3CCEZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
b'SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cceZ00
1YIJ1 3I561 1VQP1 1M902 1Q7Y1 1KD12 1YJW1 1VQM1 1JJ2Y 1KC82 1M1K2 1Q822 1YJN1 3I551 1QVFY 3CMA1 3CCS1 1YJ9Z 3CCRZ 1QVGY 1QVFZ 3CMEZ 3CCLZ 1Q811 1VQ5Z 3CC71 3CCMZ 1K731 1VQ41 1QVGZ 1YIT1 2OTLZ 1VQNZ 3CC2Z 3CCV1 1Q862 3CCQZ 3CCJZ 1VQ8Z 3CPWY 1VQ61 3CD6Z 1NJI2 2QEX1 3G6EZ 3CC41 1VQO1 3G4S1 3CPWZ 2QA4Z 1VQL1 1N8R1 3G711 3CCE1 1VQK1 1YIJZ 3I56Z 1VQPZ 1JJ2Z 1YJWZ 3CCUZ 1K9M2 1VQ71 1M901 3CCSZ 1KQSY 1S721 2OTJZ 1YHQZ 1YI21 1KQSZ 3CXCY 1YITZ 1K8A1 3CME1 1VQ91 1VQ51 3CCVZ 1VQN1 1Q7Y2 1VQ6Z 3CC21 2QEXZ 3OW2Y 3CCQ1 3G4SZ 3CCJ1 1VQOZ 1VQMZ 1VQ81 1VQLZ 1VQKZ 3CCEZ 1YJNZ 3CD61 3I55Z 1Q861 3G6E1 3CMAZ 2QA41 1NJI1 1KD11 1Q812 1K732 1KC81 1M1K1 1Q821 3CC7Z 1VQ7Z 1YJ91 3CCR1 1VQ4Z 1S72Z 3CCU1 3CCL1 1W2BY 3CXCZ 3CCM1 1YI2Z 1K8A2 1K9M1 2OTL1 1W2BZ 2OTJ1 1YHQ1 1VQ9Z 1N8R2 3CC4Z 3G71Z 3OW2Z
chains in the Genus database with same CATH superfamily
1NP6A 1YUAA 1SIWA 1SFOI 3ESWA 3F3FC 3F3PC 1M902 1KD12 4NOZA 1I3QI 3J81b 2LIYA 4A3EI 1VQM1 3GTMS 2JIQA 1FDOA 3CMA1 4NB9A 1USPB 3CCS1 4NBDA 1QVGY 1S7MA 5T64A 1QVFZ 1AA6A 3CC71 1K731 1VQNZ 3M3YI 3IFUA 3CCV1 2BJOA 3CCJZ 2V3VA 3CD6Z 3H0GI 1WJ2A 1VQO1 3S1NI 1VQL1 4NH1C 3CCE1 1Y1VI 1P9NA 3I07A 1RO4A 4A3KI 4NBBA 3GTGI 2P28A 1YJWZ 2NVYI 3VMGA 3S1MI 2ZAEB 1PFTA 1ZB9A 2JIMA 4E31A 2F4OA 2NVXI 1TWGI 2Y0SA 3D2LA 3LUSA 4RVFA 5FLXb 1WZNA 3S14I 3JAMb 1I6HI 1VQ6Z 2IV2X 3CC21 2RIQA 3GCFA 2K5RA 3G4SZ 3CCQ1 1VQMZ 3CMAZ 2QA41 3T4NB 1KD11 2R7ZI 4MONA 4A3JI 4NBFA 1WW9A 1K732 3CC7Z 1VQ7Z 3S2DI 4Y52I 2JA8I 2DE5A 5AN9F 4A3MI 2GTHA 4MD7A 4A3FI 4A3II 5T6BA 3HKZA 3HOXI 1W2BZ 2E7ZA 1RLYA 3MZKB 3K7AI 3VMHA 1RNIA 1Y1WI 4RV9A 5C4XI 3OW2Z 3Q87A 3FQMA 4S1TA 3NDJA 4A3LI 4A3CI 1KRLA 1YJW1 3CQZI 3NH8A 2E2II 4A3GI 2W04A 2WB1A 4A93I 4A3DI 2RHBA 4MRIA 3CCRZ 2VUMI 3CCLZ 3CCMZ 1VQ41 3H3VJ 4EWCA 1RO2A 4RVDA 2VPZA 3CC2Z 4HGZA 5D1OB 4CL1A 3CCQZ 1VQ61 3CPWY 4X6AI 1K83I 5D1OA 3FQQA 3NDIA 1ML8A 2K3RA 3G4S1 2QA4Z 1YIJZ 1VQPZ 2V8JA 1JJ2Z 3GTQI 4MXUA 1USPA 2QLVB 4BY1I 2GTIA 1VQ71 3I4NI 4NBHA 4DK1A 