3PO3I

Arrested rna polymerase ii reactivation intermediate
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3I02
1Y1WI 1ZB9A 5C4JI 2R92I 2JA6I 3VMHA 2P3YA 5CM2M 3K7AI 4Y52I 4BY1I 2JA5I 3S15I 1DL6A 3ESWA 2DE7A 1WCMI 3GCFA 4A3LI 3RZOI 1TWCI 1K83I 3GTKI 1ZB8A 4A3II 3S1MI 2YU9I 4A3JI 3S1RI 4NOZA 4X6AI 3S1QI 2VUMI 3S2HI 4QTTA 4A3FI 3RZDI 2JS4A 3M3YI 1RO4A 3LUSA 4NB8A 4QTUA 3GTMS 2KPIA 3HOYI 1QYPA 2PK7A 2DE5A 3H0GI 3PO3S 4BBSI 1I3QI 3S17I 3M4OI 4BY7I 4Y7NI 2R93I 1N2FA 4NBHA 1YUAA 1WW9A 3D6WA 4A3MI 1TWFI 4A3KI 4A3GI 2F4MA 2R7ZI 4BXXI 5C4XI 5IP7I 4A3DI 4A3CI 2F4OA 3HOWI 1ML8A 3PO2I 1NUIA 1PFTA 1Y1VS 3GTMI 3S1NI 4NBBA 4NBCA 1TFIA 5C3EI 3GTLI 3FKII 4XX2A 3HOXI 4A3EI 5IP9I 3PO3I 4A93I 2HF1A 5FLMI 3U50C 3GTJI 2NVTI 2NVQI 3GTOI 2JA8I 1LQLA 1X3ZA 3GTQI 3HOUI 3CQZI 3VMGA 2JR6A 1SFOI 3H3VJ 4BBRI 2BJOA 2NVXI 2B63I 2JNYA 1RLYA 1TWAI 3S14I 1R9TI 3GTPI 1I50I 2E2HI 1L1OC 1USPB 3Q87A 4A3BI 4NB9A 3VMIA 1Y1VI 2J6AA 1TWHI 1I6HI 4NBAA 3I07A 3HOZI 2JA7I 4NBDA 1VLAA 2K5RA 3S2DI 3I4NI 3VB9A 3GTGI 4NBFA 4NBEA 3EERA 3GKQA 3HOVI 4MH4A 1TWGI 4NBGA 1X3WA 5C44I 3S16I 2E2II 2NVYI 3I4MI 2RBLA 2DE6A 2E2JI 1USPA 2AKLA
chains in the Genus database with same CATH superfamily
2PMZA 1ZB9A 3CCSZ 3CPWY 1S7MA 3I56Z 3VMHA 3BG1B 3K7AI 3CCS1 3S15I 4RVFA 3I561 3RZOI 4S1TA 3MZLB 1YIJZ 3GTKI 1P9NA 3CPWZ 5A2Qf 1YIJ1 3MZKB 1X0TA 1M902 4E2WA 3S1QI 3J7A4 3RZDI 1Q812 1K8A1 1RNIA 2JS4A 3M3YI 3LUSA 4NB8A 4DK1A 3GTMS 1VQ6Z 3FQQA 1QYPA 2E7ZA 2M6NA 2JMOA 1K8A2 4BBSI 1WJ2A 1VQ61 1Y8CA 1Q16A 1S72Z 4BY7I 1VQMZ 3HKZA 2R93I 2VPYA 2IZ3A 4RV9A 3QWUA 4A3MI 1TWFI 1S721 4BXXI 5T64A 1VQ9Z 1VQM1 2JIMA 4EWCA 1RO0A 1W2BZ 1Q811 5T6BA 1VQ91 4XX2A 4A3EI 5IP9I 3U50C 2NVTI 3GTOI 2JA8I 3HOUI 4E2ZA 3VMGA 2JR6A 3H3VJ 2Y0SA 1VQNZ 1KD11 1I50I 2P28A 1VQN1 3IF8A 3NH5A 4A3BI 1FDOA 2O53A 3VMIA 1Y1VI 2OZKA 2V45A 4MD7A 2YADA 3CCUZ 3FQMA 1KQSY 1N8R2 2K5RA 2RT9A 3VB9A 3GTGI 3CCLZ 3CCU1 4MH4A 3CMAZ 4NBGA 2Q51A 5C44I 3CCL1 1KQSZ 2V8IA 2RBLA 3CMA1 1USPA 1Y1WI 2R92I 2K3RA 3J80b 2QKDA 3J81f 5CM2M 1FDIA 1DL6A 2QRCB 1M1K1 2DE7A 3GCFA 1N8R1 3CC2Z 4CL1A 3S1MI 4MXUA 3CCMZ 3CC21 2H85A 1RO4A 2GTIA 4QTUA 3CCM1 5A2Qb 2DE5A 3PO3S 2OOYB 2R6MA 4MRIA 4E2XA 