3CCEZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cceZ00
1YJN1 3CC2Z 1VQPZ 3CCS1 1Q7Y1 1YIT1 1VQM1 1M901 3CCLZ 1VQ7Z 1KD12 2OTL1 3OW2Y 1QVGZ 1VQ51 3G6EZ 1VQMZ 1YI2Z 1NJI2 3G4SZ 1QVGY 1Q862 2OTLZ 1YHQ1 1NJI1 3CMAZ 3CXCZ 1YJNZ 1Q822 1VQLZ 1YJ91 1YJWZ 1VQ8Z 3CCL1 3CMEZ 3CCRZ 3CC41 1VQ5Z 1K8A2 3CCM1 1KQSZ 1VQOZ 3CC4Z 1Q811 1K9M1 3CMA1 2QA41 1JJ2Z 1KC81 1VQ4Z 1VQL1 3CC7Z 1YJ9Z 1VQ91 3CD6Z 3CPWZ 1VQP1 1K8A1 1YITZ 1W2BZ 1QVFY 1VQN1 3CCQZ 1VQ61 3I551 1Q861 3CD61 1KC82 1K732 1YIJZ 3G4S1 2OTJZ 1M902 3CCR1 3CCJ1 1YHQZ 1VQK1 1M1K2 2OTJ1 1VQO1 1N8R2 3CCJZ 3CCU1 3CCQ1 2QEXZ 3I55Z 1YJW1 3CCVZ 3CPWY 2QA4Z 3CCSZ 3CCEZ 3CC71 1S721 3CCUZ 1Q821 1KD11 3I561 3CCV1 1W2BY 1JJ2Y 3G6E1 1VQKZ 1VQ6Z 1Q812 3I56Z 3CC21 3G71Z 1QVFZ 2QEX1 1VQ9Z 1YIJ1 1Q7Y2 1K9M2 1K731 3CCMZ 3CCE1 1VQ71 1S72Z 3G711 1KQSY 1VQNZ 1VQ81 3CXCY 3CME1 1YI21 3OW2Z 1VQ41 1M1K1 1N8R1
chains in the Genus database with same CATH superfamily
2RIQA 1YJN1 1ML8A 3CC2Z 1VQPZ 3CCS1 3HOVI 2K3RA 1YUKA 3NH5A 2OTL1 3OW2Y 1QVGZ 3GTPI 3FQMA 2RPRA 4DGLA 4A3FI 5FLXf 3GTKI 1NJI1 4NBDA 3EERA 1VQLZ 1ZB9A 4AYBA 3F3PC 3ESWA 1TWFI 2QR1B 4NBEA 4DQYB 3CC41 4HH4A 1VQ5Z 3KIFA 2R6MA 1Y1VS 1VQOZ 4BBRI 4MXUA 3S17I 2JUBA 3VMIA 4EWCA 2OZKA 4NBGA 5A2Qf 1SIWA 1TWHI 1YJ9Z 4NBAA 5FLMI 1RO4A 4E32A 2Q51A 1VQN1 2YADA 1L1OC 3T4NB 1QXFA 1KC82 1K732 1N2FA 3CCR1 1RO2A 1PFTA 1VQK1 3VB9A 3S1QI 2H85A 3CCQ1 3I55Z 1YJW1 3CCVZ 3CPWY 2QA4Z 2E7ZA 2ZAEB 1S721 3J81b 3I561 1TWCI 5IP7I 1W2BY 4Y52I 4NOZA 4S1TA 1QYPA 3G6E1 2GTIA 1Y8CA 2WAQA 3HKZA 3NDJA 1USPB 3G71Z 1YIJ1 1K9M2 2VUGA 1K731 4NFRA 3GTMI 1VQ71 2V3VA 5C4JI 2IZ3A 4NBFA 1Z03A 4A3LI 1YI21 2QREB 3D6WA 4TNUA 3I4NI 3HOYI 2E2JI 3FKII 3CCLZ 4E2XA 1VQMZ 3H0GI 3KIHA 2R7ZI 1YJNZ 1QF8A 1Q822 1NP6A 5C4XI 1TWGI 1Y1WI 1YJWZ 3J80b 1VQ8Z 2LEXA 1ZH1A 3S1MI 1ZB8A 3IF8A 5LL6f 3GKQA 1RLYA 2AYDA 3VTNA 1R9TI 1RO0A 3GCFA 2VPYA 4MRIA 5AN9F 3PO3S 1VQL1 3CC7Z 4NBCA 3IX0A 3CPWZ 1Q16A 1YITZ 4NBHA 3MZLB 4A3KI 1VQ61 3GTMS 2JA6I 2JA7I 3CD61 2E2HI 3S2HI 5D1PA 3S1RI 3PO2I 3G4S1 2OTJZ 3CCJ1 1YHQZ 1JWHC 5D1OB 1SFOI 1VQO1 3CCU1 4A93I 2NVYI 5D1OA 3CCEZ 1NUIA 3RZOI 