2NVXI

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dutp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvxI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvxI02
4NBHA 1TWCI 5C4JI 3HOVI 1SFOI 4A3GI 2F4OA 1Y1VI 1USPA 3HOXI 4NBBA 3HOWI 4Y52I 3K7AI 1L1OC 3RZDI 4BBSI 4NBFA 3GTGI 2JA5I 1DL6A 2R93I 2F4MA 2NVYI 5CM2M 3I4MI 1I3QI 4BY7I 3I4NI 2B63I 3S1NI 4A3II 1N2FA 1ZB9A 3S1QI 1Y1WI 4XX2A 2NVQI 4NBGA 2JS4A 4X6AI 2R92I 4A3DI 1ZB8A 3H0GI 3LUSA 3GTOI 4A3MI 4BBRI 2JA7I 1NUIA 1X3ZA 3S16I 4A3LI 4A3FI 3PO3I 2DE7A 4NBAA 5IP9I 2BJOA 1YUAA 3GTQI 1WCMI 4NBCA 2R7ZI 2JNYA 3S1RI 1TWFI 1I6HI 3S1MI 2VUMI 3D6WA 3GTMS 1K83I 3U50C 2KPIA 2DE5A 4NBEA 4NOZA 3PO2I 2PK7A 3GTPI 3S2HI 3S15I 2JA8I 3VMIA 3FKII 4A93I 1TWHI 3RZOI 3HOUI 4A3CI 5C44I 1Y1VS 3I07A 3HOZI 3S14I 3GTLI 2E2HI 1WW9A 5C3EI 3M3YI 1PFTA 3GTKI 2HF1A 3CQZI 5IP7I 3GKQA 1X3WA 1I50I 2YU9I 3S2DI 2RBLA 4A3JI 4NB9A 2NVXI 3EERA 5FLMI 1R9TI 1QYPA 4NBDA 3GTJI 3GCFA 3M4OI 4Y7NI 2JA6I 1USPB 3S17I 4MH4A 1ML8A 1RLYA 2AKLA 3ESWA 3VMGA 4A3BI 4A3EI 4BY1I 3VB9A 3H3VJ 2JR6A 2P3YA 3VMHA 2DE6A 1RO4A 4BXXI 2E2II 1LQLA 3PO3S 1VLAA 1TWAI 3HOYI 2K5RA 2J6AA 4QTUA 2NVTI 3GTMI 2E2JI 1TFIA 4QTTA 4A3KI 1TWGI 3Q87A 5C4XI 4NB8A
chains in the Genus database with same CATH superfamily
3BG0B 1SFOI 3CPWY 1VQ61 3HOXI 1K732 2JMOA 2RIQA 4MD9A 3RZDI 4BBSI 2E7ZA 2OOYB 2JA5I 2R93I 2E9HA 1S721 1RO0A 5FLXf 3CCUZ 3S1NI 4HGYA 1Y1WI 4NBGA 2JS4A 4E2XA 2R92I 1K731 1N8R2 3NH8A 1KQSZ 3GTOI 3NFZA 2JA7I 1YIT1 3CCSZ 1QXFA 1M902 1VQN1 3PO3I 2DE7A 3VTNA 5IP9I 2VPXA 3CCEZ 1WIIA 1TWFI 1Z03A 3S1MI 3CC71 2QLVB 1N8R1 2Q4ZA 2Q51A 4RS4A 5AN9F 3CC41 3D6WA 4RVFA 1Z02A 1KD12 1M901 2Y0SA 3CCJZ 1YI2Z 4RVGA 3S2HI 1YJWZ 4E33A 1YJN1 1Z01A 3JAMb 1TWHI 4A3CI 3BG1B 2IZ4A 3S14I 1QVGY 1KD11 2JIMA 3G71Z 1PFTA 3I551 2YU9I 1Q812 3IX0A 4NB9A 5D1OB 2NVXI 1QYPA 3QWUA 3GTJI 5A2Qf 3OW2Z 1Q7Y2 1JJ2Z 5D1PA 3CCMZ 2EGTA 1YJ91 2AKLA 1S7MA 3ESWA 3VMGA 2QEX1 2QREB 2O4HA 2JR6A 1AA6A 2P3YA 3I561 2E2II 2GU2A 1Q811 3HOYI 1TFIA 4CL1A 1Q7Y1 2VUGA 1VQ81 3Q87A 2V3VA 3NH4A 3CCR1 3HOVI 3CXCZ 1VQ9Z 1USPA 3HOWI 2OTLZ 3G4S1 3FQQA 4MONA 2NVYI 1VQKZ 3CCVZ 3I4MI 2M48A 3IR7A 1I3QI 1VQ51 2GTIA 1N2FA 3CMEZ 3S1QI 1M1K2 