2NVXI

Rna polymerase ii elongation complex in 5 mm mg+2 with 2'-dutp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvxI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2nvxI02
3RZDI 2J6AA 3S1QI 1X3ZA 3M3YI 1ZB9A 3H0GI 3VMGA 2NVYI 3GTGI 3H3VJ 2KPIA 1WCMI 1ZB8A 3S14I 4A3II 1Y1VI 4NBCA 1DL6A 3RZOI 5FLMI 1I50I 2DE6A 2RBLA 1VLAA 4A3EI 3M4OI 3GTOI 4Y52I 3GTMS 5C4XI 1RLYA 3PO3S 4BBRI 5IP9I 2BJOA 2R93I 2DE7A 4NBFA 2AKLA 1TWFI 1USPB 4A3BI 2JA5I 1K83I 1RO4A 1ML8A 4Y7NI 2JA8I 3FKII 5CM2M 3HOUI 1Y1VS 4NB9A 4NBHA 4A3FI 3S2DI 3S1NI 3GCFA 4A3GI 2JNYA 5C44I 3I4NI 2R7ZI 1YUAA 5C3EI 4NB8A 4NOZA 4A3MI 1TFIA 1PFTA 2JS4A 2K5RA 3S1RI 3CQZI 4A3CI 3GKQA 1NUIA 2JA6I 1I3QI 1LQLA 2R92I 3HOWI 4MH4A 3VMIA 4NBGA 2JR6A 4QTUA 3VB9A 4BY1I 2PK7A 1WW9A 2NVTI 4X6AI 2YU9I 2E2II 4BY7I 1X3WA 1N2FA 3HOVI 1TWGI 3VMHA 2E2JI 3GTMI 3HOXI 2VUMI 3S16I 4A3KI 2F4OA 1USPA 4XX2A 1L1OC 3U50C 4A93I 3ESWA 2JA7I 3GTQI 4A3DI 1R9TI 3GTPI 3GTLI 3I4MI 4BBSI 4NBEA 3GTKI 1I6HI 4NBBA 5IP7I 3S17I 3Q87A 3PO2I 3K7AI 3I07A 2P3YA 1SFOI 3S15I 2DE5A 3S2HI 3S1MI 2B63I 3LUSA 5C4JI 3GTJI 2HF1A 2F4MA 2NVQI 4A3JI 3EERA 2NVXI 3HOZI 4NBDA 3D6WA 1TWCI 3HOYI 3PO3I 2E2HI 4NBAA 4BXXI 1TWHI 1Y1WI 4A3LI 1QYPA 4QTTA 1TWAI
chains in the Genus database with same CATH superfamily
4E2YA 2GTHA 3M3YI 1Q821 3GTGI 1WCMI 1ZB8A 1KD11 1Y1VI 1QVGZ 3RZOI 1JJ2Y 2VUGA 4RV9A 3M4OI 1RLYA 3PO3S 5D1OA 4BBRI 1K8A2 5IP9I 1FDOA 1YJNZ 2BJOA 2R6MA 2E7ZA 1TWFI 1VQ81 4A3BI 4RS4A 1VQ7Z 3I551 4Y7NI 4RVHA 3HOUI 3NH8A 4NB9A 1W2BY 3T4NB 3S1NI 3CCQ1 3I4NI 1YUAA 1Q812 4A3MI 1TFIA 1VQ6Z 3S1RI 3CQZI 1LQLA 3CCR1 2R92I 1Q7Y1 3HOWI 1QXFA 4RVFA 3VMIA 3CCL1 3EEDA 3IX0A 2JIOA 2PK7A 1VQM1 2YU9I 1Q811 1N8R1 1X3WA 3CPWZ 4DQYB 3S16I 2E2JI 1YJW1 4A3KI 4A93I 3JAMf 4MD8A 1FDIA 1R9TI 2GU2A 3I4MI 3G711 1VQ41 4NBEA 3GTKI 2Q51A 4NBBA 1VQN1 2H85A 3CMA1 2B63I 2P28A 3LUSA 2WB1A 5C4JI 3GTJI 3EERA 3JAMb 2Y0SA 3PO3I 4BXXI 4S1TA 3G4S1 3CCV1 4QTTA 1S721 1RNIA 1VQ8Z 2EGTA 2G2KA 2J6AA 3S1QI 1NJI2 4E2WA 2YADA 4CL1A 1WIIA 3VMGA 3I55Z 2OTJ1 4DGLA 5D1OB 2QRDB 2RT9A 3CCQZ 5FLMI 1Q822 3CMEZ 1VLAA 3NFZA 2QA41 2IZ4A 2RHBA 3CXCZ 1K732 3CCRZ 3CCLZ 2IV2X 2AKLA 4MD7A 1USPB 1VQ91 3F3FC 1VQMZ 3J81f 1K83I 