4MD8A 4BY1I 2GTHA 1VQKZ 5A2Qb 2RHBA 5T64A 1Q812 5T6BA 3LUSA 1QVFZ 4NB8A 1VQ9Z 2KI7B 1K83I 4E2WA 1S72Z 2JIQA 4HGZA 3NFZA 4MD7A 4A3BI 2QLVB 1TFIA 2EGTA 1I3QI 3CXCY 3CME1 2VPZA 2JIMA 4RV9A 2NVQI 3S2DI 3Q87A 3FQQA 2Q4ZA 3K7AI 1Q7Y1 3NDIA 1YIT1 1M901 3GTQI 3J81f 1Y1VI 1KD12 1VQ7Z 1RNIA 2OOYB 4NB9A 2F4OA 3G6EZ 1LQLA 1YI2Z 3G4SZ 3I4MI 1Q862 1WJ2A 2O4HA 2QKDA 4Y7NI 3CMAZ 3QWUA 1YHQ1 2JR6A 2OTLZ 1FDIA 3CXCZ 1P9NA 3S1NI 4A3JI 2V8IA 4HGYA 2I3CA 3GTLI 3P5JB 3CCL1 3IR7A 1K8A2 3J80f 3CCM1 1KQSZ 2BJOA 2NVXI 3CC4Z 4A3DI 1JJ2Z 3NH8A 3BG1B 1VQ4Z 3IFUA 3RZDI 2JIOA 1VQ91 2JNYA 5FLXb 4RVDA 1WCMI 1W2BZ 1USPA 1QVFY 4QTUA 1Q861 2QRCB 4E30A 4A3GI 3U50C 5T67A 3I07A 2JA5I 3D9XA 3BG0B 2JIRA 4XX2A 4A3MI 2PMZA 1M1K2 2R93I 2G2KA 2M48A 4A3EI 1AA6A 2QEXZ 2NAPA 2OOXB 3MONA 3CCSZ 3CC71 4BBSI 1Q821 1KD11 1Z01A 3CCV1 4RS4A 3EEDA 3M3YI 1VQ6Z 3I56Z 1DL6A 3CC21 2DE6A 5IT9f 3NH4A 4E33A 3MZKB 3CCMZ 3CCE1 2JIPA 3J7A4 3G711 1KQSY 3HOXI 2M6NA 2PM9A 3OW2Z 2B63I 2PK7A 1VQ41 1M1K1 5C3EI 2K5RA 3GTJI 4E31A 1N8R1 4BY7I 1RQFA 5CM2M 1Z02A 1VQM1 3TDHB 4MONA 3VMHA 4A3CI 1X0TA 2J6AA 5IT9b 2IV2X 1VQ51 2VPXA 1NJI2 1QVGY 2KPIA 3TE5B 2P28A 2V45A 2LIYA 1VLAA 1X3WA 1WIIA 1YJ91 3M4OI 3CMEZ 3CCRZ 2V8KA 4E2YA 2F4MA 3JAMf 4A3II 4RVHA 4NH1C 2DE5A 2W03A 1X3ZA 4E2ZA 1Q811 1K9M1 4CL1A 5C44I 2YU9I 3CMA1 3H3VJ 2QA41 1KC81 4QTTA 2JMOA 3PO3I 2WB1A 3VMGA 4NBBA 3CD6Z 1VQP1 1K8A1 2IZ4A 2JA8I 3HOUI 2RT9A 3CCQZ 3I551 3S16I 2V8JA 3JAMb 2VPWA 4DK1A 2E2II 2VF1A 2E9HA 1YIJZ 2NVTI 2HF1A 1M902 2RBLA 4MH4A 2P3YA 2OTJ1 4RVFA 1S7MA 1N8R2 3CCJZ 2VUMI 2LFUA 5IP9I 1I50I 4RVGA 3HOZI 3S15I 3CCUZ 1TWAI 4MD9A 2AKLA 1JJ2Y 1YUAA 2O53A 2HU9A 2JS4A 3F3FC 4BXXI 1KRLA 2DE7A 3HOWI 2R92I 1I6HI 2QEX1 2GU2A 1FDOA 4X6AI 3GTGI 1Q7Y2 2Y0SA 3CQZI 3S14I 1VQNZ 2QRDB 1VQ81 3GTOI 3D2LA 1WW9A 1WZNA 2W04A
chains in the Genus database with same CATH topology