3G6EZ 4X6AI 1W2BZ 1FDIA 1K8A2 2QRCB 4A3DI 3H0GI 1VQ41 3LUSA 1Q16A 2RHBA 4HGZA 1NUIA 3IFUA 3T4NB 1VQM1 1VQ7Z 1M1K1 2P28A 3GTQI 1WCMI 4NBCA 2JNYA 4DK1A 2K3RA 2JIPA 1K8A1 1QVFZ 2QA4Z 3CD61 2DE5A 4NOZA 1YIJ1 1RQFA 2IZ3A 2PMZA 1YHQ1 3S15I 5FLXb 3MZKB 3VMIA 3NDIA 3FKII 3HOUI 2JIOA 3IF8A 1QF8A 3CCQZ 2E2HI 1WW9A 5C3EI 3FQMA 1KC82 3M3YI 3GTKI 4MD8A 2OTJ1 4DQYB 4E31A 4A3JI 5LL6f 3J80b 3EERA 4MXUA 2OZKA 4E2YA 3GCFA 4Y7NI 4RV9A 4E30A 1RLYA 1VQOZ 3CMA1 1KC81 4BY1I 4E2ZA 3CC2Z 2DE6A 1RO4A 3F3PC 3CCLZ 3D2LA 1VQLZ 5T67A 2E2JI 1YUKA 2OOXB 1X0TA 3D9XA 5C4XI 4NB8A 4NBHA 3KIFA 2VPYA 1TWCI 4AYBA 3CPWZ 5D1OA 1VQPZ 4A3GI 2YADA 3J81f 1P9NA 3CCU1 4NBBA 2HU9A 3K7AI 1L1OC 1WZNA 4NBFA 3GTGI 1DL6A 4TNUA 2W03A 2G2KA 5CM2M 1VQ6Z 5A2Qb 4BY7I 2B63I 2NVQI 4XX2A 3CCS1 1ZH1A 3NH5A 4S1TA 3CCE1 1S72Z 1ZB8A 4BBRI 1X3ZA 3S16I 1KQSY 1KRLA 4A3LI 4A3FI 2BJOA 2O53A 3CCJ1 2LIYA 3S1RI 2QR1B 5IT9f 1YITZ 1YI21 1Q862 1YJW1 1VQNZ 1JWHC 3GTMS 3HKZA 4NBEA 2WAQA 4RVHA 2JIQA 3PO2I 3GTPI 4E2WA 4MRIA 3G711 3CC4Z 4A93I 2QRDB 3RZOI 5C44I 1Y1VS 1K9M2 1Q861 4MD7A 4EWCA 2WB1A 2VPWA 3TDHB 2IV2X 1YJNZ 3CQZI 3CCM1 5IP7I 3GKQA 3S2DI 2V8KA 1K9M1 3EEDA 5FLMI 2LEXA 3S17I 3I55Z 1ML8A 3OW2Y 3MZLB 1JJ2Y 4A3BI 3VMHA 2W04A 4BXXI 2H85A 2V8IA 1LQLA 1TWAI 1Y8CA 2GTHA 2K5RA 1YJ9Z 1WJ2A 4QTUA 2NVTI 3GTMI 4QTTA 2QEXZ 1VQ91 4A3KI 1NP6A 5T6BA 3I56Z 2JIRA 2OTL1 5C4JI 3KIHA 1VQK1 2F4OA 1Y1VI 3CCV1 3CXCY 1VQ8Z 4Y52I 3CME1 4NFRA 3CCRZ 3G6E1 3J80f 4HH4A 2F4MA 2KI7B 3I4NI 3JAMf 4A3II 1ZB9A 1Q822 3G4SZ 2V45A 2V8JA 3P5JB 2R6MA 2M6NA 1VQ71 2VF1A 1SIWA 1VQ5Z 1W2BY 4A3MI 4E32A 4NBAA 2QKDA 2QA41 1Q821 1YUAA 2R7ZI 1VQ4Z 1I6HI 2LFUA 2AYDA 2RPRA 3J81b 2VUMI 1VQMZ 1K83I 3U50C 2KPIA 1QVFY 1RO2A 2VPZA 3CCQ1 2PK7A 2JA8I 3CD6Z 3I07A 1FDOA 3HOZI 2PM9A 1YIJZ 3J7A4 1YHQZ 2NAPA 3GTLI 2ZAEB 3MONA 2HF1A 2RT9A 1NJI2 1VQO1 1X3WA 1I50I 2RBLA 4RVDA 3CC21 4NH1C 1R9TI 3CCL1 4NBDA 2JA6I 3CC7Z 1RNIA 1USPB 5IT9b 2OTJZ 4MH4A 1VQL1 4A3EI 3F3FC 2I3CA 3VB9A 3H3VJ 5T64A 1NJI1 3TE5B 1QVGZ 3PO3S 1VLAA 3NDJA 2J6AA 4DGLA 1VQP1 3CMAZ 2JUBA 1TWGI 3M4OI
chains in the Genus database with same CATH topology
