3PO3I

Arrested rna polymerase ii reactivation intermediate
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3I02
3K7AI 4A3BI 1USPA 5IP7I 3S1RI 1VLAA 2KPIA 2JA8I 4BY7I 3GKQA 1LQLA 2VUMI 2NVQI 2J6AA 1PFTA 3S1QI 1QYPA 2R7ZI 3S16I 4NB8A 2JR6A 2HF1A 2NVXI 4A3EI 3I07A 1K83I 4A3II 4A3MI 4A3DI 3FKII 4NBGA 3HOXI 2E2JI 4XX2A 5C4JI 3S2HI 1TWHI 3GTKI 2E2HI 5C3EI 5CM2M 3CQZI 3I4NI 4NOZA 4Y52I 2JA5I 4BXXI 4A3GI 3S17I 3VMIA 2RBLA 3GTPI 3HOUI 4NBAA 3HOZI 2DE6A 2NVYI 2B63I 4A3CI 3U50C 4NBCA 1ZB9A 3LUSA 2R92I 4X6AI 4A3LI 4A3KI 1Y1VI 3GTOI 2E2II 1I3QI 4NBEA 1X3ZA 1Y1VS 3Q87A 3VMHA 1Y1WI 3GTQI 1N2FA 4BBRI 5FLMI 3PO3I 1RLYA 2JA6I 2P3YA 1I6HI 3HOWI 3PO3S 3HOVI 4NB9A 2JNYA 4BY1I 1L1OC 2PK7A 4NBHA 4Y7NI 1SFOI 3PO2I 1NUIA 1ZB8A 1USPB 2R93I 3S15I 1ML8A 1TFIA 3ESWA 1TWAI 3RZOI 2DE7A 4BBSI 4A3FI 3M3YI 1I50I 3D6WA 1RO4A 4MH4A 2JA7I 2AKLA 3GCFA 2NVTI 3GTMI 1TWFI 2YU9I 2DE5A 1TWCI 4NBBA 3GTMS 3I4MI 3VB9A 3GTLI 3M4OI 3VMGA 2BJOA 2K5RA 3S1NI 3GTGI 2F4OA 3RZDI 1WW9A 5IP9I 3HOYI 3EERA 3H0GI 1R9TI 3GTJI 1DL6A 5C4XI 5C44I 1YUAA 4NBDA 2JS4A 1WCMI 3S1MI 1TWGI 3S2DI 1X3WA 3S14I 4QTUA 2F4MA 4A93I 4QTTA 4A3JI 4NBFA 3H3VJ
chains in the Genus database with same CATH superfamily
1USPA 2WB1A 1VQ91 2OTLZ 1VLAA 2KPIA 1YJWZ 2JA8I 3CCV1 2J6AA 3S1QI 3FQQA 1K732 5IT9b 1Z03A 3I55Z 1VQP1 1KQSY 1QF8A 1K83I 4A3MI 3CCQZ 1KC81 5D1OA 3NH8A 3S2HI 1RO0A 3GTKI 2E2HI 1SIWA 5CM2M 1VQ81 3BG1B 3CQZI 3I4NI 2NAPA 1AA6A 3S17I 1VQ71 3CCU1 2NVYI 2B63I 2PMZA 1ZB9A 3QWUA 3LUSA 2QEX1 2R92I 1VQOZ 2WAQA 1YUKA 2QRCB 3G4S1 4NBEA 5LL6f 3Q87A 1Y1VS 2RPRA 1YJW1 3GTQI 5FLXf 5FLMI 2W03A 2P3YA 4E30A 1JJ2Z 3HOWI 5T67A 2QRDB 3CMEZ 2PK7A 4NBHA 4Y7NI 4E2ZA 3PO2I 3JAMf 3KIFA 1NUIA 1ZB8A 3D9XA 3CCQ1 3CCE1 1TWAI 1VQKZ 1Q822 2JIMA 2IZ4A 3CCMZ 2O53A 2RT9A 3FQMA 2QA41 4MH4A 2JA7I 3GTMI 1TWFI 2YU9I 1TWCI 3I4MI 2M48A 2R6MA 4RVGA 3VMGA 2BJOA 3GTGI 1QXFA 1JJ2Y 1X0TA 3I56Z 3P5JB 3IFUA 1S721 3HOYI 2QLVB 5C4XI 1ZH1A 2QKDA 4NBDA 2W04A 1Q861 4MD7A 1KD12 3S14I 3NDIA 3CC71 2RHBA 4NBFA 2OTJ1 3MONA 4RV9A 2LIYA 3CME1 3CCL1 2G2KA 1VQ6Z 4HGZA 5A2Qb 1K9M2 1KQSZ 3J7A4 1YHQZ 1LQLA 1PFTA 1VQL1 2M6NA 3TDHB 3IF8A 1VQK1 3CMAZ 2VUGA 2R7ZI 4CL1A 1K8A1 4A3EI 1Z01A 