  2O53 A;  1K73 1;  3S14 I;  2RHB A;  3CCE Z;  1K8A 1;  4E30 A;  1M90 1;  1VQ7 1;  1JWH C;  5D1O B;  2LIY A;  1KD1 2;  2LFU A;  2VUG A;  3NDI A;  3I4M I;  3CCR Z;  2QRC B;  1YJW Z;  2E2I I;  3VTN A;  3I55 1;  4CL1 A;  3CXC Z;  3K7A I;  4A3K I;  4A3J I;  2F4M A;  3HOY I;  4RVD A;  1YJ9 Z;  2GU2 A;  1YJN Z;  2W04 A;  3D9X A;  2JIP A;  2V8J A;  3G71 Z;  1VQO Z;  1RLY A;  1QVG Y;  1LQL A;  2JA8 I;  3GTP I;  1VQM 1;  4NFR A;  1KD1 1;  2E2J I;  4BY7 I;  3OW2 Y;  3NFZ A;  3GKQ A;  2JA7 I;  3CCJ Z;  3CC2 1;  1QVG Z;  1VQ7 Z;  1VQ8 1;  4X6A I;  2K5R A;  2OTJ Z;  4E2Z A;  3CCV 1;  1N8R 2;  2OZK A;  1Q86 2;  1S7M A;  5C44 I;  5C3E I;  3PO2 I;  1RO4 A;  5D1O A;  3J81 b;  4A93 I;  3CPW Y;  1Q81 2;  2JA5 I;  3LUS A;  3CC7 1;  3P5J B;  2O4H A;  3FKI I;  5C4J I;  1TWH I;  1Q7Y 1;  3H0G I;  2V8K A;  3CCM 1;  4BBR I;  1X0T A;  1WCM I;  3QWU A;  3KIH A;  3CPW Z;  4NBC A;  1Q86 1;  1VQN Z;  4A3L I;  3CCL 1;  5C4X I;  1VQ8 Z;  4NBE A;  2NVT I;  5A2Q f;  2G2K A;  1Y1V I;  1Q81 1;  1USP B;  2Y0S A;  2YAD A;  4EWC A;  3CD6 1;  2M6N A;  2I3C A;  2QA4 1;  1VQ9 Z;  4A3E I;  1YI2 Z;  2QEX Z;  1I50 I;  3G4S Z;  2K3R A;  2H85 A;  4XX2 A;  1VQL Z;  2HF1 A;  3IF8 A;  4DK1 A;  4RVH A;  3CC7 Z;  2DE6 A;  4A3D I;  4MD9 A;  2VPZ A;  2GTI A;  3CMA 1;  2W03 A;  4BXX I;  1YIT 1;  3FQQ A;  3CQZ I;  3J81 f;  1VQ4 1;  1L1O C;  3F3P C;  4DQY B;  1K83 I;  3S16 I;  2E7Z A;  4NB8 A;  3VB9 A;  3GTL I;  3GTM I;  3NH5 A;  1VQ6 1;  3TE5 B;  4TNU A;  2OTL 1;  3CCS Z;  1X3W A;  2NVQ I;  5IP7 I;  3HKZ A;  3NH8 A;  3CXC Y;  4A3C I;  1KQS Y;  3I56 Z;  4S1T A;  2LEX A;  2AYD A;  2NVX I;  5IT9 b;  3NH4 A;  4RVF A;  1KQS Z;  1FDI A;  2R6M A;  3EER A;  1NJI 2;  1YIJ 1;  2QRE B;  4HH4 A;  2E2H I;  1WJ2 A;  2Q51 A;  1NP6 A;  2JS4 A;  3CME 1;  1WZN A;  1Y1W I;  1TFI A;  2VPW A;  3CC4 1;  2PMZ A;  3S1R I;  1KRL A;  2JR6 A;  3HOU I;  2EGT A;  4NBB A;  1P9N A;  1I3Q I;  4A3M I;  1Q7Y 2;  1NJI 1;  3G6E 1;  3RZD I;  3I55 Z;  5D1P A;  1Q16 A;  2PK7 A;  2R92 I;  2JIQ A;  2R93 I;  3H3V J;  2P28 