1QF8A

Truncated form of casein kinase ii beta subunit (2-182) from homo sapiens
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
173
structure length
167
Chain Sequence
b'VSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASEIN KINASE II
publication title Crystal structure of the human protein kinase CK2 regulatory subunit reveals its zinc finger-mediated dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 41
structure length 167
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.7.1.37: Transferred entry: 2.7.11.1, 2.7.11.8, 2.7.11.9, 2.7.11.10, 2.7.11.11,
pdb deposition date 1999-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 1qf8A01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qf8A02
1QF8A 4NH1C 2JMOA 3EEDA 4MD8A 2RT9A 4DGLA 1JWHC 2R6MA 4MD9A 2M6NA 2M48A 1RQFA 4MD7A
chains in the Genus database with same CATH superfamily
2Y0SA 2I3CA 3JAMf 2Q51A 1X3ZA 1VQ8Z 2F4MA 1NUIA 2NVYI 1YJN1 4A3KI 4E32A 2J6AA 3I551 4NBGA 3CCEZ 4X6AI 4E31A 5C44I 3NFZA 1USPA 3S1MI 3U50C 2K5RA 2JS4A 2VPXA 1YHQ1 3CMAZ 4NBDA 3HOYI 1QVFY 3IX0A 3D9XA 1Z01A 3PO2I 2W03A 3BG0B 2JA8I 3CCJZ 4E2ZA 3GTGI 2W04A 3CCQ1 1QVGY 2AKLA 3HOZI 2JUBA 1VQMZ 3H0GI 1WZNA 4BBRI 2JNYA 4NBFA 1VQLZ 4A3GI 3CCUZ 1WJ2A 3Q87A 1Q861 3FQQA 1FDIA 2JA5I 1VQPZ 3M4OI 1M1K2 3CC71 1WW9A 1W2BY 1VLAA 2PM9A 1Q7Y1 2JIOA 3CXCY 4Y52I 1M901 3BG1B 2R93I 2R6MA 2B63I 3IR7A 3VTNA 4QTUA 1VQ81 1K8A2 1Y1WI 2YADA 1VQ5Z 2NVXI 3OW2Y 1VQ6Z 4A3DI 2WAQA 5LL6f 4XX2A 2QKDA 2RPRA 1WIIA 2K3RA 5IP7I 2VPWA 1YI21 3HOVI 3M3YI 2VUGA 3EEDA 2QRDB 2GTHA 2OTJZ 4A3EI 4QTTA 1YUKA 2NAPA 2QA4Z 1KC81 1I50I 1Y1VS 4E33A 1VQK1 3NDIA 1KQSZ 1VQM1 3GTJI 2OOYB 3D6WA 1VQ7Z 1VQL1 2E2II 3I07A 3S2DI 1N8R2 2JR6A 3NH8A 4RVGA 1VQP1 2V8JA 1NJI1 3GCFA 2IV2X 5FLXb 4RVDA 2R92I 2M6NA 4A3MI 1S7MA 1Y1VI 4RV9A 1VQ9Z 2QEXZ 4HGZA 3IFUA 4EWCA 3EERA 4E30A 1VQ51 2Q4ZA 3I4MI 2HF1A 4RVHA 3GTQI 2O53A 3CCLZ 3VMIA 4HGYA 1VQ61 2M48A 2H85A 3J80f 2RBLA 1JJ2Z 