1QF8A

Truncated form of casein kinase ii beta subunit (2-182) from homo sapiens
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
173
structure length
167
Chain Sequence
VSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASEIN KINASE II
publication title Crystal structure of the human protein kinase CK2 regulatory subunit reveals its zinc finger-mediated dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 41
structure length 167
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.7.1.37: Transferred entry: 2.7.11.1, 2.7.11.8, 2.7.11.9, 2.7.11.10, 2.7.11.11,
pdb deposition date 1999-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 1qf8A01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qf8A02
4MD9A 3EEDA 1JWHC 2M6NA 2M48A 4MD7A 4NH1C 1RQFA 1QF8A 4MD8A 2RT9A 2JMOA 4DGLA 2R6MA
chains in the Genus database with same CATH superfamily
1QVFY 3S14I 3S2HI 1VQK1 3I551 1VQP1 1VQ81 1VQOZ 1R9TI 3G711 4EWCA 2H85A 3OW2Z 4Y52I 3BG1B 3GKQA 2YADA 2QR1B 1M902 3CCEZ 1M1K1 3GTMI 1I3QI 2VF1A 3F3PC 3JAMb 2O4HA 3G4S1 1Q821 1N8R2 1S72Z 5CM2M 1JJ2Z 1TWCI 1Z03A 5FLXf 3CMA1 1RNIA 1VLAA 3GTJI 1Q862 4NOZA 2DE7A 2PM9A 1YUAA 3CC4Z 1USPA 4E30A 1VQO1 4DK1A 2NVYI 3J81b 4DQYB 3BG0B 1Z01A 3CPWY 1FDIA 3EERA 3TDHB 4X6AI 1Y8CA 1SIWA 1RQFA 3CCLZ 4A3JI 1YHQZ 2KI7B 2W04A 2JA7I 1NP6A 1QVGY 2E9HA 2E2II 4NFRA 2VPWA 3G6EZ 3KIFA 2WAQA 1LQLA 2QREB 2LFUA 1Q7Y2 1QXFA 3H3VJ 3CC41 4E31A 4A3II 1K8A2 5D1PA 2RBLA 2R7ZI 1KC81 2R6MA 4NBEA 1I6HI 1YJN1 3CCL1 1TWGI 1YHQ1 4E2YA 1NJI2 3FQMA 1RLYA 3HOWI 3HOVI 4A3GI 1TWAI 3G6E1 4E2WA 3NH8A 2YU9I 1NUIA 3CD6Z 3CCQZ 1Q7Y1 5AN9F 3CCVZ 3JAMf 5C3EI 2GU2A 1ZB9A 3CXCZ 1Q811 2Q51A 4TNUA 1VQ8Z 2VUMI 4A3KI 3G71Z 2K5RA 2JIPA 3IX0A 1L1OC 2JR6A 4HH4A 2JA6I 2OZKA 3ESWA 3J81f 3HOYI 2VPZA 2EGTA 4S1TA 2OTJZ 2KPIA 3NDIA 3CD61 1S7MA 3CCQ1 4A3BI 3T4NB 1N2FA 1TFIA 2P28A 3CMAZ 2P3YA 3CCV1 3D2LA 1Q822 4A3CI 2NVXI 2PK7A 1X0TA 2PMZA 4AYBA 1RO0A 2JNYA 1VQNZ 2V8JA 