1AA6A 3FKII 3CCS1 3CCU1 3S2DI 4A3FI 1YJWZ 4MD9A 1K731 1RO0A 3IFUA 4NB8A 4NOZA 1YJ91 1KRLA 1SIWA 2JS4A 1JWHC 2K5RA 1M902 4A3CI 1QF8A 1Q16A 2NAPA 3G71Z 2JA6I 2LFUA 1YHQ1 3FQQA 1VQ4Z 4MH4A 3I561 4RVGA 1VQNZ 3J81b 4QTUA 3CCE1 2HU9A 3F3PC 3CMAZ 1Q861 4BY1I 1Q7Y2 1WW9A 2QEX1 1YUKA 1TWGI 4TNUA 3GTMI 1M901 2AYDA 1USPA 3CME1 1N8R2 3U50C 1QVFY 3ESWA 4MONA 3G4SZ 2VPYA 3CCVZ 1JJ2Z 4A3DI 1Z02A 1S72Z 1YITZ 2K3RA 2KI7B 2OTJZ 3K7AI 5IT9f 3CCJ1 3I07A 3CC71 1VQ51 2DE5A 3G6EZ 2WAQA 3S1MI 4NFRA 4E2XA 2VPWA 2HF1A 3OW2Y 2VPZA 4NBDA 2QA4Z 1TWCI 5FLXf 2JIMA 2PM9A 1W2BZ 4NBAA 4A3LI 1QYPA 1QVFZ 1TWAI 2LEXA 5IT9b 4HGYA 3NH4A 1VQ9Z 2M6NA 3H0GI 4DK1A 1RO2A 3H3VJ 2KPIA 1WJ2A 3CCSZ 2I3CA 4NBCA 3CCUZ 4NH1C 1DL6A 5FLXb 1K9M1 1VQK1 3OW2Z 2PMZA 4E30A 1YJ9Z 4Y52I 3CC41 3GTMS 5C4XI 1YHQZ 1KC81 2R93I 2DE7A 3I56Z 3CCEZ 1YIT1 3NH5A 1Z03A 2JA5I 2QREB 1RO4A 2QEXZ 1ML8A 2JA8I 1S7MA 1Y8CA 3G6E1 3TDHB 4A3GI 3GCFA 3CD61 3J7A4 3BG1B 2JNYA 2R7ZI 4E33A 3BG0B 5C3EI 2RPRA 5AN9F 1NP6A 1PFTA 1WZNA 3GKQA 5T6BA 2QLVB 1NUIA 2OZKA 1I3QI 5A2Qf 1VQL1 1VQO1 2ZAEB 3CCJZ 3CC7Z 2JR6A 3KIHA 1VQ5Z 1QVGY 3VB9A 2W03A 2OTL1 4X6AI 3CCM1 1Q862 3HOVI 2JIPA 2VUMI 5T67A 2F4OA 2IZ3A 1Z01A 1L1OC 2JMOA 4RVDA 2JA7I 3GTQI 3GTPI 3GTLI 5A2Qb 2OOXB 2RIQA 1I6HI 4HH4A 1YIJ1 3S17I 2P3YA 3S2HI 3VTNA 5LL6f 2OOYB 3CC21 2QKDA 2NVQI 1VQKZ 2NVXI 3HOZI 3D6WA 2GTIA 3CC4Z 2V3VA 3HOYI 5T64A 2O4HA 3J80f 3RZDI 1VQP1 1X3ZA 1ZB9A 3D2LA 2NVYI 3FQMA 3CPWY 3S14I 4A3II 2V45A 1YI21 2V8KA 4AYBA 3NDJA 3CD6Z 1I50I 3KIFA 4EWCA 2DE6A 1K8A1 2RBLA 4A3EI 4HGZA 3GTOI 3IR7A 4MRIA 3NDIA 3QWUA 2VF1A 1K9M2 3J80b 1VQLZ 1VQOZ 4NBFA 2QR1B 1P9NA 1KC82 2OTLZ 1X0TA 3MZLB 4E31A 4E32A 2JIRA 1KQSY 3CCMZ 5CM2M 1Y1VS 4NBHA 2O53A 5C44I 3P5JB 2LIYA 1RQFA 2JUBA 1YJN1 3D9XA 2M48A 1YIJZ 4NBGA 2W04A 2Q4ZA 4MXUA 3CC2Z 1VQ71 2NVTI 3MONA 3HKZA 2E2II 4BY7I 5D1PA 1N2FA 1KQSZ 3CXCY 3VMHA 3HOXI 3TE5B 4XX2A 2JIQA 1VQ61 4BBSI 1ZH1A 2VPXA 1VQPZ 1M1K2 3MZKB 5IP7I 3Q87A 3PO2I 3S15I 1SFOI 1YI2Z 2E9HA 2V8IA 2F4MA 4A3JI 1KD12 3IF8A 2E2HI 1TWHI 2QRCB 1Y1WI 1NJI1 2V8JA 1M1K1 4E2ZA
chains in the Genus database with same CATH topology