1TFIA 3G711 5IT9f 1Q812 1K9M1 3VMHA 1K83I 3F3PC 4TNUA 4NH1C 2V45A 4A3BI 2DE5A 3F3FC 2OTJ1 2BJOA 1Q862 1QVGZ 4MXUA 3KIFA 3S14I 2R7ZI 3JAMb 1R9TI 4MH4A 3NDJA 3LUSA 2LIYA 3GTKI 1Q7Y2 2LEXA 3CCR1 3PO3S 3H3VJ 4NFRA 3T4NB 4NOZA 4MD8A 3RZDI 4E2WA 1VQ91 1RQFA 2JMOA 1X3WA 1LQLA 1X0TA 3PO3I 3CC4Z 3G6EZ 2EGTA 3CCMZ 3CCL1 4DGLA 3GTLI 4MD9A 1K732 1VQOZ 3NH4A 1KD12 2IZ3A 4Y7NI 3S1RI 3IF8A 1YIJZ 2RIQA 3CCE1 1I6HI 3S1QI 3D2LA 1ML8A 5D1PA 2G2KA 2DE7A 2IZ4A 1YJ9Z 3FKII 2O4HA 3CCSZ 5C4JI 5T6BA 2E2HI 2ZAEB 1QYPA 1RNIA 1RO4A 2QREB 1Q822 3CMA1 1PFTA 1NJI2 2QRCB 3CCVZ 1RO0A 2GTIA 2OZKA 3CCJ1 3MZKB 3VMGA 4A3CI 1M1K1 3I56Z 2P3YA 1P9NA 3S15I 3G4SZ 4NB9A 4DQYB 1ZH1A 4NBHA 3CCU1 4MD7A 1YITZ 2E7ZA 3CPWY 3CC2Z 1K8A1 2OTLZ 1TWAI 2V8KA 1S72Z 4A3LI 1YHQZ 1RLYA 1L1OC 3MONA 3G6E1 3K7AI 4A3FI 2VPZA 3CCQZ 1VQO1 3S17I 4BXXI 1KRLA 1RO2A 4RVFA 4NBAA 1TWFI 2JA7I 1USPB 2AYDA 1YIJ1 1KQSY 4A3II 1VQNZ 2RHBA 3S16I 5IP9I 1FDOA 3TDHB 1Y8CA 1YJ91 3CCS1 2VPYA 3CC7Z 3I4NI 1YUAA 1QVFZ 1TWHI 1N8R1 3CCV1 3S1NI 4BBSI 1JWHC 2E9HA 3CD6Z 3I561 2QA41 1SIWA 3J81f 1DL6A 3J80b 2JA6I 3QWUA 3G4S1 1VQ71 1YIT1 1YJWZ 1M902 3HOXI 1JJ2Y 3CC21 3GTPI 1N2FA 5IT9b 4S1TA 2PMZA 2OTL1 5A2Qf 2KI7B 1W2BZ 1S721 2E2JI 5T64A 1YI2Z 5CM2M 3GKQA 3CXCZ 4BY1I 4NBBA 2QEX1 3RZOI 1Q811 3GTOI 5C3EI 3J81b 2PK7A 2F4OA 3OW2Z 1VQKZ 2WB1A 3KIHA 2JIMA 5D1OB 1VQN1 5AN9F 2V3VA 3GTMS 3CMEZ 5A2Qb 2VUMI 3HOUI 4MONA 2RT9A 4A3JI 5C4XI 1VQ4Z 1KC82 5T67A 1TWCI 1QF8A 1AA6A 1SFOI 3TE5B 2NVQI 1QXFA 2GU2A 4E2YA 3CD61 1Z03A 3GTMI 3HOWI 4NB8A 3S2HI 5FLMI 1YJNZ 3FQMA 1Z02A 2P28A 3CPWZ 2JIPA 4MRIA 2V8IA 2NVTI 1YJW1 5D1OA 3HKZA 3I55Z 3G71Z 1WCMI 2HU9A 5FLXf 1K731 2VF1A 4NBCA 1KD11 4RS4A 2OOXB 2QR1B 2DE6A 4BY7I 1Q16A 2JIRA 4CL1A 2KPIA 3P5JB 3CC41 2YU9I 3CCM1 1K9M2 1I3QI 3ESWA 4E2XA 3CCRZ 4NBEA 3CME1 1Q821 3NH5A 3CQZI 2LFUA 4HH4A 4A93I 2JIQA 1VQ41 1ZB9A 1TWGI 3VB9A 2QLVB 3J7A4 4AYBA 1NP6A 3MZLB 1ZB8A 4DK1A
chains in the Genus database with same CATH topology
