3CCEZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cceZ00
2QEXZ 1QVGY 3CCJ1 1VQL1 3CME1 1VQ6Z 3CCRZ 1K731 3I56Z 3OW2Z 1VQ7Z 1VQ41 1VQKZ 1YIT1 1Q821 3CCE1 1YJ91 1KQSY 3G6EZ 2OTJ1 1M1K1 1K9M2 1QVFY 1VQ8Z 1KD11 3G711 1YJW1 3CCLZ 1KQSZ 1YI21 1Q861 3CD61 3CCM1 1VQ9Z 3CC2Z 3I551 2OTL1 3CCU1 1W2BY 1Q811 1K732 3CPWZ 3CCVZ 1YJNZ 1NJI1 1Q822 1VQ51 3G4SZ 3CC7Z 1QVGZ 3CCQZ 1VQMZ 1M1K2 3CMA1 1VQP1 1VQLZ 3CCJZ 1S721 1KD12 3CXCY 2QEX1 1Q862 3CCSZ 3I561 1VQOZ 1N8R1 2QA41 1Q812 1VQ71 1JJ2Y 1QVFZ 1NJI2 1VQN1 1M901 3G71Z 1YJWZ 1Q7Y1 3CD6Z 3CCMZ 1KC81 1YHQZ 1W2BZ 1YIJ1 1VQ91 3CC41 1K8A1 3CMEZ 3CCV1 1N8R2 1VQ5Z 1VQ61 3CCR1 1VQ4Z 3CMAZ 3CXCZ 1VQPZ 1YITZ 3CCEZ 3CCQ1 1VQM1 1YJ9Z 1M902 1S72Z 1VQK1 1Q7Y2 3OW2Y 2OTJZ 1KC82 3G6E1 1JJ2Z 3CCS1 1VQ81 1YI2Z 2QA4Z 3CCL1 1VQO1 1K8A2 3I55Z 2OTLZ 3CCUZ 3CC21 1VQNZ 1YJN1 1YIJZ 1YHQ1 1K9M1 3CPWY 3G4S1 3CC4Z 3CC71
chains in the Genus database with same CATH superfamily
4MH4A 2Q51A 2M48A 1VQ6Z 2V8IA 4A3MI 1K731 4X6AI 2R6MA 3M4OI 3S14I 3JAMb 2O4HA 3OW2Z 3U50C 4A3FI 1VQKZ 1N2FA 3S1RI 4DGLA 4A3JI 5FLXb 2JNYA 3G6EZ 4S1TA 1VQ8Z 1YJW1 1KQSZ 2QR1B 2QREB 3GKQA 3H0GI 5D1PA 3CCM1 1TWGI 5IP9I 1W2BY 4NBAA 4RVGA 2QLVB 2VF1A 1Q811 1RO0A 2JA6I 3MZLB 3HOXI 4NBHA 3HKZA 1NJI1 3Q87A 2QRCB 2IV2X 4NBGA 3I4MI 3CMA1 2E2II 3GTLI 3CCJZ 3M3YI 1WIIA 3CXCY 2V8JA 4EWCA 3TDHB 2YADA 2F4OA 2JIOA 3I561 1FDIA 1VQOZ 1N8R1 3GTKI 1LQLA 1SFOI 4MXUA 1VQN1 4MD8A 3FQMA 3CD6Z 2DE6A 2WB1A 1KC81 3I4NI 3HOVI 2NVXI 3HOZI 2YU9I 5D1OB 4A3KI 1VQ61 3D6WA 4BY1I 1VQPZ 2NVTI 3CCQ1 2JMOA 1S72Z 1VQK1 3MONA 2KPIA 3G6E1 2Y0SA 2E2HI 1VQ81 1X3WA 1K8A2 4NBFA 2AKLA 2JIMA 3PO2I 1R9TI 3S2DI 1TWCI 1QF8A 1YIJZ 2B63I 3HOUI 1VLAA 3CPWY 1X0TA 4NB8A 3CC4Z 4Y7NI 3J80f 2NVQI 4A3GI 2RHBA 3CCJ1 2E2JI 3H3VJ 2RT9A 3KIFA 5A2Qb 2R92I 3I56Z 4E2WA 3IR7A 4E31A 1YIT1 1QXFA 2LEXA 4NBEA 1K9M2 1QVFY 5IP7I 5C4JI 3CD61 3RZDI 1ZB8A 1ZH1A 2JA7I 2HU9A 4RV9A 3TE5B 1WCMI 3D9XA 3GCFA 2JA8I 3BG1B 1YJNZ 3K7AI 4BBSI 1QVGZ 3CCQZ 1M1K2 1VQP1 3FKII 1S721 1KD12 4NOZA 1Y8CA 1USPB 2QKDA 1Q16A 4TNUA 1Z02A 2OZKA 1YIJ1 1Z03A 3S1QI 3GTQI 4E2ZA 2VPWA 2K3RA 3CC41 3HOYI 