2R7ZI

Cisplatin lesion containing rna polymerase ii elongation complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*CP*TP*TP*GUP*CP*CP*CP*TP*CP*CP*TP*CP*AP*T)-3'
publication title Mechanism of transcriptional stalling at cisplatin-damaged DNA.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r7zI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r7zI02
2NVXI 1TWHI 1N2FA 2R92I 4Y52I 5IP7I 1USPA 4A3LI 2JA8I 4BBSI 3GTOI 2K5RA 1TWFI 3VMHA 5IP9I 4A3EI 2BJOA 4A3BI 1X3WA 2VUMI 3GTGI 3S16I 3PO2I 2DE6A 5C3EI 3H3VJ 2F4MA 4BY7I 4A3GI 3HOYI 3ESWA 2JA7I 3U50C 4A3II 4NB9A 3S1RI 2E2II 3D6WA 3S17I 2JS4A 3HOUI 5C4JI 3GTMI 4NBGA 2AKLA 2PK7A 3HOVI 2DE7A 4BBRI 3S15I 1I3QI 4NBEA 1YUAA 3M3YI 4NBHA 4BY1I 3K7AI 1TWAI 1DL6A 4A3MI 2E2JI 1I6HI 1ML8A 3GTPI 2R93I 1QYPA 3VMGA 2F4OA 4BXXI 3H0GI 3GTKI 3S14I 1Y1VI 4NBDA 5CM2M 1RLYA 4Y7NI 2DE5A 1ZB9A 3PO3I 3M4OI 2R7ZI 3I07A 4NBCA 1WCMI 5FLMI 3S1NI 1LQLA 2P3YA 3GKQA 3VMIA 2KPIA 1L1OC 3GTMS 2JA5I 5C4XI 1ZB8A 3S1MI 3CQZI 4QTUA 4NB8A 1TWGI 4A93I 2YU9I 4A3KI 3GTLI 3I4MI 4NBAA 3LUSA 2B63I 2JR6A 4A3JI 3GCFA 1PFTA 1TFIA 3EERA 1SFOI 1USPB 3Q87A 2JNYA 1VLAA 4NOZA 3HOXI 1NUIA 3S2HI 4A3CI 1RO4A 2E2HI 4XX2A 3RZOI 1Y1VS 3VB9A 3GTJI 1Y1WI 4MH4A 3HOWI 1X3ZA 2RBLA 2NVQI 3PO3S 5C44I 4QTTA 3S1QI 3HOZI 4NBBA 2JA6I 4NBFA 3S2DI 1TWCI 1R9TI 4A3DI 1K83I 3FKII 2HF1A 3RZDI 2J6AA 1WW9A 3GTQI 1I50I 4X6AI 4A3FI 2NVYI 2NVTI 3I4NI
chains in the Genus database with same CATH superfamily
1VQL1 2NVXI 2O53A 3CCUZ 4Y52I 4MD9A 4RVFA 3CC4Z 5IP7I 5D1PA 4A3LI 3FQMA 1VQ4Z 3GTOI 2QLVB 1TWFI 2JIMA 4A3EI 1M1K1 4A3BI 1RNIA 2VUMI 3PO2I 2O4HA 3CC7Z 5IT9f 3NH4A 3HOYI 2IV2X 2IZ4A 2JA7I 2YADA 3U50C 3CPWZ 2M48A 3S17I 2JS4A 2V45A 3GTMI 2OTJZ 4NBGA 2QA4Z 1W2BY 1QVFY 3S15I 3J80f 2E9HA 3G711 3CCS1 1YJN1 1K9M2 1ML8A 2R93I 3HKZA 1QYPA 1VQ51 4BXXI 3H0GI 4E32A 3CCRZ 4NBDA 1RO0A 3MZKB 2DE5A 2QKDA 3M4OI 3CC41 1VQOZ 3I561 4NBCA 4RVDA 1Q861 1VQ41 4RVHA 2M6NA 1VQMZ 2E7ZA 3NDJA 1Q7Y1 2P3YA 3CCMZ 3G4SZ 1QXFA 1NJI1 5C4XI 3S1MI 3CC71 4NB8A 3LUSA 2JIPA 5A2Qb 3CCVZ 4A3JI 2ZAEB 2OTJ1 2JIQA 2QA41 1TFIA 3EERA 3T4NB 3JAMb 1SFOI 1USPB 3Q87A 4MONA 1VQLZ 1S7MA 3J81b 1FDIA 3S2HI 2E2HI 2OOYB 4XX2A 3VB9A 1VQN1 2IZ3A 2V8JA 2VF1A 