2Y0SA 2I3CA 3JAMf 2Q51A 1X3ZA 1VQ8Z 2F4MA 1NUIA 2NVYI 1YJN1 4A3KI 4E32A 2J6AA 3I551 4NBGA 3CCEZ 4X6AI 4E31A 5C44I 3NFZA 1USPA 3S1MI 3U50C 2K5RA 2JS4A 1YHQ1 3CMAZ 4NBDA 3HOYI 1QVFY 3IX0A 3D9XA 1Z01A 3PO2I 2W03A 3BG0B 2JA8I 3CCJZ 4E2ZA 3GTGI 2W04A 3CCQ1 1QVGY 2AKLA 3HOZI 2JUBA 1VQMZ 3H0GI 4BBRI 2JNYA 4NBFA 1VQLZ 4A3GI 3CCUZ 3Q87A 1Q861 3FQQA 2JA5I 1VQPZ 3M4OI 1M1K2 3CC71 1WW9A 1W2BY 1VLAA 2PM9A 1Q7Y1 3CXCY 4Y52I 1M901 3BG1B 2R93I 2R6MA 2B63I 3VTNA 4QTUA 1VQ81 1K8A2 1Y1WI 2YADA 1VQ5Z 2NVXI 3OW2Y 1VQ6Z 4A3DI 2WAQA 5LL6f 4XX2A 2QKDA 2RPRA 1WIIA 2K3RA 5IP7I 1YI21 3HOVI 3M3YI 2VUGA 3EEDA 2QRDB 2GTHA 2OTJZ 4A3EI 4QTTA 1YUKA 2QA4Z 1KC81 1I50I 1Y1VS 4E33A 1VQK1 3NDIA 1KQSZ 1VQM1 3GTJI 2OOYB 3D6WA 1VQ7Z 1VQL1 2E2II 3I07A 3S2DI 1N8R2 2JR6A 3NH8A 4RVGA 1VQP1 2V8JA 1NJI1 3GCFA 5FLXb 4RVDA 2R92I 2M6NA 4A3MI 1S7MA 1Y1VI 4RV9A 1VQ9Z 2QEXZ 4HGZA 3IFUA 4EWCA 3EERA 4E30A 1VQ51 2Q4ZA 3I4MI 2HF1A 4RVHA 3GTQI 2O53A 3CCLZ 3VMIA 4HGYA 1VQ61 2M48A 2H85A 3J80f 2RBLA 1JJ2Z 1TFIA 3G711 5IT9f 1Q812 1K9M1 3VMHA 1K83I 3F3PC 4TNUA 4NH1C 4A3BI 2DE5A 3F3FC 2OTJ1 2BJOA 1Q862 1QVGZ 4MXUA 3KIFA 3S14I 2R7ZI 3JAMb 1R9TI 4MH4A 3NDJA 3LUSA 2LIYA 3GTKI 1Q7Y2 3CCR1 3PO3S 3H3VJ 4NFRA 3T4NB 4NOZA 4MD8A 3RZDI 4E2WA 1VQ91 1RQFA 2JMOA 1X3WA 1LQLA 1X0TA 3PO3I 3CC4Z 3G6EZ 2EGTA 3CCMZ 3CCL1 4DGLA 3GTLI 4MD9A 1K732 1VQOZ 3NH4A 1KD12 2IZ3A 4Y7NI 3S1RI 3IF8A 1YIJZ 2RIQA 3CCE1 1I6HI 3S1QI 1ML8A 5D1PA 2G2KA 2DE7A 2IZ4A 1YJ9Z 3FKII 2O4HA 3CCSZ 5C4JI 5T6BA 2E2HI 2ZAEB 1QYPA 1RNIA 1RO4A 2QREB 1Q822 3CMA1 1PFTA 1NJI2 2QRCB 3CCVZ 1RO0A 2GTIA 2OZKA 3CCJ1 3MZKB 3VMGA 4A3CI 1M1K1 3I56Z 2P3YA 1P9NA 3S15I 3G4SZ 4NB9A 4DQYB 1ZH1A 4NBHA 4MD7A 3CCU1 1YITZ 3CPWY 3CC2Z 1K8A1 2OTLZ 1TWAI 2V8KA 1S72Z 4A3LI 1YHQZ 1RLYA 1L1OC 3MONA 3G6E1 3K7AI 4A3FI 3CCQZ 1VQO1 3S17I 4BXXI 1KRLA 1RO2A 4RVFA 4NBAA 1TWFI 2JA7I 1USPB 1YIJ1 1KQSY 4A3II 1VQNZ 2RHBA 3S16I 5IP9I 3TDHB 1YJ91 3CCS1 3CC7Z 3I4NI 1YUAA 1QVFZ 1TWHI 1N8R1 3CCV1 3S1NI 4BBSI 