1YJN1 4A3II 2VPXA 4A3DI 3FKII 3HOXI 1VQNZ 4XX2A 4MD8A 2VPYA 2V8IA 1KRLA 1Q7Y1 3I561 1VQ41 3VMIA 3CD6Z 1YI2Z 4RVFA 2YADA 4RVHA 4AYBA 3HOZI 4A3CI 3U50C 2HU9A 3CXCY 4A3LI 1M901 3GTOI 2E2II 1I3QI 2Q51A 1N2FA 1QVGY 1YIJZ 3BG0B 1YJ91 3CMA1 4NB9A 2GU2A 4E2XA 4BY1I 2IZ3A 3CCJ1 3S15I 1TFIA 3CC21 2DE7A 3KIHA 5IT9f 2Q4ZA 4BBSI 3J81b 2OTL1 3D6WA 1VQMZ 1RO4A 3HKZA 3GCFA 2VPZA 3GTMS 2LFUA 3NH5A 3NDJA 3I551 4E31A 2ZAEB 1RQFA 2PM9A 3M4OI 2K5RA 1WW9A 5IP9I 5T64A 1DL6A 2VF1A 1RNIA 5C44I 1YUAA 1QVFY 3S1MI 1TWGI 1M1K1 4QTUA 2F4MA 4QTTA 3H3VJ 5IP7I 3G6EZ 3CC4Z 4BY7I 3GKQA 2VUMI 2NVQI 1QYPA 2OZKA 2VPWA 1Q821 1VQO1 4NB8A 3IR7A 3CCRZ 2NVXI 1VQM1 3F3FC 3CCSZ 3I07A 2V8JA 2IV2X 4E2YA 3J80b 2RIQA 1W2BY 5C4JI 2V3VA 1N8R2 2GTHA 1S7MA 5C3EI 4NOZA 3CXCZ 4Y52I 4BXXI 5T6BA 1VQ9Z 3HOUI 4NBAA 2OOYB 1WIIA 1Z02A 1RO2A 1QVGZ 1FDOA 3CCM1 2EGTA 1P9NA 4NBCA 1Q16A 2V8KA 1K8A2 1VQPZ 3CC41 1Y1WI 1K9M1 3PO3I 2JA6I 2K3RA 2V45A 4MD9A 2JNYA 3G71Z 3CCR1 3CCS1 1FDIA 1VQ8Z 1SFOI 5D1OB 3F3PC 5A2Qf 1Q811 2R93I 2KI7B 3ESWA 4DQYB 3CCUZ 1NJI1 3RZOI 2QREB 4A3FI 4HGYA 1Y8CA 1VQ61 2I3CA 1M902 1YHQ1 3G4SZ 1KC82 4NBBA 4DGLA 1K731 3VB9A 1QVFZ 4EWCA 2JMOA 3S1NI 2F4OA 3RZDI 1VQN1 2JIPA 5FLXb 1WCMI 1YITZ 3S2DI 1X3WA 4HH4A 2E7ZA 3CCEZ 3K7AI 4A3BI 3G711 2E9HA 4MONA 3CPWY 3S1RI 3D2LA 2QA4Z 3CD61 3JAMb 1YI21 3S16I 2JR6A 2HF1A 1W2BZ 1VQ5Z 1YIJ1 1S72Z 4NBGA 2E2JI 1M1K2 3OW2Z 1TWHI 4MXUA 3J81f 3CC7Z 3MZKB 2OTJZ 4RVDA 1WZNA 2JA5I 3CCLZ 4A3GI 2RBLA 3GTPI 1WJ2A 2DE6A 4TNUA 1YIT1 3EEDA 1VQLZ 4S1TA 4X6AI 2P28A 4A3KI 1Y1VI 4MRIA 2AYDA 3VMHA 1X3ZA 1YJNZ 2H85A 4BBRI 1Q862 1RLYA 5AN9F 1I6HI 3PO3S 4NFRA 3T4NB 3HOVI 3VTNA 3IX0A 4DK1A 2OOXB 1L1OC 5D1PA 1NP6A 1VQ51 2Y0SA 3OW2Y 2JIOA 3CCVZ 1USPB 1VQ4Z 1ML8A 4E2WA 1KD11 4NH1C 4RS4A 2JIQA 2GTIA 1N8R1 3M3YI 1I50I 3G6E1 4E32A 3NH4A 2AKLA 1JWHC 2NVTI 3J80f 4E33A 2DE5A 3GTLI 1YJ9Z 3NFZA 2QR1B 1Q7Y2 3MZLB 3TE5B 2JIRA 2LEXA 3CPWZ 1Q812 3EERA 2O4HA 3H0GI 3GTJI 1VQ7Z 1R9TI 2JUBA 2JS4A 3CCJZ 1NJI2 3CC2Z 2QEXZ 4A93I 4A3JI
chains in the Genus database with same CATH topology