3HOWI 4MH4A 1X3ZA 2RBLA 1JWHC 3CCL1 3NDIA 5LL6f 3CCR1 1R9TI 2LFUA 2V8KA 1KQSZ 3FKII 2JMOA 2KI7B 4HGZA 3GTQI 4X6AI 2NVTI 4DQYB 1TWHI 2RIQA 2R92I 1K9M1 3G6E1 1K732 1RO2A 2VPWA 2W03A 2K5RA 3G71Z 1VQPZ 1KRLA 2BJOA 4RV9A 3CCSZ 2F4MA 3CCV1 3IX0A 4A3II 1SIWA 3HOUI 3CCQ1 1YJ9Z 2AKLA 2PK7A 3HOVI 3D9XA 5D1OA 2AYDA 3I56Z 2QRCB 1YUAA 3VTNA 3K7AI 5IT9b 1TWAI 1I6HI 1JJ2Y 2OTLZ 2GU2A 2EGTA 3CME1 2QREB 4Y7NI 3OW2Z 1X0TA 3J80b 1ZB9A 1QF8A 1WIIA 3NFZA 2K3RA 1Z02A 4MRIA 3F3FC 3CXCY 1VQP1 4TNUA 1VQNZ 1N8R2 1L1OC 3EEDA 5FLXf 4S1TA 3CQZI 4QTUA 2G2KA 1TWGI 3I551 4NBAA 3CCLZ 2QEX1 1K731 1KC82 3GCFA 2LEXA 4E2YA 1YJ91 1PFTA 3IFUA 1K8A2 2JNYA 4NOZA 3HOXI 1NUIA 4A3CI 1RO4A 1Y1VS 3GTJI 3CC2Z 3G6EZ 1ZH1A 2Q51A 2OOXB 1W2BZ 1QVFZ 2VPYA 2OTL1 4MD7A 4QTTA 5AN9F 4NBBA 3NH8A 3CCEZ 4NBFA 3CMA1 1TWCI 2VPXA 3S2DI 3CD6Z 2J6AA 2WAQA 2NVYI 4CL1A 1N2FA 1Q822 1QVGY 2OZKA 3CCQZ 1USPA 3QWUA 2JA8I 5IP9I 1X3WA 3S16I 1VQ9Z 2DE6A 4A3GI 2VUGA 2E2II 2JIOA 3D6WA 3CMEZ 5C4JI 1N8R1 3F3PC 3CC21 1YIJ1 3M3YI 1S72Z 3KIFA 4BY1I 1KC81 1DL6A 4A3MI 2E2JI 3CCE1 1K8A1 3IR7A 2PM9A 2RPRA 3CD61 3VMGA 4E33A 3S14I 2V8IA 1Y1VI 4DK1A 5CM2M 3BG0B 3I55Z 1RLYA 2QEXZ 3P5JB 2P28A 3J7A4 4E2XA 1NP6A 4HGYA 1YIT1 3CCJ1 3I07A 4EWCA 2RT9A 3TE5B 1YJW1 3NH5A 3IF8A 1LQLA 3VMIA 3GKQA 2W04A 2KPIA 3FQQA 3CPWY 2V3VA 5T64A 1VQ91 1AA6A 1Q821 2WB1A 4A93I 2YU9I 2GTHA 3I4MI 2Y0SA 3CMAZ 1WJ2A 2JR6A 4HH4A 1VQ61 1Z01A 1YHQ1 5D1OB 1VQK1 1VLAA 3RZOI 5FLXb 1S721 1Y1WI 3PO3S 3S1QI 3HOZI 2JA6I 2JIRA 4A3DI 1K83I 2HF1A 2JUBA 1VQ8Z 1JJ2Z 1YUKA 4MXUA 2R6MA 3MZLB 5T6BA 1P9NA 4BBSI 3TDHB 1WZNA 2GTIA 2HU9A 2QRDB 3VMHA 2LIYA 1YIJZ 4NFRA 1FDOA 1VQ71 3GTGI 3CXCZ 3H3VJ 5C3EI 4BY7I 2QR1B 3ESWA 4NB9A 4RS4A 3S1RI 1RQFA 4E2ZA 3CCU1 3BG1B 4DGLA 2DE7A 4E30A 4E2WA 4BBRI 2NAPA 1YITZ 1KD12 3CCJZ 1Q812 1I3QI 4NBEA 4NBHA 1YI2Z 1M901 1YJWZ 1KQSY 3KIHA 3GTPI 2VPZA 2F4OA 4E31A 3GTKI 1Y8CA 1VQ81 1M1K2 1VQ6Z 3PO3I 2R7ZI 5A2Qf 1YHQZ 1VQKZ 1Q16A 2PMZA 1WCMI 3MONA 5FLMI 4RVGA 3S1NI 3JAMf 1QVGZ 4AYBA 3J81f 3GTMS 2JA5I 1ZB8A 4A3KI 3GTLI 2I3CA 2B63I 2H85A 3D2LA 1VQO1 1VQM1 4NH1C 1Z03A 3CCM1 4MD8A 1YI21 3G4S1 2RHBA 2NVQI 5C44I 3OW2Y 1YJNZ 1Q862 1VQ7Z 1Q7Y2 1VQ5Z 5T67A 3RZDI 1KD11 1WW9A 1I50I 2Q4ZA 1Q811 1M902 4A3FI 3I4NI 1NJI2
