1QF8A

Truncated form of casein kinase ii beta subunit (2-182) from homo sapiens
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
173
structure length
167
Chain Sequence
VSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CASEIN KINASE II
publication title Crystal structure of the human protein kinase CK2 regulatory subunit reveals its zinc finger-mediated dimerization.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 167
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.7.1.37: Transferred entry: 2.7.11.1, 2.7.11.8, 2.7.11.9, 2.7.11.10, 2.7.11.11,
pdb deposition date 1999-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 1qf8A01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1qf8A02
2M6NA 4NH1C 2JMOA 1RQFA 1QF8A 3EEDA 4MD8A 2M48A 2R6MA 4MD7A 4MD9A 1JWHC 2RT9A 4DGLA
chains in the Genus database with same CATH superfamily
3IX0A 3S1NI 3T4NB 3S1QI 4HGZA 4QTTA 3IFUA 4NBDA 1SIWA 1YITZ 3CCRZ 3F3FC 3QWUA 4MRIA 1Y1WI 3G711 1TWGI 1K9M2 3CCVZ 3TE5B 4HH4A 2NAPA 4NB8A 3CPWZ 1FDIA 2R6MA 1YJW1 1KC82 3NH5A 4BY7I 3PO3S 1WCMI 1WJ2A 3CCE1 2E2JI 4CL1A 4BBSI 4NBCA 2OZKA 4DGLA 1RQFA 1YIJZ 1WW9A 2WAQA 1YJN1 2LIYA 3OW2Y 4DQYB 3RZDI 3ESWA 1JWHC 5C4XI 3CC41 3HOWI 3CME1 1WZNA 2JMOA 3MZKB 2KI7B 1VQMZ 2OTLZ 5C44I 1Q7Y2 3CCL1 2JA8I 3CCQZ 2RT9A 1QXFA 4MXUA 2IZ3A 3CD61 2R92I 2K3RA 5IP9I 1VQN1 2GTIA 1K83I 3CCSZ 1YHQ1 4MD9A 1RO2A 2JIPA 3VMHA 5A2Qf 1VQ9Z 4MONA 1YI21 2QA4Z 2QRDB 1KRLA 1M901 3CC21 3D9XA 3PO3I 1ZH1A 2EGTA 4BY1I 5T6BA 2VPZA 4A3MI 1M1K1 2PMZA 3FQMA 4A3DI 4MH4A 2RHBA 2Y0SA 2PM9A 2JS4A 3S14I 4E2WA 5FLXf 3NH4A 3I07A 1WIIA 2WB1A 2E9HA 1VQ7Z 1X0TA 4NBEA 1VQK1 3KIHA 3HOXI 3S1MI 4E30A 3GTKI 4NBHA 4E2XA 3I4MI 3D2LA 2OTJZ 2QREB 5LL6f 1N8R1 4A3BI 1Q7Y1 2IZ4A 5A2Qb 4E2YA 1VLAA 3JAMf 3CCMZ 1S7MA 3CXCY 4A3JI 1VQ61 3M4OI 3D6WA 4MD8A 4NBBA 1KD12 3CCUZ 2LFUA 3GKQA 1YUAA 2JA7I 1YJ91 1NP6A 5IT9f 1Y1VI 2BJOA 3NFZA 2QKDA 1M902 1ZB8A 2OOYB 1KQSY 1VQ8Z 2YU9I 1VQ5Z 