1Q822 4E32A 1I3QI 2M48A 1VQ8Z 1Z01A 3CCJZ 1YITZ 5D1OB 4Y7NI 2V8KA 1N2FA 1VQ81 2OTLZ 3CCJ1 1YIT1 4A3GI 2R7ZI 1AA6A 5T67A 2WAQA 1ML8A 3TE5B 2OTL1 1NUIA 2ZAEB 1YI2Z 1Q862 3MONA 2OTJZ 3GTLI 2KI7B 2HF1A 3GTQI 2RIQA 1YI21 1Q821 2GU2A 2OTJ1 3P5JB 1YJNZ 4BBRI 2LFUA 5D1PA 2BJOA 1W2BY 3G6EZ 1VQ5Z 1KC82 2JNYA 1KD12 1YJN1 1R9TI 3NH4A 3G6E1 1VQ51 3Q87A 4E30A 3OW2Z 2RPRA 1I6HI 1Q861 3I07A 4NBDA 3NFZA 1RQFA 4NBFA 1QXFA 3GKQA 3HOVI 1TWGI 1KC81 2W04A 4AYBA 1VQ4Z 2E2II 2NVYI 3I4MI 2DE6A 3CCQZ 2AKLA 3NH8A 1VQ41 1NJI2 1QVGZ 2JA6I 1Z03A 2JIPA 5AN9F 3CCQ1 1M1K2 4E2YA 2HU9A 4RS4A 1TWCI 2RHBA 3J81b 2G2KA 2VUGA 3TDHB 2O4HA 2GTHA 2QRDB 4X6AI 2VUMI 3S2HI 4QTTA 4A3FI 3HOYI 3F3PC 1NJI1 2VPWA 2E9HA 3F3FC 1VQKZ 2Q4ZA 3NDIA 1YUKA 2V8JA 3S17I 2QR1B 5D1OA 4E31A 3M4OI 4HGZA 3CD6Z 1VQK1 2NAPA 1YUAA 3D6WA 4A3KI 3JAMf 5C4XI 3CD61 4A3DI 4A3CI 2LIYA 2QLVB 2F4OA 1YHQZ 3NDJA 1Y1VS 1QVFY 3CCRZ 3GTMI 3S1NI 4NBCA 1TFIA 1K9M1 3T4NB 2JIQA 3FKII 4A93I 2JIRA 1X3ZA 3CCR1 1SFOI 4TNUA 2IZ4A 1QVFZ 1RLYA 1TWAI 3S14I 2OOXB 3CC4Z 3CXCZ 1USPB 1JJ2Y 1WIIA 4NB9A 1SIWA 3CC41 3VTNA 1TWHI 1JWHC 2JIOA 5LL6f 4HH4A 3BG0B 5FLXf 1JJ2Z 3I4NI 3EERA 3CC7Z 3OW2Y 3S16I 1YJ9Z 3CC71 4NFRA 2E2JI 3IX0A 5IT9b 5C4JI 1YJ91 2JUBA 2QREB 1QF8A 1ZH1A 2P3YA 3D9XA 4Y52I 4BY1I 2JA5I 3ESWA 1VQLZ 1NP6A 1K732 1WCMI 4A3LI 3G71Z 3CCEZ 1K83I 5IT9f 1ZB8A 3I55Z 3IR7A 4A3II 1Q7Y2 1QVGY 1VQL1 2YU9I 4A3JI 3G711 3CCE1 3S1RI 4NOZA 3I551 4DQYB 4DGLA 1M901 1KRLA 3D2LA 2KPIA 4NH1C 2PK7A 3H0GI 1VQ7Z 2PM9A 1K731 1VQ71 1Z02A 4NBHA 1WW9A 1Q7Y1 2F4MA 5IP7I 2AYDA 4HGYA 3HOWI 3PO2I 1PFTA 4NBBA 4RVDA 1K9M2 2I3CA 3JAMb 5C3EI 3CMEZ 2QEXZ 3PO3I 2VF1A 3HOXI 2VPZA 2NVQI 5FLMI 3GTJI 2QA4Z 1LQLA 3CQZI 3KIFA 2LEXA 1VQOZ 3CME1 2QEX1 2NVXI 2B63I 2QA41 1VQO1 2W03A 3GTPI 2E2HI 2IV2X 1L1OC 4MD8A 3CCVZ 2VPXA 2J6AA 4RVHA 3IFUA 4E33A 4NBAA 1YJWZ 4RVGA 1YHQ1 3KIHA 3CCV1 3HOZI 3CXCY 2JA7I 1VLAA 3S2DI 1WZNA 4NBEA 1RO2A 1YJW1 3G4SZ 2EGTA 2WB1A 4MD9A 3J80f 1VQPZ 1X3WA 3EEDA 4MONA 5FLXb 3G4S1 1VQP1 2V3VA
chains in the Genus database with same CATH topology