A;  1ZH1 A;  2IZ3 A;  5IT9 f;  2JIR A;  4Y7N I;  3I4N I;  1YIJ Z;  3HOV I;  3VMI A;  3BG1 B;  5FLM I;  4E2W A;  2NVY I;  4RV9 A;  1VQK 1;  3CCQ 1;  5T64 A;  1VQM Z;  1Z03 A;  1TWC I;  4MRI A;  2PM9 A;  3M4O I;  2HU9 A;  3CC2 Z;  4DGL A;  3RZO I;  3GTQ I;  2JA6 I;  5IP9 I;  3CCV Z;  2M48 A;  1WW9 A;  3T4N B;  1QYP A;  3CCU 1;  1VQ5 1;  2WAQ A;  4RVG A;  3S2D I;  2KPI A;  1TWG I;  4AYB A;  1S72 1;  4A3B I;  4E2Y A;  2GTH A;  2R7Z I;  3GTO I;  2BJO A;  1RNI A;  1YHQ 1;  3S1Q I;  3CCE 1;  3CCM Z;  1X3Z A;  4E32 A;  1Z02 A;  1W2B Y;  4A3F I;  3IR7 A;  3CCL Z;  3NDJ A;  3CCR 1;  2KI7 B;  3F3F C;  5AN9 F;  2JNY A;  2IZ4 A;  1KC8 1;  2JUB A;  2OOY B;  2IV2 X;  1W2B Z;  1YJ9 1;  3CD6 Z;  1QVF Y;  2QA4 Z;  1YJN 1;  3PO3 S;  4NBH A;  4QTU A;  1VQO 1;  3S1M I;  3CCU Z;  2VPX A;  2YU9 I;  3GTK I;  1WII A;  1PFT A;  3GTJ I;  4MD8 A;  1VQP 1;  1Q82 2;  1K9M 1;  1AA6 A;  2QKD A;  3CMA Z;  1USP A;  2VF1 A;  3J7A 4;  1QVF Z;  3HOX I;  1I6H I;  1YHQ Z;  2VUM I;  4NH1 C;  1YIT Z;  5T67 A;  1VQ4 Z;  3CCJ 1;  1NUI A;  3S15 I;  2WB1 A;  4NB9 A;  1Z01 A;  2OTJ 1;  1VQ6 Z;  3FQM A;  2OTL Z;  2V8I A;  1YUK A;  3J80 b;  1Q82 1;  2NAP A;  3VMG A;  2V3V A;  5T6B A;  4NBA A;  4A3I I;  3GTG I;  2VPY A;  4A3G I;  1VQP Z;  3JAM b;  4E2X A;  3IX0 A;  5A2Q b;  3HOZ I;  2Q4Z A;  3S1N I;  1FDO A;  1VQN 1;  1QF8 A;  3CME Z;  3HOW I;  4RS4 A;  1JJ2 Y;  3CC4 Z;  2QRD B;  3OW2 Z;  3Q87 A;  4MD7 A;  1Y8C A;  1VQ9 1;  2RPR A;  1YI2 1;  2QEX 1;  3G4S 1;  4MH4 A;  3EED A;  5FLX b;  3MON A;  4NBD A;  3BG0 B;  4E33 A;  1JJ2 Z;  1VQL 1;  2OOX B;  2QR1 B;  3G6E Z;  1VLA A;  4MON A;  2RT9 A;  3ESW A;  3J80 f;  4BY1 I;  2JIO A;  4HGZ A;  4MXU A;  1M1K 2;  1SFO I;  2ZAE B;  1R9T I;  5CM2 M;  1N8R 1;  2B63 I;  2AKL A;  1Y1V S;  3MZL B;  1KC8 2;  3JAM f;  2J6A A;  3S17 I;  2DE5 A;  4HGY A; 
#chains in the Genus database with same CATH homology