3VTNA 1K8A1 3CCV1 1Y1VS 4RS4A 1VQ5Z 4HGYA 5IT9f 1AA6A 1YITZ 1VQM1 1M902 2E7ZA 1Q7Y2 3OW2Y 3BG0B 4BXXI 1WJ2A 1JJ2Z 3NFZA 2QA4Z 1RO2A 2OOYB 4DQYB 2JUBA 5T64A 3VMIA 5D1OA 3IFUA 2JIQA 3GTOI 3MZKB 1FDOA 1YJN1 2ZAEB 1YHQ1 1K9M1 5T6BA 2AYDA 3J81f 3VMGA 1K83I 4BBRI 4MONA 5C3EI 4NB9A 1Z01A 2P28A 3PO3S 2EGTA 4MRIA 2V3VA 3LUSA 2PM9A 4A3EI 1ZB9A 4QTUA 2O53A 2PK7A 2OTJ1 3ESWA 5IT9b 1M1K1 3CQZI 1RQFA 2M6NA 4MD9A 4NFRA 1KD11 2VPZA 4AYBA 3T4NB 2GU2A 2VPYA 3CC2Z 3S1MI 3S2HI 2OTL1 2K5RA 3CCVZ 3F3PC 3D2LA 2F4MA 1DL6A 1Q822 4HGZA 3G4SZ 1VQ51 3VMHA 3NH8A 4RVDA 1VQMZ 1QYPA 1TWAI 4CL1A 3JAMf 1VQLZ 2JS4A 2QEX1 1Q862 1YUKA 5FLXf 2P3YA 4Y52I 4HH4A 2QA41 1JWHC 1VQ71 2H85A 3GTJI 1NP6A 1M901 1YUAA 3G71Z 2R7ZI 1Q7Y1 1RNIA 1YHQZ 1W2BZ 3GTPI 3S15I 1P9NA 1VQ91 3RZOI 2E9HA 1USPA 1TFIA 1X3ZA 1SIWA 2JIPA 3GTMS 4DK1A 3J80b 4RVHA 2HF1A 2WAQA 3CXCZ 4NBDA 3S17I 5CM2M 2VUMI 2OTJZ 2J6AA 1WW9A 2W04A 4QTTA 3CCS1 3QWUA 4A3BI 5FLMI 4E30A 4E2YA 2Q4ZA 2RBLA 2OTLZ 4A3DI 1KRLA 3CC21 2V8KA 2W03A 3I07A 1ML8A 1Y1VI 3GTGI 1I3QI 3VB9A 2G2KA 3G4S1 4A3CI 2I3CA 1L1OC 2NVYI 3P5JB 2QEXZ 1QVGY 1VQL1 3CME1 3CCRZ 4XX2A 2JR6A 1I6HI 3EEDA 1VQ7Z 1VQ41 1Q821 3CCE1 4E32A 1YJ91 1NUIA 4E2XA 1KQSY 3NDIA 3S16I 2IZ3A 3G711 3CCLZ 1YI21 1Q861 4A93I 1VQ9Z 1I50I 3KIHA 2OOXB 2V45A 3I551 5LL6f 4MD7A 3CCU1 2LFUA 1K732 3CPWZ 3NH5A 3PO3I 2GTIA 1PFTA 3CC7Z 1S7MA 5A2Qf 4NH1C 1WZNA 1RLYA 2VUGA 1Y1WI 2NAPA 3CCSZ 4NBBA 2DE5A 1Q812 1JJ2Y 1QVFZ 3IF8A 1NJI2 4E33A 1YJWZ 2JA5I 2VPXA 2RPRA 3CCMZ 1TWFI 2IZ4A 5C4XI 5T67A 3HOWI 3NDJA 2DE7A 2R93I 3CMEZ 5AN9F 1TWHI 1N8R2 3FQQA 3J81b 3CCR1 3IX0A 1VQ4Z 3CMAZ 3CCEZ 1YJ9Z 2JIRA 3J7A4 5C44I 1KC82 3S1NI 2QRDB 2KI7B 3NH4A 3EERA 2PMZA 1YI2Z 3CCL1 1VQO1 2BJOA 4NBCA 3I55Z 3CCUZ 4A3II 4RVFA 1VQNZ 1RO4A 2LIYA 2RIQA 3GTMI 2GTHA 4BY7I 4A3LI 3F3FC 3CC71
chains in the Genus database with same CATH topology
