1QF8A

Truncated form of casein kinase ii beta subunit (2-182) from homo sapiens
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
173
structure length
167
Chain Sequence
VSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human protein kinase CK2 regulatory subunit reveals its zinc finger-mediated dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords CASEIN KINASE II
total genus 41
structure length 167
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.7.1.37: Transferred entry: 2.7.11.1, 2.7.11.8, 2.7.11.9, 2.7.11.10, 2.7.11.11,
pdb deposition date 1999-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 1qf8A01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qf8A02
4MD7A 2JMOA 4MD9A 2M48A 2RT9A 1QF8A 1JWHC 2M6NA 4MD8A 4NH1C 2R6MA 1RQFA 3EEDA 4DGLA
chains in the Genus database with same CATH superfamily
1VQM1 4MXUA 2F4MA 2E9HA 4E2YA 3G4S1 2J6AA 1YI21 2QRCB 4RS4A 2HU9A 1NJI1 3F3FC 3I07A 3VTNA 3GTMS 1K9M1 3CCQZ 3KIHA 3CC41 1Q7Y1 5D1PA 1ZB8A 3H3VJ 2G2KA 2W03A 1VQLZ 2OOYB 3CC4Z 3J7A4 3CCUZ 3G71Z 3RZDI 3MONA 4RV9A 1VQ6Z 1ZB9A 3I551 3G711 4MONA 4E2WA 3I56Z 2NVTI 2NVQI 5CM2M 4NBHA 1FDOA 2R7ZI 3CCV1 2B63I 1Y8CA 2K3RA 1TFIA 1WZNA 2JA5I 3VMIA 3VMHA 1R9TI 2JA8I 3CCE1 1VQ9Z 1Q16A 5LL6f 1VQPZ 4A3DI 3S1QI 2NVYI 3D2LA 3CCEZ 4DGLA 2KI7B 2V8KA 4A3BI 1M1K2 2LEXA 1KRLA 1K8A2 3GTMI 2DE6A 1VQ71 2QREB 1YHQ1 2YU9I 4E2XA 3NDJA 1AA6A 2HF1A 4NB8A 3GTLI 2WB1A 5T6BA 2M6NA 3S1NI 3I55Z 3Q87A 5FLXb 2V45A 1L1OC 2GTIA 3D6WA 3CCSZ 3CXCY 4RVFA 3J80f 2R93I 2V8JA 1YI2Z 3CD6Z 4Y52I 1M901 1PFTA 2PMZA 1S721 1YJN1 1QVFY 4BY7I 3J81f 3PO2I 1FDIA 1X3WA 1QXFA 3HOXI 2NAPA 1Z01A 1VQ7Z 2RPRA 3S1MI 2OTJ1 3HOWI 3NH8A 5FLXf 4HGYA 4QTUA 4NBDA 2OTL1 1KQSY 4RVDA 3TE5B 3I561 2Q51A 3NFZA 2F4OA 4MRIA 3CQZI 3CCVZ 3JAMf 1VQ41 1K9M2 1VQ5Z 1RO0A 2I3CA 2RT9A 4A3CI 2P28A 1VQ4Z 1QVGY 4TNUA 1VQ51 3K7AI 4E31A 1N8R1 3CCL1 4A3JI 3CXCZ 3GTKI 1M902 2E2HI 3CMA1 2RIQA 1VQ81 3CCQ1 3NH4A 4A3KI 