3CCEZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cceZ00
2QEX1 1VQP1 2QA4Z 1KQSY 3CD61 1JJ2Z 1VQ6Z 3G71Z 1VQ81 1VQL1 1VQN1 3I56Z 3CC2Z 3I55Z 2QEXZ 1VQPZ 1Q811 1KQSZ 3CCEZ 3CCLZ 1YI2Z 1YJ91 1VQM1 2QA41 3CD6Z 1Q861 1K9M1 3CPWY 1Q7Y1 3G4S1 1Q821 3CCQZ 1VQ7Z 1N8R1 1K8A1 1S721 1NJI1 2OTLZ 3CXCZ 3CME1 2OTJ1 1VQO1 1M1K1 1VQ41 1JJ2Y 1YJW1 1VQOZ 1YIJZ 1VQ71 1Q812 1KC82 1QVGZ 1VQ61 1VQ51 1YJWZ 3I551 1QVFY 1YIT1 1Q822 1M902 3CCVZ 3CC4Z 3CCE1 3CCL1 3G6EZ 3OW2Y 1W2BZ 1QVGY 3G4SZ 1K732 1YHQ1 3CCJZ 1K9M2 3CCV1 1M901 3CCQ1 1N8R2 1K8A2 1NJI2 3CMA1 1VQLZ 1KD12 1KC81 1KD11 1S72Z 1Q7Y2 1W2BY 3CPWZ 1M1K2 1VQMZ 3CXCY 1Q862 1K731 1YJ9Z 3CCS1 3CCUZ 1YI21 3CMAZ 3CCMZ 1VQ9Z 1YJN1 1YITZ 1VQ5Z 1VQK1 3OW2Z 3CC71 2OTL1 3CCSZ 3CCU1 3CCRZ 3CC41 3CMEZ 2OTJZ 3G6E1 3G711 1VQ8Z 1VQNZ 3CCM1 3CC7Z 3I561 1VQ91 3CCR1 1YJNZ 1VQ4Z 1YHQZ 1VQKZ 3CCJ1 3CC21 1QVFZ 1YIJ1
chains in the Genus database with same CATH superfamily
3CQZI 1VQP1 2J6AA 3S1RI 3HOZI 1K83I 2NVXI 1KRLA 3K7AI 1VQN1 3T4NB 1FDOA 2E2JI 1Q811 2G2KA 1KQSZ 2PMZA 3CCLZ 4BY1I 2JMOA 3HOXI 2B63I 3CD6Z 4BBRI 1I6HI 5IT9f 3J81f 1NP6A 1X3ZA 1S721 3U50C 5T6BA 3NH4A 1USPA 4HH4A 1PFTA 2NVQI 2JIRA 4NBCA 1VQ41 5D1PA 1VQ71 3TE5B 3GTMS 1KC82 3S16I 4RS4A 2VPYA 4DQYB 1ZB9A 1QVFY 2DE7A 2OOYB 1Q822 1M902 1RO0A 4HGZA 3PO3S 4A3GI 3CC4Z 4NH1C 1TWAI 1K9M2 5IT9b 3F3PC 2QLVB 2GTIA 1WJ2A 4S1TA 1NJI2 1FDIA 1WZNA 3JAMf 2LFUA 2V8KA 3S17I 5IP7I 3CPWZ 2LEXA 3S1MI 1M1K2 2K3RA 4DK1A 3CXCY 3QWUA 3MZKB 2IZ3A 3CCUZ 4A3II 2JIMA 1YITZ 1QYPA 1VQ5Z 2QKDA 2OTL1 2JR6A 2VPWA 2O53A 4NBDA 4NBGA 3G711 1VQ8Z 3I561 3FQMA 3J81b 1YHQZ 4A3EI 2NAPA 1YIJ1 1Y1VS 2QEX1 2QA4Z 1KQSY 4A3KI 1Z03A 4A3BI 3G71Z 1ZH1A 1VQ81 3S2DI 2E7ZA 3CCEZ 1YI2Z 1VQM1 2O4HA 4RVHA 4MD7A 2PK7A 2E2II 2V8JA 1VQ7Z 2PM9A 4E2ZA 2VPZA 1K8A1 4E30A 3VTNA 2OTLZ 4Y7NI 1Y1WI 1QF8A 3S1QI 5CM2M 4MRIA 3NDJA 4QTTA 4E33A 2ZAEB 1YJW1 2QRCB 1YUAA 3H0GI 1YIJZ 3GTGI 5FLMI 2JIOA 4E2YA 2HF1A 3J7A4 1X0TA 2IV2X 4EWCA 1SFOI 5C4XI 4DGLA 3P5JB 2V45A 3I551 4A93I 5A2Qf 2P28A 3CCVZ 1TWFI 1Y1VI 4HGYA 3FKII 4XX2A 3HOYI 2QREB 1W2BZ 1QVGY 4RVDA 4MD8A 1M901 1TFIA 2R92I 