2RIQA 1YJN1 1ML8A 3CC2Z 1VQPZ 3CCS1 3HOVI 2K3RA 1YUKA 3NH5A 2OTL1 3OW2Y 1QVGZ 3GTPI 3FQMA 2RPRA 4DGLA 4A3FI 5FLXf 3GTKI 1NJI1 4NBDA 3EERA 1VQLZ 1ZB9A 4AYBA 3F3PC 3ESWA 1TWFI 2QR1B 4NBEA 4DQYB 3CC41 4HH4A 1VQ5Z 3KIFA 2R6MA 1Y1VS 1VQOZ 4BBRI 4MXUA 3S17I 2JUBA 3VMIA 4EWCA 2OZKA 4NBGA 5A2Qf 1TWHI 1YJ9Z 4NBAA 5FLMI 1RO4A 4E32A 2Q51A 1VQN1 2YADA 1L1OC 3T4NB 1KC82 1K732 1N2FA 3CCR1 1RO2A 1PFTA 1VQK1 3VB9A 3S1QI 2H85A 3CCQ1 3I55Z 1YJW1 3CCVZ 3CPWY 2QA4Z 2ZAEB 1S721 3J81b 3I561 1TWCI 5IP7I 1W2BY 4Y52I 4NOZA 4S1TA 1QYPA 3G6E1 2GTIA 2WAQA 3HKZA 3NDJA 1USPB 3G71Z 1YIJ1 1K9M2 1K731 2VUGA 4NFRA 3GTMI 1VQ71 5C4JI 2IZ3A 4NBFA 1Z03A 4A3LI 1YI21 2QREB 3D6WA 4TNUA 3I4NI 3HOYI 2E2JI 3FKII 3CCLZ 4E2XA 1VQMZ 3H0GI 3KIHA 2R7ZI 1YJNZ 1QF8A 1Q822 1NP6A 5C4XI 1TWGI 1Y1WI 1YJWZ 3J80b 1VQ8Z 1ZH1A 3S1MI 1ZB8A 3IF8A 5LL6f 3GKQA 1RLYA 3VTNA 1R9TI 1RO0A 3GCFA 4MRIA 5AN9F 3PO3S 1VQL1 3CC7Z 4NBCA 3IX0A 3CPWZ 1YITZ 4NBHA 3MZLB 4A3KI 1VQ61 3GTMS 2JA6I 2JA7I 3CD61 2E2HI 3S2HI 5D1PA 3S1RI 3PO2I 3G4S1 2OTJZ 3CCJ1 1YHQZ 1JWHC 5D1OB 1SFOI 1VQO1 3CCU1 4A93I 2NVYI 5D1OA 3CCEZ 1NUIA 3RZOI 4MD8A 4BY1I 2GTHA 1VQKZ 5A2Qb 2RHBA 5T64A 1Q812 5T6BA 3LUSA 1QVFZ 4NB8A 1VQ9Z 2KI7B 1K83I 4E2WA 1S72Z 4HGZA 3NFZA 4MD7A 4A3BI 2QLVB 1TFIA 2EGTA 1I3QI 3CXCY 3CME1 4RV9A 2NVQI 3S2DI 3Q87A 3FQQA 2Q4ZA 3K7AI 1Q7Y1 3NDIA 1YIT1 1M901 3GTQI 3J81f 1Y1VI 1KD12 1VQ7Z 1RNIA 2OOYB 4NB9A 2F4OA 3G6EZ 1LQLA 1YI2Z 3G4SZ 3I4MI 1Q862 2QKDA 2O4HA 1YHQ1 4Y7NI 3CMAZ 3QWUA 2OTLZ 2JR6A 3CXCZ 1P9NA 3S1NI 4A3JI 2V8IA 4HGYA 2I3CA 3GTLI 3P5JB 3CCL1 1K8A2 3J80f 3CCM1 1KQSZ 2BJOA 2NVXI 3CC4Z 4A3DI 1JJ2Z 3NH8A 3BG1B 1VQ4Z 3IFUA 3RZDI 1VQ91 2JNYA 5FLXb 4RVDA 1WCMI 1W2BZ 1USPA 1QVFY 4QTUA 1Q861 2QRCB 4E30A 4A3GI 3U50C 5T67A 3I07A 2JA5I 3D9XA 3BG0B 4XX2A 4A3MI 2PMZA 1M1K2 2R93I 2G2KA 2M48A 4A3EI 2QEXZ 2OOXB 3MONA 3CCSZ 3CC71 4BBSI 1Q821 1KD11 1Z01A 3CCV1 4RS4A 3EEDA 3M3YI 1VQ6Z 3I56Z 1DL6A 3CC21 2DE6A 5IT9f 3NH4A 4E33A 3MZKB 3CCMZ 3CCE1 3J7A4 3G711 1KQSY 3HOXI 2M6NA 2PM9A 3OW2Z 2B63I 2PK7A 1VQ41 1M1K1 5C3EI 2K5RA 3GTJI 4E31A 1N8R1 4BY7I 1RQFA 5CM2M 1Z02A 1VQM1 3TDHB 4MONA 3VMHA 4A3CI 1X0TA 2J6AA 5IT9b 1VQ51 1NJI2 1QVGY 2KPIA 3TE5B 2P28A 2LIYA 1VLAA 1X3WA 1WIIA 1YJ91 3M4OI 3CMEZ 3CCRZ 2V8KA 4E2YA 2F4MA 3JAMf 4A3II 4RVHA 4NH1C 2DE5A 2W03A 1X3ZA 4E2ZA 1Q811 1K9M1 4CL1A 5C44I 2YU9I 3CMA1 3H3VJ 2QA41 1KC81 