3GTQI 4E32A 2QRCB 4RV9A 2RHBA 4NB8A 1AA6A 3VMHA 1K83I 1KQSZ 3OW2Y 3I4NI 2K3RA 2V3VA 4MD8A 4MONA 2VPXA 2OTJ1 1VQMZ 3HOZI 3GTLI 5C4JI 1WW9A 3MZKB 2QA4Z 1JJ2Y 3H0GI 2NAPA 3IR7A 1Z02A 1VQ7Z 5A2Qb 2JA8I 3S16I 2Q4ZA 2AYDA 4HGYA 1W2BZ 1X3ZA 1VQN1 2R92I 3GTOI 1RO2A 4RVHA 3I4MI 3NH5A 4DGLA 2Y0SA 3D9XA 1YJNZ 1KC82 1VQM1 2QKDA 3CCRZ 2JUBA 4Y7NI 2HF1A 2QA41 1Y1VS 3PO2I 1TWHI 1VQ71 3VMGA 2JIQA 3MZLB 2E2JI 5IT9b 2F4OA 1VQ9Z 2VUGA 3NDJA 2VPYA 2QRDB 5C44I 1KD11 4A3EI 2JMOA 3LUSA 1I50I 1YJ9Z 3I56Z 1Q812 1KRLA 1K9M1 4A3FI 3HKZA 3I07A 4NBHA 3J7A4 2V8IA 2DE5A 2I3CA 2GTHA 3CCR1 2B63I 2V8KA 4QTTA 1WCMI 3IFUA 4MD7A 3GTMS 3CC2Z 3GTGI 3HOUI 1VQ91 1YJWZ 1Y1WI 3MONA 4RVFA 3CXCY 2E2HI 2OOXB 2M6NA 2M48A 2NVTI 5A2Qf 1YUKA 3VMIA 3S1QI 1YJ91 3S17I 3I561 4BY1I 1VQ6Z 2NVQI 2JIOA 1ZB8A 4BY7I 2IZ3A 5T6BA 1Q16A 2F4MA 1ZH1A 3VB9A 3J80b 1YITZ 3CC21 2GTIA 3CCMZ 4A3MI 2JIMA 1YJW1 4MXUA 2LIYA 2OTLZ 3GTPI 1VQLZ 2BJOA 2RPRA 5T67A 5IT9f 3CMEZ 1Y1VI 2JIRA 4RVDA 2IV2X 1VQ61 3IF8A 1YIJZ 4XX2A 3P5JB 3D6WA 1WZNA 1QVFZ 1YIT1 3CC7Z 4E2ZA 3CCM1 1RO4A 4BXXI 3VTNA 4RVGA 2QEXZ 1W2BY 1WJ2A 2OTL1 4HGZA 1K731 5D1OB 1VQL1 4NB9A 3RZOI 4A93I 3CME1 2QLVB 1P9NA 1KD12 2RIQA 1YIJ1 2JS4A 1YI2Z 3PO3S 1VQ41 1K9M2 3FQQA 1X3WA 4NBCA 5LL6f 1JWHC 3CC71 1DL6A 5IP7I 4NBDA 2E7ZA 2G2KA 5IP9I 3K7AI 4NBGA 4MD9A 3J80f 3GCFA 1M901 2QEX1 3RZDI 3CPWZ 4NH1C 3S1NI 4NBBA 3CCE1 3CCSZ 1N8R1 3Q87A 3M4OI 1QVGZ 3M3YI 1S721 3GTKI 1Q861 1YI21 2AKLA 3NFZA 3QWUA 2RT9A 5D1OA 3S1MI 3S1RI 2HU9A 1QYPA 4MH4A 1ML8A 3CCUZ 4RS4A 2ZAEB 3FKII 3CQZI 3CCJZ 1FDOA 4A3LI 3F3FC 3TE5B 2IZ4A 3NH4A 3CCS1 5FLXb 2O53A 5T64A 3S15I 1SFOI 5FLMI 2J6AA 4CL1A 3U50C 1QF8A 4NBAA 1VQ5Z 1K8A1 4E33A 4A3DI 4BBRI 1TWFI 1PFTA 4MRIA 2DE6A 1VQKZ 3I55Z 3CCU1 1VQPZ 3EEDA 3HOXI 1NJI1 3PO3I 3CCJ1 4BBSI 2LEXA 2JA5I 3S2DI 1USPB 2W03A 1KQSY 1K732 2V45A 4NBFA 4QTUA 2OOYB 3KIHA 3G4SZ 2R93I 1WIIA 1M1K2 4E2XA 1VQ51 5C4XI 1VQ4Z 2WB1A
chains in the Genus database with same CATH topology