chains in the Genus database with same CATH topology
1VQL1 2NVXI 2O53A 3CCUZ 4Y52I 4MD9A 4RVFA 3CC4Z 5IP7I 5D1PA 4A3LI 3FQMA 1VQ4Z 3GTOI 2QLVB 1TWFI 4A3EI 1M1K1 4A3BI 1RNIA 2VUMI 3PO2I 2O4HA 3CC7Z 5IT9f 3NH4A 3HOYI 2IZ4A 2JA7I 2YADA 3U50C 3CPWZ 2M48A 3S17I 2JS4A 3GTMI 2OTJZ 4NBGA 2QA4Z 1W2BY 1QVFY 3S15I 3J80f 2E9HA 3G711 3CCS1 1YJN1 1K9M2 1ML8A 2R93I 3HKZA 1QYPA 1VQ51 4BXXI 3H0GI 4E32A 3CCRZ 4NBDA 1RO0A 3MZKB 2DE5A 2QKDA 3M4OI 3CC41 1VQOZ 3I561 4NBCA 4RVDA 1Q861 1VQ41 4RVHA 2M6NA 1VQMZ 3NDJA 1Q7Y1 2P3YA 3CCMZ 3G4SZ 1NJI1 5C4XI 3S1MI 3CC71 4NB8A 3LUSA 5A2Qb 3CCVZ 4A3JI 2ZAEB 2OTJ1 2QA41 1TFIA 3EERA 3T4NB 3JAMb 1SFOI 1USPB 3Q87A 4MONA 1VQLZ 1S7MA 3J81b 3S2HI 2E2HI 2OOYB 4XX2A 3VB9A 1VQN1 2IZ3A 2V8JA 2VF1A 3HOWI 4MH4A 1X3ZA 2RBLA 1JWHC 3CCL1 3NDIA 5LL6f 3CCR1 1R9TI 2LFUA 2V8KA 1KQSZ 3FKII 2JMOA 2KI7B 4HGZA 3GTQI 4X6AI 2NVTI 4DQYB 1TWHI 2RIQA 2R92I 1K9M1 3G6E1 1K732 1RO2A 2W03A 2K5RA 3G71Z 1VQPZ 1KRLA 2BJOA 4RV9A 3CCSZ 2F4MA 3CCV1 3IX0A 4A3II 3HOUI 3CCQ1 1YJ9Z 2AKLA 2PK7A 3HOVI 3D9XA 5D1OA 3I56Z 2QRCB 1YUAA 3VTNA 3K7AI 5IT9b 1TWAI 1I6HI 1JJ2Y 2OTLZ 2GU2A 2EGTA 3CME1 2QREB 4Y7NI 3OW2Z 1X0TA 3J80b 1ZB9A 1QF8A 1WIIA 3NFZA 2K3RA 1Z02A 4MRIA 3F3FC 3CXCY 1VQP1 4TNUA 1VQNZ 1N8R2 1L1OC 3EEDA 5FLXf 4S1TA 3CQZI 4QTUA 2G2KA 1TWGI 3I551 4NBAA 3CCLZ 2QEX1 1K731 1KC82 3GCFA 1YJ91 4E2YA 1PFTA 3IFUA 1K8A2 2JNYA 4NOZA 3HOXI 1NUIA 4A3CI 1RO4A 1Y1VS 3GTJI 3CC2Z 3G6EZ 1ZH1A 2Q51A 2OOXB 1W2BZ 1QVFZ 2OTL1 4MD7A 4QTTA 5AN9F 4NBBA 3NH8A 3CCEZ 4NBFA 3CMA1 1TWCI 3S2DI 3CD6Z 2J6AA 2WAQA 2NVYI 4CL1A 1N2FA 1Q822 1QVGY 2OZKA 3CCQZ 1USPA 3QWUA 2JA8I 5IP9I 1X3WA 3S16I 1VQ9Z 2DE6A 4A3GI 2VUGA 2E2II 3D6WA 3CMEZ 5C4JI 1N8R1 3F3PC 3CC21 1YIJ1 3M3YI 1S72Z 3KIFA 4BY1I 1KC81 1DL6A 4A3MI 2E2JI 3CCE1 1K8A1 2PM9A 2RPRA 3CD61 3VMGA 4E33A 3S14I 2V8IA 1Y1VI 4DK1A 5CM2M 3BG0B 3I55Z 1RLYA 2QEXZ 3P5JB 2P28A 3J7A4 4E2XA 1NP6A 4HGYA 1YIT1 3CCJ1 3I07A 4EWCA 2RT9A 3TE5B 1YJW1 3NH5A 3IF8A 1LQLA 3VMIA 3GKQA 2W04A 2KPIA 3FQQA 3CPWY 5T64A 1VQ91 1Q821 2WB1A 4A93I 2YU9I 2GTHA 3I4MI 2Y0SA 3CMAZ 2JR6A 4HH4A 1VQ61 1Z01A 1YHQ1 5D1OB 1VQK1 1VLAA 3RZOI 5FLXb 1S721 1Y1WI 3PO3S 3S1QI 3HOZI 2JA6I 4A3DI 1K83I 2HF1A 2JUBA 1VQ8Z 1JJ2Z 1YUKA 