1JWHC 2E9HA 3CD6Z 3I561 2QA41 3J81f 1DL6A 3J80b 2JA6I 3QWUA 3G4S1 1VQ71 1YIT1 1YJWZ 1M902 3HOXI 1JJ2Y 3CC21 3GTPI 1N2FA 5IT9b 4S1TA 2PMZA 2OTL1 5A2Qf 2KI7B 1W2BZ 1S721 2E2JI 5T64A 1YI2Z 5CM2M 3GKQA 3CXCZ 4BY1I 4NBBA 2QEX1 3RZOI 1Q811 3GTOI 5C3EI 3J81b 2PK7A 2F4OA 3OW2Z 1VQKZ 2WB1A 3KIHA 5D1OB 1VQN1 5AN9F 3GTMS 3CMEZ 5A2Qb 2VUMI 3HOUI 4MONA 2RT9A 4A3JI 5C4XI 1VQ4Z 1KC82 5T67A 1TWCI 1QF8A 1SFOI 3TE5B 2NVQI 2GU2A 4E2YA 3CD61 1Z03A 3GTMI 3HOWI 4NB8A 3S2HI 5FLMI 1YJNZ 3FQMA 1Z02A 2P28A 3CPWZ 4MRIA 2V8IA 2NVTI 1YJW1 5D1OA 3HKZA 3I55Z 3G71Z 1WCMI 2HU9A 5FLXf 1K731 2VF1A 4NBCA 1KD11 4RS4A 2OOXB 2QR1B 2DE6A 4BY7I 4CL1A 2KPIA 3P5JB 3CC41 2YU9I 3CCM1 1K9M2 1I3QI 3ESWA 4E2XA 3CCRZ 4NBEA 3CME1 1Q821 3NH5A 3CQZI 2LFUA 4HH4A 4A93I 1VQ41 1ZB9A 1TWGI 3VB9A 2QLVB 3J7A4 4AYBA 1NP6A 3MZLB 1ZB8A 4DK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QF8 A;  4NH1 C;  2JMO A;  3EED A;  4MD8 A;  2RT9 A;  4DGL A;  1JWH C;  2R6M A;  4MD9 A;  2M6N A;  2M48 A;  1RQF A;  4MD7 A; 
#chains in the Genus database with same CATH topology
 2Y0S A;  2I3C A;  3JAM f;  2Q51 A;  1X3Z A;  1VQ8 Z;  2F4M A;  1NUI A;  2NVY I;  1YJN 1;  4A3K I;  4E32 A;  2J6A A;  3I55 1;  4NBG A;  3CCE Z;  4X6A I;  4E31 A;  5C44 I;  3NFZ A;  1USP A;  3S1M I;  3U50 C;  2K5R A;  2JS4 A;  2VPX A;  1YHQ 1;  3CMA Z;  4NBD A;  3HOY I;  1QVF Y;  3IX0 A;  3D9X A;  1Z01 A;  3PO2 I;  2W03 A;  3BG0 B;  2JA8 I;  3CCJ Z;  4E2Z A;  3GTG I;  2W04 A;  3CCQ 1;  1QVG Y;  2AKL A;  3HOZ I;  2JUB A;  1VQM Z;  3H0G I;  1WZN A;  4BBR I;  2JNY A;  4NBF A;  1VQL Z;  4A3G I;  3CCU Z;  1WJ2 A;  3Q87 A;  1Q86 1;  3FQQ A;  1FDI A;  2JA5 I;  1VQP Z;  3M4O I;  1M1K 2;  3CC7 1;  1WW9 A;  1W2B Y;  1VLA A;  2PM9 A;  1Q7Y 1;  2JIO A;  3CXC Y;  4Y52 I;  1M90 1;  3BG1 B;  2R93 I;  2R6M A;  2B63 I;  3IR7 A;  3VTN A;  4QTU A;  1VQ8 1;  1K8A 2;  1Y1W I;  2YAD A;  1VQ5 Z;  2NVX I;  3OW2 Y;  1VQ6 Z;  4A3D I;  2WAQ A;  5LL6 f;  4XX2 A;  2QKD A;  