2PMZA 1ZB9A 3CCSZ 3CPWY 1S7MA 3I56Z 3VMHA 3BG1B 3K7AI 3CCS1 3S15I 4RVFA 3I561 3RZOI 4S1TA 3MZLB 1YIJZ 3GTKI 1P9NA 3CPWZ 5A2Qf 1YIJ1 3MZKB 1X0TA 1M902 4E2WA 3S1QI 3J7A4 3RZDI 1Q812 1K8A1 1RNIA 2JS4A 3M3YI 3LUSA 4NB8A 4DK1A 3GTMS 1VQ6Z 3FQQA 1QYPA 2M6NA 2JMOA 1K8A2 4BBSI 1VQ61 1S72Z 4BY7I 1VQMZ 3HKZA 2R93I 2IZ3A 4RV9A 3QWUA 4A3MI 1TWFI 1S721 4BXXI 5T64A 1VQ9Z 1VQM1 4EWCA 1RO0A 1W2BZ 1Q811 5T6BA 1VQ91 4XX2A 4A3EI 5IP9I 3U50C 2NVTI 3GTOI 2JA8I 3HOUI 4E2ZA 3VMGA 2JR6A 3H3VJ 2Y0SA 1VQNZ 1KD11 1I50I 2P28A 1VQN1 3IF8A 3NH5A 4A3BI 2O53A 3VMIA 1Y1VI 2OZKA 4MD7A 2YADA 3CCUZ 3FQMA 1KQSY 1N8R2 2K5RA 2RT9A 3VB9A 3GTGI 3CCLZ 3CCU1 4MH4A 3CMAZ 4NBGA 2Q51A 5C44I 3CCL1 1KQSZ 2V8IA 2RBLA 3CMA1 1USPA 1Y1WI 2R92I 2K3RA 3J80b 2QKDA 3J81f 5CM2M 1DL6A 2QRCB 1M1K1 2DE7A 3GCFA 1N8R1 3CC2Z 4CL1A 3S1MI 4MXUA 3CCMZ 3CC21 2H85A 1RO4A 2GTIA 4QTUA 3CCM1 5A2Qb 2DE5A 3PO3S 2OOYB 2R6MA 4MRIA 4E2XA 1Q822 4E32A 1I3QI 2M48A 1VQ8Z 1Z01A 3CCJZ 1YITZ 5D1OB 4Y7NI 2V8KA 1N2FA 1VQ81 2OTLZ 3CCJ1 1YIT1 4A3GI 2R7ZI 5T67A 2WAQA 1ML8A 3TE5B 2OTL1 1NUIA 2ZAEB 1YI2Z 1Q862 3MONA 2OTJZ 3GTLI 2KI7B 2HF1A 3GTQI 2RIQA 1YI21 1Q821 2GU2A 2OTJ1 3P5JB 1YJNZ 4BBRI 2LFUA 5D1PA 2BJOA 1W2BY 3G6EZ 1VQ5Z 1KC82 2JNYA 1KD12 1YJN1 1R9TI 3NH4A 3G6E1 1VQ51 3Q87A 4E30A 3OW2Z 2RPRA 1I6HI 1Q861 3I07A 4NBDA 3NFZA 1RQFA 4NBFA 3GKQA 3HOVI 1TWGI 1KC81 2W04A 4AYBA 1VQ4Z 2E2II 2NVYI 3I4MI 2DE6A 3CCQZ 2AKLA 3NH8A 1VQ41 1NJI2 1QVGZ 2JA6I 1Z03A 5AN9F 3CCQ1 1M1K2 4E2YA 2HU9A 4RS4A 1TWCI 2RHBA 3J81b 2G2KA 2VUGA 3TDHB 2O4HA 2GTHA 2QRDB 4X6AI 2VUMI 3S2HI 4QTTA 4A3FI 3HOYI 3F3PC 1NJI1 2E9HA 3F3FC 1VQKZ 2Q4ZA 3NDIA 1YUKA 2V8JA 3S17I 2QR1B 5D1OA 4E31A 3M4OI 4HGZA 3CD6Z 1VQK1 1YUAA 3D6WA 4A3KI 3JAMf 5C4XI 3CD61 4A3DI 4A3CI 2LIYA 2QLVB 2F4OA 1YHQZ 3NDJA 1Y1VS 1QVFY 3CCRZ 3GTMI 3S1NI 4NBCA 1TFIA 1K9M1 3T4NB 3FKII 4A93I 1X3ZA 3CCR1 1SFOI 4TNUA 2IZ4A 1QVFZ 1RLYA 1TWAI 3S14I 2OOXB 3CC4Z 3CXCZ 1USPB 1JJ2Y 1WIIA 4NB9A 3CC41 3VTNA 1TWHI 1JWHC 5LL6f 4HH4A 3BG0B 5FLXf 1JJ2Z 3I4NI 3EERA 3CC7Z 3OW2Y 3S16I 1YJ9Z 3CC71 4NFRA 2E2JI 3IX0A 5IT9b 5C4JI 1YJ91 2JUBA 2QREB 1QF8A 1ZH1A 2P3YA 3D9XA 4Y52I 4BY1I 2JA5I 3ESWA 1VQLZ 1NP6A 1K732 1WCMI 4A3LI 3G71Z 3CCEZ 1K83I 5IT9f 1ZB8A 3I55Z 4A3II 1Q7Y2 1QVGY 1VQL1 2YU9I 4A3JI 3G711 3CCE1 3S1RI 4NOZA 3I551 4DQYB 4DGLA 1M901 1KRLA 2KPIA 