4MH4A 2Q51A 2M48A 1VQ6Z 2V8IA 4A3MI 1K731 4X6AI 2R6MA 3M4OI 3S14I 3JAMb 2O4HA 3OW2Z 3U50C 4A3FI 1VQKZ 1N2FA 3S1RI 4DGLA 4A3JI 5FLXb 2JNYA 3G6EZ 4S1TA 1VQ8Z 1YJW1 1KQSZ 2QR1B 2QREB 3GKQA 3H0GI 5D1PA 3CCM1 1TWGI 5IP9I 1W2BY 4NBAA 4RVGA 2QLVB 2VF1A 1Q811 1RO0A 2JA6I 3MZLB 3HOXI 4NBHA 3HKZA 1NJI1 3Q87A 2QRCB 4NBGA 3I4MI 3CMA1 2E2II 3GTLI 3CCJZ 3M3YI 1WIIA 3CXCY 2V8JA 4EWCA 3TDHB 2YADA 2F4OA 3I561 1VQOZ 1N8R1 3GTKI 1LQLA 1SFOI 4MXUA 1VQN1 4MD8A 3FQMA 3CD6Z 2DE6A 2WB1A 1KC81 3I4NI 3HOVI 2NVXI 3HOZI 2YU9I 5D1OB 4A3KI 1VQ61 3D6WA 4BY1I 1VQPZ 2NVTI 3CCQ1 2JMOA 1S72Z 1VQK1 3MONA 2KPIA 3G6E1 2Y0SA 2E2HI 1VQ81 1X3WA 1K8A2 4NBFA 2AKLA 3PO2I 1R9TI 3S2DI 1TWCI 1QF8A 1YIJZ 2B63I 3HOUI 1VLAA 3CPWY 1X0TA 4NB8A 3CC4Z 4Y7NI 3J80f 2NVQI 4A3GI 2RHBA 3CCJ1 2E2JI 3H3VJ 2RT9A 3KIFA 5A2Qb 2R92I 3I56Z 4E2WA 4E31A 1YIT1 4NBEA 1K9M2 1QVFY 5IP7I 5C4JI 3CD61 3RZDI 1ZB8A 1ZH1A 2JA7I 2HU9A 4RV9A 3TE5B 1WCMI 3D9XA 3GCFA 2JA8I 3BG1B 1YJNZ 3K7AI 4BBSI 1QVGZ 3CCQZ 1M1K2 1VQP1 3FKII 1S721 1KD12 4NOZA 1USPB 2QKDA 4TNUA 1Z02A 2OZKA 1YIJ1 1Z03A 3S1QI 3GTQI 4E2ZA 2K3RA 3CC41 3HOYI 3VTNA 1K8A1 3CCV1 1Y1VS 4RS4A 1VQ5Z 4HGYA 5IT9f 1YITZ 1VQM1 1M902 1Q7Y2 3OW2Y 3BG0B 4BXXI 1JJ2Z 3NFZA 2QA4Z 1RO2A 2OOYB 4DQYB 2JUBA 5T64A 3VMIA 5D1OA 3IFUA 3GTOI 3MZKB 1YJN1 2ZAEB 1YHQ1 1K9M1 5T6BA 3J81f 3VMGA 1K83I 4BBRI 4MONA 5C3EI 4NB9A 1Z01A 2P28A 3PO3S 2EGTA 4MRIA 3LUSA 2PM9A 4A3EI 1ZB9A 4QTUA 2O53A 2PK7A 2OTJ1 3ESWA 5IT9b 1M1K1 3CQZI 1RQFA 2M6NA 4MD9A 4NFRA 1KD11 4AYBA 3T4NB 2GU2A 3CC2Z 3S2HI 3S1MI 2OTL1 2K5RA 3CCVZ 3F3PC 2F4MA 1DL6A 1Q822 4HGZA 3G4SZ 1VQ51 3VMHA 3NH8A 4RVDA 1VQMZ 1QYPA 1TWAI 4CL1A 3JAMf 1VQLZ 2JS4A 2QEX1 1Q862 1YUKA 5FLXf 2P3YA 4Y52I 4HH4A 2QA41 1JWHC 1VQ71 2H85A 3GTJI 1NP6A 1M901 1YUAA 3G71Z 2R7ZI 1Q7Y1 1RNIA 1YHQZ 1W2BZ 3GTPI 3S15I 1P9NA 1VQ91 3RZOI 2E9HA 1USPA 1TFIA 1X3ZA 3GTMS 4DK1A 3J80b 4RVHA 2HF1A 2WAQA 3CXCZ 4NBDA 3S17I 5CM2M 2VUMI 2OTJZ 2J6AA 1WW9A 2W04A 4QTTA 3CCS1 3QWUA 4A3BI 5FLMI 4E30A 4E2YA 2Q4ZA 2RBLA 2OTLZ 4A3DI 1KRLA 3CC21 2V8KA 2W03A 3I07A 1ML8A 1Y1VI 3GTGI 1I3QI 3VB9A 2G2KA 3G4S1 4A3CI 2I3CA 1L1OC 2NVYI 3P5JB 2QEXZ 1QVGY 1VQL1 3CME1 3CCRZ 4XX2A 2JR6A 1I6HI 3EEDA 1VQ7Z 1VQ41 1Q821 3CCE1 4E32A 1YJ91 1NUIA 4E2XA 1KQSY 3NDIA 3S16I 2IZ3A 3G711 3CCLZ 1YI21 1Q861 4A93I 1VQ9Z 1I50I 3KIHA 2OOXB 3I551 5LL6f 4MD7A 3CCU1 2LFUA 1K732 3CPWZ 3NH5A 3PO3I 