 1VQK Z;  3CCQ Z;  1RO2 A;  1DL6 A;  3TDH B;  3D6W A;  3GCF A;  3CCS 1;  1ML8 A;  2JMO A;  4Y52 I;  4NBF A;  2QLV B;  1ZB9 A;  2P3Y A;  3I56 1;  4NOZ A;  2RIQ A;  1K9M 2;  2DE7 A;  1K73 2;  3U50 C;  4E31 A;  1YJW 1;  1ZB8 A;  3MZK B;  1M1K 1;  1K8A 2;  4NBG A;  4QTT A;  3S2H I;  1M90 2;  4BBS I;  3VMH A;  1RO0 A;  1RQF A;  1YUA A;  3GTM S;  3M3Y I;  1N2F A;  3G71 1;  2F4O A;  5LL6 f;  5FLX f;  2E9H A;  1TWA I;  1VQ5 Z;  2RBL A;  3KIF A;  3I07 A;  1TWF I;  3IFU A;  1S72 Z;  3PO3 I;  2O53 A;  1K73 1;  3S14 I;  2RHB A;  3CCE Z;  1K8A 1;  4E30 A;  1M90 1;  1VQ7 1;  1JWH C;  5D1O B;  2LIY A;  1KD1 2;  2LFU A;  2VUG A;  3NDI A;  3I4M I;  3CCR Z;  2QRC B;  1YJW Z;  2E2I I;  3VTN A;  3I55 1;  4CL1 A;  3CXC Z;  3K7A I;  4A3K I;  4A3J I;  2F4M A;  3HOY I;  4RVD A;  1YJ9 Z;  2GU2 A;  1YJN Z;  2W04 A;  3D9X A;  3G71 Z;  2V8J A;  1VQO Z;  1RLY A;  1QVG Y;  1LQL A;  2JA8 I;  3GTP I;  1VQM 1;  4NFR A;  1KD1 1;  2E2J I;  4BY7 I;  3OW2 Y;  3NFZ A;  3GKQ A;  2JA7 I;  3CCJ Z;  3CC2 1;  1QVG Z;  1VQ7 Z;  1VQ8 1;  4X6A I;  2K5R A;  2OTJ Z;  4E2Z A;  3CCV 1;  1N8R 2;  2OZK A;  1Q86 2;  1S7M A;  5C44 I;  5C3E I;  3PO2 I;  1RO4 A;  5D1O A;  3J81 b;  4A93 I;  3CPW Y;  1Q81 2;  2JA5 I;  3LUS A;  3CC7 1;  3P5J B;  2O4H A;  3FKI I;  5C4J I;  1TWH I;  1Q7Y 1;  3H0G I;  2V8K A;  3CCM 1;  4BBR I;  1X0T A;  1WCM I;  3QWU A;  3KIH A;  3CPW Z;  4NBC A;  1Q86 1;  1VQN Z;  4A3L I;  3CCL 1;  5C4X I;  1VQ8 Z;  4NBE A;  2NVT I;  5A2Q f;  2G2K A;  1Y1V I;  1Q81 1;  1USP B;  2Y0S A;  2YAD A;  4EWC A;  3CD6 1;  2M6N A;  2I3C A;  2QA4 1;  1VQ9 Z;  4A3E I;  1YI2 Z;  2QEX Z;  1I50 I;  3G4S Z;  2K3R A;  2H85 A;  4XX2 A;  1VQL Z;  2HF1 A;  3IF8 A;  4DK1 A;  4RVH A;  3CC7 Z;  2DE6 A;  4A3D I;  4MD9 A;  2GTI A;  3CMA 1;  2W03 A;  4BXX I;  1YIT 1;  3FQQ A;  3CQZ I;  3J81 f;  1VQ4 1;  1L1O C;  3F3P C;  4DQY B;  1K83 I;  3S16 I;  4NB8 A;  3VB9 A;  3GTL I;  3GTM I;  3NH5 A;  1VQ6 1;  3TE5 B;  4TNU A;  2OTL 1;  3CCS Z;  1X3W A;  2NVQ I;  5IP7 I;  3HKZ A;  3NH8 A;  3CXC Y;  4A3C I;  1KQS Y;  3I56 Z;  4S1T A;  2NVX I;  5IT9 b;  3NH4 A;  4RVF A;  1KQS Z;  2R6M A;  3EER A;  1NJI 2;  1YIJ 1;  2QRE B;  4HH4 A;  2E2H I;  2Q51 