1USPA 2WB1A 1VQ91 2OTLZ 1VLAA 2KPIA 1YJWZ 2JA8I 3CCV1 2J6AA 3S1QI 3FQQA 1K732 5IT9b 1Z03A 3I55Z 1VQP1 1KQSY 1QF8A 1K83I 4A3MI 3CCQZ 1KC81 5D1OA 3NH8A 3S2HI 1RO0A 3GTKI 2E2HI 5CM2M 1VQ81 3BG1B 3CQZI 3I4NI 3S17I 1VQ71 3CCU1 2NVYI 2B63I 2PMZA 1ZB9A 3QWUA 3LUSA 2QEX1 2R92I 1VQOZ 2WAQA 1YUKA 2QRCB 3G4S1 4NBEA 5LL6f 3Q87A 1Y1VS 2RPRA 1YJW1 3GTQI 5FLXf 5FLMI 2W03A 2P3YA 4E30A 1JJ2Z 3HOWI 5T67A 2QRDB 3CMEZ 2PK7A 4NBHA 4Y7NI 4E2ZA 3PO2I 3JAMf 3KIFA 1NUIA 1ZB8A 3D9XA 3CCQ1 3CCE1 1TWAI 1VQKZ 1Q822 2IZ4A 3CCMZ 2O53A 2RT9A 3FQMA 2QA41 4MH4A 2JA7I 3GTMI 1TWFI 2YU9I 1TWCI 3I4MI 2M48A 2R6MA 4RVGA 3VMGA 2BJOA 3GTGI 1JJ2Y 1X0TA 3I56Z 3P5JB 3IFUA 1S721 3HOYI 2QLVB 5C4XI 1ZH1A 2QKDA 4NBDA 2W04A 1Q861 4MD7A 1KD12 3S14I 3NDIA 3CC71 2RHBA 4NBFA 2OTJ1 3MONA 4RV9A 2LIYA 3CME1 3CCL1 2G2KA 1VQ6Z 4HGZA 5A2Qb 1K9M2 1KQSZ 3J7A4 1YHQZ 1LQLA 1PFTA 1VQL1 2M6NA 3TDHB 3IF8A 1VQK1 3CMAZ 2VUGA 2R7ZI 4CL1A 1K8A1 4A3EI 1Z01A 1YJN1 4A3II 4A3DI 3FKII 3HOXI 1VQNZ 4XX2A 4MD8A 2V8IA 1KRLA 1Q7Y1 3I561 1VQ41 3VMIA 3CD6Z 1YI2Z 4RVFA 2YADA 4RVHA 4AYBA 3HOZI 4A3CI 3U50C 2HU9A 3CXCY 4A3LI 1M901 3GTOI 2E2II 1I3QI 2Q51A 1N2FA 1QVGY 1YIJZ 3BG0B 1YJ91 3CMA1 4NB9A 2GU2A 4E2XA 4BY1I 2IZ3A 3CCJ1 3S15I 1TFIA 3CC21 2DE7A 3KIHA 5IT9f 2Q4ZA 4BBSI 3J81b 2OTL1 3D6WA 1VQMZ 1RO4A 3HKZA 3GCFA 3GTMS 2LFUA 3NH5A 3NDJA 3I551 4E31A 2ZAEB 1RQFA 2PM9A 3M4OI 2K5RA 1WW9A 5IP9I 5T64A 1DL6A 2VF1A 1RNIA 5C44I 1YUAA 1QVFY 3S1MI 1TWGI 1M1K1 4QTUA 2F4MA 4QTTA 3H3VJ 5IP7I 3G6EZ 3CC4Z 4BY7I 3GKQA 2VUMI 2NVQI 1QYPA 2OZKA 1Q821 1VQO1 4NB8A 3CCRZ 2NVXI 1VQM1 3F3FC 3CCSZ 3I07A 2V8JA 4E2YA 3J80b 2RIQA 1W2BY 5C4JI 1N8R2 2GTHA 1S7MA 5C3EI 4NOZA 3CXCZ 4Y52I 4BXXI 5T6BA 1VQ9Z 3HOUI 4NBAA 2OOYB 1WIIA 1Z02A 1RO2A 1QVGZ 3CCM1 2EGTA 1P9NA 4NBCA 2V8KA 1K8A2 1VQPZ 3CC41 1Y1WI 1K9M1 3PO3I 2JA6I 2K3RA 4MD9A 2JNYA 3G71Z 3CCR1 1VQ8Z 3CCS1 1SFOI 5D1OB 3F3PC 5A2Qf 1Q811 2R93I 2KI7B 3ESWA 4DQYB 3CCUZ 1NJI1 3RZOI 2QREB 4A3FI 4HGYA 1VQ61 2I3CA 1M902 1YHQ1 3G4SZ 1KC82 4NBBA 4DGLA 1K731 3VB9A 1QVFZ 4EWCA 2JMOA 3S1NI 2F4OA 3RZDI 1VQN1 5FLXb 1WCMI 1YITZ 3S2DI 1X3WA 4HH4A 3CCEZ 3K7AI 4A3BI 3G711 2E9HA 4MONA 3CPWY 3S1RI 2QA4Z 3CD61 3JAMb 1YI21 3S16I 2JR6A 2HF1A 1W2BZ 1VQ5Z 1YIJ1 1S72Z 4NBGA 2E2JI 1M1K2 3OW2Z 1TWHI 4MXUA 3J81f 3CC7Z 3MZKB 2OTJZ 4RVDA 2JA5I 3CCLZ 4A3GI 2RBLA 3GTPI 