3BG0B 1SFOI 3CPWY 1VQ61 3HOXI 1K732 2JMOA 2RIQA 4MD9A 3RZDI 4BBSI 2OOYB 2JA5I 2R93I 2E9HA 1S721 1RO0A 5FLXf 3CCUZ 3S1NI 4HGYA 1Y1WI 4NBGA 2JS4A 4E2XA 2R92I 1K731 1N8R2 3NH8A 1KQSZ 3GTOI 3NFZA 2JA7I 1YIT1 3CCSZ 1M902 1VQN1 3PO3I 2DE7A 3VTNA 5IP9I 3CCEZ 1WIIA 1TWFI 1Z03A 3S1MI 3CC71 2QLVB 1N8R1 2Q4ZA 2Q51A 4RS4A 5AN9F 3CC41 3D6WA 4RVFA 1Z02A 1KD12 1M901 2Y0SA 3CCJZ 1YI2Z 4RVGA 3S2HI 1YJWZ 4E33A 1YJN1 1Z01A 3JAMb 1TWHI 4A3CI 3BG1B 2IZ4A 3S14I 1QVGY 1KD11 3G71Z 1PFTA 3I551 2YU9I 1Q812 3IX0A 4NB9A 5D1OB 2NVXI 1QYPA 3QWUA 3GTJI 5A2Qf 3OW2Z 1Q7Y2 1JJ2Z 5D1PA 3CCMZ 2EGTA 1YJ91 2AKLA 1S7MA 3ESWA 3VMGA 2QEX1 2QREB 2O4HA 2JR6A 2P3YA 3I561 2E2II 2GU2A 1Q811 3HOYI 1TFIA 4CL1A 1Q7Y1 2VUGA 1VQ81 3Q87A 3NH4A 3CCR1 3HOVI 3CXCZ 1VQ9Z 1USPA 3HOWI 2OTLZ 3G4S1 3FQQA 4MONA 2NVYI 1VQKZ 3CCVZ 3I4MI 2M48A 1I3QI 1VQ51 2GTIA 1N2FA 3CMEZ 3S1QI 1M1K2 3G6EZ 4X6AI 1W2BZ 4A3DI 1K8A2 2QRCB 3H0GI 1VQ41 3LUSA 2RHBA 4HGZA 1NUIA 3IFUA 3T4NB 1VQM1 1VQ7Z 1M1K1 2P28A 3GTQI 1WCMI 4NBCA 2JNYA 4DK1A 2K3RA 1K8A1 1QVFZ 2QA4Z 3CD61 2DE5A 4NOZA 1YIJ1 1RQFA 2IZ3A 2PMZA 1YHQ1 3S15I 5FLXb 3MZKB 3VMIA 3NDIA 3FKII 3HOUI 3IF8A 1QF8A 3CCQZ 2E2HI 1WW9A 5C3EI 3FQMA 1KC82 3M3YI 3GTKI 4MD8A 2OTJ1 4DQYB 4E31A 4A3JI 5LL6f 3J80b 3EERA 4MXUA 2OZKA 4E2YA 3GCFA 4Y7NI 4RV9A 4E30A 1RLYA 1VQOZ 3CMA1 1KC81 4BY1I 4E2ZA 3CC2Z 2DE6A 1RO4A 3F3PC 3CCLZ 1VQLZ 5T67A 2E2JI 1YUKA 2OOXB 1X0TA 3D9XA 5C4XI 4NB8A 4NBHA 3KIFA 1TWCI 4AYBA 3CPWZ 5D1OA 1VQPZ 4A3GI 2YADA 3J81f 1P9NA 3CCU1 4NBBA 2HU9A 3K7AI 1L1OC 4NBFA 3GTGI 1DL6A 4TNUA 2W03A 2G2KA 5CM2M 1VQ6Z 5A2Qb 4BY7I 2B63I 2NVQI 4XX2A 3CCS1 1ZH1A 3NH5A 4S1TA 3CCE1 1S72Z 1ZB8A 4BBRI 1X3ZA 3S16I 1KQSY 1KRLA 4A3LI 4A3FI 2BJOA 2O53A 3CCJ1 2LIYA 3S1RI 2QR1B 5IT9f 1YITZ 1YI21 1Q862 1YJW1 1VQNZ 1JWHC 3GTMS 3HKZA 4NBEA 2WAQA 4RVHA 3PO2I 3GTPI 4E2WA 4MRIA 3G711 3CC4Z 4A93I 2QRDB 3RZOI 5C44I 1Y1VS 1K9M2 1Q861 4MD7A 4EWCA 2WB1A 3TDHB 1YJNZ 3CQZI 3CCM1 5IP7I 3GKQA 3S2DI 2V8KA 1K9M1 3EEDA 5FLMI 3S17I 3I55Z 1ML8A 3OW2Y 3MZLB 1JJ2Y 4A3BI 3VMHA 2W04A 4BXXI 2H85A 2V8IA 1LQLA 1TWAI 2GTHA 2K5RA 1YJ9Z 4QTUA 2NVTI 3GTMI 4QTTA 2QEXZ 1VQ91 4A3KI 1NP6A 5T6BA 3I56Z 2OTL1 5C4JI 3KIHA 1VQK1 2F4OA 1Y1VI 3CCV1 3CXCY 1VQ8Z 4Y52I 3CME1 4NFRA 3CCRZ 3G6E1 3J80f 4HH4A 2F4MA 2KI7B 3I4NI 3JAMf 4A3II 