4E2YA 2GTHA 3M3YI 1Q821 3GTGI 1WCMI 1ZB8A 1KD11 1Y1VI 1QVGZ 3RZOI 1JJ2Y 2VUGA 4RV9A 3M4OI 1RLYA 3PO3S 5D1OA 4BBRI 1K8A2 5IP9I 1YJNZ 2BJOA 2R6MA 1TWFI 1VQ81 4A3BI 4RS4A 1VQ7Z 3I551 4Y7NI 4RVHA 3HOUI 3NH8A 4NB9A 1W2BY 3T4NB 3S1NI 3CCQ1 3I4NI 1YUAA 1Q812 4A3MI 1TFIA 1VQ6Z 3S1RI 3CQZI 1LQLA 3CCR1 2R92I 1Q7Y1 3HOWI 3VMIA 4RVFA 3CCL1 3EEDA 3IX0A 2PK7A 1VQM1 2YU9I 1Q811 1N8R1 1X3WA 3CPWZ 4DQYB 3S16I 2E2JI 1YJW1 4A3KI 4A93I 3JAMf 4MD8A 1R9TI 2GU2A 3I4MI 3G711 1VQ41 4NBEA 3GTKI 2Q51A 4NBBA 1VQN1 2H85A 3CMA1 2B63I 2P28A 3LUSA 2WB1A 5C4JI 3GTJI 3EERA 3JAMb 2Y0SA 3PO3I 4BXXI 4S1TA 3G4S1 3CCV1 4QTTA 1S721 1RNIA 1VQ8Z 2EGTA 2G2KA 2J6AA 3S1QI 1NJI2 4E2WA 2YADA 4CL1A 1WIIA 3VMGA 3I55Z 2OTJ1 4DGLA 5D1OB 2QRDB 2RT9A 3CCQZ 5FLMI 1Q822 3CMEZ 1VLAA 3NFZA 2QA41 2IZ4A 2RHBA 3CXCZ 1K732 3CCRZ 3CCLZ 2AKLA 4MD7A 1USPB 1VQ91 3F3FC 1VQMZ 3J81f 1K83I 3FKII 3CCS1 3CCU1 3S2DI 4A3FI 1YJWZ 4MD9A 1K731 1RO0A 3IFUA 4NB8A 4NOZA 1YJ91 1KRLA 2JS4A 1JWHC 2K5RA 1M902 4A3CI 1QF8A 3G71Z 2JA6I 2LFUA 1YHQ1 3FQQA 1VQ4Z 4MH4A 3I561 4RVGA 1VQNZ 3J81b 4QTUA 3CCE1 2HU9A 3F3PC 3CMAZ 1Q861 4BY1I 1Q7Y2 1WW9A 2QEX1 1YUKA 1TWGI 4TNUA 3GTMI 1M901 1USPA 3CME1 1N8R2 3U50C 1QVFY 3ESWA 4MONA 3G4SZ 1JJ2Z 3CCVZ 4A3DI 1Z02A 1S72Z 1YITZ 2K3RA 2KI7B 2OTJZ 3K7AI 5IT9f 3CCJ1 3I07A 3CC71 1VQ51 2DE5A 3G6EZ 2WAQA 3S1MI 4NFRA 4E2XA 2HF1A 3OW2Y 4NBDA 2QA4Z 1TWCI 5FLXf 2PM9A 1W2BZ 4NBAA 4A3LI 1QYPA 1QVFZ 1TWAI 5IT9b 4HGYA 3NH4A 1VQ9Z 2M6NA 3H0GI 4DK1A 1RO2A 3H3VJ 2KPIA 3CCSZ 2I3CA 4NBCA 3CCUZ 4NH1C 1DL6A 5FLXb 1K9M1 1VQK1 3OW2Z 2PMZA 4E30A 1YJ9Z 4Y52I 3CC41 3GTMS 5C4XI 1YHQZ 1KC81 2R93I 2DE7A 3I56Z 3CCEZ 1YIT1 3NH5A 1Z03A 2JA5I 2QREB 1RO4A 2QEXZ 1ML8A 2JA8I 1S7MA 3G6E1 3TDHB 4A3GI 3GCFA 3CD61 3J7A4 3BG1B 2JNYA 2R7ZI 4E33A 3BG0B 5C3EI 2RPRA 5AN9F 1NP6A 1PFTA 3GKQA 5T6BA 2QLVB 1NUIA 2OZKA 1I3QI 5A2Qf 1VQL1 1VQO1 2ZAEB 3CCJZ 3CC7Z 2JR6A 3KIHA 1VQ5Z 1QVGY 3VB9A 2W03A 2OTL1 4X6AI 3CCM1 1Q862 3HOVI 2VUMI 5T67A 2F4OA 2IZ3A 1Z01A 1L1OC 2JMOA 4RVDA 2JA7I 3GTQI 3GTPI 3GTLI 5A2Qb 2OOXB 2RIQA 1I6HI 4HH4A 1YIJ1 3S17I 2P3YA 3S2HI 3VTNA 5LL6f 2OOYB 3CC21 2QKDA 2NVQI 1VQKZ 2NVXI 3HOZI 3D6WA 2GTIA 3CC4Z 3HOYI 5T64A 2O4HA 3J80f 3RZDI 1VQP1 1X3ZA 1ZB9A 2NVYI 3FQMA 3CPWY 3S14I 4A3II 1YI21 2V8KA 4AYBA 3NDJA 3CD6Z 1I50I 