A;  1NP6 A;  2JS4 A;  3CME 1;  1Y1W I;  1TFI A;  3CC4 1;  2PMZ A;  3S1R I;  1KRL A;  2JR6 A;  3HOU I;  2EGT A;  4NBB A;  1P9N A;  1I3Q I;  4A3M I;  1Q7Y 2;  1NJI 1;  3G6E 1;  3RZD I;  3I55 Z;  5D1P A;  2PK7 A;  2R92 I;  2R93 I;  3H3V J;  2P28 A;  1ZH1 A;  2IZ3 A;  5IT9 f;  4Y7N I;  3I4N I;  1YIJ Z;  3HOV I;  3VMI A;  3BG1 B;  5FLM I;  4E2W A;  2NVY I;  4RV9 A;  1VQK 1;  3CCQ 1;  5T64 A;  1VQM Z;  1Z03 A;  1TWC I;  4MRI A;  2PM9 A;  3M4O I;  2HU9 A;  3CC2 Z;  4DGL A;  3RZO I;  3GTQ I;  2JA6 I;  5IP9 I;  3CCV Z;  2M48 A;  1WW9 A;  3T4N B;  1QYP A;  3CCU 1;  1VQ5 1;  2WAQ A;  4RVG A;  3S2D I;  2KPI A;  1TWG I;  4AYB A;  1S72 1;  4A3B I;  4E2Y A;  2GTH A;  2R7Z I;  3GTO I;  2BJO A;  1RNI A;  1YHQ 1;  3S1Q I;  3CCE 1;  3CCM Z;  1X3Z A;  4E32 A;  1Z02 A;  1W2B Y;  4A3F I;  3CCL Z;  3NDJ A;  3CCR 1;  2KI7 B;  3F3F C;  5AN9 F;  2JNY A;  2IZ4 A;  1KC8 1;  2JUB A;  2OOY B;  1W2B Z;  1YJ9 1;  3CD6 Z;  1QVF Y;  2QA4 Z;  1YJN 1;  3PO3 S;  4NBH A;  4QTU A;  1VQO 1;  3S1M I;  3CCU Z;  2YU9 I;  3GTK I;  1WII A;  1PFT A;  3GTJ I;  4MD8 A;  1VQP 1;  1Q82 2;  1K9M 1;  2QKD A;  3CMA Z;  1USP A;  2VF1 A;  3J7A 4;  1QVF Z;  3HOX I;  1I6H I;  1YHQ Z;  2VUM I;  4NH1 C;  1YIT Z;  5T67 A;  1VQ4 Z;  3CCJ 1;  1NUI A;  3S15 I;  2WB1 A;  4NB9 A;  1Z01 A;  2OTJ 1;  1VQ6 Z;  3FQM A;  2OTL Z;  2V8I A;  1YUK A;  3J80 b;  1Q82 1;  3VMG A;  5T6B A;  4NBA A;  4A3I I;  3GTG I;  4A3G I;  1VQP Z;  3JAM b;  4E2X A;  3IX0 A;  5A2Q b;  3HOZ I;  2Q4Z A;  3S1N I;  1VQN 1;  1QF8 A;  3CME Z;  3HOW I;  4RS4 A;  1JJ2 Y;  3CC4 Z;  2QRD B;  3OW2 Z;  3Q87 A;  4MD7 A;  1VQ9 1;  2RPR A;  1YI2 1;  2QEX 1;  3G4S 1;  4MH4 A;  3EED A;  5FLX b;  3MON A;  4NBD A;  3BG0 B;  4E33 A;  1JJ2 Z;  1VQL 1;  2OOX B;  2QR1 B;  3G6E Z;  1VLA A;  4MON A;  2RT9 A;  3ESW A;  3J80 f;  4BY1 I;  4HGZ A;  4MXU A;  1M1K 2;  1SFO I;  2ZAE B;  1R9T I;  5CM2 M;  1N8R 1;  2B63 I;  2AKL A;  1Y1V S;  3MZL B;  1KC8 2;  3JAM f;  2J6A A;  3S17 I;  2DE5 A;  4HGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...