4MXUA 2R6MA 3MZLB 5T6BA 1P9NA 4BBSI 3TDHB 2GTIA 2QRDB 2HU9A 3VMHA 2LIYA 1YIJZ 4NFRA 1VQ71 3GTGI 3CXCZ 3H3VJ 5C3EI 4BY7I 2QR1B 3ESWA 4NB9A 4RS4A 3S1RI 1RQFA 4E2ZA 3CCU1 3BG1B 4DGLA 2DE7A 4E30A 4E2WA 4BBRI 1YITZ 1KD12 3CCJZ 1Q812 1I3QI 4NBEA 4NBHA 1YI2Z 1M901 1YJWZ 1KQSY 3KIHA 3GTPI 2F4OA 4E31A 3GTKI 1VQ81 1M1K2 1VQ6Z 3PO3I 2R7ZI 5A2Qf 1YHQZ 1VQKZ 2PMZA 1WCMI 3MONA 5FLMI 4RVGA 3S1NI 3JAMf 1QVGZ 4AYBA 3J81f 3GTMS 2JA5I 1ZB8A 4A3KI 3GTLI 2I3CA 2B63I 2H85A 1VQO1 1VQM1 4NH1C 1Z03A 3CCM1 4MD8A 1YI21 3G4S1 2RHBA 2NVQI 5C44I 3OW2Y 1YJNZ 1Q862 1VQ7Z 1Q7Y2 1VQ5Z 5T67A 3RZDI 1KD11 1WW9A 1I50I 2Q4ZA 1Q811 1M902 4A3FI 3I4NI 1NJI2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVX I;  1TWH I;  1N2F A;  2R92 I;  4Y52 I;  5IP7 I;  1USP A;  4A3L I;  2JA8 I;  4BBS I;  3GTO I;  2K5R A;  1TWF I;  3VMH A;  5IP9 I;  4A3E I;  2BJO A;  4A3B I;  1X3W A;  2VUM I;  3GTG I;  3S16 I;  3PO2 I;  2DE6 A;  5C3E I;  3H3V J;  2F4M A;  4BY7 I;  4A3G I;  3HOY I;  3ESW A;  2JA7 I;  3U50 C;  4A3I I;  4NB9 A;  3S1R I;  2E2I I;  3D6W A;  3S17 I;  2JS4 A;  3HOU I;  5C4J I;  3GTM I;  4NBG A;  2AKL A;  2PK7 A;  3HOV I;  2DE7 A;  4BBR I;  3S15 I;  1I3Q I;  4NBE A;  1YUA A;  3M3Y I;  4NBH A;  4BY1 I;  3K7A I;  1TWA I;  1DL6 A;  4A3M I;  2E2J I;  1I6H I;  1ML8 A;  3GTP I;  2R93 I;  1QYP A;  3VMG A;  2F4O A;  4BXX I;  3H0G I;  3GTK I;  3S14 I;  1Y1V I;  4NBD A;  5CM2 M;  1RLY A;  4Y7N I;  2DE5 A;  1ZB9 A;  3PO3 I;  3M4O I;  2R7Z I;  3I07 A;  4NBC A;  1WCM I;  5FLM I;  3S1N I;  1LQL A;  2P3Y A;  3GKQ A;  3VMI A;  2KPI A;  1L1O C;  3GTM S;  2JA5 I;  5C4X I;  1ZB8 A;  3S1M I;  3CQZ I;  4QTU A;  4NB8 A;  1TWG I;  4A93 I;  2YU9 I;  4A3K I;  3GTL I;  3I4M I;  4NBA A;  3LUS A;  2B63 I;  2JR6 A;  4A3J I;  3GCF A;  1PFT A;  1TFI A;  3EER A;  1SFO I;  1USP B;  3Q87 A;  2JNY A;  1VLA A;  4NOZ A;  3HOX I;  1NUI A;  3S2H I;  4A3C I;  1RO4 A;  2E2H I;  4XX2 A;  3RZO I;  1Y1V S;  3VB9 A;  3GTJ I;  1Y1W I;  4MH4 A;  3HOW I;  1X3Z A;  2RBL A;  2NVQ I;  3PO3 S;  5C44 I;  4QTT A;  3S1Q I;  3HOZ I;  4NBB A;  2JA6 I;  4NBF A;  3S2D I;  1TWC I;  1R9T I;  4A3D I;  1K83 I;  3FKI I;  2HF1 A;  3RZD I;  2J6A A;  1WW9 A;  3GTQ I;  1I50 I;  4X6A I;  4A3F I;  2NVY I;  2NVT I;  3I4N I; 