3IF8A 5C44I 3NFZA 3CCQ1 1N8R2 3EEDA 3NDIA 4BBSI 4RVGA 3CMA1 1KD12 1L1OC 3J80b 3VMHA 1VQMZ 4AYBA 1Q862 1K731 1YJ9Z 1WCMI 3M4OI 1VQK1 2JIPA 1QXFA 3CCU1 2P3YA 2M48A 3KIHA 1Y8CA 2VPXA 1LQLA 3GKQA 3I4NI 3IR7A 3CCM1 3CCR1 2AKLA 4MONA 1WW9A 4A3CI 4E31A 1QVFZ 3I4MI 2QRDB 5D1OB 3CD61 1JJ2Z 1VQ6Z 2JIQA 2W04A 2KI7B 4NBFA 2VUGA 3I56Z 2F4OA 3CC2Z 3I55Z 2QEXZ 1VQPZ 1ML8A 1RO2A 3GTJI 5AN9F 2WAQA 3Q87A 4NBHA 1Q861 4RVFA 1Q7Y1 3G4S1 5FLXb 3S15I 1Q821 1VLAA 4A3DI 2Q51A 3GTPI 1USPB 3EERA 4NB8A 3CXCZ 2JA5I 3CME1 2OTJ1 3RZDI 3FQQA 1JJ2Y 3BG0B 1VQOZ 2NVTI 1R9TI 5T64A 1VQ51 2KPIA 1YJWZ 3VMIA 2JA7I 4A3LI 4NBEA 2NVYI 3GTLI 1RNIA 2I3CA 3HKZA 2QR1B 3CCE1 3CCL1 3S14I 3TDHB 3G6EZ 3JAMb 2JNYA 2DE5A 4A3FI 3NH5A 5IP9I 4RV9A 3VMGA 3S1NI 1YUKA 2YU9I 1TWHI 1Q7Y2 2W03A 2V8IA 3VB9A 3PO2I 2HU9A 4TNUA 3IX0A 3GTQI 2R93I 4NOZA 2M6NA 1VQ9Z 1X3WA 1Z01A 5C4JI 2RHBA 4BXXI 4X6AI 3HOVI 2RIQA 1TWCI 2AYDA 3CCSZ 3CCRZ 3CC41 2DE6A 3G6E1 3J80f 2K5RA 5FLXf 4E2XA 1VQ91 1S7MA 1Q16A 5D1OA 3CC21 4E2WA 2JA8I 2GU2A 4MXUA 2IZ4A 2JS4A 3I07A 1VQL1 1N2FA 5A2Qb 4QTUA 1JWHC 1I50I 2F4MA 4A3JI 3BG1B 3F3FC 2E2HI 1YJ91 2WB1A 2QA41 1SIWA 1K9M1 3CPWY 4NBBA 3CCQZ 5LL6f 2VF1A 1ZB8A 1N8R1 2Y0SA 1NJI1 5C3EI 3HOUI 5T67A 4Y52I 1DL6A 2OZKA 1M1K1 2JA6I 3MZLB 2E9HA 2LIYA 3KIFA 4BY7I 1Z02A 3ESWA 1Q812 2VUMI 3GTKI 1QVGZ 1VQ61 3IFUA 2OOXB 3GTOI 1YIT1 1I3QI 3RZOI 2Q4ZA 4E32A 1RQFA 3NH8A 3OW2Y 3H3VJ 3G4SZ 1K732 4NBAA 1YHQ1 3CCJZ 1NUIA 2RT9A 3CCV1 2R7ZI 2V3VA 2BJOA 1K8A2 4NFRA 3S2HI 3MONA 1VQLZ 1KC81 1KD11 1S72Z 1W2BY 3D6WA 4NB9A 4CL1A 1P9NA 3GCFA 4MD9A 3LUSA 1WIIA 3CCS1 1YI21 2JUBA 3CMAZ 3CCMZ 3D9XA 4A3MI 3M3YI 1YJN1 1RO4A 3OW2Z 2RBLA 3CC71 3D2LA 2GTHA 3GTMI 4MH4A 2R6MA 3HOWI 3CMEZ 2EGTA 2OTJZ 2H85A 1TWGI 1AA6A 1VQNZ 3CC7Z 2YADA 1RLYA 1YJNZ 1VQ4Z 2RPRA 3CCJ1 1VQKZ 3PO3I 1VQO1
chains in the Genus database with same CATH topology