2P3YA 1Q861 1Q811 3HKZA 4E2ZA 2K5RA 3S17I 1YJ91 2OTJZ 1W2BZ 2QA4Z 1NP6A 3IX0A 1N2FA 1TWCI 1QVGZ 3P5JB 3KIFA 2O53A 2H85A 3S1RI 1RO4A 2JIOA 4DQYB 3IF8A 3TDHB 4A3MI 1K8A1 1VQ91 1VQP1 5D1OA 3S15I 2IV2X 1Q821 4XX2A 2RBLA 3MZKB 2Q4ZA 4HGZA 1KC81 3MZLB 3CD61 2VPZA 1YIJ1 1K731 3NH5A 3CCRZ 1S72Z 4E30A 3CMAZ 1YIJZ 1S7MA 1WCMI 3OW2Y 3GKQA 5C3EI 1ZH1A 3CPWY 2JUBA 3F3PC 2OZKA 1TWGI 3HOVI 2DE5A 3S2HI 1Y1VI 2BJOA 4MH4A 1SIWA 2GU2A 4A93I 4NOZA 3I4NI 3QWUA 3FKII 1USPA 3JAMb 1SFOI 4BXXI 2QEX1 4RVGA 5IP9I 3CCLZ 1NJI2 3ESWA 2QLVB 3D9XA 1YJNZ 2ZAEB 2PK7A 5A2Qf 2JA6I 4NBGA 1VQ8Z 3S16I 3J80b 1I6HI 1Q822 3CC21 4NBCA 4DK1A 2LIYA 1WIIA 4NBBA 1Z02A 1I50I 1Y1WI 1X3ZA 1I3QI 1DL6A 3CCMZ 4MD8A 2NVXI 4X6AI 1TWAI 5D1OB 2PM9A 2QKDA 3U50C 5T64A 1VLAA 4A3II 5A2Qb 3GTGI 4CL1A 1YUAA 3BG1B 1WW9A 3CMEZ 1VQK1 1VQO1 1Q812 1QF8A 1VQKZ 2VUMI 2QEXZ 3GCFA 4NBEA 3M4OI 3CCR1 2E2II 2OOXB 3BG0B 2V8IA 3CC71 4NBFA 1N8R2 2JIQA 1YJ9Z 3CC7Z 3I4MI 2JIRA 2QA41 2YADA 1Z03A 2VPWA 1P9NA 2R6MA 1TWHI 1TWFI 2JIMA 4MD7A 2VUGA 3G6E1 3PO3S 4RVHA 3H0GI 3FQMA 1Q7Y2 2JS4A 1RO2A 3CPWZ 5IP7I 3G6EZ 2E7ZA 4QTTA 4E32A 5AN9F 1RQFA 4BBSI 1W2BY 4EWCA 1M1K1 3VMGA 2KPIA 4AYBA 3J81b 3HOYI 4A3GI 1WJ2A 1JJ2Y 3RZOI 2IZ4A 3CC2Z 3GTOI 3S14I 1RLYA 1Q862 1KD11 1ML8A 2JNYA 1RNIA 1VQ61 3CCJ1 2M48A 5C4JI 2RHBA 1VQN1 4NBAA 2AKLA 1YIT1 3IFUA 1USPB 5T67A 4A3EI 4BY1I 2DE7A 2EGTA 4NFRA 1X0TA 2QR1B 4Y7NI 2E2JI 2AYDA 2W04A 1LQLA 4E33A 2GTHA 2JA7I 4A3LI 3OW2Z 1KQSZ 4S1TA 2IZ3A 1VQL1 2VF1A 3CCM1 1Y1VS 3VB9A 5IT9b 5FLMI 3EERA 2JIPA 5IT9f 3EEDA 3PO3I 3M3YI 1JWHC 3CME1 1VQOZ 3IR7A 1YJW1 1QVFZ 3GTJI 3CCS1 1KC82 3S2DI 3FQQA 3HOZI 3LUSA 1YJWZ 2V3VA 4BBRI 1K732 5C44I 4A3FI 1JJ2Z 1QYPA 1YUKA 3GTQI 1YHQZ 2R92I 1K83I 2LFUA 3CCU1 4HH4A 4NB9A 2VPYA 1KD12 2OTLZ 1NUIA 4NH1C 3HOUI 3CCJZ 2O4HA 3GTPI 4MD9A 2JR6A 1VQNZ 2QRDB 2WAQA 2VPXA 1YITZ 2JMOA 2Y0SA 1VQMZ 3T4NB 3G4SZ 3NDIA 5C4XI
chains in the Genus database with same CATH topology