4QTTA 2JMOA 3PO3I 2WB1A 3VMGA 4NBBA 3CD6Z 1VQP1 1K8A1 2IZ4A 2JA8I 3HOUI 2RT9A 3CCQZ 3I551 3S16I 2V8JA 3JAMb 4DK1A 2E2II 2VF1A 2E9HA 1YIJZ 2NVTI 2HF1A 1M902 2RBLA 4MH4A 2P3YA 2OTJ1 4RVFA 1S7MA 1N8R2 3CCJZ 2VUMI 2LFUA 5IP9I 1I50I 4RVGA 3HOZI 3S15I 3CCUZ 1TWAI 4MD9A 2AKLA 1JJ2Y 1YUAA 2O53A 2HU9A 2JS4A 3F3FC 4BXXI 1KRLA 2DE7A 3HOWI 2R92I 1I6HI 2QEX1 2GU2A 4X6AI 3GTGI 1Q7Y2 2Y0SA 3CQZI 3S14I 1VQNZ 2QRDB 1VQ81 3GTOI 1WW9A 2W04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN 1;  3CC2 Z;  1VQP Z;  3CCS 1;  1Q7Y 1;  1YIT 1;  1VQM 1;  1M90 1;  3CCL Z;  1VQ7 Z;  1KD1 2;  2OTL 1;  3OW2 Y;  1QVG Z;  1VQ5 1;  3G6E Z;  1VQM Z;  1YI2 Z;  1NJI 2;  3G4S Z;  1QVG Y;  1Q86 2;  2OTL Z;  1YHQ 1;  1NJI 1;  3CMA Z;  3CXC Z;  1YJN Z;  1Q82 2;  1VQL Z;  1YJ9 1;  1YJW Z;  1VQ8 Z;  3CCL 1;  3CME Z;  3CCR Z;  3CC4 1;  1VQ5 Z;  1K8A 2;  3CCM 1;  1KQS Z;  1VQO Z;  3CC4 Z;  1Q81 1;  1K9M 1;  3CMA 1;  2QA4 1;  1JJ2 Z;  1KC8 1;  1VQ4 Z;  1VQL 1;  3CC7 Z;  1YJ9 Z;  1VQ9 1;  3CD6 Z;  3CPW Z;  1VQP 1;  1K8A 1;  1YIT Z;  1W2B Z;  1QVF Y;  1VQN 1;  3CCQ Z;  1VQ6 1;  3I55 1;  1Q86 1;  3CD6 1;  1KC8 2;  1K73 2;  1YIJ Z;  3G4S 1;  2OTJ Z;  1M90 2;  3CCR 1;  3CCJ 1;  1YHQ Z;  1VQK 1;  1M1K 2;  2OTJ 1;  1VQO 1;  1N8R 2;  3CCJ Z;  3CCU 1;  3CCQ 1;  2QEX Z;  3I55 Z;  1YJW 1;  3CCV Z;  3CPW Y;  2QA4 Z;  3CCS Z;  3CCE Z;  3CC7 1;  1S72 1;  3CCU Z;  1Q82 1;  1KD1 1;  3I56 1;  3CCV 1;  1W2B Y;  1JJ2 Y;  3G6E 1;  1VQK Z;  1VQ6 Z;  1Q81 2;  3I56 Z;  3CC2 1;  3G71 Z;  1QVF Z;  2QEX 1;  1VQ9 Z;  1YIJ 1;  1Q7Y 2;  1K9M 2;  1K73 1;  3CCM Z;  3CCE 1;  1VQ7 1;  1S72 Z;  3G71 1;  1KQS Y;  1VQN Z;  1VQ8 1;  3CXC Y;  3CME 1;  1YI2 1;  3OW2 Z;  1VQ4 1;  1M1K 1;  1N8R 1; 
#chains in the Genus database with same CATH topology
 2RIQ A;  1YJN 1;  1ML8 A;  3CC2 Z;  1VQP Z;  3CCS 1;  3HOV I;  2K3R A;  1YUK A;  3NH5 A;  2OTL 1;  3OW2 Y;  1QVG Z;  3GTP I;  3FQM A;  2RPR A;  4DGL A;  4A3F I;  5FLX f;  3GTK I;  1NJI 1;  4NBD A;  3EER A;  1VQL Z;  1ZB9 A;  4AYB A;  3F3P C;  3ESW A;  1TWF I;  2QR1 B;  4NBE A;  4DQY B;  3CC4 1;  4HH4 A;  1VQ5 Z;  3KIF