1QVFY 3S14I 3S2HI 1VQK1 3I551 1VQP1 1VQ81 1VQOZ 1R9TI 3G711 4EWCA 2H85A 3OW2Z 4Y52I 3BG1B 3GKQA 2YADA 2QR1B 1M902 3CCEZ 1M1K1 3GTMI 1I3QI 2VF1A 3F3PC 3JAMb 2O4HA 3G4S1 1Q821 1N8R2 1S72Z 5CM2M 1JJ2Z 1TWCI 1Z03A 5FLXf 3CMA1 1RNIA 1VLAA 3GTJI 1Q862 4NOZA 2DE7A 2PM9A 1YUAA 3CC4Z 1USPA 4E30A 1VQO1 4DK1A 2NVYI 3J81b 4DQYB 3BG0B 1Z01A 3CPWY 3EERA 3TDHB 4X6AI 1RQFA 3CCLZ 4A3JI 1YHQZ 2KI7B 2W04A 2JA7I 1NP6A 1QVGY 2E9HA 2E2II 4NFRA 3G6EZ 3KIFA 2WAQA 1LQLA 2QREB 2LFUA 1Q7Y2 3H3VJ 3CC41 4E31A 4A3II 1K8A2 5D1PA 2RBLA 2R7ZI 1KC81 2R6MA 4NBEA 1I6HI 1YJN1 3CCL1 1TWGI 1YHQ1 4E2YA 1NJI2 3FQMA 1RLYA 3HOWI 3HOVI 4A3GI 1TWAI 3G6E1 4E2WA 3NH8A 2YU9I 1NUIA 3CD6Z 3CCQZ 1Q7Y1 5AN9F 3CCVZ 3JAMf 5C3EI 2GU2A 1ZB9A 3CXCZ 1Q811 2Q51A 4TNUA 1VQ8Z 2VUMI 4A3KI 3G71Z 2K5RA 3IX0A 1L1OC 2JR6A 4HH4A 2JA6I 2OZKA 3ESWA 3J81f 3HOYI 2EGTA 4S1TA 2OTJZ 2KPIA 3NDIA 3CD61 1S7MA 3CCQ1 4A3BI 3T4NB 1N2FA 1TFIA 2P28A 3CMAZ 2P3YA 3CCV1 1Q822 4A3CI 2NVXI 2PK7A 1X0TA 2PMZA 4AYBA 1RO0A 2JNYA 1VQNZ 2V8JA 3GTQI 4E32A 2QRCB 4RV9A 2RHBA 4NB8A 3VMHA 1K83I 1KQSZ 3OW2Y 3I4NI 2K3RA 4MD8A 4MONA 2OTJ1 1VQMZ 3HOZI 3GTLI 5C4JI 1WW9A 3MZKB 2QA4Z 1JJ2Y 3H0GI 1Z02A 1VQ7Z 5A2Qb 2JA8I 3S16I 2Q4ZA 4HGYA 1W2BZ 1X3ZA 1VQN1 2R92I 3GTOI 1RO2A 4RVHA 3I4MI 3NH5A 4DGLA 2Y0SA 3D9XA 1YJNZ 1KC82 1VQM1 2QKDA 3CCRZ 2JUBA 4Y7NI 2HF1A 2QA41 1Y1VS 3PO2I 1TWHI 1VQ71 3VMGA 3MZLB 2E2JI 5IT9b 2F4OA 1VQ9Z 2VUGA 3NDJA 2QRDB 5C44I 1KD11 4A3EI 2JMOA 3LUSA 1I50I 1YJ9Z 3I56Z 1Q812 1KRLA 1K9M1 4A3FI 3HKZA 3I07A 4NBHA 3J7A4 2V8IA 2DE5A 2I3CA 2GTHA 3CCR1 2B63I 2V8KA 4QTTA 1WCMI 3IFUA 4MD7A 3GTMS 3CC2Z 3GTGI 3HOUI 1VQ91 1YJWZ 1Y1WI 3MONA 4RVFA 3CXCY 2E2HI 2OOXB 2M6NA 2M48A 2NVTI 5A2Qf 1YUKA 3VMIA 3S1QI 1YJ91 3S17I 3I561 4BY1I 1VQ6Z 2NVQI 1ZB8A 4BY7I 2IZ3A 5T6BA 2F4MA 1ZH1A 3VB9A 3J80b 1YITZ 3CC21 2GTIA 3CCMZ 4A3MI 1YJW1 4MXUA 2LIYA 2OTLZ 3GTPI 1VQLZ 2BJOA 2RPRA 5T67A 5IT9f 3CMEZ 1Y1VI 4RVDA 1VQ61 3IF8A 1YIJZ 4XX2A 3P5JB 3D6WA 1QVFZ 1YIT1 3CC7Z 4E2ZA 