1VQM1 4MXUA 2F4MA 2E9HA 4E2YA 3G4S1 2J6AA 1YI21 2QRCB 4RS4A 2HU9A 1NJI1 3F3FC 3I07A 3VTNA 3GTMS 1K9M1 3CCQZ 3KIHA 3CC41 1Q7Y1 5D1PA 1ZB8A 3H3VJ 2G2KA 2W03A 1VQLZ 2OOYB 3CC4Z 3J7A4 3CCUZ 3G71Z 3RZDI 3MONA 4RV9A 1VQ6Z 1ZB9A 3I551 3G711 4MONA 4E2WA 3I56Z 2NVTI 2NVQI 5CM2M 4NBHA 2R7ZI 3CCV1 2B63I 2K3RA 1TFIA 2JA5I 3VMIA 3VMHA 1R9TI 2JA8I 3CCE1 1VQ9Z 5LL6f 1VQPZ 4A3DI 3S1QI 2NVYI 3CCEZ 4DGLA 2KI7B 2V8KA 4A3BI 1M1K2 1KRLA 1K8A2 3GTMI 2DE6A 1VQ71 2QREB 1YHQ1 2YU9I 4E2XA 3NDJA 2HF1A 4NB8A 3GTLI 2WB1A 5T6BA 2M6NA 3S1NI 3I55Z 3Q87A 5FLXb 1L1OC 2GTIA 3D6WA 3CCSZ 3CXCY 4RVFA 3J80f 2R93I 2V8JA 1YI2Z 3CD6Z 4Y52I 1M901 1PFTA 2PMZA 1S721 1YJN1 1QVFY 4BY7I 3J81f 3PO2I 1X3WA 3HOXI 1Z01A 1VQ7Z 2RPRA 3S1MI 2OTJ1 3HOWI 3NH8A 5FLXf 4HGYA 4QTUA 4NBDA 2OTL1 1KQSY 4RVDA 3TE5B 3I561 2Q51A 3NFZA 2F4OA 4MRIA 3CQZI 3CCVZ 3JAMf 1VQ41 1K9M2 1VQ5Z 1RO0A 2I3CA 2RT9A 4A3CI 2P28A 1VQ4Z 1QVGY 4TNUA 1VQ51 3K7AI 4E31A 1N8R1 3CCL1 4A3JI 3CXCZ 3GTKI 1M902 2E2HI 3CMA1 2RIQA 1VQ81 3CCQ1 3NH4A 4A3KI 2P3YA 1Q861 1Q811 3HKZA 4E2ZA 2K5RA 3S17I 1YJ91 2OTJZ 1W2BZ 2QA4Z 1NP6A 3IX0A 1N2FA 1TWCI 1QVGZ 3P5JB 3KIFA 2O53A 2H85A 3S1RI 1RO4A 4DQYB 3IF8A 3TDHB 4A3MI 1K8A1 1VQ91 1VQP1 5D1OA 3S15I 1Q821 4XX2A 2RBLA 3MZKB 2Q4ZA 4HGZA 1KC81 3MZLB 3CD61 1YIJ1 1K731 3NH5A 3CCRZ 1S72Z 4E30A 3CMAZ 1YIJZ 1S7MA 1WCMI 3OW2Y 3GKQA 5C3EI 1ZH1A 3CPWY 2JUBA 3F3PC 2OZKA 1TWGI 3HOVI 2DE5A 3S2HI 1Y1VI 2BJOA 4MH4A 2GU2A 4A93I 4NOZA 3I4NI 3QWUA 3FKII 1USPA 3JAMb 1SFOI 4BXXI 2QEX1 4RVGA 5IP9I 3CCLZ 1NJI2 3ESWA 2QLVB 3D9XA 1YJNZ 2ZAEB 2PK7A 5A2Qf 2JA6I 4NBGA 1VQ8Z 3S16I 3J80b 1I6HI 1Q822 3CC21 4NBCA 4DK1A 2LIYA 1WIIA 4NBBA 1Z02A 1I50I 1Y1WI 1X3ZA 1I3QI 1DL6A 3CCMZ 4MD8A 2NVXI 4X6AI 1TWAI 5D1OB 2PM9A 2QKDA 3U50C 5T64A 1VLAA 4A3II 5A2Qb 3GTGI 4CL1A 1YUAA 3BG1B 1WW9A 3CMEZ 1VQK1 1VQO1 1Q812 1QF8A 1VQKZ 2VUMI 2QEXZ 3GCFA 4NBEA 3M4OI 3CCR1 2E2II 2OOXB 3BG0B 2V8IA 3CC71 4NBFA 1N8R2 1YJ9Z 3CC7Z 3I4MI 2QA41 2YADA 1Z03A 1P9NA 2R6MA 1TWHI 1TWFI 4MD7A 2VUGA 