#chains in the Genus database with same CATH topology
 1VQL 1;  2NVX I;  2O53 A;  3CCU Z;  4Y52 I;  4MD9 A;  4RVF A;  3CC4 Z;  5IP7 I;  5D1P A;  4A3L I;  3FQM A;  1VQ4 Z;  3GTO I;  2QLV B;  1TWF I;  2JIM A;  4A3E I;  1M1K 1;  4A3B I;  1RNI A;  2VUM I;  3PO2 I;  2O4H A;  3CC7 Z;  5IT9 f;  3NH4 A;  3HOY I;  2IV2 X;  2IZ4 A;  2JA7 I;  2YAD A;  3U50 C;  3CPW Z;  2M48 A;  3S17 I;  2JS4 A;  2V45 A;  3GTM I;  2OTJ Z;  4NBG A;  2QA4 Z;  1W2B Y;  1QVF Y;  3S15 I;  3J80 f;  2E9H A;  3G71 1;  3CCS 1;  1YJN 1;  1K9M 2;  1ML8 A;  2R93 I;  3HKZ A;  1QYP A;  1VQ5 1;  4BXX I;  3H0G I;  4E32 A;  3CCR Z;  4NBD A;  1RO0 A;  3MZK B;  2DE5 A;  2QKD A;  3M4O I;  3CC4 1;  1VQO Z;  3I56 1;  4NBC A;  4RVD A;  1Q86 1;  1VQ4 1;  4RVH A;  2M6N A;  1VQM Z;  2E7Z A;  3NDJ A;  1Q7Y 1;  2P3Y A;  3CCM Z;  3G4S Z;  1QXF A;  1NJI 1;  5C4X I;  3S1M I;  3CC7 1;  4NB8 A;  3LUS A;  2JIP A;  5A2Q b;  3CCV Z;  4A3J I;  2ZAE B;  2OTJ 1;  2JIQ A;  2QA4 1;  1TFI A;  3EER A;  3T4N B;  3JAM b;  1SFO I;  1USP B;  3Q87 A;  4MON A;  1VQL Z;  1S7M A;  3J81 b;  1FDI A;  3S2H I;  2E2H I;  2OOY B;  4XX2 A;  3VB9 A;  1VQN 1;  2IZ3 A;  2V8J A;  2VF1 A;  3HOW I;  4MH4 A;  1X3Z A;  2RBL A;  1JWH C;  3CCL 1;  3NDI A;  5LL6 f;  3CCR 1;  1R9T I;  2LFU A;  2V8K A;  1KQS Z;  3FKI I;  2JMO A;  2KI7 B;  4HGZ A;  3GTQ I;  4X6A I;  2NVT I;  4DQY B;  1TWH I;  2RIQ A;  2R92 I;  1K9M 1;  3G6E 1;  1K73 2;  1RO2 A;  2VPW A;  2W03 A;  2K5R A;  3G71 Z;  1VQP Z;  1KRL A;  2BJO A;  4RV9 A;  3CCS Z;  2F4M A;  3CCV 1;  3IX0 A;  4A3I I;  1SIW A;  3HOU I;  3CCQ 1;  1YJ9 Z;  2AKL A;  2PK7 A;  3HOV I;  3D9X A;  5D1O A;  2AYD A;  3I56 Z;  2QRC B;  1YUA A;  3VTN A;  3K7A I;  5IT9 b;  1TWA I;  1I6H I;  1JJ2 Y;  2OTL Z;  2GU2 A;  2EGT A;  3CME 1;  2QRE B;  4Y7N I;  3OW2 Z;  1X0T A;  3J80 b;  1ZB9 A;  1QF8 A;  1WII A;  3NFZ A;  2K3R A;  1Z02 A;  4MRI A;  3F3F C;  3CXC Y;  1VQP 1;  4TNU A;  1VQN Z;  1N8R 2;  1L1O C;  3EED A;  5FLX f;  4S1T A;  3CQZ I;  4QTU A;  2G2K A;  1TWG I;  3I55 1;  4NBA A;  3CCL Z;  2QEX 1;  1K73 1;  1KC8 2;  3GCF A;  2LEX A;  4E2Y A;  1YJ9 1;  1PFT A;  3IFU A;  1K8A 2;  2JNY A;  4NOZ A;  3HOX I;  1NUI A;  4A3C