1ZB9A 1Q822 3G4SZ 2V8JA 3P5JB 2R6MA 2M6NA 1VQ71 2VF1A 1VQ5Z 1W2BY 4A3MI 4E32A 4NBAA 2QKDA 2QA41 1Q821 1YUAA 2R7ZI 1VQ4Z 1I6HI 2LFUA 2RPRA 3J81b 2VUMI 1VQMZ 1K83I 3U50C 2KPIA 1QVFY 1RO2A 3CCQ1 2PK7A 2JA8I 3CD6Z 3I07A 3HOZI 2PM9A 1YIJZ 3J7A4 1YHQZ 3GTLI 2ZAEB 3MONA 2HF1A 2RT9A 1NJI2 1VQO1 1X3WA 1I50I 2RBLA 4RVDA 3CC21 4NH1C 1R9TI 3CCL1 4NBDA 2JA6I 3CC7Z 1RNIA 1USPB 5IT9b 2OTJZ 4MH4A 1VQL1 4A3EI 3F3FC 2I3CA 3VB9A 3H3VJ 5T64A 1NJI1 3TE5B 1QVGZ 3PO3S 1VLAA 3NDJA 2J6AA 4DGLA 1VQP1 3CMAZ 2JUBA 1TWGI 3M4OI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBH A;  1TWC I;  5C4J I;  3HOV I;  1SFO I;  4A3G I;  2F4O A;  1Y1V I;  1USP A;  3HOX I;  4NBB A;  3HOW I;  4Y52 I;  3K7A I;  1L1O C;  3RZD I;  4BBS I;  4NBF A;  3GTG I;  2JA5 I;  1DL6 A;  2R93 I;  2F4M A;  2NVY I;  5CM2 M;  3I4M I;  1I3Q I;  4BY7 I;  3I4N I;  2B63 I;  3S1N I;  4A3I I;  1N2F A;  1ZB9 A;  3S1Q I;  1Y1W I;  4XX2 A;  2NVQ I;  4NBG A;  2JS4 A;  4X6A I;  2R92 I;  4A3D I;  1ZB8 A;  3H0G I;  3LUS A;  3GTO I;  4A3M I;  4BBR I;  2JA7 I;  1NUI A;  1X3Z A;  3S16 I;  4A3L I;  4A3F I;  3PO3 I;  2DE7 A;  4NBA A;  5IP9 I;  2BJO A;  1YUA A;  3GTQ I;  1WCM I;  4NBC A;  2R7Z I;  2JNY A;  3S1R I;  1TWF I;  1I6H I;  3S1M I;  2VUM I;  3D6W A;  3GTM S;  1K83 I;  3U50 C;  2KPI A;  2DE5 A;  4NBE A;  4NOZ A;  3PO2 I;  2PK7 A;  3GTP I;  3S2H I;  3S15 I;  2JA8 I;  3VMI A;  3FKI I;  4A93 I;  1TWH I;  3RZO I;  3HOU I;  4A3C I;  5C44 I;  1Y1V S;  3I07 A;  3HOZ I;  3S14 I;  3GTL I;  2E2H I;  1WW9 A;  5C3E I;  3M3Y I;  1PFT A;  3GTK I;  2HF1 A;  3CQZ I;  5IP7 I;  3GKQ A;  1X3W A;  1I50 I;  2YU9 I;  3S2D I;  2RBL A;  4A3J I;  4NB9 A;  2NVX I;  3EER A;  5FLM I;  1R9T I;  1QYP A;  4NBD A;  3GTJ I;  3GCF A;  3M4O I;  4Y7N I;  2JA6 I;  1USP B;  3S17 I;  4MH4 A;  1ML8 A;  1RLY A;  2AKL A;  3ESW A;  3VMG A;  4A3B I;  4A3E I;  4BY1 I;  3VB9 A;  3H3V J;  2JR6 A;  2P3Y A;  3VMH A;  2DE6 A;  1RO4 A;  4BXX I;  2E2I I;  1LQL A;  3PO3 S;  1VLA A;  1TWA I;  3HOY I;  2K5R A;  2J6A A;  4QTU A;  2NVT I;  3GTM I;  2E2J I;  1TFI A;  4QTT A;  4A3K I;  1TWG I;  3Q87 A;  5C4X I;  4NB8 A; 
#chains in the Genus database with same CATH topology