5FLXb 3CCR1 2DE6A 4NB9A 3S16I 1X3ZA 1M1K2 4DK1A 4MD7A 3G6E1 4RS4A 1X3WA 5AN9F 4S1TA 4E31A 3G4SZ 3HOUI 2JIQA 2VPXA 2E7ZA 3CMAZ 4A3FI 1FDOA 2R7ZI 3FKII 3G71Z 1YIJ1 1Z03A 2V45A 2VPYA 2W04A 2NVYI 1VQPZ 1NJI2 2VUGA 4E33A 2JR6A 1N8R2 2ZAEB 1NUIA 5T64A 1VQM1 4A3II 2OTL1 2JIRA 2H85A 4NBAA 5IT9b 3CC7Z 3CCQ1 3VB9A 4NOZA 3J7A4 4RVDA 1SFOI 3GTJI 3MZLB 1VQOZ 1KD11 1ML8A 1VQ4Z 3NDIA 5FLMI 1Y8CA 1K8A2 3F3PC 3CCJZ 1R9TI 4BXXI 4Y52I 1ZB9A 1VQ91 3S2HI 3OW2Z 2QA41 1TWFI 2AKLA 4Y7NI 3J80f 3I56Z 4NFRA 2GU2A 1Q812 4BBRI 2V3VA 4NBGA 3M3YI 3PO2I 2O4HA 3NDJA 5C3EI 3S1RI 1K732 3IF8A 2F4OA 2HF1A 1W2BY 3GTMS 2J6AA 3VMIA 2JUBA 2IV2X 1RO0A 4XX2A 1P9NA 2B63I 2JIMA 5T67A 1QVFY 1N2FA 2RIQA 2OTJ1 1NJI1 2JA5I 2NVQI 1JJ2Y 3CCM1 1S72Z 2Q4ZA 3KIFA 3RZOI 2QLVB 5D1PA 3CCU1 2RBLA 4A3KI 1AA6A 3J80b 4A3EI 3FQQA 1RO4A 2M48A 2QEXZ 2KPIA 2LEXA 1K8A1 1VQ81 1YIT1 1VQ6Z 1VQ51 1PFTA 4TNUA 1VQLZ 3HOVI 2Q51A 1Q862 3CCV1 1TWAI 1QVFZ 3GTMI 1Q811 3EEDA 3I55Z 4A3GI 2R93I 1JJ2Z 3CXCZ 2E2HI 3G4S1 3CQZI 4AYBA 1K731 3CMA1 2M6NA 3GTLI 1Q821 2JA6I 2W03A 3J81f 3P5JB 2PK7A 3JAMb 1QYPA 1USPB 3G6EZ 1YJWZ 1I6HI 1Z02A 1VQP1 4A3LI 3S2DI 1QVGY 3CCEZ 1KQSZ 4RV9A 1I3QI 3S15I 3MONA 3VMGA 5IP7I 3GTQI 4RVHA 4E32A 4A93I 2I3CA 2GTHA 3CC71 4RVGA 2E2II 3HKZA 4HGYA 1YJNZ 2P3YA 1TFIA 2VPWA 3CC4Z 1VQO1 3CMEZ 3GTOI 1RLYA 1VQ41 4E2ZA 3CCS1 5CM2M 3HOZI 2YADA 3HOYI 1YUKA 3CCJ1 3CCLZ 2DE7A 3CD6Z 2NVXI 3I561 1QVGZ 3LUSA 2K5RA 3EERA 2VUMI 1VQNZ 4NBFA 1YHQZ 1Q861 3J81b 1RNIA 1YI2Z 1Q822 1USPA 2P28A 3CC2Z 1Y1VS 4NH1C 1VQ71 5D1OB 1LQLA 1TWCI 3NH8A 4A3CI 1TWHI 2HU9A 2G2KA 3Q87A 1K9M1 2V8KA 2VF1A 3BG1B 3S17I 1Q16A 3IR7A 1KC81 3H0GI 3GCFA 3H3VJ 1Z01A 1VQKZ 2V8JA 4QTUA 1S721 3VTNA 3GTGI 3U50C 3GTPI 1DL6A 2OOXB 2JNYA 1W2BZ 5C4JI 4RVFA 2QRCB 3CPWY 2QR1B 2O53A 4EWCA 2QEX1 2NVTI 2AYDA 1VQL1 1QF8A 1I50I 3BG0B 3K7AI 1L1OC 2RPRA 2F4MA 1YJ9Z 2V8IA 2DE5A 3TDHB 2JIOA 5D1OA 3I4NI 4X6AI 3I551
chains in the Genus database with same CATH topology