3CCM1 1RO4A 4BXXI 3VTNA 4RVGA 2QEXZ 1W2BY 2OTL1 4HGZA 1K731 5D1OB 1VQL1 4NB9A 3RZOI 4A93I 3CME1 2QLVB 1P9NA 1KD12 2RIQA 1YIJ1 2JS4A 1YI2Z 3PO3S 1VQ41 1K9M2 3FQQA 1X3WA 4NBCA 5LL6f 1JWHC 3CC71 1DL6A 5IP7I 4NBDA 2G2KA 5IP9I 3K7AI 4NBGA 4MD9A 3J80f 3GCFA 1M901 2QEX1 3RZDI 3CPWZ 4NH1C 3S1NI 4NBBA 3CCE1 3CCSZ 1N8R1 3Q87A 3M4OI 1QVGZ 3M3YI 1S721 3GTKI 1Q861 1YI21 2AKLA 3NFZA 3QWUA 2RT9A 5D1OA 3S1MI 3S1RI 2HU9A 1QYPA 4MH4A 1ML8A 3CCUZ 4RS4A 2ZAEB 3FKII 3CQZI 3CCJZ 4A3LI 3F3FC 3TE5B 2IZ4A 3NH4A 3CCS1 5FLXb 2O53A 5T64A 3S15I 1SFOI 5FLMI 2J6AA 4CL1A 3U50C 1QF8A 4NBAA 1VQ5Z 1K8A1 4E33A 4A3DI 4BBRI 1TWFI 1PFTA 4MRIA 2DE6A 1VQKZ 3I55Z 3CCU1 1VQPZ 3EEDA 3HOXI 1NJI1 3PO3I 3CCJ1 4BBSI 2JA5I 3S2DI 1USPB 2W03A 1KQSY 1K732 4NBFA 4QTUA 2OOYB 3KIHA 3G4SZ 2R93I 1WIIA 1M1K2 4E2XA 1VQ51 5C4XI 1VQ4Z 2WB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MD9 A;  3EED A;  1JWH C;  2M6N A;  2M48 A;  4MD7 A;  4NH1 C;  1RQF A;  1QF8 A;  4MD8 A;  2RT9 A;  2JMO A;  4DGL A;  2R6M A; 
#chains in the Genus database with same CATH topology
 1QVF Y;  3S14 I;  3S2H I;  1VQK 1;  3I55 1;  1VQP 1;  1VQ8 1;  1VQO Z;  1R9T I;  3G71 1;  4EWC A;  2H85 A;  3OW2 Z;  4Y52 I;  3BG1 B;  3GKQ A;  2YAD A;  2QR1 B;  1M90 2;  3CCE Z;  1M1K 1;  3GTM I;  1I3Q I;  2VF1 A;  3F3P C;  3JAM b;  2O4H A;  3G4S 1;  1Q82 1;  1N8R 2;  1S72 Z;  5CM2 M;  1JJ2 Z;  1TWC I;  1Z03 A;  5FLX f;  3CMA 1;  1RNI A;  1VLA A;  3GTJ I;  1Q86 2;  4NOZ A;  2DE7 A;  2PM9 A;  1YUA A;  3CC4 Z;  1USP A;  4E30 A;  1VQO 1;  4DK1 A;  2NVY I;  3J81 b;  4DQY B;  3BG0 B;  1Z01 A;  3CPW Y;  1FDI A;  3EER A;  3TDH B;  4X6A I;  1Y8C A;  1SIW A;  1RQF A;  3CCL Z;  4A3J I;  1YHQ Z;  2KI7 B;  2W04 A;  2JA7 I;  1NP6 A;  1QVG Y;  2E9H A;  2E2I I;  4NFR A;  2VPW A;  3G6E Z;  3KIF A;  2WAQ A;  1LQL A;  2QRE B;  2LFU A;  1Q7Y 2;  1QXF A;  3H3V J;  3CC4 1;  4E31 A;  4A3I I;  1K8A 2;  5D1P A;  2RBL A;  2R7Z I;  1KC8 1;  2R6M A;  4NBE A;  1I6H I;  