3CQZI 1VQP1 2J6AA 3S1RI 3HOZI 1K83I 2NVXI 1KRLA 3K7AI 1VQN1 3T4NB 2E2JI 1Q811 2G2KA 1KQSZ 2PMZA 3CCLZ 4BY1I 2JMOA 3HOXI 2B63I 3CD6Z 4BBRI 1I6HI 5IT9f 3J81f 1NP6A 1X3ZA 1S721 3U50C 5T6BA 3NH4A 1USPA 4HH4A 1PFTA 2NVQI 1VQ41 4NBCA 5D1PA 1VQ71 3TE5B 3GTMS 1KC82 3S16I 4RS4A 4DQYB 1ZB9A 1QVFY 2DE7A 2OOYB 1Q822 1M902 1RO0A 4HGZA 3PO3S 4A3GI 3CC4Z 4NH1C 1TWAI 1K9M2 5IT9b 3F3PC 2QLVB 2GTIA 4S1TA 1NJI2 3JAMf 2LFUA 2V8KA 3S17I 5IP7I 3CPWZ 3S1MI 1M1K2 2K3RA 4DK1A 3CXCY 3QWUA 3MZKB 2IZ3A 3CCUZ 4A3II 1YITZ 1QYPA 1VQ5Z 2QKDA 2OTL1 2JR6A 2O53A 4NBDA 4NBGA 3G711 1VQ8Z 3I561 3FQMA 3J81b 1YHQZ 4A3EI 1YIJ1 1Y1VS 2QEX1 2QA4Z 1KQSY 4A3KI 1Z03A 4A3BI 3G71Z 1ZH1A 1VQ81 3S2DI 3CCEZ 1YI2Z 1VQM1 2O4HA 4RVHA 4MD7A 2PK7A 2E2II 2V8JA 1VQ7Z 2PM9A 4E2ZA 1K8A1 4E30A 3VTNA 2OTLZ 4Y7NI 1Y1WI 1QF8A 3S1QI 5CM2M 4MRIA 3NDJA 4QTTA 4E33A 2ZAEB 1YJW1 2QRCB 1YUAA 3H0GI 1YIJZ 3GTGI 5FLMI 4E2YA 2HF1A 3J7A4 1X0TA 1SFOI 4EWCA 5C4XI 4DGLA 3P5JB 3I551 4A93I 5A2Qf 2P28A 3CCVZ 1TWFI 1Y1VI 4HGYA 3FKII 4XX2A 3HOYI 2QREB 1W2BZ 1QVGY 4RVDA 4MD8A 1M901 1TFIA 2R92I 3IF8A 5C44I 3NFZA 3CCQ1 1N8R2 3EEDA 3NDIA 4BBSI 4RVGA 3CMA1 1KD12 1L1OC 3J80b 3VMHA 1VQMZ 4AYBA 1Q862 1K731 1YJ9Z 1WCMI 3M4OI 1VQK1 3CCU1 2P3YA 2M48A 3KIHA 1LQLA 3GKQA 3I4NI 3CCM1 3CCR1 2AKLA 4MONA 1WW9A 4A3CI 4E31A 1QVFZ 3I4MI 2QRDB 5D1OB 3CD61 1JJ2Z 1VQ6Z 2W04A 2KI7B 4NBFA 2VUGA 3I56Z 2F4OA 3CC2Z 3I55Z 2QEXZ 1VQPZ 1ML8A 1RO2A 3GTJI 5AN9F 2WAQA 3Q87A 4NBHA 1Q861 4RVFA 1Q7Y1 3G4S1 5FLXb 3S15I 1Q821 1VLAA 4A3DI 2Q51A 3GTPI 1USPB 3EERA 4NB8A 3CXCZ 2JA5I 3CME1 2OTJ1 3RZDI 3FQQA 1JJ2Y 3BG0B 1VQOZ 2NVTI 1R9TI 5T64A 1VQ51 2KPIA 1YJWZ 3VMIA 2JA7I 4A3LI 4NBEA 2NVYI 3GTLI 1RNIA 2I3CA 3HKZA 2QR1B 3CCE1 3CCL1 3S14I 3TDHB 3G6EZ 3JAMb 2JNYA 2DE5A 4A3FI 3NH5A 5IP9I 4RV9A 3VMGA 3S1NI 1YUKA 2YU9I 1TWHI 1Q7Y2 2W03A 2V8IA 3VB9A 3PO2I 2HU9A 4TNUA 3IX0A 3GTQI 2R93I 4NOZA 2M6NA 1VQ9Z 1X3WA 1Z01A 5C4JI 2RHBA 4BXXI 4X6AI 3HOVI 2RIQA 1TWCI 3CCSZ 3CCRZ 3CC41 2DE6A 3G6E1 3J80f 2K5RA 5FLXf 4E2XA 1VQ91 1S7MA 5D1OA 3CC21 4E2WA 2JA8I 2GU2A 4MXUA 2IZ4A 2JS4A 3I07A 1VQL1 1N2FA 5A2Qb 4QTUA 1JWHC 1I50I 2F4MA 4A3JI 3BG1B 3F3FC 2E2HI 1YJ91 2WB1A 2QA41 1K9M1 3CPWY 4NBBA 3CCQZ 5LL6f 2VF1A 1ZB8A 1N8R1 2Y0SA 1NJI1 5C3EI 3HOUI 5T67A 4Y52I 1DL6A 2OZKA 1M1K1 2JA6I 3MZLB 2E9HA 2LIYA 3KIFA 4BY7I 1Z02A 3ESWA 1Q812 2VUMI 3GTKI 1QVGZ 1VQ61 3IFUA 2OOXB 