3IX0A 3S1NI 3T4NB 3S1QI 4HGZA 4QTTA 3IFUA 4NBDA 1YITZ 3CCRZ 3F3FC 3QWUA 4MRIA 1Y1WI 3G711 1TWGI 1K9M2 3CCVZ 3TE5B 4HH4A 4NB8A 3CPWZ 2R6MA 1YJW1 1KC82 3NH5A 4BY7I 3PO3S 1WCMI 3CCE1 4BBSI 2E2JI 4CL1A 4NBCA 2OZKA 4DGLA 1RQFA 1YIJZ 1WW9A 2WAQA 1YJN1 2LIYA 3OW2Y 4DQYB 3RZDI 3ESWA 1JWHC 5C4XI 3CC41 3HOWI 3CME1 2JMOA 3MZKB 2KI7B 1VQMZ 2OTLZ 5C44I 1Q7Y2 3CCL1 2JA8I 3CCQZ 2RT9A 4MXUA 2IZ3A 3CD61 2R92I 2K3RA 5IP9I 1VQN1 2GTIA 1K83I 3CCSZ 1YHQ1 4MD9A 1RO2A 3VMHA 5A2Qf 1VQ9Z 4MONA 1YI21 2QA4Z 2QRDB 1KRLA 1M901 3CC21 3D9XA 3PO3I 1ZH1A 2EGTA 4BY1I 5T6BA 4A3MI 1M1K1 2PMZA 3FQMA 4A3DI 4MH4A 2RHBA 2Y0SA 2PM9A 2JS4A 3S14I 4E2WA 5FLXf 3NH4A 3I07A 1WIIA 2WB1A 2E9HA 1VQ7Z 1X0TA 4NBEA 1VQK1 3KIHA 3HOXI 3S1MI 4E30A 3GTKI 4NBHA 4E2XA 3I4MI 2OTJZ 2QREB 5LL6f 1N8R1 4A3BI 1Q7Y1 2IZ4A 5A2Qb 4E2YA 1VLAA 3JAMf 3CCMZ 1S7MA 3CXCY 4A3JI 1VQ61 3M4OI 3D6WA 4MD8A 4NBBA 1KD12 3CCUZ 2LFUA 3GKQA 1YUAA 2JA7I 1YJ91 1NP6A 5IT9f 1Y1VI 2BJOA 3NFZA 2QKDA 1M902 1ZB8A 2OOYB 1KQSY 1VQ8Z 2YU9I 1VQ5Z 5FLXb 3CCR1 2DE6A 4NB9A 3S16I 1X3ZA 1M1K2 4DK1A 4MD7A 3G6E1 4RS4A 1X3WA 5AN9F 4S1TA 4E31A 3G4SZ 3HOUI 3CMAZ 4A3FI 2R7ZI 3FKII 3G71Z 1YIJ1 1Z03A 2W04A 2NVYI 1VQPZ 1NJI2 2VUGA 4E33A 2JR6A 1N8R2 2ZAEB 1NUIA 5T64A 1VQM1 4A3II 2OTL1 2H85A 4NBAA 5IT9b 3CC7Z 3CCQ1 3VB9A 4NOZA 3J7A4 4RVDA 1SFOI 3GTJI 3MZLB 1VQOZ 1KD11 1ML8A 1VQ4Z 3NDIA 5FLMI 1K8A2 3F3PC 3CCJZ 1R9TI 4BXXI 4Y52I 1ZB9A 1VQ91 3S2HI 3OW2Z 2QA41 1TWFI 2AKLA 4Y7NI 3J80f 3I56Z 4NFRA 2GU2A 1Q812 4BBRI 4NBGA 3M3YI 3PO2I 2O4HA 3NDJA 5C3EI 3S1RI 1K732 3IF8A 2F4OA 2HF1A 1W2BY 3GTMS 2J6AA 3VMIA 2JUBA 1RO0A 4XX2A 1P9NA 2B63I 5T67A 1QVFY 1N2FA 2RIQA 2OTJ1 1NJI1 2JA5I 2NVQI 1JJ2Y 3CCM1 1S72Z 2Q4ZA 3KIFA 3RZOI 2QLVB 5D1PA 3CCU1 2RBLA 4A3KI 3J80b 4A3EI 3FQQA 1RO4A 2M48A 2QEXZ 2KPIA 1K8A1 1VQ81 1YIT1 1VQ6Z 1VQ51 1PFTA 4TNUA 1VQLZ 3HOVI 2Q51A 1Q862 3CCV1 1TWAI 1QVFZ 3GTMI 1Q811 3EEDA 3I55Z 4A3GI 2R93I 1JJ2Z 3CXCZ 2E2HI 3G4S1 3CQZI 4AYBA 1K731 3CMA1 2M6NA 3GTLI 1Q821 2JA6I 