2DE6A 4TNUA 1YIT1 3EEDA 1VQLZ 4S1TA 4X6AI 2P28A 4A3KI 1Y1VI 4MRIA 3VMHA 1X3ZA 1YJNZ 2H85A 4BBRI 1Q862 1RLYA 5AN9F 1I6HI 3PO3S 4NFRA 3T4NB 3HOVI 3VTNA 3IX0A 4DK1A 2OOXB 1L1OC 5D1PA 1NP6A 1VQ51 2Y0SA 3OW2Y 3CCVZ 1USPB 1VQ4Z 1ML8A 4E2WA 1KD11 4NH1C 4RS4A 2GTIA 1N8R1 3M3YI 1I50I 3G6E1 4E32A 3NH4A 2AKLA 1JWHC 2NVTI 3J80f 4E33A 2DE5A 3GTLI 1YJ9Z 3NFZA 2QR1B 1Q7Y2 3MZLB 3TE5B 3CPWZ 1Q812 3EERA 2O4HA 3H0GI 3GTJI 1VQ7Z 1R9TI 2JUBA 2JS4A 3CCJZ 1NJI2 3CC2Z 2QEXZ 4A93I 4A3JI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7A I;  4A3B I;  1USP A;  5IP7 I;  3S1R I;  1VLA A;  2KPI A;  2JA8 I;  4BY7 I;  3GKQ A;  1LQL A;  2VUM I;  2NVQ I;  2J6A A;  1PFT A;  3S1Q I;  1QYP A;  2R7Z I;  3S16 I;  4NB8 A;  2JR6 A;  2HF1 A;  2NVX I;  4A3E I;  3I07 A;  1K83 I;  4A3I I;  4A3M I;  4A3D I;  3FKI I;  4NBG A;  3HOX I;  2E2J I;  4XX2 A;  5C4J I;  3S2H I;  1TWH I;  3GTK I;  2E2H I;  5C3E I;  5CM2 M;  3CQZ I;  3I4N I;  4NOZ A;  4Y52 I;  2JA5 I;  4BXX I;  4A3G I;  3S17 I;  3VMI A;  2RBL A;  3GTP I;  3HOU I;  4NBA A;  3HOZ I;  2DE6 A;  2NVY I;  2B63 I;  4A3C I;  3U50 C;  4NBC A;  1ZB9 A;  3LUS A;  2R92 I;  4X6A I;  4A3L I;  4A3K I;  1Y1V I;  3GTO I;  2E2I I;  1I3Q I;  4NBE A;  1X3Z A;  1Y1V S;  3Q87 A;  3VMH A;  1Y1W I;  3GTQ I;  1N2F A;  4BBR I;  5FLM I;  3PO3 I;  1RLY A;  2JA6 I;  2P3Y A;  1I6H I;  3HOW I;  3PO3 S;  3HOV I;  4NB9 A;  2JNY A;  4BY1 I;  1L1O C;  2PK7 A;  4NBH A;  4Y7N I;  1SFO I;  3PO2 I;  1NUI A;  1ZB8 A;  1USP B;  2R93 I;  3S15 I;  1ML8 A;  1TFI A;  3ESW A;  1TWA I;  3RZO I;  2DE7 A;  4BBS I;  4A3F I;  3M3Y I;  1I50 I;  3D6W A;  1RO4 A;  4MH4 A;  2JA7 I;  2AKL A;  3GCF A;  2NVT I;  3GTM I;  1TWF I;  2YU9 I;  2DE5 A;  1TWC I;  4NBB A;  3GTM S;  3I4M I;  3VB9 A;  3GTL I;  3M4O I;  3VMG A;  2BJO A;  2K5R A;  3S1N I;  3GTG I;  2F4O A;  3RZD I;  1WW9 A;  5IP9 I;  3HOY I;  3EER A;  3H0G I;  1R9T I;  3GTJ I;  1DL6 A;  5C4X I;  5C44 I;  1YUA A;  4NBD A;  2JS4 A;  1WCM I;  3S1M I;  1TWG I;  3S2D I;  1X3W A;  3S14 I;  4QTU A;  2F4M A;  4A93 I;  4QTT A;  4A3J I;  4NBF A;  3H3V J; 
#chains in the Genus database with same CATH topology