3GTOI 1YIT1 1I3QI 3RZOI 2Q4ZA 4E32A 1RQFA 3NH8A 3OW2Y 3H3VJ 3G4SZ 1K732 4NBAA 1YHQ1 3CCJZ 1NUIA 2RT9A 3CCV1 2R7ZI 2BJOA 1K8A2 4NFRA 3S2HI 3MONA 1VQLZ 1KC81 1KD11 1S72Z 1W2BY 3D6WA 4NB9A 4CL1A 1P9NA 3GCFA 4MD9A 3LUSA 1WIIA 3CCS1 1YI21 2JUBA 3CMAZ 3CCMZ 3D9XA 4A3MI 3M3YI 1YJN1 1RO4A 2RBLA 3CC71 3OW2Z 2GTHA 3GTMI 4MH4A 2R6MA 3HOWI 3CMEZ 2EGTA 2OTJZ 2H85A 1TWGI 1VQNZ 3CC7Z 2YADA 1RLYA 1YJNZ 1VQ4Z 2RPRA 3CCJ1 1VQKZ 3PO3I 1VQO1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX 1;  1VQP 1;  2QA4 Z;  1KQS Y;  3CD6 1;  1JJ2 Z;  1VQ6 Z;  3G71 Z;  1VQ8 1;  1VQL 1;  1VQN 1;  3I56 Z;  3CC2 Z;  3I55 Z;  2QEX Z;  1VQP Z;  1Q81 1;  1KQS Z;  3CCE Z;  3CCL Z;  1YI2 Z;  1YJ9 1;  1VQM 1;  2QA4 1;  3CD6 Z;  1Q86 1;  1K9M 1;  3CPW Y;  1Q7Y 1;  3G4S 1;  1Q82 1;  3CCQ Z;  1VQ7 Z;  1N8R 1;  1K8A 1;  1S72 1;  1NJI 1;  2OTL Z;  3CXC Z;  3CME 1;  2OTJ 1;  1VQO 1;  1M1K 1;  1VQ4 1;  1JJ2 Y;  1YJW 1;  1VQO Z;  1YIJ Z;  1VQ7 1;  1Q81 2;  1KC8 2;  1QVG Z;  1VQ6 1;  1VQ5 1;  1YJW Z;  3I55 1;  1QVF Y;  1YIT 1;  1Q82 2;  1M90 2;  3CCV Z;  3CC4 Z;  3CCE 1;  3CCL 1;  3G6E Z;  3OW2 Y;  1W2B Z;  1QVG Y;  3G4S Z;  1K73 2;  1YHQ 1;  3CCJ Z;  1K9M 2;  3CCV 1;  1M90 1;  3CCQ 1;  1N8R 2;  1K8A 2;  1NJI 2;  3CMA 1;  1VQL Z;  1KD1 2;  1KC8 1;  1KD1 1;  1S72 Z;  1Q7Y 2;  1W2B Y;  3CPW Z;  1M1K 2;  1VQM Z;  3CXC Y;  1Q86 2;  1K73 1;  1YJ9 Z;  3CCS 1;  3CCU Z;  1YI2 1;  3CMA Z;  3CCM Z;  1VQ9 Z;  1YJN 1;  1YIT Z;  1VQ5 Z;  1VQK 1;  3OW2 Z;  3CC7 1;  2OTL 1;  3CCS Z;  3CCU 1;  3CCR Z;  3CC4 1;  3CME Z;  2OTJ Z;  3G6E 1;  3G71 1;  1VQ8 Z;  1VQN Z;  3CCM 1;  3CC7 Z;  3I56 1;  1VQ9 1;  3CCR 1;  1YJN Z;  1VQ4 Z;  1YHQ Z;  1VQK Z;  3CCJ 1;  3CC2 1;  1QVF Z;  1YIJ 1; 
#chains in the Genus database with same CATH topology
 3CQZ I;  1VQP 1;  2J6A A;  3S1R I;  3HOZ I;  1K83 I;  2NVX I;  1KRL A;  3K7A I;  1VQN 1;  3T4N B;  1FDO A;  2E2J I;  1Q81 1;  2G2K A;  1KQS Z;  2PMZ A;  3CCL Z;  4BY1 I;  2JMO A;  3HOX I;  2B63 I;  3CD6 Z;  4BBR I;  1I6H I;  5IT9 f;  3J81 f;  1NP6 A;  1X3Z A;  1S72 1;  3U50 C;  5T6B A;  3NH4 A;  1USP A;  4HH4 A;  1PFT