4NH1C 2PK7A 3H0GI 1VQ7Z 2PM9A 1K731 1VQ71 1Z02A 4NBHA 1WW9A 1Q7Y1 2F4MA 5IP7I 4HGYA 3HOWI 3PO2I 1PFTA 4NBBA 4RVDA 1K9M2 2I3CA 3JAMb 5C3EI 3CMEZ 2QEXZ 3PO3I 2VF1A 3HOXI 2NVQI 5FLMI 3GTJI 2QA4Z 1LQLA 3CQZI 3KIFA 1VQOZ 3CME1 2QEX1 2NVXI 2B63I 2QA41 1VQO1 2W03A 3GTPI 2E2HI 1L1OC 4MD8A 3CCVZ 2J6AA 4RVHA 3IFUA 4E33A 4NBAA 1YJWZ 4RVGA 1YHQ1 3KIHA 3CCV1 3HOZI 3CXCY 2JA7I 1VLAA 3S2DI 4NBEA 1RO2A 1YJW1 3G4SZ 2EGTA 2WB1A 4MD9A 3J80f 1VQPZ 1X3WA 3EEDA 4MONA 5FLXb 3G4S1 1VQP1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1W I;  1ZB9 A;  5C4J I;  2R92 I;  2JA6 I;  3VMH A;  2P3Y A;  5CM2 M;  3K7A I;  4Y52 I;  4BY1 I;  2JA5 I;  3S15 I;  1DL6 A;  3ESW A;  2DE7 A;  1WCM I;  3GCF A;  4A3L I;  3RZO I;  1TWC I;  1K83 I;  3GTK I;  1ZB8 A;  4A3I I;  3S1M I;  2YU9 I;  4A3J I;  3S1R I;  4NOZ A;  4X6A I;  3S1Q I;  2VUM I;  3S2H I;  4QTT A;  4A3F I;  3RZD I;  2JS4 A;  3M3Y I;  1RO4 A;  3LUS A;  4NB8 A;  4QTU A;  3GTM S;  2KPI A;  3HOY I;  1QYP A;  2PK7 A;  2DE5 A;  3H0G I;  3PO3 S;  4BBS I;  1I3Q I;  3S17 I;  3M4O I;  4BY7 I;  4Y7N I;  2R93 I;  1N2F A;  4NBH A;  1YUA A;  1WW9 A;  3D6W A;  4A3M I;  1TWF I;  4A3K I;  4A3G I;  2F4M A;  2R7Z I;  4BXX I;  5C4X I;  5IP7 I;  4A3D I;  4A3C I;  2F4O A;  3HOW I;  1ML8 A;  3PO2 I;  1NUI A;  1PFT A;  1Y1V S;  3GTM I;  3S1N I;  4NBB A;  4NBC A;  1TFI A;  5C3E I;  3GTL I;  3FKI I;  4XX2 A;  3HOX I;  4A3E I;  5IP9 I;  3PO3 I;  4A93 I;  2HF1 A;  5FLM I;  3U50 C;  3GTJ I;  2NVT I;  2NVQ I;  3GTO I;  2JA8 I;  1LQL A;  1X3Z A;  3GTQ I;  3HOU I;  3CQZ I;  3VMG A;  2JR6 A;  1SFO I;  3H3V J;  4BBR I;  2BJO A;  2NVX I;  2B63 I;  2JNY A;  1RLY A;  1TWA I;  3S14 I;  1R9T I;  3GTP I;  1I50 I;  2E2H I;  1L1O C;  1USP B;  3Q87 A;  4A3B I;  4NB9 A;  3VMI A;  1Y1V I;  2J6A A;  1TWH I;  1I6H I;  4NBA A;  3I07 A;  3HOZ I;  2JA7 I;  4NBD A;  1VLA A;  2K5R A;  3S2D I;  3I4N I;  3VB9 A;  3GTG I;  4NBF A;  4NBE A;  3EER A;  3GKQ A;  3HOV I;  4MH4 A;  1TWG I;  4NBG A;  1X3W A;  5C44 I;  3S16 I;  2E2I I;  2NVY I;  3I4M I;  2RBL A;  2DE6 A;  2E2J I;  1USP A;  2AKL A; 
#chains in the Genus database with same CATH topology