I;  1RO4 A;  1Y1V S;  3GTJ I;  3CC2 Z;  3G6E Z;  1ZH1 A;  2Q51 A;  2OOX B;  1W2B Z;  1QVF Z;  2VPY A;  2OTL 1;  4MD7 A;  4QTT A;  5AN9 F;  4NBB A;  3NH8 A;  3CCE Z;  4NBF A;  3CMA 1;  1TWC I;  2VPX A;  3S2D I;  3CD6 Z;  2J6A A;  2WAQ A;  2NVY I;  4CL1 A;  1N2F A;  1Q82 2;  1QVG Y;  2OZK A;  3CCQ Z;  1USP A;  3QWU A;  2JA8 I;  5IP9 I;  1X3W A;  3S16 I;  1VQ9 Z;  2DE6 A;  4A3G I;  2VUG A;  2E2I I;  2JIO A;  3D6W A;  3CME Z;  5C4J I;  1N8R 1;  3F3P C;  3CC2 1;  1YIJ 1;  3M3Y I;  1S72 Z;  3KIF A;  4BY1 I;  1KC8 1;  1DL6 A;  4A3M I;  2E2J I;  3CCE 1;  1K8A 1;  3IR7 A;  2PM9 A;  2RPR A;  3CD6 1;  3VMG A;  4E33 A;  3S14 I;  2V8I A;  1Y1V I;  4DK1 A;  5CM2 M;  3BG0 B;  3I55 Z;  1RLY A;  2QEX Z;  3P5J B;  2P28 A;  3J7A 4;  4E2X A;  1NP6 A;  4HGY A;  1YIT 1;  3CCJ 1;  3I07 A;  4EWC A;  2RT9 A;  3TE5 B;  1YJW 1;  3NH5 A;  3IF8 A;  1LQL A;  3VMI A;  3GKQ A;  2W04 A;  2KPI A;  3FQQ A;  3CPW Y;  2V3V A;  5T64 A;  1VQ9 1;  1AA6 A;  1Q82 1;  2WB1 A;  4A93 I;  2YU9 I;  2GTH A;  3I4M I;  2Y0S A;  3CMA Z;  1WJ2 A;  2JR6 A;  4HH4 A;  1VQ6 1;  1Z01 A;  1YHQ 1;  5D1O B;  1VQK 1;  1VLA A;  3RZO I;  5FLX b;  1S72 1;  1Y1W I;  3PO3 S;  3S1Q I;  3HOZ I;  2JA6 I;  2JIR A;  4A3D I;  1K83 I;  2HF1 A;  2JUB A;  1VQ8 Z;  1JJ2 Z;  1YUK A;  4MXU A;  2R6M A;  3MZL B;  5T6B A;  1P9N A;  4BBS I;  3TDH B;  1WZN A;  2GTI A;  2HU9 A;  2QRD B;  3VMH A;  2LIY A;  1YIJ Z;  4NFR A;  1FDO A;  1VQ7 1;  3GTG I;  3CXC Z;  3H3V J;  5C3E I;  4BY7 I;  2QR1 B;  3ESW A;  4NB9 A;  4RS4 A;  3S1R I;  1RQF A;  4E2Z A;  3CCU 1;  3BG1 B;  4DGL A;  2DE7 A;  4E30 A;  4E2W A;  4BBR I;  2NAP A;  1YIT Z;  1KD1 2;  3CCJ Z;  1Q81 2;  1I3Q I;  4NBE A;  4NBH A;  1YI2 Z;  1M90 1;  1YJW Z;  1KQS Y;  3KIH A;  3GTP I;  2VPZ A;  2F4O A;  4E31 A;  3GTK I;  1Y8C A;  1VQ8 1;  1M1K 2;  1VQ6 Z;  3PO3 I;  2R7Z I;  5A2Q f;  1YHQ Z;  1VQK Z;  1Q16 A;  2PMZ A;  1WCM I;  3MON A;  5FLM I;  4RVG A;  3S1N I;  3JAM f;  1QVG Z;  4AYB A;  3J81 f;  3GTM S;  2JA5 I;  1ZB8 A;  4A3K I;  3GTL I;  2I3C A;  2B63 I;  2H85 A;  3D2L A;  1VQO 1;  1VQM 1;  4NH1 C;  1Z03 A;  3CCM 1;  4MD8 A;  1YI2 1;  3G4S 1;  2RHB A;  2NVQ I;  5C44 I;  3OW2 Y;  1YJN Z;  1Q86 2;  1VQ7 Z;  1Q7Y 2;  1VQ5 Z;  5T67 A;  3RZD I;  1KD1 1;  1WW9 A;  1I50 I;  2Q4Z A;  1Q81 1;  1M90 2;  4A3F I;  3I4N I;  1NJI 2; 