2W03A 3J81f 3P5JB 2PK7A 3JAMb 1QYPA 1USPB 3G6EZ 1YJWZ 1I6HI 1Z02A 1VQP1 4A3LI 3S2DI 1QVGY 3CCEZ 1KQSZ 4RV9A 1I3QI 3S15I 3MONA 3VMGA 5IP7I 3GTQI 4RVHA 4E32A 4A93I 2I3CA 2GTHA 3CC71 4RVGA 2E2II 3HKZA 4HGYA 1YJNZ 2P3YA 1TFIA 3CC4Z 1VQO1 3CMEZ 3GTOI 1RLYA 1VQ41 4E2ZA 3CCS1 5CM2M 3HOZI 2YADA 3HOYI 1YUKA 3CCJ1 3CCLZ 2DE7A 3CD6Z 2NVXI 3I561 1QVGZ 3LUSA 2K5RA 3EERA 2VUMI 1VQNZ 4NBFA 1YHQZ 1Q861 3J81b 1RNIA 1YI2Z 1Q822 1USPA 2P28A 3CC2Z 1Y1VS 4NH1C 1VQ71 5D1OB 1LQLA 1TWCI 3NH8A 4A3CI 1TWHI 2HU9A 2G2KA 3Q87A 1K9M1 2V8KA 2VF1A 3BG1B 3S17I 1KC81 3H0GI 3GCFA 3H3VJ 1Z01A 1VQKZ 2V8JA 4QTUA 1S721 3VTNA 3GTGI 3U50C 3GTPI 1DL6A 2OOXB 2JNYA 1W2BZ 5C4JI 4RVFA 2QRCB 3CPWY 2QR1B 2O53A 4EWCA 2QEX1 2NVTI 1VQL1 1QF8A 1I50I 3BG0B 3K7AI 1L1OC 2RPRA 2F4MA 1YJ9Z 2V8IA 2DE5A 3TDHB 5D1OA 3I4NI 4X6AI 3I551
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6N A;  4NH1 C;  2JMO A;  1RQF A;  1QF8 A;  3EED A;  4MD8 A;  2M48 A;  2R6M A;  4MD7 A;  4MD9 A;  1JWH C;  2RT9 A;  4DGL A; 
#chains in the Genus database with same CATH topology
 3IX0 A;  3S1N I;  3T4N B;  3S1Q I;  4HGZ A;  4QTT A;  3IFU A;  4NBD A;  1SIW A;  1YIT Z;  3CCR Z;  3F3F C;  3QWU A;  4MRI A;  1Y1W I;  3G71 1;  1TWG I;  1K9M 2;  3CCV Z;  3TE5 B;  4HH4 A;  2NAP A;  4NB8 A;  3CPW Z;  1FDI A;  2R6M A;  1YJW 1;  1KC8 2;  3NH5 A;  4BY7 I;  3PO3 S;  1WCM I;  1WJ2 A;  3CCE 1;  2E2J I;  4CL1 A;  4BBS I;  4NBC A;  2OZK A;  4DGL A;  1RQF A;  1YIJ Z;  1WW9 A;  2WAQ A;  1YJN 1;  2LIY A;  3OW2 Y;  4DQY B;  3RZD I;  3ESW A;  1JWH C;  5C4X I;  3CC4 1;  3HOW I;  3CME 1;  1WZN A;  2JMO A;  3MZK B;  2KI7 B;  1VQM Z;  2OTL Z;  5C44 I;  1Q7Y 2;  3CCL 1;  2JA8 I;  3CCQ Z;  2RT9 A;  1QXF A;  4MXU A;  2IZ3 A;  3CD6 1;  2R92 I;  2K3R A;  5IP9 I;  1VQN 1;  2GTI A;  1K83 I;  3CCS Z;  1YHQ 1;  4MD9 A;  1RO2 A;  2JIP A;  3VMH A;  5A2Q f;  1VQ9 Z;  4MON A;  1YI2 1;  2QA4 Z;  2QRD B;  1KRL A;  1M90 1;  3CC2 1;  3D9X A;  3PO3 I;  1ZH1 A;  2EGT