3KIFA 4EWCA 2DE6A 1K8A1 2RBLA 4A3EI 4HGZA 3GTOI 4MRIA 3NDIA 3QWUA 2VF1A 1K9M2 3J80b 1VQLZ 1VQOZ 4NBFA 2QR1B 1P9NA 1KC82 2OTLZ 1X0TA 3MZLB 4E31A 4E32A 1KQSY 3CCMZ 5CM2M 1Y1VS 4NBHA 2O53A 5C44I 3P5JB 2LIYA 1RQFA 2JUBA 1YJN1 3D9XA 2M48A 1YIJZ 4NBGA 2W04A 2Q4ZA 4MXUA 3CC2Z 1VQ71 2NVTI 3MONA 3HKZA 2E2II 4BY7I 5D1PA 1N2FA 1KQSZ 3CXCY 3VMHA 3HOXI 3TE5B 4XX2A 1VQ61 4BBSI 1ZH1A 1VQPZ 1M1K2 3MZKB 5IP7I 3Q87A 3PO2I 3S15I 1SFOI 1YI2Z 2E9HA 2V8IA 2F4MA 4A3JI 1KD12 3IF8A 2E2HI 1TWHI 2QRCB 1Y1WI 1NJI1 2V8JA 1M1K1 4E2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZD I;  2J6A A;  3S1Q I;  1X3Z A;  3M3Y I;  1ZB9 A;  3H0G I;  3VMG A;  2NVY I;  3GTG I;  3H3V J;  2KPI A;  1WCM I;  1ZB8 A;  3S14 I;  4A3I I;  1Y1V I;  4NBC A;  1DL6 A;  3RZO I;  5FLM I;  1I50 I;  2DE6 A;  2RBL A;  1VLA A;  4A3E I;  3M4O I;  3GTO I;  4Y52 I;  3GTM S;  5C4X I;  1RLY A;  3PO3 S;  4BBR I;  5IP9 I;  2BJO A;  2R93 I;  2DE7 A;  4NBF A;  2AKL A;  1TWF I;  1USP B;  4A3B I;  2JA5 I;  1K83 I;  1RO4 A;  1ML8 A;  4Y7N I;  2JA8 I;  3FKI I;  5CM2 M;  3HOU I;  1Y1V S;  4NB9 A;  4NBH A;  4A3F I;  3S2D I;  3S1N I;  3GCF A;  4A3G I;  2JNY A;  5C44 I;  3I4N I;  2R7Z I;  1YUA A;  5C3E I;  4NB8 A;  4NOZ A;  4A3M I;  1TFI A;  1PFT A;  2JS4 A;  2K5R A;  3S1R I;  3CQZ I;  4A3C I;  3GKQ A;  1NUI A;  2JA6 I;  1I3Q I;  1LQL A;  2R92 I;  3HOW I;  4MH4 A;  3VMI A;  4NBG A;  2JR6 A;  4QTU A;  3VB9 A;  4BY1 I;  2PK7 A;  1WW9 A;  2NVT I;  4X6A I;  2YU9 I;  2E2I I;  4BY7 I;  1X3W A;  1N2F A;  3HOV I;  1TWG I;  3VMH A;  2E2J I;  3GTM I;  3HOX I;  2VUM I;  3S16 I;  4A3K I;  2F4O A;  1USP A;  4XX2 A;  1L1O C;  3U50 C;  4A93 I;  3ESW A;  2JA7 I;  3GTQ I;  4A3D I;  1R9T I;  3GTP I;  3GTL I;  3I4M I;  4BBS I;  4NBE A;  3GTK I;  1I6H I;  4NBB A;  5IP7 I;  3S17 I;  3Q87 A;  3PO2 I;  3K7A I;  3I07 A;  2P3Y A;  1SFO I;  3S15 I;  2DE5 A;  3S2H I;  3S1M I;  2B63 I;  3LUS A;  5C4J I;  3GTJ I;  2HF1 A;  2F4M A;  2NVQ I;  4A3J I;  3EER A;  2NVX I;  3HOZ I;  4NBD A;  3D6W A;  1TWC I;  3HOY I;  3PO3 I;  2E2H I;  4NBA A;  4BXX I;  1TWH I;  1Y1W I;  4A3L I;  1QYP A;  4QTT A;  1TWA I; 
#chains in the Genus database with same CATH topology