2GTIA 1PFTA 3CC7Z 1S7MA 5A2Qf 4NH1C 1RLYA 2VUGA 1Y1WI 3CCSZ 4NBBA 2DE5A 1Q812 1JJ2Y 1QVFZ 3IF8A 1NJI2 4E33A 1YJWZ 2JA5I 2RPRA 3CCMZ 1TWFI 2IZ4A 5C4XI 5T67A 3HOWI 3NDJA 2DE7A 2R93I 3CMEZ 5AN9F 1TWHI 1N8R2 3FQQA 3J81b 3CCR1 3IX0A 1VQ4Z 3CMAZ 3CCEZ 1YJ9Z 3J7A4 5C44I 1KC82 3S1NI 2QRDB 2KI7B 3NH4A 3EERA 2PMZA 1YI2Z 3CCL1 1VQO1 2BJOA 4NBCA 3I55Z 3CCUZ 4A3II 4RVFA 1VQNZ 1RO4A 2LIYA 2RIQA 3GTMI 2GTHA 4BY7I 4A3LI 3F3FC 3CC71
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX Z;  1QVG Y;  3CCJ 1;  1VQL 1;  3CME 1;  1VQ6 Z;  3CCR Z;  1K73 1;  3I56 Z;  3OW2 Z;  1VQ7 Z;  1VQ4 1;  1VQK Z;  1YIT 1;  1Q82 1;  3CCE 1;  1YJ9 1;  1KQS Y;  3G6E Z;  2OTJ 1;  1M1K 1;  1K9M 2;  1QVF Y;  1VQ8 Z;  1KD1 1;  3G71 1;  1YJW 1;  3CCL Z;  1KQS Z;  1YI2 1;  1Q86 1;  3CD6 1;  3CCM 1;  1VQ9 Z;  3CC2 Z;  3I55 1;  2OTL 1;  3CCU 1;  1W2B Y;  1Q81 1;  1K73 2;  3CPW Z;  3CCV Z;  1YJN Z;  1NJI 1;  1Q82 2;  1VQ5 1;  3G4S Z;  3CC7 Z;  1QVG Z;  3CCQ Z;  1VQM Z;  1M1K 2;  3CMA 1;  1VQP 1;  1VQL Z;  3CCJ Z;  1S72 1;  1KD1 2;  3CXC Y;  2QEX 1;  1Q86 2;  3CCS Z;  3I56 1;  1VQO Z;  1N8R 1;  2QA4 1;  1Q81 2;  1VQ7 1;  1JJ2 Y;  1QVF Z;  1NJI 2;  1VQN 1;  1M90 1;  3G71 Z;  1YJW Z;  1Q7Y 1;  3CD6 Z;  3CCM Z;  1KC8 1;  1YHQ Z;  1W2B Z;  1YIJ 1;  1VQ9 1;  3CC4 1;  1K8A 1;  3CME Z;  3CCV 1;  1N8R 2;  1VQ5 Z;  1VQ6 1;  3CCR 1;  1VQ4 Z;  3CMA Z;  3CXC Z;  1VQP Z;  1YIT Z;  3CCE Z;  3CCQ 1;  1VQM 1;  1YJ9 Z;  1M90 2;  1S72 Z;  1VQK 1;  1Q7Y 2;  3OW2 Y;  2OTJ Z;  1KC8 2;  3G6E 1;  1JJ2 Z;  3CCS 1;  1VQ8 1;  1YI2 Z;  2QA4 Z;  3CCL 1;  1VQO 1;  1K8A 2;  3I55 Z;  2OTL Z;  3CCU Z;  3CC2 1;  1VQN Z;  1YJN 1;  1YIJ Z;  1YHQ 1;  1K9M 1;  3CPW Y;  3G4S 1;  3CC4 Z;  3CC7 1; 
#chains in the Genus database with same CATH topology
 4MH4 A;  2Q51 A;  2M48 A;  1VQ6 Z;  2V8I A;  4A3M I;  1K73 1;  4X6A I;  2R6M A;  3M4O I;  3S14 I;  3JAM b;  2O4H A;  3OW2 Z;  3U50 C;  4A3F I;  1VQK Z;  1N2F A;  3S1R I;  4DGL A;  4A3J I;  5FLX b;  2JNY A;  3G6E Z;  4S1T A;  1VQ8 Z;  1YJW 1;  1KQS Z;  2QR1 B;  2QRE B;  3GKQ A;  3H0G I;  5D1P A;  3CCM 1;  1TWG I;  