A;  4BY1 I;  5T6B A;  2VPZ A;  4A3M I;  1M1K 1;  2PMZ A;  3FQM A;  4A3D I;  4MH4 A;  2RHB A;  2Y0S A;  2PM9 A;  2JS4 A;  3S14 I;  4E2W A;  5FLX f;  3NH4 A;  3I07 A;  1WII A;  2WB1 A;  2E9H A;  1VQ7 Z;  1X0T A;  4NBE A;  1VQK 1;  3KIH A;  3HOX I;  3S1M I;  4E30 A;  3GTK I;  4NBH A;  4E2X A;  3I4M I;  3D2L A;  2OTJ Z;  2QRE B;  5LL6 f;  1N8R 1;  4A3B I;  1Q7Y 1;  2IZ4 A;  5A2Q b;  4E2Y A;  1VLA A;  3JAM f;  3CCM Z;  1S7M A;  3CXC Y;  4A3J I;  1VQ6 1;  3M4O I;  3D6W A;  4MD8 A;  4NBB A;  1KD1 2;  3CCU Z;  2LFU A;  3GKQ A;  1YUA A;  2JA7 I;  1YJ9 1;  1NP6 A;  5IT9 f;  1Y1V I;  2BJO A;  3NFZ A;  2QKD A;  1M90 2;  1ZB8 A;  2OOY B;  1KQS Y;  1VQ8 Z;  2YU9 I;  1VQ5 Z;  5FLX b;  3CCR 1;  2DE6 A;  4NB9 A;  3S16 I;  1X3Z A;  1M1K 2;  4DK1 A;  4MD7 A;  3G6E 1;  4RS4 A;  1X3W A;  5AN9 F;  4S1T A;  4E31 A;  3G4S Z;  3HOU I;  2JIQ A;  2VPX A;  2E7Z A;  3CMA Z;  4A3F I;  1FDO A;  2R7Z I;  3FKI I;  3G71 Z;  1YIJ 1;  1Z03 A;  2V45 A;  2VPY A;  2W04 A;  2NVY I;  1VQP Z;  1NJI 2;  2VUG A;  4E33 A;  2JR6 A;  1N8R 2;  2ZAE B;  1NUI A;  5T64 A;  1VQM 1;  4A3I I;  2OTL 1;  2JIR A;  2H85 A;  4NBA A;  5IT9 b;  3CC7 Z;  3CCQ 1;  3VB9 A;  4NOZ A;  3J7A 4;  4RVD A;  1SFO I;  3GTJ I;  3MZL B;  1VQO Z;  1KD1 1;  1ML8 A;  1VQ4 Z;  3NDI A;  5FLM I;  1Y8C A;  1K8A 2;  3F3P C;  3CCJ Z;  1R9T I;  4BXX I;  4Y52 I;  1ZB9 A;  1VQ9 1;  3S2H I;  3OW2 Z;  2QA4 1;  1TWF I;  2AKL A;  4Y7N I;  3J80 f;  3I56 Z;  4NFR A;  2GU2 A;  1Q81 2;  4BBR I;  2V3V A;  4NBG A;  3M3Y I;  3PO2 I;  2O4H A;  3NDJ A;  5C3E I;  3S1R I;  1K73 2;  3IF8 A;  2F4O A;  2HF1 A;  1W2B Y;  3GTM S;  2J6A A;  3VMI A;  2JUB A;  2IV2 X;  1RO0 A;  4XX2 A;  1P9N A;  2B63 I;  2JIM A;  5T67 A;  1QVF Y;  1N2F A;  2RIQ A;  2OTJ 1;  1NJI 1;  2JA5 I;  2NVQ I;  1JJ2 Y;  3CCM 1;  1S72 Z;  2Q4Z A;  3KIF A;  3RZO I;  2QLV B;  5D1P A;  3CCU 1;  2RBL A;  4A3K I;  1AA6 A;  3J80 b;  4A3E I;  3FQQ A;  1RO4 A;  2M48 A;  2QEX Z;  2KPI A;  2LEX