A;  2NVQ I;  2JIR A;  4NBC A;  1VQ4 1;  5D1P A;  1VQ7 1;  3TE5 B;  3GTM S;  1KC8 2;  3S16 I;  4RS4 A;  2VPY A;  4DQY B;  1ZB9 A;  1QVF Y;  2DE7 A;  2OOY B;  1Q82 2;  1M90 2;  1RO0 A;  4HGZ A;  3PO3 S;  4A3G I;  3CC4 Z;  4NH1 C;  1TWA I;  1K9M 2;  5IT9 b;  3F3P C;  2QLV B;  2GTI A;  1WJ2 A;  4S1T A;  1NJI 2;  1FDI A;  1WZN A;  3JAM f;  2LFU A;  2V8K A;  3S17 I;  5IP7 I;  3CPW Z;  2LEX A;  3S1M I;  1M1K 2;  2K3R A;  4DK1 A;  3CXC Y;  3QWU A;  3MZK B;  2IZ3 A;  3CCU Z;  4A3I I;  2JIM A;  1YIT Z;  1QYP A;  1VQ5 Z;  2QKD A;  2OTL 1;  2JR6 A;  2VPW A;  2O53 A;  4NBD A;  4NBG A;  3G71 1;  1VQ8 Z;  3I56 1;  3FQM A;  3J81 b;  1YHQ Z;  4A3E I;  2NAP A;  1YIJ 1;  1Y1V S;  2QEX 1;  2QA4 Z;  1KQS Y;  4A3K I;  1Z03 A;  4A3B I;  3G71 Z;  1ZH1 A;  1VQ8 1;  3S2D I;  2E7Z A;  3CCE Z;  1YI2 Z;  1VQM 1;  2O4H A;  4RVH A;  4MD7 A;  2PK7 A;  2E2I I;  2V8J A;  1VQ7 Z;  2PM9 A;  4E2Z A;  2VPZ A;  1K8A 1;  4E30 A;  3VTN A;  2OTL Z;  4Y7N I;  1Y1W I;  1QF8 A;  3S1Q I;  5CM2 M;  4MRI A;  3NDJ A;  4QTT A;  4E33 A;  2ZAE B;  1YJW 1;  2QRC B;  1YUA A;  3H0G I;  1YIJ Z;  3GTG I;  5FLM I;  2JIO A;  4E2Y A;  2HF1 A;  3J7A 4;  1X0T A;  2IV2 X;  4EWC A;  1SFO I;  5C4X I;  4DGL A;  3P5J B;  2V45 A;  3I55 1;  4A93 I;  5A2Q f;  2P28 A;  3CCV Z;  1TWF I;  1Y1V I;  4HGY A;  3FKI I;  4XX2 A;  3HOY I;  2QRE B;  1W2B Z;  1QVG Y;  4RVD A;  4MD8 A;  1M90 1;  1TFI A;  2R92 I;  3IF8 A;  5C44 I;  3NFZ A;  3CCQ 1;  1N8R 2;  3EED A;  3NDI A;  4BBS I;  4RVG A;  3CMA 1;  1KD1 2;  1L1O C;  3J80 b;  3VMH A;  1VQM Z;  4AYB A;  1Q86 2;  1K73 1;  1YJ9 Z;  1WCM I;  3M4O I;  1VQK 1;  2JIP A;  1QXF A;  3CCU 1;  2P3Y A;  2M48 A;  3KIH A;  1Y8C A;  2VPX A;  1LQL A;  3GKQ A;  3I4N I;  3IR7 A;  3CCM 1;  3CCR 1;  2AKL A;  4MON A;  1WW9 A;  4A3C I;  4E31 A;  1QVF Z;  3I4M I;  2QRD B;  5D1O B;  3CD6 1;  1JJ2 Z;  1VQ6 Z;  2JIQ A;  2W04 A;  2KI7 B;  4NBF A;  2VUG A;  3I56 Z;  2F4O A;  3CC2 Z;  3I55 Z;  2QEX Z;  1VQP Z;  1ML8 A;  1RO2 A;  3GTJ I;  5AN9 F;  2WAQ A;  3Q87 A;  4NBH A;  1Q86 1;  4RVF A;  1Q7Y 1;  3G4S 1;  5FLX b;  3S15 I;  1Q82 1;  