A;  2R6M A;  1Y1V S;  1VQO Z;  4BBR I;  4MXU A;  3S17 I;  2JUB A;  3VMI A;  4EWC A;  2OZK A;  4NBG A;  5A2Q f;  1SIW A;  1TWH I;  1YJ9 Z;  4NBA A;  5FLM I;  1RO4 A;  4E32 A;  2Q51 A;  1VQN 1;  2YAD A;  1L1O C;  3T4N B;  1QXF A;  1KC8 2;  1K73 2;  1N2F A;  3CCR 1;  1RO2 A;  1PFT A;  1VQK 1;  3VB9 A;  3S1Q I;  2H85 A;  3CCQ 1;  3I55 Z;  1YJW 1;  3CCV Z;  3CPW Y;  2QA4 Z;  2E7Z A;  2ZAE B;  1S72 1;  3J81 b;  3I56 1;  1TWC I;  5IP7 I;  1W2B Y;  4Y52 I;  4NOZ A;  4S1T A;  1QYP A;  3G6E 1;  2GTI A;  1Y8C A;  2WAQ A;  3HKZ A;  3NDJ A;  1USP B;  3G71 Z;  1YIJ 1;  1K9M 2;  2VUG A;  1K73 1;  4NFR A;  3GTM I;  1VQ7 1;  2V3V A;  5C4J I;  2IZ3 A;  4NBF A;  1Z03 A;  4A3L I;  1YI2 1;  2QRE B;  3D6W A;  4TNU A;  3I4N I;  3HOY I;  2E2J I;  3FKI I;  3CCL Z;  4E2X A;  1VQM Z;  3H0G I;  3KIH A;  2R7Z I;  1YJN Z;  1QF8 A;  1Q82 2;  1NP6 A;  5C4X I;  1TWG I;  1Y1W I;  1YJW Z;  3J80 b;  1VQ8 Z;  2LEX A;  1ZH1 A;  3S1M I;  1ZB8 A;  3IF8 A;  5LL6 f;  3GKQ A;  1RLY A;  2AYD A;  3VTN A;  1R9T I;  1RO0 A;  3GCF A;  2VPY A;  4MRI A;  5AN9 F;  3PO3 S;  1VQL 1;  3CC7 Z;  4NBC A;  3IX0 A;  3CPW Z;  1Q16 A;  1YIT Z;  4NBH A;  3MZL B;  4A3K I;  1VQ6 1;  3GTM S;  2JA6 I;  2JA7 I;  3CD6 1;  2E2H I;  3S2H I;  5D1P A;  3S1R I;  3PO2 I;  3G4S 1;  2OTJ Z;  3CCJ 1;  1YHQ Z;  1JWH C;  5D1O B;  1SFO I;  1VQO 1;  3CCU 1;  4A93 I;  2NVY I;  5D1O A;  3CCE Z;  1NUI A;  3RZO I;  4MD8 A;  4BY1 I;  2GTH A;  1VQK Z;  5A2Q b;  2RHB A;  5T64 A;  1Q81 2;  5T6B A;  3LUS A;  1QVF Z;  4NB8 A;  1VQ9 Z;  2KI7 B;  1K83 I;  4E2W A;  1S72 Z;  2JIQ A;  4HGZ A;  3NFZ A;  4MD7 A;  4A3B I;  2QLV B;  1TFI A;  2EGT A;  1I3Q I;  3CXC Y;  3CME 1;  2VPZ A;  2JIM A;  4RV9 A;  2NVQ I;  3S2D I;  3Q87 A;  3FQQ A;  2Q4Z A;  3K7A I;  1Q7Y 1;  3NDI A;  1YIT 1;  1M90 1;  3GTQ I;  3J81 f;  1Y1V I;  1KD1 2;  1VQ7 Z;  1RNI A;  2OOY B;  4NB9 A;  2F4O A;  3G6E Z;  1LQL A;  1YI2 Z;  3G4S Z;  3I4M I;  1Q86 2;  1WJ2 A;  2O4H A;  2QKD A;  4Y7N I;  3CMA Z;  3QWU A;  1YHQ 1;  2JR6 A;  2OTL Z;  1FDI A;  3CXC Z;  1P9N A;  3S1N I;  4A3J I;  2V8I A;  4HGY A;  2I3C A;  