A;  1K8A 1;  1VQ8 1;  1YIT 1;  1VQ6 Z;  1VQ5 1;  1PFT A;  4TNU A;  1VQL Z;  3HOV I;  2Q51 A;  1Q86 2;  3CCV 1;  1TWA I;  1QVF Z;  3GTM I;  1Q81 1;  3EED A;  3I55 Z;  4A3G I;  2R93 I;  1JJ2 Z;  3CXC Z;  2E2H I;  3G4S 1;  3CQZ I;  4AYB A;  1K73 1;  3CMA 1;  2M6N A;  3GTL I;  1Q82 1;  2JA6 I;  2W03 A;  3J81 f;  3P5J B;  2PK7 A;  3JAM b;  1QYP A;  1USP B;  3G6E Z;  1YJW Z;  1I6H I;  1Z02 A;  1VQP 1;  4A3L I;  3S2D I;  1QVG Y;  3CCE Z;  1KQS Z;  4RV9 A;  1I3Q I;  3S15 I;  3MON A;  3VMG A;  5IP7 I;  3GTQ I;  4RVH A;  4E32 A;  4A93 I;  2I3C A;  2GTH A;  3CC7 1;  4RVG A;  2E2I I;  3HKZ A;  4HGY A;  1YJN Z;  2P3Y A;  1TFI A;  2VPW A;  3CC4 Z;  1VQO 1;  3CME Z;  3GTO I;  1RLY A;  1VQ4 1;  4E2Z A;  3CCS 1;  5CM2 M;  3HOZ I;  2YAD A;  3HOY I;  1YUK A;  3CCJ 1;  3CCL Z;  2DE7 A;  3CD6 Z;  2NVX I;  3I56 1;  1QVG Z;  3LUS A;  2K5R A;  3EER A;  2VUM I;  1VQN Z;  4NBF A;  1YHQ Z;  1Q86 1;  3J81 b;  1RNI A;  1YI2 Z;  1Q82 2;  1USP A;  2P28 A;  3CC2 Z;  1Y1V S;  4NH1 C;  1VQ7 1;  5D1O B;  1LQL A;  1TWC I;  3NH8 A;  4A3C I;  1TWH I;  2HU9 A;  2G2K A;  3Q87 A;  1K9M 1;  2V8K A;  2VF1 A;  3BG1 B;  3S17 I;  1Q16 A;  3IR7 A;  1KC8 1;  3H0G I;  3GCF A;  3H3V J;  1Z01 A;  1VQK Z;  2V8J A;  4QTU A;  1S72 1;  3VTN A;  3GTG I;  3U50 C;  3GTP I;  1DL6 A;  2OOX B;  2JNY A;  1W2B Z;  5C4J I;  4RVF A;  2QRC B;  3CPW Y;  2QR1 B;  2O53 A;  4EWC A;  2QEX 1;  2NVT I;  2AYD A;  1VQL 1;  1QF8 A;  1I50 I;  3BG0 B;  3K7A I;  1L1O C;  2RPR A;  2F4M A;  1YJ9 Z;  2V8I A;  2DE5 A;  3TDH B;  2JIO A;  5D1O A;  3I4N I;  4X6A I;  3I55 1; 
#chains in the Genus database with same CATH homology
 3IX0 A;  3S1N I;  3T4N B;  3S1Q I;  4HGZ A;  4QTT A;  3IFU A;  4NBD A;  1YIT Z;  3CCR Z;  3F3F C;  3QWU A;  4MRI A;  1Y1W I;  3G71 1;  1TWG I;  1K9M 2;  3CCV Z;  3TE5 B;  4HH4 A;  4NB8 A;  3CPW Z;  2R6M A;  1YJW 1;  1KC8 2;  3NH5 A;  4BY7 I;  3PO3 S;  1WCM I;  3CCE 1;  4BBS I;  2E2J I;  4CL1 A;  4NBC A;  