1YJN 1;  3CCL 1;  1TWG I;  1YHQ 1;  4E2Y A;  1NJI 2;  3FQM A;  1RLY A;  3HOW I;  3HOV I;  4A3G I;  1TWA I;  3G6E 1;  4E2W A;  3NH8 A;  2YU9 I;  1NUI A;  3CD6 Z;  3CCQ Z;  1Q7Y 1;  5AN9 F;  3CCV Z;  3JAM f;  5C3E I;  2GU2 A;  1ZB9 A;  3CXC Z;  1Q81 1;  2Q51 A;  4TNU A;  1VQ8 Z;  2VUM I;  4A3K I;  3G71 Z;  2K5R A;  2JIP A;  3IX0 A;  1L1O C;  2JR6 A;  4HH4 A;  2JA6 I;  2OZK A;  3ESW A;  3J81 f;  3HOY I;  2VPZ A;  2EGT A;  4S1T A;  2OTJ Z;  2KPI A;  3NDI A;  3CD6 1;  1S7M A;  3CCQ 1;  4A3B I;  3T4N B;  1N2F A;  1TFI A;  2P28 A;  3CMA Z;  2P3Y A;  3CCV 1;  3D2L A;  1Q82 2;  4A3C I;  2NVX I;  2PK7 A;  1X0T A;  2PMZ A;  4AYB A;  1RO0 A;  2JNY A;  1VQN Z;  2V8J A;  3GTQ I;  4E32 A;  2QRC B;  4RV9 A;  2RHB A;  4NB8 A;  1AA6 A;  3VMH A;  1K83 I;  1KQS Z;  3OW2 Y;  3I4N I;  2K3R A;  2V3V A;  4MD8 A;  4MON A;  2VPX A;  2OTJ 1;  1VQM Z;  3HOZ I;  3GTL I;  5C4J I;  1WW9 A;  3MZK B;  2QA4 Z;  1JJ2 Y;  3H0G I;  2NAP A;  3IR7 A;  1Z02 A;  1VQ7 Z;  5A2Q b;  2JA8 I;  3S16 I;  2Q4Z A;  2AYD A;  4HGY A;  1W2B Z;  1X3Z A;  1VQN 1;  2R92 I;  3GTO I;  1RO2 A;  4RVH A;  3I4M I;  3NH5 A;  4DGL A;  2Y0S A;  3D9X A;  1YJN Z;  1KC8 2;  1VQM 1;  2QKD A;  3CCR Z;  2JUB A;  4Y7N I;  2HF1 A;  2QA4 1;  1Y1V S;  3PO2 I;  1TWH I;  1VQ7 1;  3VMG A;  2JIQ A;  3MZL B;  2E2J I;  5IT9 b;  2F4O A;  1VQ9 Z;  2VUG A;  3NDJ A;  2VPY A;  2QRD B;  5C44 I;  1KD1 1;  4A3E I;  2JMO A;  3LUS A;  1I50 I;  1YJ9 Z;  3I56 Z;  1Q81 2;  1KRL A;  1K9M 1;  4A3F I;  3HKZ A;  3I07 A;  4NBH A;  3J7A 4;  2V8I A;  2DE5 A;  2I3C A;  2GTH A;  3CCR 1;  2B63 I;  2V8K A;  4QTT A;  1WCM I;  3IFU A;  4MD7 A;  3GTM S;  3CC2 Z;  3GTG I;  3HOU I;  1VQ9 1;  1YJW Z;  1Y1W I;  3MON A;  4RVF A;  3CXC Y;  2E2H I;  2OOX B;  2M6N A;  2M48 A;  2NVT I;  5A2Q f;  1YUK A;  3VMI A;  3S1Q I;  1YJ9 1;  3S17 I;  3I56 1;  4BY1 I;  1VQ6 Z;  2NVQ I;  2JIO A;  1ZB8 A;  4BY7 I;  2IZ3 A;  5T6B A;  1Q16 A;  2F4M A;  1ZH1 A;  3VB9 A;  3J80 b;  