3G6E1 3PO3S 4RVHA 3H0GI 1Q7Y2 3FQMA 2JS4A 1RO2A 3CPWZ 5IP7I 3G6EZ 4QTTA 4E32A 5AN9F 1RQFA 4BBSI 1W2BY 4EWCA 1M1K1 3VMGA 2KPIA 4AYBA 3J81b 3HOYI 4A3GI 1JJ2Y 3RZOI 2IZ4A 3CC2Z 3GTOI 3S14I 1RLYA 1Q862 1KD11 1ML8A 2JNYA 1RNIA 1VQ61 3CCJ1 2M48A 5C4JI 2RHBA 1VQN1 4NBAA 2AKLA 1YIT1 3IFUA 1USPB 5T67A 4A3EI 4BY1I 2DE7A 2EGTA 4NFRA 1X0TA 2QR1B 4Y7NI 2E2JI 2W04A 1LQLA 4E33A 2GTHA 2JA7I 4A3LI 3OW2Z 1KQSZ 4S1TA 2IZ3A 1VQL1 2VF1A 3CCM1 1Y1VS 3VB9A 5IT9b 5FLMI 3EERA 5IT9f 3EEDA 3PO3I 3M3YI 1JWHC 3CME1 1VQOZ 1YJW1 1QVFZ 3GTJI 3CCS1 1KC82 3S2DI 3FQQA 3HOZI 3LUSA 1YJWZ 4BBRI 1K732 5C44I 4A3FI 1JJ2Z 1QYPA 1YUKA 3GTQI 1YHQZ 2R92I 1K83I 2LFUA 3CCU1 4HH4A 4NB9A 1KD12 2OTLZ 1NUIA 4NH1C 3HOUI 3CCJZ 2O4HA 3GTPI 4MD9A 2JR6A 1VQNZ 2QRDB 2WAQA 1YITZ 2JMOA 2Y0SA 1VQMZ 3T4NB 3G4SZ 3NDIA 5C4XI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MD7 A;  2JMO A;  4MD9 A;  2M48 A;  2RT9 A;  1QF8 A;  1JWH C;  2M6N A;  4MD8 A;  4NH1 C;  2R6M A;  1RQF A;  3EED A;  4DGL A; 
#chains in the Genus database with same CATH topology
 1VQM 1;  4MXU A;  2F4M A;  2E9H A;  4E2Y A;  3G4S 1;  2J6A A;  1YI2 1;  2QRC B;  4RS4 A;  2HU9 A;  1NJI 1;  3F3F C;  3I07 A;  3VTN A;  3GTM S;  1K9M 1;  3CCQ Z;  3KIH A;  3CC4 1;  1Q7Y 1;  5D1P A;  1ZB8 A;  3H3V J;  2G2K A;  2W03 A;  1VQL Z;  2OOY B;  3CC4 Z;  3J7A 4;  3CCU Z;  3G71 Z;  3RZD I;  3MON A;  4RV9 A;  1VQ6 Z;  1ZB9 A;  3I55 1;  3G71 1;  4MON A;  4E2W A;  3I56 Z;  2NVT I;  2NVQ I;  5CM2 M;  4NBH A;  1FDO A;  2R7Z I;  3CCV 1;  2B63 I;  1Y8C A;  2K3R A;  1TFI A;  1WZN A;  2JA5 I;  3VMI A;  3VMH A;  1R9T I;  2JA8 I;  3CCE 1;  1VQ9 Z;  1Q16 A;  5LL6 f;  1VQP Z;  4A3D I;  3S1Q I;  2NVY I;  3D2L A;  3CCE Z;  4DGL A;  2KI7 B;  2V8K A;  4A3B I;  1M1K 2;  2LEX A;  1KRL A;  1K8A 2;  3GTM I;  2DE6 A;  1VQ7 1;  2QRE B;  1YHQ 1;  2YU9 I;  4E2X A;  3NDJ A;  1AA6 A;  2HF1 A;  4NB8 A;  3GTL I;  2WB1 A;  5T6B A;  2M6N A;  3S1N I;  3I55 Z;  3Q87 A;  5FLX b;  2V45 