 4E2Y A;  2GTH A;  3M3Y I;  1Q82 1;  3GTG I;  1WCM I;  1ZB8 A;  1KD1 1;  1Y1V I;  1QVG Z;  3RZO I;  1JJ2 Y;  2VUG A;  4RV9 A;  3M4O I;  1RLY A;  3PO3 S;  5D1O A;  4BBR I;  1K8A 2;  5IP9 I;  1FDO A;  1YJN Z;  2BJO A;  2R6M A;  2E7Z A;  1TWF I;  1VQ8 1;  4A3B I;  4RS4 A;  1VQ7 Z;  3I55 1;  4Y7N I;  4RVH A;  3HOU I;  3NH8 A;  4NB9 A;  1W2B Y;  3T4N B;  3S1N I;  3CCQ 1;  3I4N I;  1YUA A;  1Q81 2;  4A3M I;  1TFI A;  1VQ6 Z;  3S1R I;  3CQZ I;  1LQL A;  3CCR 1;  2R92 I;  1Q7Y 1;  3HOW I;  1QXF A;  4RVF A;  3VMI A;  3CCL 1;  3EED A;  3IX0 A;  2JIO A;  2PK7 A;  1VQM 1;  2YU9 I;  1Q81 1;  1N8R 1;  1X3W A;  3CPW Z;  4DQY B;  3S16 I;  2E2J I;  1YJW 1;  4A3K I;  4A93 I;  3JAM f;  4MD8 A;  1FDI A;  1R9T I;  2GU2 A;  3I4M I;  3G71 1;  1VQ4 1;  4NBE A;  3GTK I;  2Q51 A;  4NBB A;  1VQN 1;  2H85 A;  3CMA 1;  2B63 I;  2P28 A;  3LUS A;  2WB1 A;  5C4J I;  3GTJ I;  3EER A;  3JAM b;  2Y0S A;  3PO3 I;  4BXX I;  4S1T A;  3G4S 1;  3CCV 1;  4QTT A;  1S72 1;  1RNI A;  1VQ8 Z;  2EGT A;  2G2K A;  2J6A A;  3S1Q I;  1NJI 2;  4E2W A;  2YAD A;  4CL1 A;  1WII A;  3VMG A;  3I55 Z;  2OTJ 1;  4DGL A;  5D1O B;  2QRD B;  2RT9 A;  3CCQ Z;  5FLM I;  1Q82 2;  3CME Z;  1VLA A;  3NFZ A;  2QA4 1;  2IZ4 A;  2RHB A;  3CXC Z;  1K73 2;  3CCR Z;  3CCL Z;  2IV2 X;  2AKL A;  4MD7 A;  1USP B;  1VQ9 1;  3F3F C;  1VQM Z;  3J81 f;  1K83 I;  1AA6 A;  3FKI I;  3CCS 1;  3CCU 1;  3S2D I;  4A3F I;  1YJW Z;  4MD9 A;  1K73 1;  1RO0 A;  3IFU A;  4NB8 A;  4NOZ A;  1YJ9 1;  1KRL A;  1SIW A;  2JS4 A;  1JWH C;  2K5R A;  1M90 2;  4A3C I;  1QF8 A;  1Q16 A;  2NAP A;  3G71 Z;  2JA6 I;  2LFU A;  1YHQ 1;  3FQQ A;  1VQ4 Z;  4MH4 A;  3I56 1;  4RVG A;  1VQN Z;  3J81 b;  4QTU A;  3CCE 1;  2HU9 A;  3F3P C;  3CMA Z;  1Q86 1;  4BY1 I;  1Q7Y 2;  1WW9 A;  2QEX 1;  1YUK A;  1TWG I;  4TNU A;  3GTM I;  1M90 1;  2AYD A;  1USP A;  3CME 1;  1N8R 2;  3U50 C;  1QVF Y;  3ESW A;  4MON A;  3G4S Z;  2VPY A;  3CCV Z;  1JJ2 Z;  4A3D I;  1Z02 A;  1S72 Z;  1YIT Z;  2K3R A;  2KI7 B;  2OTJ Z;  3K7A I;  5IT9 f;  3CCJ 1;  3I07 A;  3CC7 1;  1VQ5 1;  2DE5 A;  3G6E Z;  2WAQ A;  3S1M I;  4NFR A;  4E2X A;  2VPW A;  2HF1 A;  3OW2 Y;  2VPZ A;  4NBD A;  2QA4 Z;  1TWC I;  