2R7ZI

Cisplatin lesion containing rna polymerase ii elongation complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna-rna hybrid
molecule keywords 5'-D(*TP*AP*CP*TP*TP*GUP*CP*CP*CP*TP*CP*CP*TP*CP*AP*T)-3'
publication title Mechanism of transcriptional stalling at cisplatin-damaged DNA.
pubmed doi rcsb
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r7zI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r7zI02
3S1MI 5FLMI 2HF1A 2F4MA 5CM2M 2JA6I 1LQLA 4NB9A 4NBBA 2E2II 1N2FA 2PK7A 1L1OC 4A3MI 5C3EI 2JA5I 4A3BI 3S2HI 1X3ZA 3LUSA 2YU9I 3Q87A 2J6AA 3PO2I 3EERA 5IP7I 3GTMS 4A3DI 4NBEA 3S15I 2NVQI 2DE6A 1TWHI 3HOZI 3VMGA 3PO3I 3GTOI 3GTPI 1RO4A 1ZB8A 1Y1VI 2DE7A 1I50I 2JNYA 4X6AI 3GTJI 4BBRI 2RBLA 2E2HI 4Y7NI 3S14I 1I6HI 3GTLI 3HOWI 5C4JI 3RZOI 2NVYI 3S1NI 1I3QI 3HOXI 3M4OI 5C4XI 3S17I 1YUAA 2VUMI 1NUIA 4A3GI 4NBHA 3HOYI 4NBFA 2NVTI 3GTMI 2R7ZI 3S1RI 3GTGI 2JS4A 1RLYA 3RZDI 1WCMI 3GCFA 2K5RA 1TFIA 1Y1WI 1QYPA 2DE5A 3S2DI 3S16I 2F4OA 1TWCI 3D6WA 3H3VJ 1USPB 3GTQI 4NBGA 2R92I 1TWAI 4A3II 4A93I 3HOUI 4BY1I 3FKII 2JR6A 2KPIA 4NBDA 1WW9A 3GKQA 4MH4A 4A3FI 4QTUA 3CQZI 1TWFI 5C44I 2B63I 1Y1VS 1PFTA 3K7AI 2E2JI 3M3YI 2P3YA 4A3EI 4BBSI 2JA7I 3GTKI 1DL6A 1X3WA 3VMIA 3HOVI 1USPA 3H0GI 4BY7I 3I07A 2JA8I 4BXXI 2R93I 1ZB9A 3I4NI 2BJOA 3ESWA 4QTTA 1TWGI 4Y52I 4A3CI 4A3JI 2AKLA 2NVXI 4NB8A 3VMHA 1K83I 4A3KI 3I4MI 3U50C 1VLAA 4NBCA 5IP9I 3VB9A 4NBAA 4A3LI 3S1QI 1SFOI 1ML8A 4NOZA 3PO3S 1R9TI 4XX2A
chains in the Genus database with same CATH superfamily
3CPWY 2OOXB 3JAMb 3KIFA 1JJ2Z 4NB9A 4E32A 4E2WA 4NBBA 1N2FA 2PK7A 2ZAEB 1Q812 3CCUZ 2Q4ZA 1VQ6Z 3CCEZ 5IT9b 1KQSY 4RV9A 1S72Z 2JA5I 5LL6f 1RQFA 1VQN1 3J81b 3EERA 2E9HA 3F3PC 1RO2A 4NBEA 3HOZI 3VMGA 1N8R1 2GTIA 1RO0A 3CC4Z 3CCQZ 1VQPZ 3GTPI 1ZB8A 1Y1VI 2DE7A 3J81f 1I50I 2JNYA 2OZKA 3GTJI 4BBRI 4Y7NI 3OW2Z 1M1K2 5T6BA 2IZ4A 5FLXb 2GU2A 5C4JI 3CC7Z 3VTNA 