2RPR A;  1WII A;  2K3R A;  5IP7 I;  2VPW A;  1YI2 1;  3HOV I;  3M3Y I;  2VUG A;  3EED A;  2QRD B;  2GTH A;  2OTJ Z;  4A3E I;  4QTT A;  1YUK A;  2NAP A;  2QA4 Z;  1KC8 1;  1I50 I;  1Y1V S;  4E33 A;  1VQK 1;  3NDI A;  1KQS Z;  1VQM 1;  3GTJ I;  2OOY B;  3D6W A;  1VQ7 Z;  1VQL 1;  2E2I I;  3I07 A;  3S2D I;  1N8R 2;  2JR6 A;  3NH8 A;  4RVG A;  1VQP 1;  2V8J A;  1NJI 1;  3GCF A;  2IV2 X;  5FLX b;  4RVD A;  2R92 I;  2M6N A;  4A3M I;  1S7M A;  1Y1V I;  4RV9 A;  1VQ9 Z;  2QEX Z;  4HGZ A;  3IFU A;  4EWC A;  3EER A;  4E30 A;  1VQ5 1;  2Q4Z A;  3I4M I;  2HF1 A;  4RVH A;  3GTQ I;  2O53 A;  3CCL Z;  3VMI A;  4HGY A;  1VQ6 1;  2M48 A;  2H85 A;  3J80 f;  2RBL A;  1JJ2 Z;  1TFI A;  3G71 1;  5IT9 f;  1Q81 2;  1K9M 1;  3VMH A;  1K83 I;  3F3P C;  4TNU A;  4NH1 C;  2V45 A;  4A3B I;  2DE5 A;  3F3F C;  2OTJ 1;  2BJO A;  1Q86 2;  1QVG Z;  4MXU A;  3KIF A;  3S14 I;  2R7Z I;  3JAM b;  1R9T I;  4MH4 A;  3NDJ A;  3LUS A;  2LIY A;  3GTK I;  1Q7Y 2;  2LEX A;  3CCR 1;  3PO3 S;  3H3V J;  4NFR A;  3T4N B;  4NOZ A;  4MD8 A;  3RZD I;  4E2W A;  1VQ9 1;  1RQF A;  2JMO A;  1X3W A;  1LQL A;  1X0T A;  3PO3 I;  3CC4 Z;  3G6E Z;  2EGT A;  3CCM Z;  3CCL 1;  4DGL A;  3GTL I;  4MD9 A;  1K73 2;  1VQO Z;  3NH4 A;  1KD1 2;  2IZ3 A;  4Y7N I;  3S1R I;  3IF8 A;  1YIJ Z;  2RIQ A;  3CCE 1;  1I6H I;  3S1Q I;  3D2L A;  1ML8 A;  5D1P A;  2G2K A;  2DE7 A;  2IZ4 A;  1YJ9 Z;  3FKI I;  2O4H A;  3CCS Z;  5C4J I;  5T6B A;  2E2H I;  2ZAE B;  1QYP A;  1RNI A;  1RO4 A;  2QRE B;  1Q82 2;  3CMA 1;  1PFT A;  1NJI 2;  2QRC B;  3CCV Z;  1RO0 A;  2GTI A;  2OZK A;  3CCJ 1;  3MZK B;  3VMG A;  4A3C I;  1M1K 1;  3I56 Z;  2P3Y A;  1P9N A;  3S15 I;  3G4S Z;  4NB9 A;  4DQY B;  1ZH1 A;  4NBH A;  3CCU 1;  4MD7 A;  1YIT Z;  2E7Z A;  3CPW Y;  3CC2 Z;  1K8A 1;  2OTL Z;  1TWA I;  2V8K A;  1S72 Z;  4A3L I;  1YHQ Z;  1RLY A;  1L1O C;  3MON A;  3G6E 1;  3K7A I;  4A3F I;  2VPZ A;  3CCQ Z;  1VQO 1;  3S17 I;  4BXX I;  1KRL A;  1RO2 A;  