5IP9 I;  1W2B Y;  4NBA A;  4RVG A;  2QLV B;  2VF1 A;  1Q81 1;  1RO0 A;  2JA6 I;  3MZL B;  3HOX I;  4NBH A;  3HKZ A;  1NJI 1;  3Q87 A;  2QRC B;  2IV2 X;  4NBG A;  3I4M I;  3CMA 1;  2E2I I;  3GTL I;  3CCJ Z;  3M3Y I;  1WII A;  3CXC Y;  2V8J A;  4EWC A;  3TDH B;  2YAD A;  2F4O A;  2JIO A;  3I56 1;  1FDI A;  1VQO Z;  1N8R 1;  3GTK I;  1LQL A;  1SFO I;  4MXU A;  1VQN 1;  4MD8 A;  3FQM A;  3CD6 Z;  2DE6 A;  2WB1 A;  1KC8 1;  3I4N I;  3HOV I;  2NVX I;  3HOZ I;  2YU9 I;  5D1O B;  4A3K I;  1VQ6 1;  3D6W A;  4BY1 I;  1VQP Z;  2NVT I;  3CCQ 1;  2JMO A;  1S72 Z;  1VQK 1;  3MON A;  2KPI A;  3G6E 1;  2Y0S A;  2E2H I;  1VQ8 1;  1X3W A;  1K8A 2;  4NBF A;  2AKL A;  2JIM A;  3PO2 I;  1R9T I;  3S2D I;  1TWC I;  1QF8 A;  1YIJ Z;  2B63 I;  3HOU I;  1VLA A;  3CPW Y;  1X0T A;  4NB8 A;  3CC4 Z;  4Y7N I;  3J80 f;  2NVQ I;  4A3G I;  2RHB A;  3CCJ 1;  2E2J I;  3H3V J;  2RT9 A;  3KIF A;  5A2Q b;  2R92 I;  3I56 Z;  4E2W A;  3IR7 A;  4E31 A;  1YIT 1;  1QXF A;  2LEX A;  4NBE A;  1K9M 2;  1QVF Y;  5IP7 I;  5C4J I;  3CD6 1;  3RZD I;  1ZB8 A;  1ZH1 A;  2JA7 I;  2HU9 A;  4RV9 A;  3TE5 B;  1WCM I;  3D9X A;  3GCF A;  2JA8 I;  3BG1 B;  1YJN Z;  3K7A I;  4BBS I;  1QVG Z;  3CCQ Z;  1M1K 2;  1VQP 1;  3FKI I;  1S72 1;  1KD1 2;  4NOZ A;  1Y8C A;  1USP B;  2QKD A;  1Q16 A;  4TNU A;  1Z02 A;  2OZK A;  1YIJ 1;  1Z03 A;  3S1Q I;  3GTQ I;  4E2Z A;  2VPW A;  2K3R A;  3CC4 1;  3HOY I;  3VTN A;  1K8A 1;  3CCV 1;  1Y1V S;  4RS4 A;  1VQ5 Z;  4HGY A;  5IT9 f;  1AA6 A;  1YIT Z;  1VQM 1;  1M90 2;  2E7Z A;  1Q7Y 2;  3OW2 Y;  3BG0 B;  4BXX I;  1WJ2 A;  1JJ2 Z;  3NFZ A;  2QA4 Z;  1RO2 A;  2OOY B;  4DQY B;  2JUB A;  5T64 A;  3VMI A;  5D1O A;  3IFU A;  2JIQ A;  3GTO I;  3MZK B;  1FDO A;  1YJN 1;  2ZAE B;  1YHQ 1;  1K9M 1;  5T6B A;  2AYD A;  3J81 f;  3VMG A;  1K83 I;  4BBR I;  4MON A;  5C3E I;  4NB9 A;  1Z01 A;  2P28 A;  3PO3 S;  2EGT A;  4MRI A;  2V3V A;  3LUS A;  2PM9 A;  4A3E I;  1ZB9 A;  4QTU A;  2O53 A;  2PK7 A;  2OTJ 1;  3ESW A;  5IT9 b;  1M1K 1;  3CQZ I;  1RQF A;  2M6N A;  4MD9 A;  4NFR A;  1KD1 1;  2VPZ A;  4AYB A;  3T4N B;  2GU2 A;  