 2PMZ A;  1ZB9 A;  3CCS Z;  3CPW Y;  1S7M A;  3I56 Z;  3VMH A;  3BG1 B;  3K7A I;  3CCS 1;  3S15 I;  4RVF A;  3I56 1;  3RZO I;  4S1T A;  3MZL B;  1YIJ Z;  3GTK I;  1P9N A;  3CPW Z;  5A2Q f;  1YIJ 1;  3MZK B;  1X0T A;  1M90 2;  4E2W A;  3S1Q I;  3J7A 4;  3RZD I;  1Q81 2;  1K8A 1;  1RNI A;  2JS4 A;  3M3Y I;  3LUS A;  4NB8 A;  4DK1 A;  3GTM S;  1VQ6 Z;  3FQQ A;  1QYP A;  2E7Z A;  2M6N A;  2JMO A;  1K8A 2;  4BBS I;  1WJ2 A;  1VQ6 1;  1Y8C A;  1Q16 A;  1S72 Z;  4BY7 I;  1VQM Z;  3HKZ A;  2R93 I;  2VPY A;  2IZ3 A;  4RV9 A;  3QWU A;  4A3M I;  1TWF I;  1S72 1;  4BXX I;  5T64 A;  1VQ9 Z;  1VQM 1;  2JIM A;  4EWC A;  1RO0 A;  1W2B Z;  1Q81 1;  5T6B A;  1VQ9 1;  4XX2 A;  4A3E I;  5IP9 I;  3U50 C;  2NVT I;  3GTO I;  2JA8 I;  3HOU I;  4E2Z A;  3VMG A;  2JR6 A;  3H3V J;  2Y0S A;  1VQN Z;  1KD1 1;  1I50 I;  2P28 A;  1VQN 1;  3IF8 A;  3NH5 A;  4A3B I;  1FDO A;  2O53 A;  3VMI A;  1Y1V I;  2OZK A;  2V45 A;  4MD7 A;  2YAD A;  3CCU Z;  3FQM A;  1KQS Y;  1N8R 2;  2K5R A;  2RT9 A;  3VB9 A;  3GTG I;  3CCL Z;  3CCU 1;  4MH4 A;  3CMA Z;  4NBG A;  2Q51 A;  5C44 I;  3CCL 1;  1KQS Z;  2V8I A;  2RBL A;  3CMA 1;  1USP A;  1Y1W I;  2R92 I;  2K3R A;  3J80 b;  2QKD A;  3J81 f;  5CM2 M;  1FDI A;  1DL6 A;  2QRC B;  1M1K 1;  2DE7 A;  3GCF A;  1N8R 1;  3CC2 Z;  4CL1 A;  3S1M I;  4MXU A;  3CCM Z;  3CC2 1;  2H85 A;  1RO4 A;  2GTI A;  4QTU A;  3CCM 1;  5A2Q b;  2DE5 A;  3PO3 S;  2OOY B;  2R6M A;  4MRI A;  4E2X A;  1Q82 2;  4E32 A;  1I3Q I;  2M48 A;  1VQ8 Z;  1Z01 A;  3CCJ Z;  1YIT Z;  5D1O B;  4Y7N I;  2V8K A;  1N2F A;  1VQ8 1;  2OTL Z;  3CCJ 1;  1YIT 1;  4A3G I;  2R7Z I;  1AA6 A;  5T67 A;  2WAQ A;  1ML8 A;  3TE5 B;  2OTL 1;  1NUI A;  2ZAE B;  1YI2 Z;  1Q86 2;  3MON A;  2OTJ Z;  3GTL I;  2KI7 B;  2HF1 A;  3GTQ I;  2RIQ A;  1YI2 1;  1Q82 1;  2GU2 A;  2OTJ 1;  3P5J B;  1YJN Z;  4BBR I;  2LFU A;  5D1P A;  2BJO A;  1W2B Y;  3G6E Z;  1VQ5 Z;  1KC8 2;  2JNY A;  1KD1 2;  1YJN 1;  1R9T I;  3NH4 A;  3G6E 1;  1VQ5 1;  3Q87 A;  4E30 A;  3OW2 Z;  2RPR A;  1I6H I;  1Q86 1;  3I07 A;  4NBD A;  3NFZ A;  1RQF A;  4NBF A;  1QXF A;  3GKQ A;  3HOV I;  1TWG I;  1KC8 1;  2W04 A;  4AYB A;  1VQ4 Z;  2E2I I;  2NVY I;  3I4M I;  2DE6 A;  3CCQ Z;  2AKL