4RVF A;  4NBA A;  1TWF I;  2JA7 I;  1USP B;  2AYD A;  1YIJ 1;  1KQS Y;  4A3I I;  1VQN Z;  2RHB A;  3S16 I;  5IP9 I;  1FDO A;  3TDH B;  1Y8C A;  1YJ9 1;  3CCS 1;  2VPY A;  3CC7 Z;  3I4N I;  1YUA A;  1QVF Z;  1TWH I;  1N8R 1;  3CCV 1;  3S1N I;  4BBS I;  1JWH C;  2E9H A;  3CD6 Z;  3I56 1;  2QA4 1;  1SIW A;  3J81 f;  1DL6 A;  3J80 b;  2JA6 I;  3QWU A;  3G4S 1;  1VQ7 1;  1YIT 1;  1YJW Z;  1M90 2;  3HOX I;  1JJ2 Y;  3CC2 1;  3GTP I;  1N2F A;  5IT9 b;  4S1T A;  2PMZ A;  2OTL 1;  5A2Q f;  2KI7 B;  1W2B Z;  1S72 1;  2E2J I;  5T64 A;  1YI2 Z;  5CM2 M;  3GKQ A;  3CXC Z;  4BY1 I;  4NBB A;  2QEX 1;  3RZO I;  1Q81 1;  3GTO I;  5C3E I;  3J81 b;  2PK7 A;  2F4O A;  3OW2 Z;  1VQK Z;  2WB1 A;  3KIH A;  2JIM A;  5D1O B;  1VQN 1;  5AN9 F;  2V3V A;  3GTM S;  3CME Z;  5A2Q b;  2VUM I;  3HOU I;  4MON A;  2RT9 A;  4A3J I;  5C4X I;  1VQ4 Z;  1KC8 2;  5T67 A;  1TWC I;  1QF8 A;  1AA6 A;  1SFO I;  3TE5 B;  2NVQ I;  1QXF A;  2GU2 A;  4E2Y A;  3CD6 1;  1Z03 A;  3GTM I;  3HOW I;  4NB8 A;  3S2H I;  5FLM I;  1YJN Z;  3FQM A;  1Z02 A;  2P28 A;  3CPW Z;  2JIP A;  4MRI A;  2V8I A;  2NVT I;  1YJW 1;  5D1O A;  3HKZ A;  3I55 Z;  3G71 Z;  1WCM I;  2HU9 A;  5FLX f;  1K73 1;  2VF1 A;  4NBC A;  1KD1 1;  4RS4 A;  2OOX B;  2QR1 B;  2DE6 A;  4BY7 I;  1Q16 A;  2JIR A;  4CL1 A;  2KPI A;  3P5J B;  3CC4 1;  2YU9 I;  3CCM 1;  1K9M 2;  1I3Q I;  3ESW A;  4E2X A;  3CCR Z;  4NBE A;  3CME 1;  1Q82 1;  3NH5 A;  3CQZ I;  2LFU A;  4HH4 A;  4A93 I;  2JIQ A;  1VQ4 1;  1ZB9 A;  1TWG I;  3VB9 A;  2QLV B;  3J7A 4;  4AYB A;  1NP6 A;  3MZL B;  1ZB8 A;  4DK1 A; 
#chains in the Genus database with same CATH homology
 2Y0S A;  2I3C A;  3JAM f;  2Q51 A;  1X3Z A;  1VQ8 Z;  2F4M A;  1NUI A;  2NVY I;  1YJN 1;  4A3K I;  4E32 A;  2J6A A;  3I55 1;  4NBG A;  3CCE Z;  4X6A I;  4E31 A;  5C44 I;  3NFZ A;  1USP A;  3S1M I;  3U50 C;  2K5R A;  2JS4 A;  1YHQ 1;  3CMA Z;  4NBD A;  3HOY I;  1QVF Y;  3IX0 A;  3D9X A;  1Z01 A;  3PO2 I;  