 1USP A;  2WB1 A;  1VQ9 1;  2OTL Z;  1VLA A;  2KPI A;  1YJW Z;  2JA8 I;  3CCV 1;  2J6A A;  3S1Q I;  3FQQ A;  1K73 2;  5IT9 b;  1Z03 A;  3I55 Z;  1VQP 1;  1KQS Y;  1QF8 A;  1K83 I;  4A3M I;  3CCQ Z;  1KC8 1;  5D1O A;  3NH8 A;  3S2H I;  1RO0 A;  3GTK I;  2E2H I;  1SIW A;  5CM2 M;  1VQ8 1;  3BG1 B;  3CQZ I;  3I4N I;  2NAP A;  1AA6 A;  3S17 I;  1VQ7 1;  3CCU 1;  2NVY I;  2B63 I;  2PMZ A;  1ZB9 A;  3QWU A;  3LUS A;  2QEX 1;  2R92 I;  1VQO Z;  2WAQ A;  1YUK A;  2QRC B;  3G4S 1;  4NBE A;  5LL6 f;  3Q87 A;  1Y1V S;  2RPR A;  1YJW 1;  3GTQ I;  5FLX f;  5FLM I;  2W03 A;  2P3Y A;  4E30 A;  1JJ2 Z;  3HOW I;  5T67 A;  2QRD B;  3CME Z;  2PK7 A;  4NBH A;  4Y7N I;  4E2Z A;  3PO2 I;  3JAM f;  3KIF A;  1NUI A;  1ZB8 A;  3D9X A;  3CCQ 1;  3CCE 1;  1TWA I;  1VQK Z;  1Q82 2;  2JIM A;  2IZ4 A;  3CCM Z;  2O53 A;  2RT9 A;  3FQM A;  2QA4 1;  4MH4 A;  2JA7 I;  3GTM I;  1TWF I;  2YU9 I;  1TWC I;  3I4M I;  2M48 A;  2R6M A;  4RVG A;  3VMG A;  2BJO A;  3GTG I;  1QXF A;  1JJ2 Y;  1X0T A;  3I56 Z;  3P5J B;  3IFU A;  1S72 1;  3HOY I;  2QLV B;  5C4X I;  1ZH1 A;  2QKD A;  4NBD A;  2W04 A;  1Q86 1;  4MD7 A;  1KD1 2;  3S14 I;  3NDI A;  3CC7 1;  2RHB A;  4NBF A;  2OTJ 1;  3MON A;  4RV9 A;  2LIY A;  3CME 1;  3CCL 1;  2G2K A;  1VQ6 Z;  4HGZ A;  5A2Q b;  1K9M 2;  1KQS Z;  3J7A 4;  1YHQ Z;  1LQL A;  1PFT A;  1VQL 1;  2M6N A;  3TDH B;  3IF8 A;  1VQK 1;  3CMA Z;  2VUG A;  2R7Z I;  4CL1 A;  1K8A 1;  4A3E I;  1Z01 A;  1YJN 1;  4A3I I;  2VPX A;  4A3D I;  3FKI I;  3HOX I;  1VQN Z;  4XX2 A;  4MD8 A;  2VPY A;  2V8I A;  1KRL A;  1Q7Y 1;  3I56 1;  1VQ4 1;  3VMI A;  3CD6 Z;  1YI2 Z;  4RVF A;  2YAD A;  4RVH A;  4AYB A;  3HOZ I;  4A3C I;  3U50 C;  2HU9 A;  3CXC Y;  4A3L I;  1M90 1;  3GTO I;  2E2I I;  1I3Q I;  2Q51 A;  1N2F A;  1QVG Y;  1YIJ Z;  3BG0 B;  1YJ9 1;  3CMA 1;  4NB9 A;  2GU2 A;  4E2X A;  4BY1 I;  2IZ3 A;  3CCJ 1;  3S15 I;  1TFI A;  3CC2 1;  2DE7 A;  3KIH A;  5IT9 f;  2Q4Z A;  4BBS I;  3J81 b;  2OTL 1;  3D6W A;  1VQM Z;  1RO4 A;  3HKZ A;  3GCF A;  2VPZ A;  3GTM S;  2LFU A;  3NH5 A;  3NDJ A;  3I55 1;  4E31 A;  2ZAE B;  1RQF A;  2PM9 A;  3M4O I;  2K5R A;  1WW9 A;  5IP9 I;  5T64 A;  1DL6 A;  2VF1 A;  1RNI A;  5C44 I;  1YUA A;  1QVF Y;  