1VLA A;  4A3D I;  2Q51 A;  3GTP I;  1USP B;  3EER A;  4NB8 A;  3CXC Z;  2JA5 I;  3CME 1;  2OTJ 1;  3RZD I;  3FQQ A;  1JJ2 Y;  3BG0 B;  1VQO Z;  2NVT I;  1R9T I;  5T64 A;  1VQ5 1;  2KPI A;  1YJW Z;  3VMI A;  2JA7 I;  4A3L I;  4NBE A;  2NVY I;  3GTL I;  1RNI A;  2I3C A;  3HKZ A;  2QR1 B;  3CCE 1;  3CCL 1;  3S14 I;  3TDH B;  3G6E Z;  3JAM b;  2JNY A;  2DE5 A;  4A3F I;  3NH5 A;  5IP9 I;  4RV9 A;  3VMG A;  3S1N I;  1YUK A;  2YU9 I;  1TWH I;  1Q7Y 2;  2W03 A;  2V8I A;  3VB9 A;  3PO2 I;  2HU9 A;  4TNU A;  3IX0 A;  3GTQ I;  2R93 I;  4NOZ A;  2M6N A;  1VQ9 Z;  1X3W A;  1Z01 A;  5C4J I;  2RHB A;  4BXX I;  4X6A I;  3HOV I;  2RIQ A;  1TWC I;  2AYD A;  3CCS Z;  3CCR Z;  3CC4 1;  2DE6 A;  3G6E 1;  3J80 f;  2K5R A;  5FLX f;  4E2X A;  1VQ9 1;  1S7M A;  1Q16 A;  5D1O A;  3CC2 1;  4E2W A;  2JA8 I;  2GU2 A;  4MXU A;  2IZ4 A;  2JS4 A;  3I07 A;  1VQL 1;  1N2F A;  5A2Q b;  4QTU A;  1JWH C;  1I50 I;  2F4M A;  4A3J I;  3BG1 B;  3F3F C;  2E2H I;  1YJ9 1;  2WB1 A;  2QA4 1;  1SIW A;  1K9M 1;  3CPW Y;  4NBB A;  3CCQ Z;  5LL6 f;  2VF1 A;  1ZB8 A;  1N8R 1;  2Y0S A;  1NJI 1;  5C3E I;  3HOU I;  5T67 A;  4Y52 I;  1DL6 A;  2OZK A;  1M1K 1;  2JA6 I;  3MZL B;  2E9H A;  2LIY A;  3KIF A;  4BY7 I;  1Z02 A;  3ESW A;  1Q81 2;  2VUM I;  3GTK I;  1QVG Z;  1VQ6 1;  3IFU A;  2OOX B;  3GTO I;  1YIT 1;  1I3Q I;  3RZO I;  2Q4Z A;  4E32 A;  1RQF A;  3NH8 A;  3OW2 Y;  3H3V J;  3G4S Z;  1K73 2;  4NBA A;  1YHQ 1;  3CCJ Z;  1NUI A;  2RT9 A;  3CCV 1;  2R7Z I;  2V3V A;  2BJO A;  1K8A 2;  4NFR A;  3S2H I;  3MON A;  1VQL Z;  1KC8 1;  1KD1 1;  1S72 Z;  1W2B Y;  3D6W A;  4NB9 A;  4CL1 A;  1P9N A;  3GCF A;  4MD9 A;  3LUS A;  1WII A;  3CCS 1;  1YI2 1;  2JUB A;  3CMA Z;  3CCM Z;  3D9X A;  4A3M I;  3M3Y I;  1YJN 1;  1RO4 A;  3OW2 Z;  2RBL A;  3CC7 1;  3D2L A;  2GTH A;  3GTM I;  4MH4 A;  2R6M A;  3HOW I;  3CME Z;  2EGT A;  2OTJ Z;  2H85 A;  1TWG I;  1AA6 A;  1VQN Z;  3CC7 Z;  2YAD A;  1RLY A;  1YJN Z;  1VQ4 Z;  2RPR A;  3CCJ 1;  1VQK Z;  3PO3 I;  1VQO 1; 
#chains in the Genus database with same CATH homology