3M4OI 2JR6A 1KQSZ 1YITZ 3CME1 2QRDB 2RBLA 3QWUA 2OOYB 2O4HA 2OZKA 2PM9A 3OW2Y 5IT9f 2R92I 2YADA 1VQKZ 2E9HA 3G6E1 4BBRI 4MD9A 3GTLI 4E33A 3GTMI 4RS4A 5FLMI 3CCR1 1VQ4Z 2H85A 1S72Z 3TDHB 4E2WA 3CCL1 3PO3S 3CXCZ 3CCM1 3GTJI 2JNYA 1K9M1 3S16I 2PMZA 2V8IA 1YHQ1 2VF1A 1VQ9Z 3KIHA 2JIPA 5IP9I 2JA7I 3J80f 2E2HI 4NB8A 2JIRA 3D9XA 1FDIA 3HOYI 1YIJ1 3MZLB 4HH4A 2QREB 1VQP1 1Q7Y1 4NBCA 1JJ2Y 1KC82 1YJN1 3I551 1R9TI 1QVFY 2Q4ZA 1RO0A 4E2ZA 3BG1B 2JA6I 2AKLA 3P5JB 3CMEZ 1Q811 1QVGZ 3RZOI 1YIT1 2OTLZ 1TWAI 1QF8A 1TWCI 2V45A 2I3CA 3J7A4 1WIIA 2R6MA 4DQYB 2AYDA 3G6EZ 4HGYA 3CC41 3G711 1VQK1 2JMOA 1L1OC 3I56Z 2HU9A 3GTKI 4NBGA 3D6WA 4NBEA 2JUBA 2RT9A 1QYPA 1K9M2 3GTOI 4BY7I 2VPXA 1S721 2DE7A 2QR1B 1YUKA 3GKQA 1YHQZ 3CXCY 1Z02A 2YU9I 1VQ91 1VQ51 3PO2I 2DE6A 3J80b 1Q7Y2 1N2FA 4RVHA 5IP7I 1TFIA 2GU2A 2QEXZ 1Y1VS 2IZ4A 1VQ81 2LEXA 4E2XA 1YJNZ 3I55Z 1Q861 5C3EI 1ZB8A 5C44I 4NFRA 1NJI1 2QKDA 1Q812 1KC81 3IR7A 4E2YA 3CCU1 2O53A 1W2BY 4QTUA 4NBAA 3KIFA 1YI2Z 1K8A2 2LFUA 2OTL1 2OTJ1 5A2Qf 5C4JI 1Z01A 3CC4Z 4MD8A 3S17I 3G71Z 4QTTA 4TNUA 2J6AA 3HOWI 3HOUI 1VLAA 3I561 3VB9A 1X3WA 1NUIA 2V8KA 1TWFI 1M1K2 2NAPA 1Q822 2WAQA 2NVQI 1JWHC 2B63I 1DL6A 2HF1A 5CM2M 1YJ9Z 4A3BI 1VQ5Z 2VUGA 1Z03A 2G2KA 3RZDI 2PK7A 3S1RI 2JIOA 4RVGA 3S1QI 3GTPI 4DGLA 2F4MA 4BBSI 3HOVI 1Q862 3FKII 3TE5B 1VQ8Z 1X3ZA 3MONA 1NJI2 2QEX1 4MH4A 3CPWZ 2M48A 3S2HI 1N8R1 3HOZI 4E32A 3CCUZ 2KI7B 3EERA 3U50C 2QRCB 3J81f 2R93I 1M901 3CCSZ 1KQSY 2IZ3A 1WCMI 2OTJZ 2Q51A 3IX0A 2M6NA 1YI21 1RQFA 3PO3I 3NH4A 5A2Qb 1Q16A 2E2JI 1K8A1 5IT9b 1ZH1A 3IF8A 5D1PA 5T67A 3VMIA 3CCVZ 1VQN1 2EGTA 1QXFA 2NVTI 2P3YA 1VQOZ 3CCJ1 1VQLZ 3BG0B 3CCEZ 4Y7NI 3CD61 2OOXB 3I4MI 1TWHI 2RPRA 1LQLA 4BXXI 3NH5A 4E30A 1M1K1 3EEDA 1Q821 1YJ91 2JS4A 2VPYA 5LL6f 1Y8CA 2VPWA 2JA5I 1X0TA 1N8R2 5FLXf 3NFZA 4AYBA 2KPIA 4XX2A 1I50I 3S15I 3VTNA 3JAMf 2W03A
chains in the Genus database with same CATH topology