1YIT Z;  3CC2 1;  2GTI A;  3CCM Z;  4A3M I;  2JIM A;  1YJW 1;  4MXU A;  2LIY A;  2OTL Z;  3GTP I;  1VQL Z;  2BJO A;  2RPR A;  5T67 A;  5IT9 f;  3CME Z;  1Y1V I;  2JIR A;  4RVD A;  2IV2 X;  1VQ6 1;  3IF8 A;  1YIJ Z;  4XX2 A;  3P5J B;  3D6W A;  1WZN A;  1QVF Z;  1YIT 1;  3CC7 Z;  4E2Z A;  3CCM 1;  1RO4 A;  4BXX I;  3VTN A;  4RVG A;  2QEX Z;  1W2B Y;  1WJ2 A;  2OTL 1;  4HGZ A;  1K73 1;  5D1O B;  1VQL 1;  4NB9 A;  3RZO I;  4A93 I;  3CME 1;  2QLV B;  1P9N A;  1KD1 2;  2RIQ A;  1YIJ 1;  2JS4 A;  1YI2 Z;  3PO3 S;  1VQ4 1;  1K9M 2;  3FQQ A;  1X3W A;  4NBC A;  5LL6 f;  1JWH C;  3CC7 1;  1DL6 A;  5IP7 I;  4NBD A;  2E7Z A;  2G2K A;  5IP9 I;  3K7A I;  4NBG A;  4MD9 A;  3J80 f;  3GCF A;  1M90 1;  2QEX 1;  3RZD I;  3CPW Z;  4NH1 C;  3S1N I;  4NBB A;  3CCE 1;  3CCS Z;  1N8R 1;  3Q87 A;  3M4O I;  1QVG Z;  3M3Y I;  1S72 1;  3GTK I;  1Q86 1;  1YI2 1;  2AKL A;  3NFZ A;  3QWU A;  2RT9 A;  5D1O A;  3S1M I;  3S1R I;  2HU9 A;  1QYP A;  4MH4 A;  1ML8 A;  3CCU Z;  4RS4 A;  2ZAE B;  3FKI I;  3CQZ I;  3CCJ Z;  1FDO A;  4A3L I;  3F3F C;  3TE5 B;  2IZ4 A;  3NH4 A;  3CCS 1;  5FLX b;  2O53 A;  5T64 A;  3S15 I;  1SFO I;  5FLM I;  2J6A A;  4CL1 A;  3U50 C;  1QF8 A;  4NBA A;  1VQ5 Z;  1K8A 1;  4E33 A;  4A3D I;  4BBR I;  1TWF I;  1PFT A;  4MRI A;  2DE6 A;  1VQK Z;  3I55 Z;  3CCU 1;  1VQP Z;  3EED A;  3HOX I;  1NJI 1;  3PO3 I;  3CCJ 1;  4BBS I;  2LEX A;  2JA5 I;  3S2D I;  1USP B;  2W03 A;  1KQS Y;  1K73 2;  2V45 A;  4NBF A;  4QTU A;  2OOY B;  3KIH A;  3G4S Z;  2R93 I;  1WII A;  1M1K 2;  4E2X A;  1VQ5 1;  5C4X I;  1VQ4 Z;  2WB1 A; 
#chains in the Genus database with same CATH homology
 1QVF Y;  3S14 I;  3S2H I;  1VQK 1;  3I55 1;  1VQP 1;  1VQ8 1;  1VQO Z;  1R9T I;  3G71 1;  4EWC A;  2H85 A;  3OW2 Z;  4Y52 I;  3BG1 B;  3GKQ A;  2YAD A;  2QR1 B;  1M90 2;  3CCE Z;  1M1K 1;  3GTM I;  1I3Q I;  2VF1 A;  3F3P C;  3JAM b;  2O4H A;  3G4S 1;  1Q82 1;  1N8R 2;  1S72 Z;  5CM2 M;  1JJ2 Z;  1TWC I;  