 3CQZ I;  1VQP 1;  2J6A A;  3S1R I;  3HOZ I;  1K83 I;  2NVX I;  1KRL A;  3K7A I;  1VQN 1;  3T4N B;  2E2J I;  1Q81 1;  2G2K A;  1KQS Z;  2PMZ A;  3CCL Z;  4BY1 I;  2JMO A;  3HOX I;  2B63 I;  3CD6 Z;  4BBR I;  1I6H I;  5IT9 f;  3J81 f;  1NP6 A;  1X3Z A;  1S72 1;  3U50 C;  5T6B A;  3NH4 A;  1USP A;  4HH4 A;  1PFT A;  2NVQ I;  1VQ4 1;  4NBC A;  5D1P A;  1VQ7 1;  3TE5 B;  3GTM S;  1KC8 2;  3S16 I;  4RS4 A;  4DQY B;  1ZB9 A;  1QVF Y;  2DE7 A;  2OOY B;  1Q82 2;  1M90 2;  1RO0 A;  4HGZ A;  3PO3 S;  4A3G I;  3CC4 Z;  4NH1 C;  1TWA I;  1K9M 2;  5IT9 b;  3F3P C;  2QLV B;  2GTI A;  4S1T A;  1NJI 2;  3JAM f;  2LFU A;  2V8K A;  3S17 I;  5IP7 I;  3CPW Z;  3S1M I;  1M1K 2;  2K3R A;  4DK1 A;  3CXC Y;  3QWU A;  3MZK B;  2IZ3 A;  3CCU Z;  4A3I I;  1YIT Z;  1QYP A;  1VQ5 Z;  2QKD A;  2OTL 1;  2JR6 A;  2O53 A;  4NBD A;  4NBG A;  3G71 1;  1VQ8 Z;  3I56 1;  3FQM A;  3J81 b;  1YHQ Z;  4A3E I;  1YIJ 1;  1Y1V S;  2QEX 1;  2QA4 Z;  1KQS Y;  4A3K I;  1Z03 A;  4A3B I;  3G71 Z;  1ZH1 A;  1VQ8 1;  3S2D I;  3CCE Z;  1YI2 Z;  1VQM 1;  2O4H A;  4RVH A;  4MD7 A;  2PK7 A;  2E2I I;  2V8J A;  1VQ7 Z;  2PM9 A;  4E2Z A;  1K8A 1;  4E30 A;  3VTN A;  2OTL Z;  4Y7N I;  1Y1W I;  1QF8 A;  3S1Q I;  5CM2 M;  4MRI A;  3NDJ A;  4QTT A;  4E33 A;  2ZAE B;  1YJW 1;  2QRC B;  1YUA A;  3H0G I;  1YIJ Z;  3GTG I;  5FLM I;  4E2Y A;  2HF1 A;  3J7A 4;  1X0T A;  1SFO I;  4EWC A;  5C4X I;  4DGL A;  3P5J B;  3I55 1;  4A93 I;  5A2Q f;  2P28 A;  3CCV Z;  1TWF I;  1Y1V I;  4HGY A;  3FKI I;  4XX2 A;  3HOY I;  2QRE B;  1W2B Z;  1QVG Y;  4RVD A;  4MD8 A;  1M90 1;  1TFI A;  2R92 I;  3IF8 A;  5C44 I;  3NFZ A;  3CCQ 1;  1N8R 2;  3EED A;  3NDI A;  4BBS I;  4RVG A;  3CMA 1;  1KD1 2;  1L1O C;  3J80 b;  3VMH A;  1VQM Z;  4AYB A;  1Q86 2;  1K73 1;  1YJ9 Z;  1WCM I;  3M4O I;  1VQK 1;  3CCU 1;  2P3Y A;  2M48 A;  3KIH A;  1LQL A;  3GKQ A;  3I4N I;  3CCM 1;  3CCR 1;  2AKL A;  4MON A;  1WW9 A;  4A3C I;  4E31 A;  1QVF Z;  3I4M I;  2QRD B;  5D1O B;  3CD6 1;  1JJ2 Z;  1VQ6 Z;  2W04 A;  2KI7 B;  4NBF A;  2VUG A;  3I56 Z;  2F4O A;  3CC2 Z;  3I55 Z;  2QEX Z;  1VQP Z;  1ML8 A;  1RO2 A;  3GTJ I;  5AN9 F;  