1NP6A 1YUAA 1SFOI 3ESWA 3F3FC 3F3PC 1M902 1KD12 4NOZA 1I3QI 3J81b 2LIYA 4A3EI 1VQM1 3GTMS 3CMA1 4NB9A 1USPB 3CCS1 4NBDA 1QVGY 1S7MA 5T64A 1QVFZ 3CC71 1K731 1VQNZ 3M3YI 3IFUA 3CCV1 2BJOA 3CCJZ 3CD6Z 3H0GI 1VQO1 3S1NI 1VQL1 4NH1C 3CCE1 1Y1VI 1P9NA 3I07A 1RO4A 4A3KI 4NBBA 3GTGI 2P28A 1YJWZ 2NVYI 3VMGA 3S1MI 2ZAEB 1PFTA 1ZB9A 4E31A 2F4OA 2NVXI 1TWGI 2Y0SA 3LUSA 4RVFA 5FLXb 3S14I 3JAMb 1I6HI 1VQ6Z 3CC21 2RIQA 3GCFA 2K5RA 3G4SZ 3CCQ1 1VQMZ 3CMAZ 2QA41 3T4NB 1KD11 2R7ZI 4MONA 4A3JI 4NBFA 1WW9A 1K732 3CC7Z 1VQ7Z 3S2DI 4Y52I 2JA8I 2DE5A 5AN9F 4A3MI 2GTHA 4MD7A 4A3FI 4A3II 5T6BA 3HKZA 3HOXI 1W2BZ 1RLYA 3MZKB 3K7AI 3VMHA 1RNIA 1Y1WI 4RV9A 5C4XI 3OW2Z 3Q87A 3FQMA 4S1TA 3NDJA 4A3LI 4A3CI 1KRLA 1YJW1 3CQZI 3NH8A 2E2II 4A3GI 2W04A 2WB1A 4A93I 4A3DI 2RHBA 4MRIA 3CCRZ 2VUMI 3CCLZ 3CCMZ 1VQ41 3H3VJ 4EWCA 1RO2A 4RVDA 3CC2Z 4HGZA 5D1OB 4CL1A 3CCQZ 1VQ61 3CPWY 4X6AI 1K83I 5D1OA 3FQQA 3NDIA 1ML8A 2K3RA 3G4S1 2QA4Z 1YIJZ 1VQPZ 2V8JA 1JJ2Z 3GTQI 4MXUA 1USPA 2QLVB 4BY1I 2GTIA 1VQ71 3I4NI 4NBHA 4DK1A 3M4OI 2JR6A 1KQSZ 1YITZ 3CME1 2QRDB 2RBLA 3QWUA 2OOYB 2O4HA 2OZKA 2PM9A 3OW2Y 5IT9f 2R92I 2YADA 1VQKZ 2E9HA 3G6E1 4BBRI 4MD9A 3GTLI 4E33A 3GTMI 4RS4A 5FLMI 3CCR1 1VQ4Z 2H85A 1S72Z 3TDHB 4E2WA 3CCL1 3PO3S 3CXCZ 3CCM1 3GTJI 2JNYA 1K9M1 3S16I 2PMZA 2V8IA 1YHQ1 2VF1A 1VQ9Z 3KIHA 5IP9I 2JA7I 3J80f 2E2HI 4NB8A 3D9XA 3HOYI 1YIJ1 3MZLB 4HH4A 2QREB 1VQP1 1Q7Y1 4NBCA 1JJ2Y 1KC82 1YJN1 3I551 1R9TI 1QVFY 2Q4ZA 1RO0A 4E2ZA 3BG1B 2JA6I 2AKLA 3P5JB 3CMEZ 1Q811 1QVGZ 3RZOI 1YIT1 2OTLZ 1TWAI 1QF8A 1TWCI 2I3CA 3J7A4 1WIIA 2R6MA 4DQYB 3G6EZ 4HGYA 3CC41 3G711 1VQK1 2JMOA 1L1OC 3I56Z 2HU9A 3GTKI 4NBGA 3D6WA 4NBEA 2JUBA 2RT9A 1QYPA 1K9M2 3GTOI 4BY7I 1S721 2DE7A 2QR1B 1YUKA 3GKQA 1YHQZ 3CXCY 1Z02A 2YU9I 1VQ91 1VQ51 3PO2I 2DE6A 3J80b 1Q7Y2 1N2FA 4RVHA 5IP7I 1TFIA 2GU2A 2QEXZ 1Y1VS 2IZ4A 1VQ81 4E2XA 1YJNZ 3I55Z 1Q861 5C3EI 1ZB8A 5C44I 4NFRA 1NJI1 2QKDA 1Q812 1KC81 4E2YA 3CCU1 2O53A 1W2BY 4QTUA 4NBAA 3KIFA 1YI2Z 1K8A2 2LFUA 2OTL1 2OTJ1 5A2Qf 5C4JI 1Z01A 3CC4Z 4MD8A 3S17I 3G71Z 4QTTA 4TNUA 2J6AA 3HOWI 3HOUI 1VLAA 3I561 3VB9A 1X3WA 1NUIA 2V8KA 1TWFI 1M1K2 1Q822 2WAQA 2NVQI 1JWHC 2B63I 1DL6A 2HF1A 5CM2M 1YJ9Z 4A3BI 1VQ5Z 2VUGA 1Z03A 2G2KA 3RZDI 2PK7A 3S1RI 4RVGA 3S1QI 3GTPI 4DGLA 2F4MA 4BBSI 3HOVI 1Q862 3FKII 3TE5B 1VQ8Z 1X3ZA 3MONA 