3GTL I;  3P5J B;  3CCL 1;  3IR7 A;  1K8A 2;  3J80 f;  3CCM 1;  1KQS Z;  2BJO A;  2NVX I;  3CC4 Z;  4A3D I;  1JJ2 Z;  3NH8 A;  3BG1 B;  1VQ4 Z;  3IFU A;  3RZD I;  2JIO A;  1VQ9 1;  2JNY A;  5FLX b;  4RVD A;  1WCM I;  1W2B Z;  1USP A;  1QVF Y;  4QTU A;  1Q86 1;  2QRC B;  4E30 A;  4A3G I;  3U50 C;  5T67 A;  3I07 A;  2JA5 I;  3D9X A;  3BG0 B;  2JIR A;  4XX2 A;  4A3M I;  2PMZ A;  1M1K 2;  2R93 I;  2G2K A;  2M48 A;  4A3E I;  1AA6 A;  2QEX Z;  2NAP A;  2OOX B;  3MON A;  3CCS Z;  3CC7 1;  4BBS I;  1Q82 1;  1KD1 1;  1Z01 A;  3CCV 1;  4RS4 A;  3EED A;  3M3Y I;  1VQ6 Z;  3I56 Z;  1DL6 A;  3CC2 1;  2DE6 A;  5IT9 f;  3NH4 A;  4E33 A;  3MZK B;  3CCM Z;  3CCE 1;  2JIP A;  3J7A 4;  3G71 1;  1KQS Y;  3HOX I;  2M6N A;  2PM9 A;  3OW2 Z;  2B63 I;  2PK7 A;  1VQ4 1;  1M1K 1;  5C3E I;  2K5R A;  3GTJ I;  4E31 A;  1N8R 1;  4BY7 I;  1RQF A;  5CM2 M;  1Z02 A;  1VQM 1;  3TDH B;  4MON A;  3VMH A;  4A3C I;  1X0T A;  2J6A A;  5IT9 b;  2IV2 X;  1VQ5 1;  2VPX A;  1NJI 2;  1QVG Y;  2KPI A;  3TE5 B;  2P28 A;  2V45 A;  2LIY A;  1VLA A;  1X3W A;  1WII A;  1YJ9 1;  3M4O I;  3CME Z;  3CCR Z;  2V8K A;  4E2Y A;  2F4M A;  3JAM f;  4A3I I;  4RVH A;  4NH1 C;  2DE5 A;  2W03 A;  1X3Z A;  4E2Z A;  1Q81 1;  1K9M 1;  4CL1 A;  5C44 I;  2YU9 I;  3CMA 1;  3H3V J;  2QA4 1;  1KC8 1;  4QTT A;  2JMO A;  3PO3 I;  2WB1 A;  3VMG A;  4NBB A;  3CD6 Z;  1VQP 1;  1K8A 1;  2IZ4 A;  2JA8 I;  3HOU I;  2RT9 A;  3CCQ Z;  3I55 1;  3S16 I;  2V8J A;  3JAM b;  2VPW A;  4DK1 A;  2E2I I;  2VF1 A;  2E9H A;  1YIJ Z;  2NVT I;  2HF1 A;  1M90 2;  2RBL A;  4MH4 A;  2P3Y A;  2OTJ 1;  4RVF A;  1S7M A;  1N8R 2;  3CCJ Z;  2VUM I;  2LFU A;  5IP9 I;  1I50 I;  4RVG A;  3HOZ I;  3S15 I;  3CCU Z;  1TWA I;  4MD9 A;  2AKL A;  1JJ2 Y;  1YUA A;  2O53 A;  2HU9 A;  2JS4 A;  3F3F C;  4BXX I;  1KRL A;  2DE7 A;  3HOW I;  2R92 I;  1I6H I;  2QEX 1;  2GU2 A;  1FDO A;  4X6A I;  3GTG I;  1Q7Y 2;  2Y0S A;  3CQZ I;  3S14 I;  1VQN Z;  2QRD B;  1VQ8 1;  3GTO I;  3D2L A;  1WW9 A;  1WZN A;  2W04 A; 
#chains in the Genus database with same CATH homology