5FLX f;  2JIM A;  2PM9 A;  1W2B Z;  4NBA A;  4A3L I;  1QYP A;  1QVF Z;  1TWA I;  2LEX A;  5IT9 b;  4HGY A;  3NH4 A;  1VQ9 Z;  2M6N A;  3H0G I;  4DK1 A;  1RO2 A;  3H3V J;  2KPI A;  1WJ2 A;  3CCS Z;  2I3C A;  4NBC A;  3CCU Z;  4NH1 C;  1DL6 A;  5FLX b;  1K9M 1;  1VQK 1;  3OW2 Z;  2PMZ A;  4E30 A;  1YJ9 Z;  4Y52 I;  3CC4 1;  3GTM S;  5C4X I;  1YHQ Z;  1KC8 1;  2R93 I;  2DE7 A;  3I56 Z;  3CCE Z;  1YIT 1;  3NH5 A;  1Z03 A;  2JA5 I;  2QRE B;  1RO4 A;  2QEX Z;  1ML8 A;  2JA8 I;  1S7M A;  1Y8C A;  3G6E 1;  3TDH B;  4A3G I;  3GCF A;  3CD6 1;  3J7A 4;  3BG1 B;  2JNY A;  2R7Z I;  4E33 A;  3BG0 B;  5C3E I;  2RPR A;  5AN9 F;  1NP6 A;  1PFT A;  1WZN A;  3GKQ A;  5T6B A;  2QLV B;  1NUI A;  2OZK A;  1I3Q I;  5A2Q f;  1VQL 1;  1VQO 1;  2ZAE B;  3CCJ Z;  3CC7 Z;  2JR6 A;  3KIH A;  1VQ5 Z;  1QVG Y;  3VB9 A;  2W03 A;  2OTL 1;  4X6A I;  3CCM 1;  1Q86 2;  3HOV I;  2JIP A;  2VUM I;  5T67 A;  2F4O A;  2IZ3 A;  1Z01 A;  1L1O C;  2JMO A;  4RVD A;  2JA7 I;  3GTQ I;  3GTP I;  3GTL I;  5A2Q b;  2OOX B;  2RIQ A;  1I6H I;  4HH4 A;  1YIJ 1;  3S17 I;  2P3Y A;  3S2H I;  3VTN A;  5LL6 f;  2OOY B;  3CC2 1;  2QKD A;  2NVQ I;  1VQK Z;  2NVX I;  3HOZ I;  3D6W A;  2GTI A;  3CC4 Z;  2V3V A;  3HOY I;  5T64 A;  2O4H A;  3J80 f;  3RZD I;  1VQP 1;  1X3Z A;  1ZB9 A;  3D2L A;  2NVY I;  3FQM A;  3CPW Y;  3S14 I;  4A3I I;  2V45 A;  1YI2 1;  2V8K A;  4AYB A;  3NDJ A;  3CD6 Z;  1I50 I;  3KIF A;  4EWC A;  2DE6 A;  1K8A 1;  2RBL A;  4A3E I;  4HGZ A;  3GTO I;  3IR7 A;  4MRI A;  3NDI A;  3QWU A;  2VF1 A;  1K9M 2;  3J80 b;  1VQL Z;  1VQO Z;  4NBF A;  2QR1 B;  1P9N A;  1KC8 2;  2OTL Z;  1X0T A;  3MZL B;  4E31 A;  4E32 A;  2JIR A;  1KQS Y;  3CCM Z;  5CM2 M;  1Y1V S;  4NBH A;  2O53 A;  5C44 I;  3P5J B;  2LIY A;  1RQF A;  2JUB A;  1YJN 1;  3D9X A;  2M48 A;  1YIJ Z;  4NBG A;  2W04 A;  2Q4Z A;  4MXU A;  3CC2 Z;  1VQ7 1;  2NVT I;  3MON A;  3HKZ A;  2E2I I;  4BY7 I;  5D1P A;  1N2F A;  1KQS Z;  3CXC Y;  3VMH A;  3HOX I;  3TE5 B;  4XX2 A;  2JIQ A;  1VQ6 1;  4BBS I;  1ZH1 A;  2VPX A;  1VQP Z;  1M1K 2;  3MZK B;  5IP7 I;  3Q87 A;  3PO2 I;  3S15 I;  1SFO I;  1YI2 Z;  2E9H A;  2V8I A;  2F4M A;  4A3J I;  1KD1 2;  3IF8 A;  2E2H I;  1TWH I;  2QRC B;  1Y1W I;  1NJI 1;  2V8J A;  1M1K 1;  4E2Z A; 