 3BG0 B;  1SFO I;  3CPW Y;  1VQ6 1;  3HOX I;  1K73 2;  2JMO A;  2RIQ A;  4MD9 A;  3RZD I;  4BBS I;  2E7Z A;  2OOY B;  2JA5 I;  2R93 I;  2E9H A;  1S72 1;  1RO0 A;  5FLX f;  3CCU Z;  3S1N I;  4HGY A;  1Y1W I;  4NBG A;  2JS4 A;  4E2X A;  2R92 I;  1K73 1;  1N8R 2;  3NH8 A;  1KQS Z;  3GTO I;  3NFZ A;  2JA7 I;  1YIT 1;  3CCS Z;  1QXF A;  1M90 2;  1VQN 1;  3PO3 I;  2DE7 A;  3VTN A;  5IP9 I;  2VPX A;  3CCE Z;  1WII A;  1TWF I;  1Z03 A;  3S1M I;  3CC7 1;  2QLV B;  1N8R 1;  2Q4Z A;  2Q51 A;  4RS4 A;  5AN9 F;  3CC4 1;  3D6W A;  4RVF A;  1Z02 A;  1KD1 2;  1M90 1;  2Y0S A;  3CCJ Z;  1YI2 Z;  4RVG A;  3S2H I;  1YJW Z;  4E33 A;  1YJN 1;  1Z01 A;  3JAM b;  1TWH I;  4A3C I;  3BG1 B;  2IZ4 A;  3S14 I;  1QVG Y;  1KD1 1;  2JIM A;  3G71 Z;  1PFT A;  3I55 1;  2YU9 I;  1Q81 2;  3IX0 A;  4NB9 A;  5D1O B;  2NVX I;  1QYP A;  3QWU A;  3GTJ I;  5A2Q f;  3OW2 Z;  1Q7Y 2;  1JJ2 Z;  5D1P A;  3CCM Z;  2EGT A;  1YJ9 1;  2AKL A;  1S7M A;  3ESW A;  3VMG A;  2QEX 1;  2QRE B;  2O4H A;  2JR6 A;  1AA6 A;  2P3Y A;  3I56 1;  2E2I I;  2GU2 A;  1Q81 1;  3HOY I;  1TFI A;  4CL1 A;  1Q7Y 1;  2VUG A;  1VQ8 1;  3Q87 A;  2V3V A;  3NH4 A;  3CCR 1;  3HOV I;  3CXC Z;  1VQ9 Z;  1USP A;  3HOW I;  2OTL Z;  3G4S 1;  3FQQ A;  4MON A;  2NVY I;  1VQK Z;  3CCV Z;  3I4M I;  2M48 A;  3IR7 A;  1I3Q I;  1VQ5 1;  2GTI A;  1N2F A;  3CME Z;  3S1Q I;  1M1K 2;  3G6E Z;  4X6A I;  1W2B Z;  1FDI A;  1K8A 2;  2QRC B;  4A3D I;  3H0G I;  1VQ4 1;  3LUS A;  1Q16 A;  2RHB A;  4HGZ A;  1NUI A;  3IFU A;  3T4N B;  1VQM 1;  1VQ7 Z;  1M1K 1;  2P28 A;  3GTQ I;  1WCM I;  4NBC A;  2JNY A;  4DK1 A;  2K3R A;  2JIP A;  1K8A 1;  1QVF Z;  2QA4 Z;  3CD6 1;  2DE5 A;  4NOZ A;  1YIJ 1;  1RQF A;  2IZ3 A;  2PMZ A;  1YHQ 1;  3S15 I;  5FLX b;  3MZK B;  3VMI A;  3NDI A;  3FKI I;  3HOU I;  2JIO A;  3IF8 A;  1QF8 A;  3CCQ Z;  2E2H I;  1WW9 A;  5C3E I;  3FQM A;  1KC8 2;  3M3Y I;  3GTK I;  4MD8 A;  2OTJ 1;  4DQY B;  4E31 A;  4A3J I;  5LL6 f;  3J80 b;  3EER A;  4MXU A;  2OZK A;  4E2Y A;  3GCF A;  4Y7N I;  4RV9 A;  4E30 A;  1RLY A;  1VQO Z;  3CMA 1;  1KC8 1;  4BY1 I;  4E2Z A;  3CC2 Z;  2DE6 A;  1RO4 A;  3F3P C;  3CCL Z;  3D2L A;  1VQL Z;  5T67 A;  2E2J I;  1YUK A;  