1NJI2 2QEX1 4MH4A 3CPWZ 2M48A 3S2HI 1N8R1 3HOZI 4E32A 3CCUZ 2KI7B 3EERA 3U50C 2QRCB 3J81f 2R93I 1M901 3CCSZ 1KQSY 2IZ3A 1WCMI 2OTJZ 2Q51A 3IX0A 2M6NA 1YI21 1RQFA 3PO3I 3NH4A 5A2Qb 2E2JI 1K8A1 5IT9b 1ZH1A 3IF8A 5D1PA 5T67A 3VMIA 3CCVZ 1VQN1 2EGTA 2NVTI 2P3YA 1VQOZ 3CCJ1 1VQLZ 3BG0B 3CCEZ 4Y7NI 3CD61 2OOXB 3I4MI 1TWHI 2RPRA 1LQLA 4BXXI 3NH5A 4E30A 1M1K1 3EEDA 1Q821 1YJ91 2JS4A 5LL6f 2JA5I 1X0TA 1N8R2 5FLXf 3NFZA 4AYBA 2KPIA 4XX2A 1I50I 3S15I 3VTNA 3JAMf 2W03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ 1;  3I56 1;  1VQP 1;  1M90 2;  1Q7Y 1;  1KD1 2;  1YJW 1;  1VQM 1;  1JJ2 Y;  1KC8 2;  1M1K 2;  1Q82 2;  1YJN 1;  3I55 1;  1QVF Y;  3CMA 1;  3CCS 1;  1YJ9 Z;  3CCR Z;  1QVG Y;  1QVF Z;  3CME Z;  3CCL Z;  1Q81 1;  1VQ5 Z;  3CC7 1;  3CCM Z;  1K73 1;  1VQ4 1;  1QVG Z;  1YIT 1;  2OTL Z;  1VQN Z;  3CC2 Z;  3CCV 1;  1Q86 2;  3CCQ Z;  3CCJ Z;  1VQ8 Z;  3CPW Y;  1VQ6 1;  3CD6 Z;  1NJI 2;  2QEX 1;  3G6E Z;  3CC4 1;  1VQO 1;  3G4S 1;  3CPW Z;  2QA4 Z;  1VQL 1;  1N8R 1;  3G71 1;  3CCE 1;  1VQK 1;  1YIJ Z;  3I56 Z;  1VQP Z;  1JJ2 Z;  1YJW Z;  3CCU Z;  1K9M 2;  1VQ7 1;  1M90 1;  3CCS Z;  1KQS Y;  1S72 1;  2OTJ Z;  1YHQ Z;  1YI2 1;  1KQS Z;  3CXC Y;  1YIT Z;  1K8A 1;  3CME 1;  1VQ9 1;  1VQ5 1;  3CCV Z;  1VQN 1;  1Q7Y 2;  1VQ6 Z;  3CC2 1;  2QEX Z;  3OW2 Y;  3CCQ 1;  3G4S Z;  3CCJ 1;  1VQO Z;  1VQM Z;  1VQ8 1;  1VQL Z;  1VQK Z;  3CCE Z;  1YJN Z;  3CD6 1;  3I55 Z;  1Q86 1;  3G6E 1;  3CMA Z;  2QA4 1;  1NJI 1;  1KD1 1;  1Q81 2;  1K73 2;  1KC8 1;  1M1K 1;  1Q82 1;  3CC7 Z;  1VQ7 Z;  1YJ9 1;  3CCR 1;  1VQ4 Z;  1S72 Z;  3CCU 1;  3CCL 1;  1W2B Y;  3CXC Z;  3CCM 1;  1YI2 Z;  1K8A 2;  1K9M 1;  2OTL 1;  1W2B Z;  2OTJ 1;  1YHQ 1;  1VQ9 Z;  1N8R 2;  3CC4 Z;  3G71 Z;  3OW2 Z; 
#chains in the Genus database with same CATH topology