1Z03 A;  5FLX f;  3CMA 1;  1RNI A;  1VLA A;  3GTJ I;  1Q86 2;  4NOZ A;  2DE7 A;  2PM9 A;  1YUA A;  3CC4 Z;  1USP A;  4E30 A;  1VQO 1;  4DK1 A;  2NVY I;  3J81 b;  4DQY B;  3BG0 B;  1Z01 A;  3CPW Y;  3EER A;  3TDH B;  4X6A I;  1RQF A;  3CCL Z;  4A3J I;  1YHQ Z;  2KI7 B;  2W04 A;  2JA7 I;  1NP6 A;  1QVG Y;  2E9H A;  2E2I I;  4NFR A;  3G6E Z;  3KIF A;  2WAQ A;  1LQL A;  2QRE B;  2LFU A;  1Q7Y 2;  3H3V J;  3CC4 1;  4E31 A;  4A3I I;  1K8A 2;  5D1P A;  2RBL A;  2R7Z I;  1KC8 1;  2R6M A;  4NBE A;  1I6H I;  1YJN 1;  3CCL 1;  1TWG I;  1YHQ 1;  4E2Y A;  1NJI 2;  3FQM A;  1RLY A;  3HOW I;  3HOV I;  4A3G I;  1TWA I;  3G6E 1;  4E2W A;  3NH8 A;  2YU9 I;  1NUI A;  3CD6 Z;  3CCQ Z;  1Q7Y 1;  5AN9 F;  3CCV Z;  3JAM f;  5C3E I;  2GU2 A;  1ZB9 A;  3CXC Z;  1Q81 1;  2Q51 A;  4TNU A;  1VQ8 Z;  2VUM I;  4A3K I;  3G71 Z;  2K5R A;  3IX0 A;  1L1O C;  2JR6 A;  4HH4 A;  2JA6 I;  2OZK A;  3ESW A;  3J81 f;  3HOY I;  2EGT A;  4S1T A;  2OTJ Z;  2KPI A;  3NDI A;  3CD6 1;  1S7M A;  3CCQ 1;  4A3B I;  3T4N B;  1N2F A;  1TFI A;  2P28 A;  3CMA Z;  2P3Y A;  3CCV 1;  1Q82 2;  4A3C I;  2NVX I;  2PK7 A;  1X0T A;  2PMZ A;  4AYB A;  1RO0 A;  2JNY A;  1VQN Z;  2V8J A;  3GTQ I;  4E32 A;  2QRC B;  4RV9 A;  2RHB A;  4NB8 A;  3VMH A;  1K83 I;  1KQS Z;  3OW2 Y;  3I4N I;  2K3R A;  4MD8 A;  4MON A;  2OTJ 1;  1VQM Z;  3HOZ I;  3GTL I;  5C4J I;  1WW9 A;  3MZK B;  2QA4 Z;  1JJ2 Y;  3H0G I;  1Z02 A;  1VQ7 Z;  5A2Q b;  2JA8 I;  3S16 I;  2Q4Z A;  4HGY A;  1W2B Z;  1X3Z A;  1VQN 1;  2R92 I;  3GTO I;  1RO2 A;  4RVH A;  3I4M I;  3NH5 A;  4DGL A;  2Y0S A;  3D9X A;  1YJN Z;  1KC8 2;  1VQM 1;  2QKD A;  3CCR Z;  2JUB A;  4Y7N I;  2HF1 A;  2QA4 1;  1Y1V S;  3PO2 I;  1TWH I;  1VQ7 1;  3VMG A;  3MZL B;  2E2J I;  5IT9 b;  2F4O A;  1VQ9 Z;  2VUG A;  3NDJ A;  2QRD B;  5C44 I;  1KD1 1;  4A3E I;  2JMO A;  3LUS A;  1I50 I;  1YJ9 Z;  3I56 Z;  1Q81 2;  1KRL A;  1K9M 1;  4A3F I;  3HKZ A;  3I07 A;  4NBH A;  3J7A 4;  2V8I