A;  1L1O C;  2GTI A;  3D6W A;  3CCS Z;  3CXC Y;  4RVF A;  3J80 f;  2R93 I;  2V8J A;  1YI2 Z;  3CD6 Z;  4Y52 I;  1M90 1;  1PFT A;  2PMZ A;  1S72 1;  1YJN 1;  1QVF Y;  4BY7 I;  3J81 f;  3PO2 I;  1FDI A;  1X3W A;  1QXF A;  3HOX I;  2NAP A;  1Z01 A;  1VQ7 Z;  2RPR A;  3S1M I;  2OTJ 1;  3HOW I;  3NH8 A;  5FLX f;  4HGY A;  4QTU A;  4NBD A;  2OTL 1;  1KQS Y;  4RVD A;  3TE5 B;  3I56 1;  2Q51 A;  3NFZ A;  2F4O A;  4MRI A;  3CQZ I;  3CCV Z;  3JAM f;  1VQ4 1;  1K9M 2;  1VQ5 Z;  1RO0 A;  2I3C A;  2RT9 A;  4A3C I;  2P28 A;  1VQ4 Z;  1QVG Y;  4TNU A;  1VQ5 1;  3K7A I;  4E31 A;  1N8R 1;  3CCL 1;  4A3J I;  3CXC Z;  3GTK I;  1M90 2;  2E2H I;  3CMA 1;  2RIQ A;  1VQ8 1;  3CCQ 1;  3NH4 A;  4A3K I;  2P3Y A;  1Q86 1;  1Q81 1;  3HKZ A;  4E2Z A;  2K5R A;  3S17 I;  1YJ9 1;  2OTJ Z;  1W2B Z;  2QA4 Z;  1NP6 A;  3IX0 A;  1N2F A;  1TWC I;  1QVG Z;  3P5J B;  3KIF A;  2O53 A;  2H85 A;  3S1R I;  1RO4 A;  2JIO A;  4DQY B;  3IF8 A;  3TDH B;  4A3M I;  1K8A 1;  1VQ9 1;  1VQP 1;  5D1O A;  3S15 I;  2IV2 X;  1Q82 1;  4XX2 A;  2RBL A;  3MZK B;  2Q4Z A;  4HGZ A;  1KC8 1;  3MZL B;  3CD6 1;  2VPZ A;  1YIJ 1;  1K73 1;  3NH5 A;  3CCR Z;  1S72 Z;  4E30 A;  3CMA Z;  1YIJ Z;  1S7M A;  1WCM I;  3OW2 Y;  3GKQ A;  5C3E I;  1ZH1 A;  3CPW Y;  2JUB A;  3F3P C;  2OZK A;  1TWG I;  3HOV I;  2DE5 A;  3S2H I;  1Y1V I;  2BJO A;  4MH4 A;  1SIW A;  2GU2 A;  4A93 I;  4NOZ A;  3I4N I;  3QWU A;  3FKI I;  1USP A;  3JAM b;  1SFO I;  4BXX I;  2QEX 1;  4RVG A;  5IP9 I;  3CCL Z;  1NJI 2;  3ESW A;  2QLV B;  3D9X A;  1YJN Z;  2ZAE B;  2PK7 A;  5A2Q f;  2JA6 I;  4NBG A;  1VQ8 Z;  3S16 I;  3J80 b;  1I6H I;  1Q82 2;  3CC2 1;  4NBC A;  4DK1 A;  2LIY A;  1WII A;  4NBB A;  1Z02 A;  1I50 I;  1Y1W I;  1X3Z A;  1I3Q I;  1DL6 A;  3CCM Z;  4MD8 A;  2NVX I;  4X6A I;  1TWA I;  5D1O B;  2PM9 A;  2QKD A;  3U50 C;  5T64 A;  1VLA A;  4A3I I;  5A2Q b;  3GTG I;  4CL1 A;  1YUA A;  3BG1 B;  1WW9 A;  3CME Z;  1VQK 1;  1VQO 1;  1Q81 2;  1QF8 