 1NP6 A;  1YUA A;  1SIW A;  1SFO I;  3ESW A;  3F3F C;  3F3P C;  1M90 2;  1KD1 2;  4NOZ A;  1I3Q I;  3J81 b;  2LIY A;  4A3E I;  1VQM 1;  3GTM S;  2JIQ A;  1FDO A;  3CMA 1;  4NB9 A;  1USP B;  3CCS 1;  4NBD A;  1QVG Y;  1S7M A;  5T64 A;  1QVF Z;  1AA6 A;  3CC7 1;  1K73 1;  1VQN Z;  3M3Y I;  3IFU A;  3CCV 1;  2BJO A;  3CCJ Z;  2V3V A;  3CD6 Z;  3H0G I;  1WJ2 A;  1VQO 1;  3S1N I;  1VQL 1;  4NH1 C;  3CCE 1;  1Y1V I;  1P9N A;  3I07 A;  1RO4 A;  4A3K I;  4NBB A;  3GTG I;  2P28 A;  1YJW Z;  2NVY I;  3VMG A;  3S1M I;  2ZAE B;  1PFT A;  1ZB9 A;  2JIM A;  4E31 A;  2F4O A;  2NVX I;  1TWG I;  2Y0S A;  3D2L A;  3LUS A;  4RVF A;  5FLX b;  1WZN A;  3S14 I;  3JAM b;  1I6H I;  1VQ6 Z;  2IV2 X;  3CC2 1;  2RIQ A;  3GCF A;  2K5R A;  3G4S Z;  3CCQ 1;  1VQM Z;  3CMA Z;  2QA4 1;  3T4N B;  1KD1 1;  2R7Z I;  4MON A;  4A3J I;  4NBF A;  1WW9 A;  1K73 2;  3CC7 Z;  1VQ7 Z;  3S2D I;  4Y52 I;  2JA8 I;  2DE5 A;  5AN9 F;  4A3M I;  2GTH A;  4MD7 A;  4A3F I;  4A3I I;  5T6B A;  3HKZ A;  3HOX I;  1W2B Z;  2E7Z A;  1RLY A;  3MZK B;  3K7A I;  3VMH A;  1RNI A;  1Y1W I;  4RV9 A;  5C4X I;  3OW2 Z;  3Q87 A;  3FQM A;  4S1T A;  3NDJ A;  4A3L I;  4A3C I;  1KRL A;  1YJW 1;  3CQZ I;  3NH8 A;  2E2I I;  4A3G I;  2W04 A;  2WB1 A;  4A93 I;  4A3D I;  2RHB A;  4MRI A;  3CCR Z;  2VUM I;  3CCL Z;  3CCM Z;  1VQ4 1;  3H3V J;  4EWC A;  1RO2 A;  4RVD A;  2VPZ A;  3CC2 Z;  4HGZ A;  5D1O B;  4CL1 A;  3CCQ Z;  1VQ6 1;  3CPW Y;  4X6A I;  1K83 I;  5D1O A;  3FQQ A;  3NDI A;  1ML8 A;  2K3R A;  3G4S 1;  2QA4 Z;  1YIJ Z;  1VQP Z;  2V8J A;  1JJ2 Z;  3GTQ I;  4MXU A;  1USP A;  2QLV B;  4BY1 I;  2GTI A;  1VQ7 1;  3I4N I;  4NBH A;  4DK1 A;  3M4O I;  2JR6 A;  1KQS Z;  1YIT Z;  3CME 1;  2QRD B;  2RBL A;  3QWU A;  2OOY B;  2O4H A;  2OZK A;  2PM9 A;  3OW2 Y;  5IT9 f;  2R92 I;  2YAD A;  1VQK Z;  2E9H A;  3G6E 1;  4BBR I;  4MD9 A;  3GTL I;  4E33 A;  3GTM I;  4RS4 A;  5FLM I;  3CCR 1;  1VQ4 Z;  2H85 A;  1S72 Z;  3TDH B;  4E2W A;  3CCL 1;  3PO3 S;  3CXC Z;  3CCM 1;  3GTJ I;  2JNY A;  1K9M 1;  3S16 I;  2PMZ A;  2V8I A;  1YHQ 1;  2VF1 A;  1VQ9 Z;  3KIH A;  2JIP A;  5IP9 I;  2JA7 I;  3J80 f;  2E2H I;  4NB8 A;  2JIR A;  3D9X A;  1FDI A;  3HOY I;  1YIJ 1;  3MZL B;  4HH4 A;  2QRE B;  1VQP 1;  1Q7Y 1;  4NBC A;  1JJ2 Y;  1KC8 2;  1YJN 1;  3I55 1;  1R9T I;  1QVF Y;  2Q4Z A;  1RO0 A;  4E2Z A;  3BG1 B;  2JA6 I;  2AKL A;  3P5J B;  3CME Z;  1Q81 1;  1QVG Z;  3RZO I;  