#chains in the Genus database with same CATH homology
 4E2Y A;  2GTH A;  3M3Y I;  1Q82 1;  3GTG I;  1WCM I;  1ZB8 A;  1KD1 1;  1Y1V I;  1QVG Z;  3RZO I;  1JJ2 Y;  2VUG A;  4RV9 A;  3M4O I;  1RLY A;  3PO3 S;  5D1O A;  4BBR I;  1K8A 2;  5IP9 I;  1YJN Z;  2BJO A;  2R6M A;  1TWF I;  1VQ8 1;  4A3B I;  4RS4 A;  1VQ7 Z;  3I55 1;  4Y7N I;  4RVH A;  3HOU I;  3NH8 A;  4NB9 A;  1W2B Y;  3T4N B;  3S1N I;  3CCQ 1;  3I4N I;  1YUA A;  1Q81 2;  4A3M I;  1TFI A;  1VQ6 Z;  3S1R I;  3CQZ I;  1LQL A;  3CCR 1;  2R92 I;  1Q7Y 1;  3HOW I;  3VMI A;  4RVF A;  3CCL 1;  3EED A;  3IX0 A;  2PK7 A;  1VQM 1;  2YU9 I;  1Q81 1;  1N8R 1;  1X3W A;  3CPW Z;  4DQY B;  3S16 I;  2E2J I;  1YJW 1;  4A3K I;  4A93 I;  3JAM f;  4MD8 A;  1R9T I;  2GU2 A;  3I4M I;  3G71 1;  1VQ4 1;  4NBE A;  3GTK I;  2Q51 A;  4NBB A;  1VQN 1;  2H85 A;  3CMA 1;  2B63 I;  2P28 A;  3LUS A;  2WB1 A;  5C4J I;  3GTJ I;  3EER A;  3JAM b;  2Y0S A;  3PO3 I;  4BXX I;  4S1T A;  3G4S 1;  3CCV 1;  4QTT A;  1S72 1;  1RNI A;  1VQ8 Z;  2EGT A;  2G2K A;  2J6A A;  3S1Q I;  1NJI 2;  4E2W A;  2YAD A;  4CL1 A;  1WII A;  3VMG A;  3I55 Z;  2OTJ 1;  4DGL A;  5D1O B;  2QRD B;  2RT9 A;  3CCQ Z;  5FLM I;  1Q82 2;  3CME Z;  1VLA A;  3NFZ A;  2QA4 1;  2IZ4 A;  2RHB A;  3CXC Z;  1K73 2;  3CCR Z;  3CCL Z;  2AKL A;  4MD7 A;  1USP B;  1VQ9 1;  3F3F C;  1VQM Z;  3J81 f;  1K83 I;  3FKI I;  3CCS 1;  3CCU 1;  3S2D I;  4A3F I;  1YJW Z;  4MD9 A;  1K73 1;  1RO0 A;  3IFU A;  4NB8 A;  4NOZ A;  1YJ9 1;  1KRL A;  2JS4 A;  1JWH C;  2K5R A;  1M90 2;  4A3C I;  1QF8 A;  3G71 Z;  2JA6 I;  2LFU A;  1YHQ 1;  3FQQ A;  1VQ4 Z;  4MH4 A;  3I56 1;  4RVG A;  1VQN Z;  3J81 b;  4QTU A;  3CCE 1;  2HU9 A;  3F3P C;  3CMA Z;  1Q86 1;  4BY1 I;  1Q7Y 2;  1WW9 A;  2QEX 1;  1YUK A;  1TWG I;  4TNU A;  3GTM I;  1M90 1;  1USP A;  3CME 1;  1N8R 2;  3U50 C;  1QVF Y;  3ESW A;  4MON A;  3G4S Z;  1JJ2 Z;  3CCV Z;  4A3D I;  1Z02 A;  1S72 Z;  1YIT Z;  2K3R A;  2KI7 B;  2OTJ Z;  3K7A I;  5IT9 f;  3CCJ 1;  3I07 A;  3CC7 1;  1VQ5 1;  2DE5 A;  3G6E Z;  2WAQ A;  3S1M I;  4NFR A;  4E2X A;  2HF1 A;  3OW2 Y;  4NBD A;  2QA4 Z;  1TWC I;  