A;  3NH8 A;  1VQ4 1;  1NJI 2;  1QVG Z;  2JA6 I;  1Z03 A;  2JIP A;  5AN9 F;  3CCQ 1;  1M1K 2;  4E2Y A;  2HU9 A;  4RS4 A;  1TWC I;  2RHB A;  3J81 b;  2G2K A;  2VUG A;  3TDH B;  2O4H A;  2GTH A;  2QRD B;  4X6A I;  2VUM I;  3S2H I;  4QTT A;  4A3F I;  3HOY I;  3F3P C;  1NJI 1;  2VPW A;  2E9H A;  3F3F C;  1VQK Z;  2Q4Z A;  3NDI A;  1YUK A;  2V8J A;  3S17 I;  2QR1 B;  5D1O A;  4E31 A;  3M4O I;  4HGZ A;  3CD6 Z;  1VQK 1;  2NAP A;  1YUA A;  3D6W A;  4A3K I;  3JAM f;  5C4X I;  3CD6 1;  4A3D I;  4A3C I;  2LIY A;  2QLV B;  2F4O A;  1YHQ Z;  3NDJ A;  1Y1V S;  1QVF Y;  3CCR Z;  3GTM I;  3S1N I;  4NBC A;  1TFI A;  1K9M 1;  3T4N B;  2JIQ A;  3FKI I;  4A93 I;  2JIR A;  1X3Z A;  3CCR 1;  1SFO I;  4TNU A;  2IZ4 A;  1QVF Z;  1RLY A;  1TWA I;  3S14 I;  2OOX B;  3CC4 Z;  3CXC Z;  1USP B;  1JJ2 Y;  1WII A;  4NB9 A;  1SIW A;  3CC4 1;  3VTN A;  1TWH I;  1JWH C;  2JIO A;  5LL6 f;  4HH4 A;  3BG0 B;  5FLX f;  1JJ2 Z;  3I4N I;  3EER A;  3CC7 Z;  3OW2 Y;  3S16 I;  1YJ9 Z;  3CC7 1;  4NFR A;  2E2J I;  3IX0 A;  5IT9 b;  5C4J I;  1YJ9 1;  2JUB A;  2QRE B;  1QF8 A;  1ZH1 A;  2P3Y A;  3D9X A;  4Y52 I;  4BY1 I;  2JA5 I;  3ESW A;  1VQL Z;  1NP6 A;  1K73 2;  1WCM I;  4A3L I;  3G71 Z;  3CCE Z;  1K83 I;  5IT9 f;  1ZB8 A;  3I55 Z;  3IR7 A;  4A3I I;  1Q7Y 2;  1QVG Y;  1VQL 1;  2YU9 I;  4A3J I;  3G71 1;  3CCE 1;  3S1R I;  4NOZ A;  3I55 1;  4DQY B;  4DGL A;  1M90 1;  1KRL A;  3D2L A;  2KPI A;  4NH1 C;  2PK7 A;  3H0G I;  1VQ7 Z;  2PM9 A;  1K73 1;  1VQ7 1;  1Z02 A;  4NBH A;  1WW9 A;  1Q7Y 1;  2F4M A;  5IP7 I;  2AYD A;  4HGY A;  3HOW I;  3PO2 I;  1PFT A;  4NBB A;  4RVD A;  1K9M 2;  2I3C A;  3JAM b;  5C3E I;  3CME Z;  2QEX Z;  3PO3 I;  2VF1 A;  3HOX I;  2VPZ A;  2NVQ I;  5FLM I;  3GTJ I;  2QA4 Z;  1LQL A;  3CQZ I;  3KIF A;  2LEX A;  1VQO Z;  3CME 1;  2QEX 1;  2NVX I;  2B63 I;  2QA4 1;  1VQO 1;  2W03 A;  3GTP I;  2E2H I;  2IV2 X;  1L1O C;  4MD8 A;  3CCV Z;  2VPX A;  2J6A A;  4RVH A;  3IFU A;  4E33 A;  4NBA A;  1YJW Z;  4RVG A;  1YHQ 1;  3KIH A;  3CCV 1;  3HOZ I;  3CXC Y;  2JA7 I;  1VLA A;  3S2D I;  1WZN A;  4NBE A;  1RO2 A;  1YJW 1;  3G4S Z;  2EGT A;  2WB1 A;  4MD9 A;  3J80 f;  1VQP Z;  1X3W A;  3EED A;  4MON A;  5FLX b;  3G4S 1;  1VQP 1;  2V3V A; 