1YIT 1;  2OTL Z;  1TWA I;  1QF8 A;  1TWC I;  2V45 A;  2I3C A;  3J7A 4;  1WII A;  2R6M A;  4DQY B;  2AYD A;  3G6E Z;  4HGY A;  3CC4 1;  3G71 1;  1VQK 1;  2JMO A;  1L1O C;  3I56 Z;  2HU9 A;  3GTK I;  4NBG A;  3D6W A;  4NBE A;  2JUB A;  2RT9 A;  1QYP A;  1K9M 2;  3GTO I;  4BY7 I;  2VPX A;  1S72 1;  2DE7 A;  2QR1 B;  1YUK A;  3GKQ A;  1YHQ Z;  3CXC Y;  1Z02 A;  2YU9 I;  1VQ9 1;  1VQ5 1;  3PO2 I;  2DE6 A;  3J80 b;  1Q7Y 2;  1N2F A;  4RVH A;  5IP7 I;  1TFI A;  2GU2 A;  2QEX Z;  1Y1V S;  2IZ4 A;  1VQ8 1;  2LEX A;  4E2X A;  1YJN Z;  3I55 Z;  1Q86 1;  5C3E I;  1ZB8 A;  5C44 I;  4NFR A;  1NJI 1;  2QKD A;  1Q81 2;  1KC8 1;  3IR7 A;  4E2Y A;  3CCU 1;  2O53 A;  1W2B Y;  4QTU A;  4NBA A;  3KIF A;  1YI2 Z;  1K8A 2;  2LFU A;  2OTL 1;  2OTJ 1;  5A2Q f;  5C4J I;  1Z01 A;  3CC4 Z;  4MD8 A;  3S17 I;  3G71 Z;  4QTT A;  4TNU A;  2J6A A;  3HOW I;  3HOU I;  1VLA A;  3I56 1;  3VB9 A;  1X3W A;  1NUI A;  2V8K A;  1TWF I;  1M1K 2;  2NAP A;  1Q82 2;  2WAQ A;  2NVQ I;  1JWH C;  2B63 I;  1DL6 A;  2HF1 A;  5CM2 M;  1YJ9 Z;  4A3B I;  1VQ5 Z;  2VUG A;  1Z03 A;  2G2K A;  3RZD I;  2PK7 A;  3S1R I;  2JIO A;  4RVG A;  3S1Q I;  3GTP I;  4DGL A;  2F4M A;  4BBS I;  3HOV I;  1Q86 2;  3FKI I;  3TE5 B;  1VQ8 Z;  1X3Z A;  3MON A;  1NJI 2;  2QEX 1;  4MH4 A;  3CPW Z;  2M48 A;  3S2H I;  1N8R 1;  3HOZ I;  4E32 A;  3CCU Z;  2KI7 B;  3EER A;  3U50 C;  2QRC B;  3J81 f;  2R93 I;  1M90 1;  3CCS Z;  1KQS Y;  2IZ3 A;  1WCM I;  2OTJ Z;  2Q51 A;  3IX0 A;  2M6N A;  1YI2 1;  1RQF A;  3PO3 I;  3NH4 A;  5A2Q b;  1Q16 A;  2E2J I;  1K8A 1;  5IT9 b;  1ZH1 A;  3IF8 A;  5D1P A;  5T67 A;  3VMI A;  3CCV Z;  1VQN 1;  2EGT A;  1QXF A;  2NVT I;  2P3Y A;  1VQO Z;  3CCJ 1;  1VQL Z;  3BG0 B;  3CCE Z;  4Y7N I;  3CD6 1;  2OOX B;  3I4M I;  1TWH I;  2RPR A;  1LQL A;  4BXX I;  3NH5 A;  4E30 A;  1M1K 1;  3EED A;  1Q82 1;  1YJ9 1;  2JS4 A;  2VPY A;  5LL6 f;  1Y8C A;  2VPW A;  2JA5 I;  1X0T A;  1N8R 2;  5FLX f;  3NFZ A;  4AYB A;  2KPI A;  4XX2 A;  1I50 I;  3S15 I;  3VTN A;  3JAM f;  2W03 A; 
#chains in the Genus database with same CATH homology