2W03 A;  3BG0 B;  2JA8 I;  3CCJ Z;  4E2Z A;  3GTG I;  2W04 A;  3CCQ 1;  1QVG Y;  2AKL A;  3HOZ I;  2JUB A;  1VQM Z;  3H0G I;  4BBR I;  2JNY A;  4NBF A;  1VQL Z;  4A3G I;  3CCU Z;  3Q87 A;  1Q86 1;  3FQQ A;  2JA5 I;  1VQP Z;  3M4O I;  1M1K 2;  3CC7 1;  1WW9 A;  1W2B Y;  1VLA A;  2PM9 A;  1Q7Y 1;  3CXC Y;  4Y52 I;  1M90 1;  3BG1 B;  2R93 I;  2R6M A;  2B63 I;  3VTN A;  4QTU A;  1VQ8 1;  1K8A 2;  1Y1W I;  2YAD A;  1VQ5 Z;  2NVX I;  3OW2 Y;  1VQ6 Z;  4A3D I;  2WAQ A;  5LL6 f;  4XX2 A;  2QKD A;  2RPR A;  1WII A;  2K3R A;  5IP7 I;  1YI2 1;  3HOV I;  3M3Y I;  2VUG A;  3EED A;  2QRD B;  2GTH A;  2OTJ Z;  4A3E I;  4QTT A;  1YUK A;  2QA4 Z;  1KC8 1;  1I50 I;  1Y1V S;  4E33 A;  1VQK 1;  3NDI A;  1KQS Z;  1VQM 1;  3GTJ I;  2OOY B;  3D6W A;  1VQ7 Z;  1VQL 1;  2E2I I;  3I07 A;  3S2D I;  1N8R 2;  2JR6 A;  3NH8 A;  4RVG A;  1VQP 1;  2V8J A;  1NJI 1;  3GCF A;  5FLX b;  4RVD A;  2R92 I;  2M6N A;  4A3M I;  1S7M A;  1Y1V I;  4RV9 A;  1VQ9 Z;  2QEX Z;  4HGZ A;  3IFU A;  4EWC A;  3EER A;  4E30 A;  1VQ5 1;  2Q4Z A;  3I4M I;  2HF1 A;  4RVH A;  3GTQ I;  2O53 A;  3CCL Z;  3VMI A;  4HGY A;  1VQ6 1;  2M48 A;  2H85 A;  3J80 f;  2RBL A;  1JJ2 Z;  1TFI A;  3G71 1;  5IT9 f;  1Q81 2;  1K9M 1;  3VMH A;  1K83 I;  3F3P C;  4TNU A;  4NH1 C;  4A3B I;  2DE5 A;  3F3F C;  2OTJ 1;  2BJO A;  1Q86 2;  1QVG Z;  4MXU A;  3KIF A;  3S14 I;  2R7Z I;  3JAM b;  1R9T I;  4MH4 A;  3NDJ A;  3LUS A;  2LIY A;  3GTK I;  1Q7Y 2;  3CCR 1;  3PO3 S;  3H3V J;  4NFR A;  3T4N B;  4NOZ A;  4MD8 A;  3RZD I;  4E2W A;  1VQ9 1;  1RQF A;  2JMO A;  1X3W A;  1LQL A;  1X0T A;  3PO3 I;  3CC4 Z;  3G6E Z;  2EGT A;  3CCM Z;  3CCL 1;  4DGL A;  3GTL I;  4MD9 A;  1K73 2;  1VQO Z;  3NH4 A;  1KD1 2;  2IZ3 A;  4Y7N I;  3S1R I;  3IF8 A;  1YIJ Z;  2RIQ A;  3CCE 1;  1I6H I;  3S1Q I;  1ML8 A;  5D1P A;  2G2K A;  2DE7 A;  2IZ4 A;  1YJ9 Z;  3FKI I;  2O4H A;  3CCS Z;  5C4J I;  5T6B A;  2E2H I;  2ZAE B;  1QYP A;  1RNI A;  1RO4 A;  2QRE