2OOX B;  1X0T A;  3D9X A;  5C4X I;  4NB8 A;  4NBH A;  3KIF A;  2VPY A;  1TWC I;  4AYB A;  3CPW Z;  5D1O A;  1VQP Z;  4A3G I;  2YAD A;  3J81 f;  1P9N A;  3CCU 1;  4NBB A;  2HU9 A;  3K7A I;  1L1O C;  1WZN A;  4NBF A;  3GTG I;  1DL6 A;  4TNU A;  2W03 A;  2G2K A;  5CM2 M;  1VQ6 Z;  5A2Q b;  4BY7 I;  2B63 I;  2NVQ I;  4XX2 A;  3CCS 1;  1ZH1 A;  3NH5 A;  4S1T A;  3CCE 1;  1S72 Z;  1ZB8 A;  4BBR I;  1X3Z A;  3S16 I;  1KQS Y;  1KRL A;  4A3L I;  4A3F I;  2BJO A;  2O53 A;  3CCJ 1;  2LIY A;  3S1R I;  2QR1 B;  5IT9 f;  1YIT Z;  1YI2 1;  1Q86 2;  1YJW 1;  1VQN Z;  1JWH C;  3GTM S;  3HKZ A;  4NBE A;  2WAQ A;  4RVH A;  2JIQ A;  3PO2 I;  3GTP I;  4E2W A;  4MRI A;  3G71 1;  3CC4 Z;  4A93 I;  2QRD B;  3RZO I;  5C44 I;  1Y1V S;  1K9M 2;  1Q86 1;  4MD7 A;  4EWC A;  2WB1 A;  2VPW A;  3TDH B;  2IV2 X;  1YJN Z;  3CQZ I;  3CCM 1;  5IP7 I;  3GKQ A;  3S2D I;  2V8K A;  1K9M 1;  3EED A;  5FLM I;  2LEX A;  3S17 I;  3I55 Z;  1ML8 A;  3OW2 Y;  3MZL B;  1JJ2 Y;  4A3B I;  3VMH A;  2W04 A;  4BXX I;  2H85 A;  2V8I A;  1LQL A;  1TWA I;  1Y8C A;  2GTH A;  2K5R A;  1YJ9 Z;  1WJ2 A;  4QTU A;  2NVT I;  3GTM I;  4QTT A;  2QEX Z;  1VQ9 1;  4A3K I;  1NP6 A;  5T6B A;  3I56 Z;  2JIR A;  2OTL 1;  5C4J I;  3KIH A;  1VQK 1;  2F4O A;  1Y1V I;  3CCV 1;  3CXC Y;  1VQ8 Z;  4Y52 I;  3CME 1;  4NFR A;  3CCR Z;  3G6E 1;  3J80 f;  4HH4 A;  2F4M A;  2KI7 B;  3I4N I;  3JAM f;  4A3I I;  1ZB9 A;  1Q82 2;  3G4S Z;  2V45 A;  2V8J A;  3P5J B;  2R6M A;  2M6N A;  1VQ7 1;  2VF1 A;  1SIW A;  1VQ5 Z;  1W2B Y;  4A3M I;  4E32 A;  4NBA A;  2QKD A;  2QA4 1;  1Q82 1;  1YUA A;  2R7Z I;  1VQ4 Z;  1I6H I;  2LFU A;  2AYD A;  2RPR A;  3J81 b;  2VUM I;  1VQM Z;  1K83 I;  3U50 C;  2KPI A;  1QVF Y;  1RO2 A;  2VPZ A;  3CCQ 1;  2PK7 A;  2JA8 I;  3CD6 Z;  3I07 A;  1FDO A;  3HOZ I;  2PM9 A;  1YIJ Z;  3J7A 4;  1YHQ Z;  2NAP A;  3GTL I;  2ZAE B;  3MON A;  2HF1 A;  2RT9 A;  1NJI 2;  1VQO 1;  1X3W A;  1I50 I;  2RBL A;  4RVD A;  3CC2 1;  4NH1 C;  1R9T I;  3CCL 1;  4NBD A;  2JA6 I;  3CC7 Z;  1RNI A;  1USP B;  5IT9 b;  2OTJ Z;  4MH4 A;  1VQL 1;  4A3E I;  3F3F C;  2I3C A;  3VB9 A;  3H3V J;  5T64 A;  1NJI 1;  3TE5 B;  1QVG Z;  3PO3 S;  1VLA A;  3NDJ A;  2J6A A;  4DGL A;  1VQP 1;  3CMA Z;  2JUB A;  1TWG I;  3M4O I; 