2VPY A;  3CC2 Z;  3S1M I;  3S2H I;  2OTL 1;  2K5R A;  3CCV Z;  3F3P C;  3D2L A;  2F4M A;  1DL6 A;  1Q82 2;  4HGZ A;  3G4S Z;  1VQ5 1;  3VMH A;  3NH8 A;  4RVD A;  1VQM Z;  1QYP A;  1TWA I;  4CL1 A;  3JAM f;  1VQL Z;  2JS4 A;  2QEX 1;  1Q86 2;  1YUK A;  5FLX f;  2P3Y A;  4Y52 I;  4HH4 A;  2QA4 1;  1JWH C;  1VQ7 1;  2H85 A;  3GTJ I;  1NP6 A;  1M90 1;  1YUA A;  3G71 Z;  2R7Z I;  1Q7Y 1;  1RNI A;  1YHQ Z;  1W2B Z;  3GTP I;  3S15 I;  1P9N A;  1VQ9 1;  3RZO I;  2E9H A;  1USP A;  1TFI A;  1X3Z A;  1SIW A;  2JIP A;  3GTM S;  4DK1 A;  3J80 b;  4RVH A;  2HF1 A;  2WAQ A;  3CXC Z;  4NBD A;  3S17 I;  5CM2 M;  2VUM I;  2OTJ Z;  2J6A A;  1WW9 A;  2W04 A;  4QTT A;  3CCS 1;  3QWU A;  4A3B I;  5FLM I;  4E30 A;  4E2Y A;  2Q4Z A;  2RBL A;  2OTL Z;  4A3D I;  1KRL A;  3CC2 1;  2V8K A;  2W03 A;  3I07 A;  1ML8 A;  1Y1V I;  3GTG I;  1I3Q I;  3VB9 A;  2G2K A;  3G4S 1;  4A3C I;  2I3C A;  1L1O C;  2NVY I;  3P5J B;  2QEX Z;  1QVG Y;  1VQL 1;  3CME 1;  3CCR Z;  4XX2 A;  2JR6 A;  1I6H I;  3EED A;  1VQ7 Z;  1VQ4 1;  1Q82 1;  3CCE 1;  4E32 A;  1YJ9 1;  1NUI A;  4E2X A;  1KQS Y;  3NDI A;  3S16 I;  2IZ3 A;  3G71 1;  3CCL Z;  1YI2 1;  1Q86 1;  4A93 I;  1VQ9 Z;  1I50 I;  3KIH A;  2OOX B;  2V45 A;  3I55 1;  5LL6 f;  4MD7 A;  3CCU 1;  2LFU A;  1K73 2;  3CPW Z;  3NH5 A;  3PO3 I;  2GTI A;  1PFT A;  3CC7 Z;  1S7M A;  5A2Q f;  4NH1 C;  1WZN A;  1RLY A;  2VUG A;  1Y1W I;  2NAP A;  3CCS Z;  4NBB A;  2DE5 A;  1Q81 2;  1JJ2 Y;  1QVF Z;  3IF8 A;  1NJI 2;  4E33 A;  1YJW Z;  2JA5 I;  2VPX A;  2RPR A;  3CCM Z;  1TWF I;  2IZ4 A;  5C4X I;  5T67 A;  3HOW I;  3NDJ A;  2DE7 A;  2R93 I;  3CME Z;  5AN9 F;  1TWH I;  1N8R 2;  3FQQ A;  3J81 b;  3CCR 1;  3IX0 A;  1VQ4 Z;  3CMA Z;  3CCE Z;  1YJ9 Z;  2JIR A;  3J7A 4;  5C44 I;  1KC8 2;  3S1N I;  2QRD B;  2KI7 B;  3NH4 A;  3EER A;  2PMZ A;  1YI2 Z;  3CCL 1;  1VQO 1;  2BJO A;  4NBC A;  3I55 Z;  3CCU Z;  4A3I I;  4RVF A;  1VQN Z;  1RO4 A;  2LIY A;  2RIQ A;  3GTM I;  2GTH A;  4BY7 I;  4A3L I;  3F3F C;  3CC7 1; 
#chains in the Genus database with same CATH homology