A;  2DE5 A;  2I3C A;  2GTH A;  3CCR 1;  2B63 I;  2V8K A;  4QTT A;  1WCM I;  3IFU A;  4MD7 A;  3GTM S;  3CC2 Z;  3GTG I;  3HOU I;  1VQ9 1;  1YJW Z;  1Y1W I;  3MON A;  4RVF A;  3CXC Y;  2E2H I;  2OOX B;  2M6N A;  2M48 A;  2NVT I;  5A2Q f;  1YUK A;  3VMI A;  3S1Q I;  1YJ9 1;  3S17 I;  3I56 1;  4BY1 I;  1VQ6 Z;  2NVQ I;  1ZB8 A;  4BY7 I;  2IZ3 A;  5T6B A;  2F4M A;  1ZH1 A;  3VB9 A;  3J80 b;  1YIT Z;  3CC2 1;  2GTI A;  3CCM Z;  4A3M I;  1YJW 1;  4MXU A;  2LIY A;  2OTL Z;  3GTP I;  1VQL Z;  2BJO A;  2RPR A;  5T67 A;  5IT9 f;  3CME Z;  1Y1V I;  4RVD A;  1VQ6 1;  3IF8 A;  1YIJ Z;  4XX2 A;  3P5J B;  3D6W A;  1QVF Z;  1YIT 1;  3CC7 Z;  4E2Z A;  3CCM 1;  1RO4 A;  4BXX I;  3VTN A;  4RVG A;  2QEX Z;  1W2B Y;  2OTL 1;  4HGZ A;  1K73 1;  5D1O B;  1VQL 1;  4NB9 A;  3RZO I;  4A93 I;  3CME 1;  2QLV B;  1P9N A;  1KD1 2;  2RIQ A;  1YIJ 1;  2JS4 A;  1YI2 Z;  3PO3 S;  1VQ4 1;  1K9M 2;  3FQQ A;  1X3W A;  4NBC A;  5LL6 f;  1JWH C;  3CC7 1;  1DL6 A;  5IP7 I;  4NBD A;  2G2K A;  5IP9 I;  3K7A I;  4NBG A;  4MD9 A;  3J80 f;  3GCF A;  1M90 1;  2QEX 1;  3RZD I;  3CPW Z;  4NH1 C;  3S1N I;  4NBB A;  3CCE 1;  3CCS Z;  1N8R 1;  3Q87 A;  3M4O I;  1QVG Z;  3M3Y I;  1S72 1;  3GTK I;  1Q86 1;  1YI2 1;  2AKL A;  3NFZ A;  3QWU A;  2RT9 A;  5D1O A;  3S1M I;  3S1R I;  2HU9 A;  1QYP A;  4MH4 A;  1ML8 A;  3CCU Z;  4RS4 A;  2ZAE B;  3FKI I;  3CQZ I;  3CCJ Z;  4A3L I;  3F3F C;  3TE5 B;  2IZ4 A;  3NH4 A;  3CCS 1;  5FLX b;  2O53 A;  5T64 A;  3S15 I;  1SFO I;  5FLM I;  2J6A A;  4CL1 A;  3U50 C;  1QF8 A;  4NBA A;  1VQ5 Z;  1K8A 1;  4E33 A;  4A3D I;  4BBR I;  1TWF I;  1PFT A;  4MRI A;  2DE6 A;  1VQK Z;  3I55 Z;  3CCU 1;  1VQP Z;  3EED A;  3HOX I;  1NJI 1;  3PO3 I;  3CCJ 1;  4BBS I;  2JA5 I;  3S2D I;  1USP B;  2W03 A;  1KQS Y;  1K73 2;  4NBF A;  4QTU A;  2OOY B;  3KIH A;  3G4S Z;  2R93 I;  1WII A;  1M1K 2;  4E2X A;  1VQ5 1;  5C4X I;  1VQ4 Z;  2WB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...