#chains in the Genus database with same CATH homology
 2PMZ A;  1ZB9 A;  3CCS Z;  3CPW Y;  1S7M A;  3I56 Z;  3VMH A;  3BG1 B;  3K7A I;  3CCS 1;  3S15 I;  4RVF A;  3I56 1;  3RZO I;  4S1T A;  3MZL B;  1YIJ Z;  3GTK I;  1P9N A;  3CPW Z;  5A2Q f;  1YIJ 1;  3MZK B;  1X0T A;  1M90 2;  4E2W A;  3S1Q I;  3J7A 4;  3RZD I;  1Q81 2;  1K8A 1;  1RNI A;  2JS4 A;  3M3Y I;  3LUS A;  4NB8 A;  4DK1 A;  3GTM S;  1VQ6 Z;  3FQQ A;  1QYP A;  2M6N A;  2JMO A;  1K8A 2;  4BBS I;  1VQ6 1;  1S72 Z;  4BY7 I;  1VQM Z;  3HKZ A;  2R93 I;  2IZ3 A;  4RV9 A;  3QWU A;  4A3M I;  1TWF I;  1S72 1;  4BXX I;  5T64 A;  1VQ9 Z;  1VQM 1;  4EWC A;  1RO0 A;  1W2B Z;  1Q81 1;  5T6B A;  1VQ9 1;  4XX2 A;  4A3E I;  5IP9 I;  3U50 C;  2NVT I;  3GTO I;  2JA8 I;  3HOU I;  4E2Z A;  3VMG A;  2JR6 A;  3H3V J;  2Y0S A;  1VQN Z;  1KD1 1;  1I50 I;  2P28 A;  1VQN 1;  3IF8 A;  3NH5 A;  4A3B I;  2O53 A;  3VMI A;  1Y1V I;  2OZK A;  4MD7 A;  2YAD A;  3CCU Z;  3FQM A;  1KQS Y;  1N8R 2;  2K5R A;  2RT9 A;  3VB9 A;  3GTG I;  3CCL Z;  3CCU 1;  4MH4 A;  3CMA Z;  4NBG A;  2Q51 A;  5C44 I;  3CCL 1;  1KQS Z;  2V8I A;  2RBL A;  3CMA 1;  1USP A;  1Y1W I;  2R92 I;  2K3R A;  3J80 b;  2QKD A;  3J81 f;  5CM2 M;  1DL6 A;  2QRC B;  1M1K 1;  2DE7 A;  3GCF A;  1N8R 1;  3CC2 Z;  4CL1 A;  3S1M I;  4MXU A;  3CCM Z;  3CC2 1;  2H85 A;  1RO4 A;  2GTI A;  4QTU A;  3CCM 1;  5A2Q b;  2DE5 A;  3PO3 S;  2OOY B;  2R6M A;  4MRI A;  4E2X A;  1Q82 2;  4E32 A;  1I3Q I;  2M48 A;  1VQ8 Z;  1Z01 A;  3CCJ Z;  1YIT Z;  5D1O B;  4Y7N I;  2V8K A;  1N2F A;  1VQ8 1;  2OTL Z;  3CCJ 1;  1YIT 1;  4A3G I;  2R7Z I;  5T67 A;  2WAQ A;  1ML8 A;  3TE5 B;  2OTL 1;  1NUI A;  2ZAE B;  1YI2 Z;  1Q86 2;  3MON A;  2OTJ Z;  3GTL I;  2KI7 B;  2HF1 A;  3GTQ I;  2RIQ A;  1YI2 1;  1Q82 1;  2GU2 A;  2OTJ 1;  3P5J B;  1YJN Z;  4BBR I;  2LFU A;  5D1P A;  2BJO A;  1W2B Y;  3G6E Z;  1VQ5 Z;  1KC8 2;  2JNY A;  1KD1 2;  1YJN 1;  1R9T I;  3NH4 A;  3G6E 1;  1VQ5 1;  3Q87 A;  4E30 A;  3OW2 Z;  2RPR A;  1I6H I;  1Q86 1;  3I07 A;  4NBD A;  3NFZ A;  1RQF A;  4NBF A;  3GKQ A;  3HOV I;  1TWG I;  1KC8 1;  2W04 A;  4AYB A;  1VQ4 Z;  2E2I I;  