 1NP6 A;  1YUA A;  1SFO I;  3ESW A;  3F3F C;  3F3P C;  1M90 2;  1KD1 2;  4NOZ A;  1I3Q I;  3J81 b;  2LIY A;  4A3E I;  1VQM 1;  3GTM S;  3CMA 1;  4NB9 A;  1USP B;  3CCS 1;  4NBD A;  1QVG Y;  1S7M A;  5T64 A;  1QVF Z;  3CC7 1;  1K73 1;  1VQN Z;  3M3Y I;  3IFU A;  3CCV 1;  2BJO A;  3CCJ Z;  3CD6 Z;  3H0G I;  1VQO 1;  3S1N I;  1VQL 1;  4NH1 C;  3CCE 1;  1Y1V I;  1P9N A;  3I07 A;  1RO4 A;  4A3K I;  4NBB A;  3GTG I;  2P28 A;  1YJW Z;  2NVY I;  3VMG A;  3S1M I;  2ZAE B;  1PFT A;  1ZB9 A;  4E31 A;  2F4O A;  2NVX I;  1TWG I;  2Y0S A;  3LUS A;  4RVF A;  5FLX b;  3S14 I;  3JAM b;  1I6H I;  1VQ6 Z;  3CC2 1;  2RIQ A;  3GCF A;  2K5R A;  3G4S Z;  3CCQ 1;  1VQM Z;  3CMA Z;  2QA4 1;  3T4N B;  1KD1 1;  2R7Z I;  4MON A;  4A3J I;  4NBF A;  1WW9 A;  1K73 2;  3CC7 Z;  1VQ7 Z;  3S2D I;  4Y52 I;  2JA8 I;  2DE5 A;  5AN9 F;  4A3M I;  2GTH A;  4MD7 A;  4A3F I;  4A3I I;  5T6B A;  3HKZ A;  3HOX I;  1W2B Z;  1RLY A;  3MZK B;  3K7A I;  3VMH A;  1RNI A;  1Y1W I;  4RV9 A;  5C4X I;  3OW2 Z;  3Q87 A;  3FQM A;  4S1T A;  3NDJ A;  4A3L I;  4A3C I;  1KRL A;  1YJW 1;  3CQZ I;  3NH8 A;  2E2I I;  4A3G I;  2W04 A;  2WB1 A;  4A93 I;  4A3D I;  2RHB A;  4MRI A;  3CCR Z;  2VUM I;  3CCL Z;  3CCM Z;  1VQ4 1;  3H3V J;  4EWC A;  1RO2 A;  4RVD A;  3CC2 Z;  4HGZ A;  5D1O B;  4CL1 A;  3CCQ Z;  1VQ6 1;  3CPW Y;  4X6A I;  1K83 I;  5D1O A;  3FQQ A;  3NDI A;  1ML8 A;  2K3R A;  3G4S 1;  2QA4 Z;  1YIJ Z;  1VQP Z;  2V8J A;  1JJ2 Z;  3GTQ I;  4MXU A;  1USP A;  2QLV B;  4BY1 I;  2GTI A;  1VQ7 1;  3I4N I;  4NBH A;  4DK1 A;  3M4O I;  2JR6 A;  1KQS Z;  1YIT Z;  3CME 1;  2QRD B;  2RBL A;  3QWU A;  2OOY B;  2O4H A;  2OZK A;  2PM9 A;  3OW2 Y;  5IT9 f;  2R92 I;  2YAD A;  1VQK Z;  2E9H A;  3G6E 1;  4BBR I;  4MD9 A;  3GTL I;  4E33 A;  3GTM I;  4RS4 A;  5FLM I;  3CCR 1;  1VQ4 Z;  2H85 A;  1S72 Z;  3TDH B;  4E2W A;  3CCL 1;  3PO3 S;  3CXC Z;  3CCM 1;  3GTJ I;  2JNY A;  1K9M 1;  3S16 I;  2PMZ A;  2V8I A;  1YHQ 1;  2VF1 A;  1VQ9 Z;  3KIH A;  5IP9 I;  2JA7 I;  3J80 f;  2E2H I;  4NB8 A;  3D9X A;  3HOY I;  1YIJ 1;  3MZL B;  4HH4 A;  2QRE B;  1VQP 1;  1Q7Y 1;  4NBC A;  1JJ2 Y;  1KC8 2;  