 4MH4 A;  2Q51 A;  2M48 A;  1VQ6 Z;  2V8I A;  4A3M I;  1K73 1;  4X6A I;  2R6M A;  3M4O I;  3S14 I;  3JAM b;  2O4H A;  3OW2 Z;  3U50 C;  4A3F I;  1VQK Z;  1N2F A;  3S1R I;  4DGL A;  4A3J I;  5FLX b;  2JNY A;  3G6E Z;  4S1T A;  1VQ8 Z;  1YJW 1;  1KQS Z;  2QR1 B;  2QRE B;  3GKQ A;  3H0G I;  5D1P A;  3CCM 1;  1TWG I;  5IP9 I;  1W2B Y;  4NBA A;  4RVG A;  2QLV B;  2VF1 A;  1Q81 1;  1RO0 A;  2JA6 I;  3MZL B;  3HOX I;  4NBH A;  3HKZ A;  1NJI 1;  3Q87 A;  2QRC B;  4NBG A;  3I4M I;  3CMA 1;  2E2I I;  3GTL I;  3CCJ Z;  3M3Y I;  1WII A;  3CXC Y;  2V8J A;  4EWC A;  3TDH B;  2YAD A;  2F4O A;  3I56 1;  1VQO Z;  1N8R 1;  3GTK I;  1LQL A;  1SFO I;  4MXU A;  1VQN 1;  4MD8 A;  3FQM A;  3CD6 Z;  2DE6 A;  2WB1 A;  1KC8 1;  3I4N I;  3HOV I;  2NVX I;  3HOZ I;  2YU9 I;  5D1O B;  4A3K I;  1VQ6 1;  3D6W A;  4BY1 I;  1VQP Z;  2NVT I;  3CCQ 1;  2JMO A;  1S72 Z;  1VQK 1;  3MON A;  2KPI A;  3G6E 1;  2Y0S A;  2E2H I;  1VQ8 1;  1X3W A;  1K8A 2;  4NBF A;  2AKL A;  3PO2 I;  1R9T I;  3S2D I;  1TWC I;  1QF8 A;  1YIJ Z;  2B63 I;  3HOU I;  1VLA A;  3CPW Y;  1X0T A;  4NB8 A;  3CC4 Z;  4Y7N I;  3J80 f;  2NVQ I;  4A3G I;  2RHB A;  3CCJ 1;  2E2J I;  3H3V J;  2RT9 A;  3KIF A;  5A2Q b;  2R92 I;  3I56 Z;  4E2W A;  4E31 A;  1YIT 1;  4NBE A;  1K9M 2;  1QVF Y;  5IP7 I;  5C4J I;  3CD6 1;  3RZD I;  1ZB8 A;  1ZH1 A;  2JA7 I;  2HU9 A;  4RV9 A;  3TE5 B;  1WCM I;  3D9X A;  3GCF A;  2JA8 I;  3BG1 B;  1YJN Z;  3K7A I;  4BBS I;  1QVG Z;  3CCQ Z;  1M1K 2;  1VQP 1;  3FKI I;  1S72 1;  1KD1 2;  4NOZ A;  1USP B;  2QKD A;  4TNU A;  1Z02 A;  2OZK A;  1YIJ 1;  1Z03 A;  3S1Q I;  3GTQ I;  4E2Z A;  2K3R A;  3CC4 1;  3HOY I;  3VTN A;  1K8A 1;  3CCV 1;  1Y1V S;  4RS4 A;  1VQ5 Z;  4HGY A;  5IT9 f;  1YIT Z;  1VQM 1;  1M90 2;  1Q7Y 2;  3OW2 Y;  3BG0 B;  4BXX I;  1JJ2 Z;  3NFZ A;  2QA4 Z;  1RO2 A;  2OOY B;  4DQY B;  2JUB A;  5T64 A;  3VMI A;  5D1O A;  3IFU A;  3GTO I;  3MZK B;  1YJN 1;  2ZAE B;  1YHQ 1;  1K9M 1;  5T6B A;  3J81 f;  3VMG A;  1K83 I;  4BBR I;  4MON A;  5C3E I;  4NB9 A;  1Z01 A;  2P28 A;  3PO3 S;  2EGT A;  4MRI A;  3LUS A;  2PM9 A;  4A3E I;  1ZB9 A;  4QTU A;  2O53 A;  2PK7 A;  