A;  1VQK Z;  2VUM I;  2QEX Z;  3GCF A;  4NBE A;  3M4O I;  3CCR 1;  2E2I I;  2OOX B;  3BG0 B;  2V8I A;  3CC7 1;  4NBF A;  1N8R 2;  2JIQ A;  1YJ9 Z;  3CC7 Z;  3I4M I;  2JIR A;  2QA4 1;  2YAD A;  1Z03 A;  2VPW A;  1P9N A;  2R6M A;  1TWH I;  1TWF I;  2JIM A;  4MD7 A;  2VUG A;  3G6E 1;  3PO3 S;  4RVH A;  3H0G I;  3FQM A;  1Q7Y 2;  2JS4 A;  1RO2 A;  3CPW Z;  5IP7 I;  3G6E Z;  2E7Z A;  4QTT A;  4E32 A;  5AN9 F;  1RQF A;  4BBS I;  1W2B Y;  4EWC A;  1M1K 1;  3VMG A;  2KPI A;  4AYB A;  3J81 b;  3HOY I;  4A3G I;  1WJ2 A;  1JJ2 Y;  3RZO I;  2IZ4 A;  3CC2 Z;  3GTO I;  3S14 I;  1RLY A;  1Q86 2;  1KD1 1;  1ML8 A;  2JNY A;  1RNI A;  1VQ6 1;  3CCJ 1;  2M48 A;  5C4J I;  2RHB A;  1VQN 1;  4NBA A;  2AKL A;  1YIT 1;  3IFU A;  1USP B;  5T67 A;  4A3E I;  4BY1 I;  2DE7 A;  2EGT A;  4NFR A;  1X0T A;  2QR1 B;  4Y7N I;  2E2J I;  2AYD A;  2W04 A;  1LQL A;  4E33 A;  2GTH A;  2JA7 I;  4A3L I;  3OW2 Z;  1KQS Z;  4S1T A;  2IZ3 A;  1VQL 1;  2VF1 A;  3CCM 1;  1Y1V S;  3VB9 A;  5IT9 b;  5FLM I;  3EER A;  2JIP A;  5IT9 f;  3EED A;  3PO3 I;  3M3Y I;  1JWH C;  3CME 1;  1VQO Z;  3IR7 A;  1YJW 1;  1QVF Z;  3GTJ I;  3CCS 1;  1KC8 2;  3S2D I;  3FQQ A;  3HOZ I;  3LUS A;  1YJW Z;  2V3V A;  4BBR I;  1K73 2;  5C44 I;  4A3F I;  1JJ2 Z;  1QYP A;  1YUK A;  3GTQ I;  1YHQ Z;  2R92 I;  1K83 I;  2LFU A;  3CCU 1;  4HH4 A;  4NB9 A;  2VPY A;  1KD1 2;  2OTL Z;  1NUI A;  4NH1 C;  3HOU I;  3CCJ Z;  2O4H A;  3GTP I;  4MD9 A;  2JR6 A;  1VQN Z;  2QRD B;  2WAQ A;  2VPX A;  1YIT Z;  2JMO A;  2Y0S A;  1VQM Z;  3T4N B;  3G4S Z;  3NDI A;  5C4X I; 
#chains in the Genus database with same CATH homology
 1VQM 1;  4MXU A;  2F4M A;  2E9H A;  4E2Y A;  3G4S 1;  2J6A A;  1YI2 1;  2QRC B;  4RS4 A;  2HU9 A;  1NJI 1;  3F3F C;  3I07 A;  3VTN A;  3GTM S;  1K9M 1;  3CCQ Z;  3KIH A;  3CC4 1;  1Q7Y 1;  5D1P A;  1ZB8 A;  3H3V J;  2G2K A;  2W03 A;  1VQL Z;  2OOY B;  3CC4 Z;  3J7A 4;  3CCU Z;  3G71 Z;  3RZD I;  3MON A;  4RV9 