1YJN 1;  3I55 1;  1R9T I;  1QVF Y;  2Q4Z A;  1RO0 A;  4E2Z A;  3BG1 B;  2JA6 I;  2AKL A;  3P5J B;  3CME Z;  1Q81 1;  1QVG Z;  3RZO I;  1YIT 1;  2OTL Z;  1TWA I;  1QF8 A;  1TWC I;  2I3C A;  3J7A 4;  1WII A;  2R6M A;  4DQY B;  3G6E Z;  4HGY A;  3CC4 1;  3G71 1;  1VQK 1;  2JMO A;  1L1O C;  3I56 Z;  2HU9 A;  3GTK I;  4NBG A;  3D6W A;  4NBE A;  2JUB A;  2RT9 A;  1QYP A;  1K9M 2;  3GTO I;  4BY7 I;  1S72 1;  2DE7 A;  2QR1 B;  1YUK A;  3GKQ A;  1YHQ Z;  3CXC Y;  1Z02 A;  2YU9 I;  1VQ9 1;  1VQ5 1;  3PO2 I;  2DE6 A;  3J80 b;  1Q7Y 2;  1N2F A;  4RVH A;  5IP7 I;  1TFI A;  2GU2 A;  2QEX Z;  1Y1V S;  2IZ4 A;  1VQ8 1;  4E2X A;  1YJN Z;  3I55 Z;  1Q86 1;  5C3E I;  1ZB8 A;  5C44 I;  4NFR A;  1NJI 1;  2QKD A;  1Q81 2;  1KC8 1;  4E2Y A;  3CCU 1;  2O53 A;  1W2B Y;  4QTU A;  4NBA A;  3KIF A;  1YI2 Z;  1K8A 2;  2LFU A;  2OTL 1;  2OTJ 1;  5A2Q f;  5C4J I;  1Z01 A;  3CC4 Z;  4MD8 A;  3S17 I;  3G71 Z;  4QTT A;  4TNU A;  2J6A A;  3HOW I;  3HOU I;  1VLA A;  3I56 1;  3VB9 A;  1X3W A;  1NUI A;  2V8K A;  1TWF I;  1M1K 2;  1Q82 2;  2WAQ A;  2NVQ I;  1JWH C;  2B63 I;  1DL6 A;  2HF1 A;  5CM2 M;  1YJ9 Z;  4A3B I;  1VQ5 Z;  2VUG A;  1Z03 A;  2G2K A;  3RZD I;  2PK7 A;  3S1R I;  4RVG A;  3S1Q I;  3GTP I;  4DGL A;  2F4M A;  4BBS I;  3HOV I;  1Q86 2;  3FKI I;  3TE5 B;  1VQ8 Z;  1X3Z A;  3MON A;  1NJI 2;  2QEX 1;  4MH4 A;  3CPW Z;  2M48 A;  3S2H I;  1N8R 1;  3HOZ I;  4E32 A;  3CCU Z;  2KI7 B;  3EER A;  3U50 C;  2QRC B;  3J81 f;  2R93 I;  1M90 1;  3CCS Z;  1KQS Y;  2IZ3 A;  1WCM I;  2OTJ Z;  2Q51 A;  3IX0 A;  2M6N A;  1YI2 1;  1RQF A;  3PO3 I;  3NH4 A;  5A2Q b;  2E2J I;  1K8A 1;  5IT9 b;  1ZH1 A;  3IF8 A;  5D1P A;  5T67 A;  3VMI A;  3CCV Z;  1VQN 1;  2EGT A;  2NVT I;  2P3Y A;  1VQO Z;  3CCJ 1;  1VQL Z;  3BG0 B;  3CCE Z;  4Y7N I;  3CD6 1;  2OOX B;  3I4M I;  1TWH I;  2RPR A;  1LQL A;  4BXX I;  3NH5 A;  4E30 A;  1M1K 1;  3EED A;  1Q82 1;  1YJ9 1;  2JS4 A;  5LL6 f;  2JA5 I;  1X0T A;  1N8R 2;  5FLX f;  3NFZ A;  4AYB A;  2KPI A;  4XX2 A;  1I50 I;  3S15 I;  3VTN A;  3JAM f;  2W03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...