3S1M I;  1TWG I;  1M1K 1;  4QTU A;  2F4M A;  4QTT A;  3H3V J;  5IP7 I;  3G6E Z;  3CC4 Z;  4BY7 I;  3GKQ A;  2VUM I;  2NVQ I;  1QYP A;  2OZK A;  2VPW A;  1Q82 1;  1VQO 1;  4NB8 A;  3IR7 A;  3CCR Z;  2NVX I;  1VQM 1;  3F3F C;  3CCS Z;  3I07 A;  2V8J A;  2IV2 X;  4E2Y A;  3J80 b;  2RIQ A;  1W2B Y;  5C4J I;  2V3V A;  1N8R 2;  2GTH A;  1S7M A;  5C3E I;  4NOZ A;  3CXC Z;  4Y52 I;  4BXX I;  5T6B A;  1VQ9 Z;  3HOU I;  4NBA A;  2OOY B;  1WII A;  1Z02 A;  1RO2 A;  1QVG Z;  1FDO A;  3CCM 1;  2EGT A;  1P9N A;  4NBC A;  1Q16 A;  2V8K A;  1K8A 2;  1VQP Z;  3CC4 1;  1Y1W I;  1K9M 1;  3PO3 I;  2JA6 I;  2K3R A;  2V45 A;  4MD9 A;  2JNY A;  3G71 Z;  3CCR 1;  3CCS 1;  1FDI A;  1VQ8 Z;  1SFO I;  5D1O B;  3F3P C;  5A2Q f;  1Q81 1;  2R93 I;  2KI7 B;  3ESW A;  4DQY B;  3CCU Z;  1NJI 1;  3RZO I;  2QRE B;  4A3F I;  4HGY A;  1Y8C A;  1VQ6 1;  2I3C A;  1M90 2;  1YHQ 1;  3G4S Z;  1KC8 2;  4NBB A;  4DGL A;  1K73 1;  3VB9 A;  1QVF Z;  4EWC A;  2JMO A;  3S1N I;  2F4O A;  3RZD I;  1VQN 1;  2JIP A;  5FLX b;  1WCM I;  1YIT Z;  3S2D I;  1X3W A;  4HH4 A;  2E7Z A;  3CCE Z;  3K7A I;  4A3B I;  3G71 1;  2E9H A;  4MON A;  3CPW Y;  3S1R I;  3D2L A;  2QA4 Z;  3CD6 1;  3JAM b;  1YI2 1;  3S16 I;  2JR6 A;  2HF1 A;  1W2B Z;  1VQ5 Z;  1YIJ 1;  1S72 Z;  4NBG A;  2E2J I;  1M1K 2;  3OW2 Z;  1TWH I;  4MXU A;  3J81 f;  3CC7 Z;  3MZK B;  2OTJ Z;  4RVD A;  1WZN A;  2JA5 I;  3CCL Z;  4A3G I;  2RBL A;  3GTP I;  1WJ2 A;  2DE6 A;  4TNU A;  1YIT 1;  3EED A;  1VQL Z;  4S1T A;  4X6A I;  2P28 A;  4A3K I;  1Y1V I;  4MRI A;  2AYD A;  3VMH A;  1X3Z A;  1YJN Z;  2H85 A;  4BBR I;  1Q86 2;  1RLY A;  5AN9 F;  1I6H I;  3PO3 S;  4NFR A;  3T4N B;  3HOV I;  3VTN A;  3IX0 A;  4DK1 A;  2OOX B;  1L1O C;  5D1P A;  1NP6 A;  1VQ5 1;  2Y0S A;  3OW2 Y;  2JIO A;  3CCV Z;  1USP B;  1VQ4 Z;  1ML8 A;  4E2W A;  1KD1 1;  4NH1 C;  4RS4 A;  2JIQ A;  2GTI A;  1N8R 1;  3M3Y I;  1I50 I;  3G6E 1;  4E32 A;  3NH4 A;  2AKL A;  1JWH C;  2NVT I;  3J80 f;  4E33 A;  2DE5 A;  3GTL I;  1YJ9 Z;  3NFZ A;  2QR1 B;  1Q7Y 2;  3MZL B;  3TE5 B;  2JIR A;  2LEX A;  3CPW Z;  1Q81 2;  3EER A;  2O4H A;  3H0G I;  3GTJ I;  1VQ7 Z;  1R9T I;  2JUB A;  2JS4 A;  3CCJ Z;  1NJI 2;  3CC2 Z;  2QEX Z;  4A93 I;  4A3J I; 