2WAQ A;  3Q87 A;  4NBH A;  1Q86 1;  4RVF A;  1Q7Y 1;  3G4S 1;  5FLX b;  3S15 I;  1Q82 1;  1VLA A;  4A3D I;  2Q51 A;  3GTP I;  1USP B;  3EER A;  4NB8 A;  3CXC Z;  2JA5 I;  3CME 1;  2OTJ 1;  3RZD I;  3FQQ A;  1JJ2 Y;  3BG0 B;  1VQO Z;  2NVT I;  1R9T I;  5T64 A;  1VQ5 1;  2KPI A;  1YJW Z;  3VMI A;  2JA7 I;  4A3L I;  4NBE A;  2NVY I;  3GTL I;  1RNI A;  2I3C A;  3HKZ A;  2QR1 B;  3CCE 1;  3CCL 1;  3S14 I;  3TDH B;  3G6E Z;  3JAM b;  2JNY A;  2DE5 A;  4A3F I;  3NH5 A;  5IP9 I;  4RV9 A;  3VMG A;  3S1N I;  1YUK A;  2YU9 I;  1TWH I;  1Q7Y 2;  2W03 A;  2V8I A;  3VB9 A;  3PO2 I;  2HU9 A;  4TNU A;  3IX0 A;  3GTQ I;  2R93 I;  4NOZ A;  2M6N A;  1VQ9 Z;  1X3W A;  1Z01 A;  5C4J I;  2RHB A;  4BXX I;  4X6A I;  3HOV I;  2RIQ A;  1TWC I;  3CCS Z;  3CCR Z;  3CC4 1;  2DE6 A;  3G6E 1;  3J80 f;  2K5R A;  5FLX f;  4E2X A;  1VQ9 1;  1S7M A;  5D1O A;  3CC2 1;  4E2W A;  2JA8 I;  2GU2 A;  4MXU A;  2IZ4 A;  2JS4 A;  3I07 A;  1VQL 1;  1N2F A;  5A2Q b;  4QTU A;  1JWH C;  1I50 I;  2F4M A;  4A3J I;  3BG1 B;  3F3F C;  2E2H I;  1YJ9 1;  2WB1 A;  2QA4 1;  1K9M 1;  3CPW Y;  4NBB A;  3CCQ Z;  5LL6 f;  2VF1 A;  1ZB8 A;  1N8R 1;  2Y0S A;  1NJI 1;  5C3E I;  3HOU I;  5T67 A;  4Y52 I;  1DL6 A;  2OZK A;  1M1K 1;  2JA6 I;  3MZL B;  2E9H A;  2LIY A;  3KIF A;  4BY7 I;  1Z02 A;  3ESW A;  1Q81 2;  2VUM I;  3GTK I;  1QVG Z;  1VQ6 1;  3IFU A;  2OOX B;  3GTO I;  1YIT 1;  1I3Q I;  3RZO I;  2Q4Z A;  4E32 A;  1RQF A;  3NH8 A;  3OW2 Y;  3H3V J;  3G4S Z;  1K73 2;  4NBA A;  1YHQ 1;  3CCJ Z;  1NUI A;  2RT9 A;  3CCV 1;  2R7Z I;  2BJO A;  1K8A 2;  4NFR A;  3S2H I;  3MON A;  1VQL Z;  1KC8 1;  1KD1 1;  1S72 Z;  1W2B Y;  3D6W A;  4NB9 A;  4CL1 A;  1P9N A;  3GCF A;  4MD9 A;  3LUS A;  1WII A;  3CCS 1;  1YI2 1;  2JUB A;  3CMA Z;  3CCM Z;  3D9X A;  4A3M I;  3M3Y I;  1YJN 1;  1RO4 A;  2RBL A;  3CC7 1;  3OW2 Z;  2GTH A;  3GTM I;  4MH4 A;  2R6M A;  3HOW I;  3CME Z;  2EGT A;  2OTJ Z;  2H85 A;  1TWG I;  1VQN Z;  3CC7 Z;  2YAD A;  1RLY A;  1YJN Z;  1VQ4 Z;  2RPR A;  3CCJ 1;  1VQK Z;  3PO3 I;  1VQO 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...