 2RIQ A;  1YJN 1;  1ML8 A;  3CC2 Z;  1VQP Z;  3CCS 1;  3HOV I;  2K3R A;  1YUK A;  3NH5 A;  2OTL 1;  3OW2 Y;  1QVG Z;  3GTP I;  3FQM A;  2RPR A;  4DGL A;  4A3F I;  5FLX f;  3GTK I;  1NJI 1;  4NBD A;  3EER A;  1VQL Z;  1ZB9 A;  4AYB A;  3F3P C;  3ESW A;  1TWF I;  2QR1 B;  4NBE A;  4DQY B;  3CC4 1;  4HH4 A;  1VQ5 Z;  3KIF A;  2R6M A;  1Y1V S;  1VQO Z;  4BBR I;  4MXU A;  3S17 I;  2JUB A;  3VMI A;  4EWC A;  2OZK A;  4NBG A;  5A2Q f;  1TWH I;  1YJ9 Z;  4NBA A;  5FLM I;  1RO4 A;  4E32 A;  2Q51 A;  1VQN 1;  2YAD A;  1L1O C;  3T4N B;  1KC8 2;  1K73 2;  1N2F A;  3CCR 1;  1RO2 A;  1PFT A;  1VQK 1;  3VB9 A;  3S1Q I;  2H85 A;  3CCQ 1;  3I55 Z;  1YJW 1;  3CCV Z;  3CPW Y;  2QA4 Z;  2ZAE B;  1S72 1;  3J81 b;  3I56 1;  1TWC I;  5IP7 I;  1W2B Y;  4Y52 I;  4NOZ A;  4S1T A;  1QYP A;  3G6E 1;  2GTI A;  2WAQ A;  3HKZ A;  3NDJ A;  1USP B;  3G71 Z;  1YIJ 1;  1K9M 2;  1K73 1;  2VUG A;  4NFR A;  3GTM I;  1VQ7 1;  5C4J I;  2IZ3 A;  4NBF A;  1Z03 A;  4A3L I;  1YI2 1;  2QRE B;  3D6W A;  4TNU A;  3I4N I;  3HOY I;  2E2J I;  3FKI I;  3CCL Z;  4E2X A;  1VQM Z;  3H0G I;  3KIH A;  2R7Z I;  1YJN Z;  1QF8 A;  1Q82 2;  1NP6 A;  5C4X I;  1TWG I;  1Y1W I;  1YJW Z;  3J80 b;  1VQ8 Z;  1ZH1 A;  3S1M I;  1ZB8 A;  3IF8 A;  5LL6 f;  3GKQ A;  1RLY A;  3VTN A;  1R9T I;  1RO0 A;  3GCF A;  4MRI A;  5AN9 F;  3PO3 S;  1VQL 1;  3CC7 Z;  4NBC A;  3IX0 A;  3CPW Z;  1YIT Z;  4NBH A;  3MZL B;  4A3K I;  1VQ6 1;  3GTM S;  2JA6 I;  2JA7 I;  3CD6 1;  2E2H I;  3S2H I;  5D1P A;  3S1R I;  3PO2 I;  3G4S 1;  2OTJ Z;  3CCJ 1;  1YHQ Z;  1JWH C;  5D1O B;  1SFO I;  1VQO 1;  3CCU 1;  4A93 I;  2NVY I;  5D1O A;  3CCE Z;  1NUI A;  3RZO I;  4MD8 A;  4BY1 I;  2GTH A;  1VQK Z;  5A2Q b;  2RHB A;  5T64 A;  1Q81 2;  5T6B A;  3LUS A;  1QVF Z;  4NB8 A;  1VQ9 Z;  2KI7 B;  1K83 I;  4E2W A;  1S72 Z;  4HGZ A;  3NFZ A;  4MD7 A;  4A3B I;  2QLV B;  1TFI A;  2EGT A;  1I3Q I;  3CXC Y;  3CME 1;  4RV9 A;  2NVQ I;  3S2D I;  3Q87 A;  3FQQ A;  2Q4Z A;  3K7A I;  1Q7Y 1;  3NDI A;  1YIT 1;  1M90 1;  3GTQ I;  3J81 f;  1Y1V I;  1KD1 2;  1VQ7 Z;  1RNI A;  2OOY B;  4NB9 A;  2F4O A;  3G6E Z;  1LQL A;  1YI2 Z;  3G4S Z;  