#chains in the Genus database with same CATH homology
 1VQL 1;  2NVX I;  2O53 A;  3CCU Z;  4Y52 I;  4MD9 A;  4RVF A;  3CC4 Z;  5IP7 I;  5D1P A;  4A3L I;  3FQM A;  1VQ4 Z;  3GTO I;  2QLV B;  1TWF I;  4A3E I;  1M1K 1;  4A3B I;  1RNI A;  2VUM I;  3PO2 I;  2O4H A;  3CC7 Z;  5IT9 f;  3NH4 A;  3HOY I;  2IZ4 A;  2JA7 I;  2YAD A;  3U50 C;  3CPW Z;  2M48 A;  3S17 I;  2JS4 A;  3GTM I;  2OTJ Z;  4NBG A;  2QA4 Z;  1W2B Y;  1QVF Y;  3S15 I;  3J80 f;  2E9H A;  3G71 1;  3CCS 1;  1YJN 1;  1K9M 2;  1ML8 A;  2R93 I;  3HKZ A;  1QYP A;  1VQ5 1;  4BXX I;  3H0G I;  4E32 A;  3CCR Z;  4NBD A;  1RO0 A;  3MZK B;  2DE5 A;  2QKD A;  3M4O I;  3CC4 1;  1VQO Z;  3I56 1;  4NBC A;  4RVD A;  1Q86 1;  1VQ4 1;  4RVH A;  2M6N A;  1VQM Z;  3NDJ A;  1Q7Y 1;  2P3Y A;  3CCM Z;  3G4S Z;  1NJI 1;  5C4X I;  3S1M I;  3CC7 1;  4NB8 A;  3LUS A;  5A2Q b;  3CCV Z;  4A3J I;  2ZAE B;  2OTJ 1;  2QA4 1;  1TFI A;  3EER A;  3T4N B;  3JAM b;  1SFO I;  1USP B;  3Q87 A;  4MON A;  1VQL Z;  1S7M A;  3J81 b;  3S2H I;  2E2H I;  2OOY B;  4XX2 A;  3VB9 A;  1VQN 1;  2IZ3 A;  2V8J A;  2VF1 A;  3HOW I;  4MH4 A;  1X3Z A;  2RBL A;  1JWH C;  3CCL 1;  3NDI A;  5LL6 f;  3CCR 1;  1R9T I;  2LFU A;  2V8K A;  1KQS Z;  3FKI I;  2JMO A;  2KI7 B;  4HGZ A;  3GTQ I;  4X6A I;  2NVT I;  4DQY B;  1TWH I;  2RIQ A;  2R92 I;  1K9M 1;  3G6E 1;  1K73 2;  1RO2 A;  2W03 A;  2K5R A;  3G71 Z;  1VQP Z;  1KRL A;  2BJO A;  4RV9 A;  3CCS Z;  2F4M A;  3CCV 1;  3IX0 A;  4A3I I;  3HOU I;  3CCQ 1;  1YJ9 Z;  2AKL A;  2PK7 A;  3HOV I;  3D9X A;  5D1O A;  3I56 Z;  2QRC B;  1YUA A;  3VTN A;  3K7A I;  5IT9 b;  1TWA I;  1I6H I;  1JJ2 Y;  2OTL Z;  2GU2 A;  2EGT A;  3CME 1;  2QRE B;  4Y7N I;  3OW2 Z;  1X0T A;  3J80 b;  1ZB9 A;  1QF8 A;  1WII A;  3NFZ A;  2K3R A;  1Z02 A;  4MRI A;  3F3F C;  3CXC Y;  1VQP 1;  4TNU A;  1VQN Z;  1N8R 2;  1L1O C;  3EED A;  5FLX f;  4S1T A;  3CQZ I;  4QTU A;  2G2K A;  1TWG I;  3I55 1;  4NBA A;  3CCL Z;  2QEX 1;  1K73 1;  1KC8 2;  3GCF A;  1YJ9 1;  4E2Y A;  1PFT A;  3IFU A;  1K8A 2;  2JNY A;  4NOZ A;  3HOX I;  1NUI A;  4A3C I;  1RO4 A;  1Y1V S;  3GTJ I;  3CC2 Z;  3G6E Z;  1ZH1 A;  2Q51 A;  2OOX B;  1W2B Z;  1QVF Z;  2OTL 1;  4MD7 A;  4QTT A;  5AN9 F;  4NBB A;  3NH8 A;  3CCE Z;  4NBF A;  3CMA 1;  1TWC I;  3S2D I;  3CD6 Z;  2J6A A;  2WAQ A;  2NVY I;  4CL1 A;  1N2F A;  1Q82 2;  1QVG Y;  2OZK A;  3CCQ Z;  1USP A;  3QWU A;  2JA8 I;  5IP9 I;  1X3W A;  3S16 I;  1VQ9 Z;  2DE6 A;  4A3G I;  2VUG A;  2E2I I;  3D6W A;  3CME Z;  5C4J I;  1N8R 1;  3F3P C;  3CC2 1;  1YIJ 1;  3M3Y I;  1S72 Z;  3KIF A;  4BY1 I;  1KC8 1;  1DL6 A;  4A3M I;  2E2J I;  3CCE 1;  1K8A 1;  2PM9 A;  2RPR A;  3CD6 1;  3VMG A;  4E33 A;  3S14 I;  2V8I A;  1Y1V I;  4DK1 A;  5CM2 M;  3BG0 B;  3I55 Z;  1RLY A;  2QEX Z;  3P5J B;  2P28 A;  3J7A 4;  4E2X A;  1NP6 A;  4HGY A;  1YIT 1;  3CCJ 1;  3I07 A;  4EWC A;  2RT9 A;  3TE5 B;  1YJW 1;  3NH5 A;  3IF8 A;  1LQL A;  3VMI A;  3GKQ A;  2W04 A;  2KPI A;  3FQQ A;  3CPW Y;  5T64 A;  1VQ9 1;  1Q82 1;  2WB1 A;  4A93 I;  2YU9 I;  2GTH A;  3I4M I;  2Y0S A;  3CMA Z;  2JR6 A;  4HH4 A;  1VQ6 1;  1Z01 A;  1YHQ 1;  5D1O B;  1VQK 1;  1VLA A;  3RZO I;  5FLX b;  1S72 1;  1Y1W I;  3PO3 S;  3S1Q I;  3HOZ I;  2JA6 I;  4A3D I;  1K83 I;  2HF1 A;  2JUB A;  1VQ8 Z;  1JJ2 Z;  1YUK A;  4MXU A;  2R6M A;  3MZL B;  5T6B A;  1P9N A;  4BBS I;  3TDH B;  2GTI A;  2QRD B;  2HU9 A;  3VMH A;  2LIY A;  1YIJ Z;  4NFR A;  1VQ7 1;  3GTG I;  3CXC Z;  3H3V J;  5C3E I;  4BY7 I;  2QR1 B;  3ESW A;  4NB9 A;  4RS4 A;  3S1R I;  1RQF A;  4E2Z A;  3CCU 1;  3BG1 B;  4DGL A;  2DE7 A;  4E30 A;  4E2W A;  4BBR I;  1YIT Z;  1KD1 2;  3CCJ Z;  1Q81 2;  1I3Q I;  4NBE A;  4NBH A;  1YI2 Z;  1M90 1;  1YJW Z;  1KQS Y;  3KIH A;  3GTP I;  2F4O A;  4E31 A;  3GTK I;  1VQ8 1;  1M1K 2;  1VQ6 Z;  3PO3 I;  2R7Z I;  5A2Q f;  1YHQ Z;  1VQK Z;  2PMZ A;  1WCM I;  3MON A;  5FLM I;  4RVG A;  3S1N I;  3JAM f;  1QVG Z;  4AYB A;  3J81 f;  3GTM S;  2JA5 I;  1ZB8 A;  4A3K I;  3GTL I;  2I3C A;  2B63 I;  2H85 A;  1VQO 1;  1VQM 1;  4NH1 C;  1Z03 A;  3CCM 1;  4MD8 A;  1YI2 1;  3G4S 1;  2RHB A;  2NVQ I;  5C44 I;  3OW2 Y;  1YJN Z;  1Q86 2;  1VQ7 Z;  1Q7Y 2;  1VQ5 Z;  5T67 A;  3RZD I;  1KD1 1;  1WW9 A;  1I50 I;  2Q4Z A;  1Q81 1;  1M90 2;  4A3F I;  3I4N I;  1NJI 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...