2OZK A;  4DGL A;  1RQF A;  1YIJ Z;  1WW9 A;  2WAQ A;  1YJN 1;  2LIY A;  3OW2 Y;  4DQY B;  3RZD I;  3ESW A;  1JWH C;  5C4X I;  3CC4 1;  3HOW I;  3CME 1;  2JMO A;  3MZK B;  2KI7 B;  1VQM Z;  2OTL Z;  5C44 I;  1Q7Y 2;  3CCL 1;  2JA8 I;  3CCQ Z;  2RT9 A;  4MXU A;  2IZ3 A;  3CD6 1;  2R92 I;  2K3R A;  5IP9 I;  1VQN 1;  2GTI A;  1K83 I;  3CCS Z;  1YHQ 1;  4MD9 A;  1RO2 A;  3VMH A;  5A2Q f;  1VQ9 Z;  4MON A;  1YI2 1;  2QA4 Z;  2QRD B;  1KRL A;  1M90 1;  3CC2 1;  3D9X A;  3PO3 I;  1ZH1 A;  2EGT A;  4BY1 I;  5T6B A;  4A3M I;  1M1K 1;  2PMZ A;  3FQM A;  4A3D I;  4MH4 A;  2RHB A;  2Y0S A;  2PM9 A;  2JS4 A;  3S14 I;  4E2W A;  5FLX f;  3NH4 A;  3I07 A;  1WII A;  2WB1 A;  2E9H A;  1VQ7 Z;  1X0T A;  4NBE A;  1VQK 1;  3KIH A;  3HOX I;  3S1M I;  4E30 A;  3GTK I;  4NBH A;  4E2X A;  3I4M I;  2OTJ Z;  2QRE B;  5LL6 f;  1N8R 1;  4A3B I;  1Q7Y 1;  2IZ4 A;  5A2Q b;  4E2Y A;  1VLA A;  3JAM f;  3CCM Z;  1S7M A;  3CXC Y;  4A3J I;  1VQ6 1;  3M4O I;  3D6W A;  4MD8 A;  4NBB A;  1KD1 2;  3CCU Z;  2LFU A;  3GKQ A;  1YUA A;  2JA7 I;  1YJ9 1;  1NP6 A;  5IT9 f;  1Y1V I;  2BJO A;  3NFZ A;  2QKD A;  1M90 2;  1ZB8 A;  2OOY B;  1KQS Y;  1VQ8 Z;  2YU9 I;  1VQ5 Z;  5FLX b;  3CCR 1;  2DE6 A;  4NB9 A;  3S16 I;  1X3Z A;  1M1K 2;  4DK1 A;  4MD7 A;  3G6E 1;  4RS4 A;  1X3W A;  5AN9 F;  4S1T A;  4E31 A;  3G4S Z;  3HOU I;  3CMA Z;  4A3F I;  2R7Z I;  3FKI I;  3G71 Z;  1YIJ 1;  1Z03 A;  2W04 A;  2NVY I;  1VQP Z;  1NJI 2;  2VUG A;  4E33 A;  2JR6 A;  1N8R 2;  2ZAE B;  1NUI A;  5T64 A;  1VQM 1;  4A3I I;  2OTL 1;  2H85 A;  4NBA A;  5IT9 b;  3CC7 Z;  3CCQ 1;  3VB9 A;  4NOZ A;  3J7A 4;  4RVD A;  1SFO I;  3GTJ I;  3MZL B;  1VQO Z;  1KD1 1;  1ML8 A;  1VQ4 Z;  3NDI A;  5FLM I;  1K8A 2;  3F3P C;  3CCJ Z;  1R9T I;  4BXX I;  4Y52 I;  1ZB9 A;  1VQ9 1;  3S2H I;  3OW2 Z;  2QA4 1;  1TWF I;  2AKL A;  4Y7N I;  3J80 f;  3I56 Z;  4NFR A;  2GU2 A;  1Q81 2;  4BBR I;  4NBG A;  3M3Y I;  3PO2 I;  2O4H A;  3NDJ A;  5C3E I;  3S1R I;  1K73 2;  3IF8 A;  2F4O A;  2HF1 A;  1W2B Y;  3GTM S;  2J6A A;  3VMI A;  2JUB A;  1RO0 A;  4XX2 A;  1P9N A;  2B63 I;  5T67 A;  1QVF Y;  1N2F A;  2RIQ A;  2OTJ 1;  1NJI 1;  2JA5 I;  2NVQ I;  1JJ2 Y;  3CCM 1;  1S72 Z;  2Q4Z A;  3KIF A;  3RZO I;  2QLV B;  5D1P A;  3CCU 1;  2RBL A;  4A3K I;  3J80 b;  4A3E I;  3FQQ A;  1RO4 A;  2M48 A;  2QEX Z;  2KPI A;  1K8A 1;  1VQ8 1;  1YIT 1;  1VQ6 Z;  1VQ5 1;  1PFT A;  4TNU A;  1VQL Z;  3HOV I;  2Q51 A;  1Q86 2;  3CCV 1;  1TWA I;  1QVF Z;  3GTM I;  1Q81 1;  3EED A;  3I55 Z;  4A3G I;  2R93 I;  1JJ2 Z;  3CXC Z;  2E2H I;  3G4S 1;  3CQZ I;  4AYB A;  1K73 1;  3CMA 1;  2M6N A;  3GTL I;  1Q82 1;  2JA6 I;  2W03 A;  3J81 f;  3P5J B;  2PK7 A;  3JAM b;  1QYP A;  1USP B;  3G6E Z;  1YJW Z;  1I6H I;  1Z02 A;  1VQP 1;  4A3L I;  3S2D I;  1QVG Y;  3CCE Z;  1KQS Z;  4RV9 A;  1I3Q I;  3S15 I;  3MON A;  3VMG A;  5IP7 I;  3GTQ I;  4RVH A;  4E32 A;  4A93 I;  2I3C A;  2GTH A;  3CC7 1;  4RVG A;  2E2I I;  3HKZ A;  4HGY A;  1YJN Z;  2P3Y A;  1TFI A;  3CC4 Z;  1VQO 1;  3CME Z;  3GTO I;  1RLY A;  1VQ4 1;  4E2Z A;  3CCS 1;  5CM2 M;  3HOZ I;  2YAD A;  3HOY I;  1YUK A;  3CCJ 1;  3CCL Z;  2DE7 A;  3CD6 Z;  2NVX I;  3I56 1;  1QVG Z;  3LUS A;  2K5R A;  3EER A;  2VUM I;  1VQN Z;  4NBF A;  1YHQ Z;  1Q86 1;  3J81 b;  1RNI A;  1YI2 Z;  1Q82 2;  1USP A;  2P28 A;  3CC2 Z;  1Y1V S;  4NH1 C;  1VQ7 1;  5D1O B;  1LQL A;  1TWC I;  3NH8 A;  4A3C I;  1TWH I;  2HU9 A;  2G2K A;  3Q87 A;  1K9M 1;  2V8K A;  2VF1 A;  3BG1 B;  3S17 I;  1KC8 1;  3H0G I;  3GCF A;  3H3V J;  1Z01 A;  1VQK Z;  2V8J A;  4QTU A;  1S72 1;  3VTN A;  3GTG I;  3U50 C;  3GTP I;  1DL6 A;  2OOX B;  2JNY A;  1W2B Z;  5C4J I;  4RVF A;  2QRC B;  3CPW Y;  2QR1 B;  2O53 A;  4EWC A;  2QEX 1;  2NVT I;  1VQL 1;  1QF8 A;  1I50 I;  3BG0 B;  3K7A I;  1L1O C;  2RPR A;  2F4M A;  1YJ9 Z;  2V8I A;  2DE5 A;  3TDH B;  5D1O A;  3I4N I;  4X6A I;  3I55 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...