#chains in the Genus database with same CATH homology
 3BG0 B;  1SFO I;  3CPW Y;  1VQ6 1;  3HOX I;  1K73 2;  2JMO A;  2RIQ A;  4MD9 A;  3RZD I;  4BBS I;  2OOY B;  2JA5 I;  2R93 I;  2E9H A;  1S72 1;  1RO0 A;  5FLX f;  3CCU Z;  3S1N I;  4HGY A;  1Y1W I;  4NBG A;  2JS4 A;  4E2X A;  2R92 I;  1K73 1;  1N8R 2;  3NH8 A;  1KQS Z;  3GTO I;  3NFZ A;  2JA7 I;  1YIT 1;  3CCS Z;  1M90 2;  1VQN 1;  3PO3 I;  2DE7 A;  3VTN A;  5IP9 I;  3CCE Z;  1WII A;  1TWF I;  1Z03 A;  3S1M I;  3CC7 1;  2QLV B;  1N8R 1;  2Q4Z A;  2Q51 A;  4RS4 A;  5AN9 F;  3CC4 1;  3D6W A;  4RVF A;  1Z02 A;  1KD1 2;  1M90 1;  2Y0S A;  3CCJ Z;  1YI2 Z;  4RVG A;  3S2H I;  1YJW Z;  4E33 A;  1YJN 1;  1Z01 A;  3JAM b;  1TWH I;  4A3C I;  3BG1 B;  2IZ4 A;  3S14 I;  1QVG Y;  1KD1 1;  3G71 Z;  1PFT A;  3I55 1;  2YU9 I;  1Q81 2;  3IX0 A;  4NB9 A;  5D1O B;  2NVX I;  1QYP A;  3QWU A;  3GTJ I;  5A2Q f;  3OW2 Z;  1Q7Y 2;  1JJ2 Z;  5D1P A;  3CCM Z;  2EGT A;  1YJ9 1;  2AKL A;  1S7M A;  3ESW A;  3VMG A;  2QEX 1;  2QRE B;  2O4H A;  2JR6 A;  2P3Y A;  3I56 1;  2E2I I;  2GU2 A;  1Q81 1;  3HOY I;  1TFI A;  4CL1 A;  1Q7Y 1;  2VUG A;  1VQ8 1;  3Q87 A;  3NH4 A;  3CCR 1;  3HOV I;  3CXC Z;  1VQ9 Z;  1USP A;  3HOW I;  2OTL Z;  3G4S 1;  3FQQ A;  4MON A;  2NVY I;  1VQK Z;  3CCV Z;  3I4M I;  2M48 A;  1I3Q I;  1VQ5 1;  2GTI A;  1N2F A;  3CME Z;  3S1Q I;  1M1K 2;  3G6E Z;  4X6A I;  1W2B Z;  4A3D I;  1K8A 2;  2QRC B;  3H0G I;  1VQ4 1;  3LUS A;  2RHB A;  4HGZ A;  1NUI A;  3IFU A;  3T4N B;  1VQM 1;  1VQ7 Z;  1M1K 1;  2P28 A;  3GTQ I;  1WCM I;  4NBC A;  2JNY A;  4DK1 A;  2K3R A;  1K8A 1;  1QVF Z;  2QA4 Z;  3CD6 1;  2DE5 A;  4NOZ A;  1YIJ 1;  1RQF A;  2IZ3 A;  2PMZ A;  1YHQ 1;  3S15 I;  5FLX b;  3MZK B;  3VMI A;  3NDI A;  3FKI I;  3HOU I;  3IF8 A;  1QF8 A;  3CCQ Z;  2E2H I;  1WW9 A;  5C3E I;  3FQM A;  1KC8 2;  3M3Y I;  3GTK I;  4MD8 A;  2OTJ 1;  4DQY B;  4E31 A;  4A3J I;  5LL6 f;  3J80 b;  3EER A;  4MXU A;  2OZK A;  4E2Y A;  3GCF A;  4Y7N I;  4RV9 A;  4E30 A;  1RLY A;  1VQO Z;  3CMA 1;  1KC8 1;  4BY1 I;  4E2Z A;  3CC2 Z;  2DE6 A;  1RO4 A;  3F3P C;  3CCL Z;  1VQL Z;  5T67 A;  2E2J