3I4M I;  1Q86 2;  2QKD A;  2O4H A;  1YHQ 1;  4Y7N I;  3CMA Z;  3QWU A;  2OTL Z;  2JR6 A;  3CXC Z;  1P9N A;  3S1N I;  4A3J I;  2V8I A;  4HGY A;  2I3C A;  3GTL I;  3P5J B;  3CCL 1;  1K8A 2;  3J80 f;  3CCM 1;  1KQS Z;  2BJO A;  2NVX I;  3CC4 Z;  4A3D I;  1JJ2 Z;  3NH8 A;  3BG1 B;  1VQ4 Z;  3IFU A;  3RZD I;  1VQ9 1;  2JNY A;  5FLX b;  4RVD A;  1WCM I;  1W2B Z;  1USP A;  1QVF Y;  4QTU A;  1Q86 1;  2QRC B;  4E30 A;  4A3G I;  3U50 C;  5T67 A;  3I07 A;  2JA5 I;  3D9X A;  3BG0 B;  4XX2 A;  4A3M I;  2PMZ A;  1M1K 2;  2R93 I;  2G2K A;  2M48 A;  4A3E I;  2QEX Z;  2OOX B;  3MON A;  3CCS Z;  3CC7 1;  4BBS I;  1Q82 1;  1KD1 1;  1Z01 A;  3CCV 1;  4RS4 A;  3EED A;  3M3Y I;  1VQ6 Z;  3I56 Z;  1DL6 A;  3CC2 1;  2DE6 A;  5IT9 f;  3NH4 A;  4E33 A;  3MZK B;  3CCM Z;  3CCE 1;  3J7A 4;  3G71 1;  1KQS Y;  3HOX I;  2M6N A;  2PM9 A;  3OW2 Z;  2B63 I;  2PK7 A;  1VQ4 1;  1M1K 1;  5C3E I;  2K5R A;  3GTJ I;  4E31 A;  1N8R 1;  4BY7 I;  1RQF A;  5CM2 M;  1Z02 A;  1VQM 1;  3TDH B;  4MON A;  3VMH A;  4A3C I;  1X0T A;  2J6A A;  5IT9 b;  1VQ5 1;  1NJI 2;  1QVG Y;  2KPI A;  3TE5 B;  2P28 A;  2LIY A;  1VLA A;  1X3W A;  1WII A;  1YJ9 1;  3M4O I;  3CME Z;  3CCR Z;  2V8K A;  4E2Y A;  2F4M A;  3JAM f;  4A3I I;  4RVH A;  4NH1 C;  2DE5 A;  2W03 A;  1X3Z A;  4E2Z A;  1Q81 1;  1K9M 1;  4CL1 A;  5C44 I;  2YU9 I;  3CMA 1;  3H3V J;  2QA4 1;  1KC8 1;  4QTT A;  2JMO A;  3PO3 I;  2WB1 A;  3VMG A;  4NBB A;  3CD6 Z;  1VQP 1;  1K8A 1;  2IZ4 A;  2JA8 I;  3HOU I;  2RT9 A;  3CCQ Z;  3I55 1;  3S16 I;  2V8J A;  3JAM b;  4DK1 A;  2E2I I;  2VF1 A;  2E9H A;  1YIJ Z;  2NVT I;  2HF1 A;  1M90 2;  2RBL A;  4MH4 A;  2P3Y A;  2OTJ 1;  4RVF A;  1S7M A;  1N8R 2;  3CCJ Z;  2VUM I;  2LFU A;  5IP9 I;  1I50 I;  4RVG A;  3HOZ I;  3S15 I;  3CCU Z;  1TWA I;  4MD9 A;  2AKL A;  1JJ2 Y;  1YUA A;  2O53 A;  2HU9 A;  2JS4 A;  3F3F C;  4BXX I;  1KRL A;  2DE7 A;  3HOW I;  2R92 I;  1I6H I;  2QEX 1;  2GU2 A;  4X6A I;  3GTG I;  1Q7Y 2;  2Y0S A;  3CQZ I;  3S14 I;  1VQN Z;  2QRD B;  1VQ8 1;  3GTO I;  1WW9 A;  2W04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...