2NVY I;  3I4M I;  2DE6 A;  3CCQ Z;  2AKL A;  3NH8 A;  1VQ4 1;  1NJI 2;  1QVG Z;  2JA6 I;  1Z03 A;  5AN9 F;  3CCQ 1;  1M1K 2;  4E2Y A;  2HU9 A;  4RS4 A;  1TWC I;  2RHB A;  3J81 b;  2G2K A;  2VUG A;  3TDH B;  2O4H A;  2GTH A;  2QRD B;  4X6A I;  2VUM I;  3S2H I;  4QTT A;  4A3F I;  3HOY I;  3F3P C;  1NJI 1;  2E9H A;  3F3F C;  1VQK Z;  2Q4Z A;  3NDI A;  1YUK A;  2V8J A;  3S17 I;  2QR1 B;  5D1O A;  4E31 A;  3M4O I;  4HGZ A;  3CD6 Z;  1VQK 1;  1YUA A;  3D6W A;  4A3K I;  3JAM f;  5C4X I;  3CD6 1;  4A3D I;  4A3C I;  2LIY A;  2QLV B;  2F4O A;  1YHQ Z;  3NDJ A;  1Y1V S;  1QVF Y;  3CCR Z;  3GTM I;  3S1N I;  4NBC A;  1TFI A;  1K9M 1;  3T4N B;  3FKI I;  4A93 I;  1X3Z A;  3CCR 1;  1SFO I;  4TNU A;  2IZ4 A;  1QVF Z;  1RLY A;  1TWA I;  3S14 I;  2OOX B;  3CC4 Z;  3CXC Z;  1USP B;  1JJ2 Y;  1WII A;  4NB9 A;  3CC4 1;  3VTN A;  1TWH I;  1JWH C;  5LL6 f;  4HH4 A;  3BG0 B;  5FLX f;  1JJ2 Z;  3I4N I;  3EER A;  3CC7 Z;  3OW2 Y;  3S16 I;  1YJ9 Z;  3CC7 1;  4NFR A;  2E2J I;  3IX0 A;  5IT9 b;  5C4J I;  1YJ9 1;  2JUB A;  2QRE B;  1QF8 A;  1ZH1 A;  2P3Y A;  3D9X A;  4Y52 I;  4BY1 I;  2JA5 I;  3ESW A;  1VQL Z;  1NP6 A;  1K73 2;  1WCM I;  4A3L I;  3G71 Z;  3CCE Z;  1K83 I;  5IT9 f;  1ZB8 A;  3I55 Z;  4A3I I;  1Q7Y 2;  1QVG Y;  1VQL 1;  2YU9 I;  4A3J I;  3G71 1;  3CCE 1;  3S1R I;  4NOZ A;  3I55 1;  4DQY B;  4DGL A;  1M90 1;  1KRL A;  2KPI A;  4NH1 C;  2PK7 A;  3H0G I;  1VQ7 Z;  2PM9 A;  1K73 1;  1VQ7 1;  1Z02 A;  4NBH A;  1WW9 A;  1Q7Y 1;  2F4M A;  5IP7 I;  4HGY A;  3HOW I;  3PO2 I;  1PFT A;  4NBB A;  4RVD A;  1K9M 2;  2I3C A;  3JAM b;  5C3E I;  3CME Z;  2QEX Z;  3PO3 I;  2VF1 A;  3HOX I;  2NVQ I;  5FLM I;  3GTJ I;  2QA4 Z;  1LQL A;  3CQZ I;  3KIF A;  1VQO Z;  3CME 1;  2QEX 1;  2NVX I;  2B63 I;  2QA4 1;  1VQO 1;  2W03 A;  3GTP I;  2E2H I;  1L1O C;  4MD8 A;  3CCV Z;  2J6A A;  4RVH A;  3IFU A;  4E33 A;  4NBA A;  1YJW Z;  4RVG A;  1YHQ 1;  3KIH A;  3CCV 1;  3HOZ I;  3CXC Y;  2JA7 I;  1VLA A;  3S2D I;  4NBE A;  1RO2 A;  1YJW 1;  3G4S Z;  2EGT A;  2WB1 A;  4MD9 A;  3J80 f;  1VQP Z;  1X3W A;  3EED A;  4MON A;  5FLX b;  3G4S 1;  1VQP 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...