I;  1YUK A;  2OOX B;  1X0T A;  3D9X A;  5C4X I;  4NB8 A;  4NBH A;  3KIF A;  1TWC I;  4AYB A;  3CPW Z;  5D1O A;  1VQP Z;  4A3G I;  2YAD A;  3J81 f;  1P9N A;  3CCU 1;  4NBB A;  2HU9 A;  3K7A I;  1L1O C;  4NBF A;  3GTG I;  1DL6 A;  4TNU A;  2W03 A;  2G2K A;  5CM2 M;  1VQ6 Z;  5A2Q b;  4BY7 I;  2B63 I;  2NVQ I;  4XX2 A;  3CCS 1;  1ZH1 A;  3NH5 A;  4S1T A;  3CCE 1;  1S72 Z;  1ZB8 A;  4BBR I;  1X3Z A;  3S16 I;  1KQS Y;  1KRL A;  4A3L I;  4A3F I;  2BJO A;  2O53 A;  3CCJ 1;  2LIY A;  3S1R I;  2QR1 B;  5IT9 f;  1YIT Z;  1YI2 1;  1Q86 2;  1YJW 1;  1VQN Z;  1JWH C;  3GTM S;  3HKZ A;  4NBE A;  2WAQ A;  4RVH A;  3PO2 I;  3GTP I;  4E2W A;  4MRI A;  3G71 1;  3CC4 Z;  4A93 I;  2QRD B;  3RZO I;  5C44 I;  1Y1V S;  1K9M 2;  1Q86 1;  4MD7 A;  4EWC A;  2WB1 A;  3TDH B;  1YJN Z;  3CQZ I;  3CCM 1;  5IP7 I;  3GKQ A;  3S2D I;  2V8K A;  1K9M 1;  3EED A;  5FLM I;  3S17 I;  3I55 Z;  1ML8 A;  3OW2 Y;  3MZL B;  1JJ2 Y;  4A3B I;  3VMH A;  2W04 A;  4BXX I;  2H85 A;  2V8I A;  1LQL A;  1TWA I;  2GTH A;  2K5R A;  1YJ9 Z;  4QTU A;  2NVT I;  3GTM I;  4QTT A;  2QEX Z;  1VQ9 1;  4A3K I;  1NP6 A;  5T6B A;  3I56 Z;  2OTL 1;  5C4J I;  3KIH A;  1VQK 1;  2F4O A;  1Y1V I;  3CCV 1;  3CXC Y;  1VQ8 Z;  4Y52 I;  3CME 1;  4NFR A;  3CCR Z;  3G6E 1;  3J80 f;  4HH4 A;  2F4M A;  2KI7 B;  3I4N I;  3JAM f;  4A3I I;  1ZB9 A;  1Q82 2;  3G4S Z;  2V8J A;  3P5J B;  2R6M A;  2M6N A;  1VQ7 1;  2VF1 A;  1VQ5 Z;  1W2B Y;  4A3M I;  4E32 A;  4NBA A;  2QKD A;  2QA4 1;  1Q82 1;  1YUA A;  2R7Z I;  1VQ4 Z;  1I6H I;  2LFU A;  2RPR A;  3J81 b;  2VUM I;  1VQM Z;  1K83 I;  3U50 C;  2KPI A;  1QVF Y;  1RO2 A;  3CCQ 1;  2PK7 A;  2JA8 I;  3CD6 Z;  3I07 A;  3HOZ I;  2PM9 A;  1YIJ Z;  3J7A 4;  1YHQ Z;  3GTL I;  2ZAE B;  3MON A;  2HF1 A;  2RT9 A;  1NJI 2;  1VQO 1;  1X3W A;  1I50 I;  2RBL A;  4RVD A;  3CC2 1;  4NH1 C;  1R9T I;  3CCL 1;  4NBD A;  2JA6 I;  3CC7 Z;  1RNI A;  1USP B;  5IT9 b;  2OTJ Z;  4MH4 A;  1VQL 1;  4A3E I;  3F3F C;  2I3C A;  3VB9 A;  3H3V J;  5T64 A;  1NJI 1;  3TE5 B;  1QVG Z;  3PO3 S;  1VLA A;  3NDJ A;  2J6A A;  4DGL A;  1VQP 1;  3CMA Z;  2JUB A;  1TWG I;  3M4O I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...