#chains in the Genus database with same CATH homology
 1USP A;  2WB1 A;  1VQ9 1;  2OTL Z;  1VLA A;  2KPI A;  1YJW Z;  2JA8 I;  3CCV 1;  2J6A A;  3S1Q I;  3FQQ A;  1K73 2;  5IT9 b;  1Z03 A;  3I55 Z;  1VQP 1;  1KQS Y;  1QF8 A;  1K83 I;  4A3M I;  3CCQ Z;  1KC8 1;  5D1O A;  3NH8 A;  3S2H I;  1RO0 A;  3GTK I;  2E2H I;  5CM2 M;  1VQ8 1;  3BG1 B;  3CQZ I;  3I4N I;  3S17 I;  1VQ7 1;  3CCU 1;  2NVY I;  2B63 I;  2PMZ A;  1ZB9 A;  3QWU A;  3LUS A;  2QEX 1;  2R92 I;  1VQO Z;  2WAQ A;  1YUK A;  2QRC B;  3G4S 1;  4NBE A;  5LL6 f;  3Q87 A;  1Y1V S;  2RPR A;  1YJW 1;  3GTQ I;  5FLX f;  5FLM I;  2W03 A;  2P3Y A;  4E30 A;  1JJ2 Z;  3HOW I;  5T67 A;  2QRD B;  3CME Z;  2PK7 A;  4NBH A;  4Y7N I;  4E2Z A;  3PO2 I;  3JAM f;  3KIF A;  1NUI A;  1ZB8 A;  3D9X A;  3CCQ 1;  3CCE 1;  1TWA I;  1VQK Z;  1Q82 2;  2IZ4 A;  3CCM Z;  2O53 A;  2RT9 A;  3FQM A;  2QA4 1;  4MH4 A;  2JA7 I;  3GTM I;  1TWF I;  2YU9 I;  1TWC I;  3I4M I;  2M48 A;  2R6M A;  4RVG A;  3VMG A;  2BJO A;  3GTG I;  1JJ2 Y;  1X0T A;  3I56 Z;  3P5J B;  3IFU A;  1S72 1;  3HOY I;  2QLV B;  5C4X I;  1ZH1 A;  2QKD A;  4NBD A;  2W04 A;  1Q86 1;  4MD7 A;  1KD1 2;  3S14 I;  3NDI A;  3CC7 1;  2RHB A;  4NBF A;  2OTJ 1;  3MON A;  4RV9 A;  2LIY A;  3CME 1;  3CCL 1;  2G2K A;  1VQ6 Z;  4HGZ A;  5A2Q b;  1K9M 2;  1KQS Z;  3J7A 4;  1YHQ Z;  1LQL A;  1PFT A;  1VQL 1;  2M6N A;  3TDH B;  3IF8 A;  1VQK 1;  3CMA Z;  2VUG A;  2R7Z I;  4CL1 A;  1K8A 1;  4A3E I;  1Z01 A;  1YJN 1;  4A3I I;  4A3D I;  3FKI I;  3HOX I;  1VQN Z;  4XX2 A;  4MD8 A;  2V8I A;  1KRL A;  1Q7Y 1;  3I56 1;  1VQ4 1;  3VMI A;  3CD6 Z;  1YI2 Z;  4RVF A;  2YAD A;  4RVH A;  4AYB A;  3HOZ I;  4A3C I;  3U50 C;  2HU9 A;  3CXC Y;  4A3L I;  1M90 1;  3GTO I;  2E2I I;  1I3Q I;  2Q51 A;  1N2F A;  1QVG Y;  1YIJ Z;  3BG0 B;  1YJ9 1;  3CMA 1;  4NB9 A;  2GU2 A;  4E2X A;  4BY1 I;  2IZ3 A;  3CCJ 1;  3S15 I;  1TFI A;  3CC2 1;  2DE7 A;  3KIH A;  5IT9 f;  2Q4Z A;  4BBS I;  3J81 b;  2OTL 1;  3D6W A;  1VQM Z;  1RO4 A;  3HKZ A;  3GCF A;  3GTM S;  2LFU A;  3NH5 A;  3NDJ A;  3I55 1;  4E31 A;  2ZAE B;  1RQF A;  2PM9 A;  3M4O I;  2K5R A;  1WW9 A;  