B;  1Q82 2;  3CMA 1;  1PFT A;  1NJI 2;  2QRC B;  3CCV Z;  1RO0 A;  2GTI A;  2OZK A;  3CCJ 1;  3MZK B;  3VMG A;  4A3C I;  1M1K 1;  3I56 Z;  2P3Y A;  1P9N A;  3S15 I;  3G4S Z;  4NB9 A;  4DQY B;  1ZH1 A;  4NBH A;  4MD7 A;  3CCU 1;  1YIT Z;  3CPW Y;  3CC2 Z;  1K8A 1;  2OTL Z;  1TWA I;  2V8K A;  1S72 Z;  4A3L I;  1YHQ Z;  1RLY A;  1L1O C;  3MON A;  3G6E 1;  3K7A I;  4A3F I;  3CCQ Z;  1VQO 1;  3S17 I;  4BXX I;  1KRL A;  1RO2 A;  4RVF A;  4NBA A;  1TWF I;  2JA7 I;  1USP B;  1YIJ 1;  1KQS Y;  4A3I I;  1VQN Z;  2RHB A;  3S16 I;  5IP9 I;  3TDH B;  1YJ9 1;  3CCS 1;  3CC7 Z;  3I4N I;  1YUA A;  1QVF Z;  1TWH I;  1N8R 1;  3CCV 1;  3S1N I;  4BBS I;  1JWH C;  2E9H A;  3CD6 Z;  3I56 1;  2QA4 1;  3J81 f;  1DL6 A;  3J80 b;  2JA6 I;  3QWU A;  3G4S 1;  1VQ7 1;  1YIT 1;  1YJW Z;  1M90 2;  3HOX I;  1JJ2 Y;  3CC2 1;  3GTP I;  1N2F A;  5IT9 b;  4S1T A;  2PMZ A;  2OTL 1;  5A2Q f;  2KI7 B;  1W2B Z;  1S72 1;  2E2J I;  5T64 A;  1YI2 Z;  5CM2 M;  3GKQ A;  3CXC Z;  4BY1 I;  4NBB A;  2QEX 1;  3RZO I;  1Q81 1;  3GTO I;  5C3E I;  3J81 b;  2PK7 A;  2F4O A;  3OW2 Z;  1VQK Z;  2WB1 A;  3KIH A;  5D1O B;  1VQN 1;  5AN9 F;  3GTM S;  3CME Z;  5A2Q b;  2VUM I;  3HOU I;  4MON A;  2RT9 A;  4A3J I;  5C4X I;  1VQ4 Z;  1KC8 2;  5T67 A;  1TWC I;  1QF8 A;  1SFO I;  3TE5 B;  2NVQ I;  2GU2 A;  4E2Y A;  3CD6 1;  1Z03 A;  3GTM I;  3HOW I;  4NB8 A;  3S2H I;  5FLM I;  1YJN Z;  3FQM A;  1Z02 A;  2P28 A;  3CPW Z;  4MRI A;  2V8I A;  2NVT I;  1YJW 1;  5D1O A;  3HKZ A;  3I55 Z;  3G71 Z;  1WCM I;  2HU9 A;  5FLX f;  1K73 1;  2VF1 A;  4NBC A;  1KD1 1;  4RS4 A;  2OOX B;  2QR1 B;  2DE6 A;  4BY7 I;  4CL1 A;  2KPI A;  3P5J B;  3CC4 1;  2YU9 I;  3CCM 1;  1K9M 2;  1I3Q I;  3ESW A;  4E2X A;  3CCR Z;  4NBE A;  3CME 1;  1Q82 1;  3NH5 A;  3CQZ I;  2LFU A;  4HH4 A;  4A93 I;  1VQ4 1;  1ZB9 A;  1TWG I;  3VB9 A;  2QLV B;  3J7A 4;  4AYB A;  1NP6 A;  3MZL B;  1ZB8 A;  4DK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...