A;  1VQ6 Z;  1ZB9 A;  3I55 1;  3G71 1;  4MON A;  4E2W A;  3I56 Z;  2NVT I;  2NVQ I;  5CM2 M;  4NBH A;  2R7Z I;  3CCV 1;  2B63 I;  2K3R A;  1TFI A;  2JA5 I;  3VMI A;  3VMH A;  1R9T I;  2JA8 I;  3CCE 1;  1VQ9 Z;  5LL6 f;  1VQP Z;  4A3D I;  3S1Q I;  2NVY I;  3CCE Z;  4DGL A;  2KI7 B;  2V8K A;  4A3B I;  1M1K 2;  1KRL A;  1K8A 2;  3GTM I;  2DE6 A;  1VQ7 1;  2QRE B;  1YHQ 1;  2YU9 I;  4E2X A;  3NDJ A;  2HF1 A;  4NB8 A;  3GTL I;  2WB1 A;  5T6B A;  2M6N A;  3S1N I;  3I55 Z;  3Q87 A;  5FLX b;  1L1O C;  2GTI A;  3D6W A;  3CCS Z;  3CXC Y;  4RVF A;  3J80 f;  2R93 I;  2V8J A;  1YI2 Z;  3CD6 Z;  4Y52 I;  1M90 1;  1PFT A;  2PMZ A;  1S72 1;  1YJN 1;  1QVF Y;  4BY7 I;  3J81 f;  3PO2 I;  1X3W A;  3HOX I;  1Z01 A;  1VQ7 Z;  2RPR A;  3S1M I;  2OTJ 1;  3HOW I;  3NH8 A;  5FLX f;  4HGY A;  4QTU A;  4NBD A;  2OTL 1;  1KQS Y;  4RVD A;  3TE5 B;  3I56 1;  2Q51 A;  3NFZ A;  2F4O A;  4MRI A;  3CQZ I;  3CCV Z;  3JAM f;  1VQ4 1;  1K9M 2;  1VQ5 Z;  1RO0 A;  2I3C A;  2RT9 A;  4A3C I;  2P28 A;  1VQ4 Z;  1QVG Y;  4TNU A;  1VQ5 1;  3K7A I;  4E31 A;  1N8R 1;  3CCL 1;  4A3J I;  3CXC Z;  3GTK I;  1M90 2;  2E2H I;  3CMA 1;  2RIQ A;  1VQ8 1;  3CCQ 1;  3NH4 A;  4A3K I;  2P3Y A;  1Q86 1;  1Q81 1;  3HKZ A;  4E2Z A;  2K5R A;  3S17 I;  1YJ9 1;  2OTJ Z;  1W2B Z;  2QA4 Z;  1NP6 A;  3IX0 A;  1N2F A;  1TWC I;  1QVG Z;  3P5J B;  3KIF A;  2O53 A;  2H85 A;  3S1R I;  1RO4 A;  4DQY B;  3IF8 A;  3TDH B;  4A3M I;  1K8A 1;  1VQ9 1;  1VQP 1;  5D1O A;  3S15 I;  1Q82 1;  4XX2 A;  2RBL A;  3MZK B;  2Q4Z A;  4HGZ A;  1KC8 1;  3MZL B;  3CD6 1;  1YIJ 1;  1K73 1;  3NH5 A;  3CCR Z;  1S72 Z;  4E30 A;  3CMA Z;  1YIJ Z;  1S7M A;  1WCM I;  3OW2 Y;  3GKQ A;  5C3E I;  1ZH1 A;  3CPW Y;  2JUB A;  3F3P C;  2OZK A;  1TWG I;  3HOV I;  2DE5 A;  3S2H I;  1Y1V I;  2BJO A;  4MH4 A;  2GU2 A;  4A93 I;  4NOZ A;  3I4N I;  3QWU A;  3FKI I;  1USP A;  3JAM b;  1SFO I;  4BXX I;  2QEX 1;  4RVG A;  5IP9 I;  3CCL Z;  1NJI 2;  3ESW A;  2QLV