5FLX f;  2PM9 A;  1W2B Z;  4NBA A;  4A3L I;  1QYP A;  1QVF Z;  1TWA I;  5IT9 b;  4HGY A;  3NH4 A;  1VQ9 Z;  2M6N A;  3H0G I;  4DK1 A;  1RO2 A;  3H3V J;  2KPI A;  3CCS Z;  2I3C A;  4NBC A;  3CCU Z;  4NH1 C;  1DL6 A;  5FLX b;  1K9M 1;  1VQK 1;  3OW2 Z;  2PMZ A;  4E30 A;  1YJ9 Z;  4Y52 I;  3CC4 1;  3GTM S;  5C4X I;  1YHQ Z;  1KC8 1;  2R93 I;  2DE7 A;  3I56 Z;  3CCE Z;  1YIT 1;  3NH5 A;  1Z03 A;  2JA5 I;  2QRE B;  1RO4 A;  2QEX Z;  1ML8 A;  2JA8 I;  1S7M A;  3G6E 1;  3TDH B;  4A3G I;  3GCF A;  3CD6 1;  3J7A 4;  3BG1 B;  2JNY A;  2R7Z I;  4E33 A;  3BG0 B;  5C3E I;  2RPR A;  5AN9 F;  1NP6 A;  1PFT A;  3GKQ A;  5T6B A;  2QLV B;  1NUI A;  2OZK A;  1I3Q I;  5A2Q f;  1VQL 1;  1VQO 1;  2ZAE B;  3CCJ Z;  3CC7 Z;  2JR6 A;  3KIH A;  1VQ5 Z;  1QVG Y;  3VB9 A;  2W03 A;  2OTL 1;  4X6A I;  3CCM 1;  1Q86 2;  3HOV I;  2VUM I;  5T67 A;  2F4O A;  2IZ3 A;  1Z01 A;  1L1O C;  2JMO A;  4RVD A;  2JA7 I;  3GTQ I;  3GTP I;  3GTL I;  5A2Q b;  2OOX B;  2RIQ A;  1I6H I;  4HH4 A;  1YIJ 1;  3S17 I;  2P3Y A;  3S2H I;  3VTN A;  5LL6 f;  2OOY B;  3CC2 1;  2QKD A;  2NVQ I;  1VQK Z;  2NVX I;  3HOZ I;  3D6W A;  2GTI A;  3CC4 Z;  3HOY I;  5T64 A;  2O4H A;  3J80 f;  3RZD I;  1VQP 1;  1X3Z A;  1ZB9 A;  2NVY I;  3FQM A;  3CPW Y;  3S14 I;  4A3I I;  1YI2 1;  2V8K A;  4AYB A;  3NDJ A;  3CD6 Z;  1I50 I;  3KIF A;  4EWC A;  2DE6 A;  1K8A 1;  2RBL A;  4A3E I;  4HGZ A;  3GTO I;  4MRI A;  3NDI A;  3QWU A;  2VF1 A;  1K9M 2;  3J80 b;  1VQL Z;  1VQO Z;  4NBF A;  2QR1 B;  1P9N A;  1KC8 2;  2OTL Z;  1X0T A;  3MZL B;  4E31 A;  4E32 A;  1KQS Y;  3CCM Z;  5CM2 M;  1Y1V S;  4NBH A;  2O53 A;  5C44 I;  3P5J B;  2LIY A;  1RQF A;  2JUB A;  1YJN 1;  3D9X A;  2M48 A;  1YIJ Z;  4NBG A;  2W04 A;  2Q4Z A;  4MXU A;  3CC2 Z;  1VQ7 1;  2NVT I;  3MON A;  3HKZ A;  2E2I I;  4BY7 I;  5D1P A;  1N2F A;  1KQS Z;  3CXC Y;  3VMH A;  3HOX I;  3TE5 B;  4XX2 A;  1VQ6 1;  4BBS I;  1ZH1 A;  1VQP Z;  1M1K 2;  3MZK B;  5IP7 I;  3Q87 A;  3PO2 I;  3S15 I;  1SFO I;  1YI2 Z;  2E9H A;  2V8I A;  2F4M A;  4A3J I;  1KD1 2;  3IF8 A;  2E2H I;  1TWH I;  2QRC B;  1Y1W I;  1NJI 1;  2V8J A;  1M1K 1;  4E2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...