2OTJ 1;  3ESW A;  5IT9 b;  1M1K 1;  3CQZ I;  1RQF A;  2M6N A;  4MD9 A;  4NFR A;  1KD1 1;  4AYB A;  3T4N B;  2GU2 A;  3CC2 Z;  3S2H I;  3S1M I;  2OTL 1;  2K5R A;  3CCV Z;  3F3P C;  2F4M A;  1DL6 A;  1Q82 2;  4HGZ A;  3G4S Z;  1VQ5 1;  3VMH A;  3NH8 A;  4RVD A;  1VQM Z;  1QYP A;  1TWA I;  4CL1 A;  3JAM f;  1VQL Z;  2JS4 A;  2QEX 1;  1Q86 2;  1YUK A;  5FLX f;  2P3Y A;  4Y52 I;  4HH4 A;  2QA4 1;  1JWH C;  1VQ7 1;  2H85 A;  3GTJ I;  1NP6 A;  1M90 1;  1YUA A;  3G71 Z;  2R7Z I;  1Q7Y 1;  1RNI A;  1YHQ Z;  1W2B Z;  3GTP I;  3S15 I;  1P9N A;  1VQ9 1;  3RZO I;  2E9H A;  1USP A;  1TFI A;  1X3Z A;  3GTM S;  4DK1 A;  3J80 b;  4RVH A;  2HF1 A;  2WAQ A;  3CXC Z;  4NBD A;  3S17 I;  5CM2 M;  2VUM I;  2OTJ Z;  2J6A A;  1WW9 A;  2W04 A;  4QTT A;  3CCS 1;  3QWU A;  4A3B I;  5FLM I;  4E30 A;  4E2Y A;  2Q4Z A;  2RBL A;  2OTL Z;  4A3D I;  1KRL A;  3CC2 1;  2V8K A;  2W03 A;  3I07 A;  1ML8 A;  1Y1V I;  3GTG I;  1I3Q I;  3VB9 A;  2G2K A;  3G4S 1;  4A3C I;  2I3C A;  1L1O C;  2NVY I;  3P5J B;  2QEX Z;  1QVG Y;  1VQL 1;  3CME 1;  3CCR Z;  4XX2 A;  2JR6 A;  1I6H I;  3EED A;  1VQ7 Z;  1VQ4 1;  1Q82 1;  3CCE 1;  4E32 A;  1YJ9 1;  1NUI A;  4E2X A;  1KQS Y;  3NDI A;  3S16 I;  2IZ3 A;  3G71 1;  3CCL Z;  1YI2 1;  1Q86 1;  4A93 I;  1VQ9 Z;  1I50 I;  3KIH A;  2OOX B;  3I55 1;  5LL6 f;  4MD7 A;  3CCU 1;  2LFU A;  1K73 2;  3CPW Z;  3NH5 A;  3PO3 I;  2GTI A;  1PFT A;  3CC7 Z;  1S7M A;  5A2Q f;  4NH1 C;  1RLY A;  2VUG A;  1Y1W I;  3CCS Z;  4NBB A;  2DE5 A;  1Q81 2;  1JJ2 Y;  1QVF Z;  3IF8 A;  1NJI 2;  4E33 A;  1YJW Z;  2JA5 I;  2RPR A;  3CCM Z;  1TWF I;  2IZ4 A;  5C4X I;  5T67 A;  3HOW I;  3NDJ A;  2DE7 A;  2R93 I;  3CME Z;  5AN9 F;  1TWH I;  1N8R 2;  3FQQ A;  3J81 b;  3CCR 1;  3IX0 A;  1VQ4 Z;  3CMA Z;  3CCE Z;  1YJ9 Z;  3J7A 4;  5C44 I;  1KC8 2;  3S1N I;  2QRD B;  2KI7 B;  3NH4 A;  3EER A;  2PMZ A;  1YI2 Z;  3CCL 1;  1VQO 1;  2BJO A;  4NBC A;  3I55 Z;  3CCU Z;  4A3I I;  4RVF A;  1VQN Z;  1RO4 A;  2LIY A;  2RIQ A;  3GTM I;  2GTH A;  4BY7 I;  4A3L I;  3F3F C;  3CC7 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...