5IP9 I;  5T64 A;  1DL6 A;  2VF1 A;  1RNI A;  5C44 I;  1YUA A;  1QVF Y;  3S1M I;  1TWG I;  1M1K 1;  4QTU A;  2F4M A;  4QTT A;  3H3V J;  5IP7 I;  3G6E Z;  3CC4 Z;  4BY7 I;  3GKQ A;  2VUM I;  2NVQ I;  1QYP A;  2OZK A;  1Q82 1;  1VQO 1;  4NB8 A;  3CCR Z;  2NVX I;  1VQM 1;  3F3F C;  3CCS Z;  3I07 A;  2V8J A;  4E2Y A;  3J80 b;  2RIQ A;  1W2B Y;  5C4J I;  1N8R 2;  2GTH A;  1S7M A;  5C3E I;  4NOZ A;  3CXC Z;  4Y52 I;  4BXX I;  5T6B A;  1VQ9 Z;  3HOU I;  4NBA A;  2OOY B;  1WII A;  1Z02 A;  1RO2 A;  1QVG Z;  3CCM 1;  2EGT A;  1P9N A;  4NBC A;  2V8K A;  1K8A 2;  1VQP Z;  3CC4 1;  1Y1W I;  1K9M 1;  3PO3 I;  2JA6 I;  2K3R A;  4MD9 A;  2JNY A;  3G71 Z;  3CCR 1;  1VQ8 Z;  3CCS 1;  1SFO I;  5D1O B;  3F3P C;  5A2Q f;  1Q81 1;  2R93 I;  2KI7 B;  3ESW A;  4DQY B;  3CCU Z;  1NJI 1;  3RZO I;  2QRE B;  4A3F I;  4HGY A;  1VQ6 1;  2I3C A;  1M90 2;  1YHQ 1;  3G4S Z;  1KC8 2;  4NBB A;  4DGL A;  1K73 1;  3VB9 A;  1QVF Z;  4EWC A;  2JMO A;  3S1N I;  2F4O A;  3RZD I;  1VQN 1;  5FLX b;  1WCM I;  1YIT Z;  3S2D I;  1X3W A;  4HH4 A;  3CCE Z;  3K7A I;  4A3B I;  3G71 1;  2E9H A;  4MON A;  3CPW Y;  3S1R I;  2QA4 Z;  3CD6 1;  3JAM b;  1YI2 1;  3S16 I;  2JR6 A;  2HF1 A;  1W2B Z;  1VQ5 Z;  1YIJ 1;  1S72 Z;  4NBG A;  2E2J I;  1M1K 2;  3OW2 Z;  1TWH I;  4MXU A;  3J81 f;  3CC7 Z;  3MZK B;  2OTJ Z;  4RVD A;  2JA5 I;  3CCL Z;  4A3G I;  2RBL A;  3GTP I;  2DE6 A;  4TNU A;  1YIT 1;  3EED A;  1VQL Z;  4S1T A;  4X6A I;  2P28 A;  4A3K I;  1Y1V I;  4MRI A;  3VMH A;  1X3Z A;  1YJN Z;  2H85 A;  4BBR I;  1Q86 2;  1RLY A;  5AN9 F;  1I6H I;  3PO3 S;  4NFR A;  3T4N B;  3HOV I;  3VTN A;  3IX0 A;  4DK1 A;  2OOX B;  1L1O C;  5D1P A;  1NP6 A;  1VQ5 1;  2Y0S A;  3OW2 Y;  3CCV Z;  1USP B;  1VQ4 Z;  1ML8 A;  4E2W A;  1KD1 1;  4NH1 C;  4RS4 A;  2GTI A;  1N8R 1;  3M3Y I;  1I50 I;  3G6E 1;  4E32 A;  3NH4 A;  2AKL A;  1JWH C;  2NVT I;  3J80 f;  4E33 A;  2DE5 A;  3GTL I;  1YJ9 Z;  3NFZ A;  2QR1 B;  1Q7Y 2;  3MZL B;  3TE5 B;  3CPW Z;  1Q81 2;  3EER A;  2O4H A;  3H0G I;  3GTJ I;  1VQ7 Z;  1R9T I;  2JUB A;  2JS4 A;  3CCJ Z;  1NJI 2;  3CC2 Z;  2QEX Z;  4A93 I;  4A3J I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...