B;  3D9X A;  1YJN Z;  2ZAE B;  2PK7 A;  5A2Q f;  2JA6 I;  4NBG A;  1VQ8 Z;  3S16 I;  3J80 b;  1I6H I;  1Q82 2;  3CC2 1;  4NBC A;  4DK1 A;  2LIY A;  1WII A;  4NBB A;  1Z02 A;  1I50 I;  1Y1W I;  1X3Z A;  1I3Q I;  1DL6 A;  3CCM Z;  4MD8 A;  2NVX I;  4X6A I;  1TWA I;  5D1O B;  2PM9 A;  2QKD A;  3U50 C;  5T64 A;  1VLA A;  4A3I I;  5A2Q b;  3GTG I;  4CL1 A;  1YUA A;  3BG1 B;  1WW9 A;  3CME Z;  1VQK 1;  1VQO 1;  1Q81 2;  1QF8 A;  1VQK Z;  2VUM I;  2QEX Z;  3GCF A;  4NBE A;  3M4O I;  3CCR 1;  2E2I I;  2OOX B;  3BG0 B;  2V8I A;  3CC7 1;  4NBF A;  1N8R 2;  1YJ9 Z;  3CC7 Z;  3I4M I;  2QA4 1;  2YAD A;  1Z03 A;  1P9N A;  2R6M A;  1TWH I;  1TWF I;  4MD7 A;  2VUG A;  3G6E 1;  3PO3 S;  4RVH A;  3H0G I;  1Q7Y 2;  3FQM A;  2JS4 A;  1RO2 A;  3CPW Z;  5IP7 I;  3G6E Z;  4QTT A;  4E32 A;  5AN9 F;  1RQF A;  4BBS I;  1W2B Y;  4EWC A;  1M1K 1;  3VMG A;  2KPI A;  4AYB A;  3J81 b;  3HOY I;  4A3G I;  1JJ2 Y;  3RZO I;  2IZ4 A;  3CC2 Z;  3GTO I;  3S14 I;  1RLY A;  1Q86 2;  1KD1 1;  1ML8 A;  2JNY A;  1RNI A;  1VQ6 1;  3CCJ 1;  2M48 A;  5C4J I;  2RHB A;  1VQN 1;  4NBA A;  2AKL A;  1YIT 1;  3IFU A;  1USP B;  5T67 A;  4A3E I;  4BY1 I;  2DE7 A;  2EGT A;  4NFR A;  1X0T A;  2QR1 B;  4Y7N I;  2E2J I;  2W04 A;  1LQL A;  4E33 A;  2GTH A;  2JA7 I;  4A3L I;  3OW2 Z;  1KQS Z;  4S1T A;  2IZ3 A;  1VQL 1;  2VF1 A;  3CCM 1;  1Y1V S;  3VB9 A;  5IT9 b;  5FLM I;  3EER A;  5IT9 f;  3EED A;  3PO3 I;  3M3Y I;  1JWH C;  3CME 1;  1VQO Z;  1YJW 1;  1QVF Z;  3GTJ I;  3CCS 1;  1KC8 2;  3S2D I;  3FQQ A;  3HOZ I;  3LUS A;  1YJW Z;  4BBR I;  1K73 2;  5C44 I;  4A3F I;  1JJ2 Z;  1QYP A;  1YUK A;  3GTQ I;  1YHQ Z;  2R92 I;  1K83 I;  2LFU A;  3CCU 1;  4HH4 A;  4NB9 A;  1KD1 2;  2OTL Z;  1NUI A;  4NH1 C;  3HOU I;  3CCJ Z;  2O4H A;  3GTP I;  4MD9 A;  2JR6 A;  1VQN Z;  2QRD B;  2WAQ A;  1YIT Z;  2JMO A;  2Y0S A;  1VQM Z;  3T4N B;  3G4S Z;  3NDI A;  5C4X I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...