4E33A 1KD11 2VUMI 1NUIA 2KI7B 1KC81 3CMAZ 3HOYI 3FQMA 4NBFA 4MXUA 4RVGA 1AA6A 3S1RI 3CD6Z 3NH5A 1YIT1 1RLYA 2Y0SA 1M901 1WCMI 1VQ8Z 1VQ91 3CCM1 2VF1A 1YIJ1 1TWCI 1M1K1 1USPB 2QRDB 1ZH1A 4NBGA 1SIWA 1TWAI 4HGZA 3CCV1 3HOUI 2I3CA 2YADA 3FKII 5T67A 4S1TA 3NFZA 1FDOA 1VQKZ 4CL1A 1PFTA 3M3YI 3G711 3IX0A 1YUKA 1VQ7Z 1DL6A 4BY7I 2PMZA 1YJW1 2JA8I 1ZB9A 1YJNZ 3EEDA 4NFRA 3ESWA 3J80b 3IFUA 4A3JI 3J80f 5IP9I 1VQLZ 4NBAA 3S1QI 1SFOI 1FDIA 1R9TI 4DK1A 4XX2A 3S1MI 5FLMI 2F4MA 1Q7Y1 2V8KA 3I551 5A2Qb 3G4SZ 1WJ2A 4EWCA 4DGLA 2JIQA 1VQ4Z 5A2Qf 4E2YA 1JJ2Y 3TE5B 3LUSA 1QF8A 2QEXZ 2O53A 1QVFZ 3Q87A 3CC2Z 3PO2I 5D1OB 2HU9A 3KIHA 4MD8A 3S15I 2OTJ1 3CCJZ 3MZLB 3T4NB 4E2ZA 1RO4A 3CCRZ 2V8IA 3MZKB 2VUGA 2RBLA 2VPWA 3CCL1 1YI21 4RVFA 3GTLI 3NH8A 2OTLZ 3JAMf 1VQ51 1W2BZ 1Q862 3HOWI 2NVYI 1KD12 3S17I 2IZ3A 1KC82 3OW2Y 3CCS1 5IT9f 2R7ZI 1WZNA 2JIRA 3GTGI 3J7A4 3RZDI 3D9XA 1M902 3CXCZ 2WAQA 2K5RA 2OOYB 1Y1WI 2VPZA 1QYPA 3S16I 2F4OA 2NAPA 4HGYA 1K8A2 4MONA 1VQM1 1Q861 3P5JB 2M6NA 3IF8A 5FLXf 2P28A 5D1PA 2B63I 1TWFI 2E7ZA 2W03A 5C44I 1YJ91 3K7AI 4BBSI 1YHQZ 1VQNZ 2AYDA 1QXFA 3HOVI 4HH4A 4MRIA 3I561 3I07A 2VPXA 4E30A 2R93I 3I4NI 1K9M1 1NJI2 1K8A1 3HKZA 3CME1 2NVXI 4NB8A 3VMHA 3I4MI 2RHBA 1VLAA 1Z03A 1Q16A 1ML8A 2M48A 3PO3S 3QWUA 2JIMA 2HF1A 5CM2M 2V45A 2JA6I 1Q7Y2 1LQLA 2JIOA 2QRCB 4AYBA 2RIQA 4A3MI 2QA41 1NJI1 5C3EI 1YITZ 3NDIA 4A3BI 3S2HI 2YU9I 3BG0B 1VQ9Z 2J6AA 3CCMZ 1VQO1 5IP7I 3GTMS 2DE6A 1TWHI 3FQQA 3PO3I 4RS4A 1QVFY 1Z02A 4X6AI 4NH1C 2G2KA 2E2HI 3CCVZ 3S14I 1I6HI 1S7MA 3G6E1 3BG1B 3CCR1 3S1NI 1I3QI 1YUAA 4A3GI 3G71Z 4NBHA 4RVHA 1W2BY 2NVTI 1YJWZ 3GTMI 2RT9A 3CCU1 1VQ61 3CCE1 4E2XA 1S721 1Q821 2V3VA 2LIYA 1QVGY 3GCFA 1TFIA 1RNIA 2DE5A 3S2DI 1Y8CA 3D6WA 2LEXA 1Z01A 3CC41 3CCQ1 1VQP1 4TNUA 3CXCY 2R92I 2LFUA 4A93I 2WB1A 2K3RA 3I55Z 3F3FC 4A3FI 1QVGZ 3CC71 4QTUA 2JIPA 1Y1VS 4A3EI 4MD7A 1X0TA 3CMA1 1USPA 3H0GI 3CD61 4BXXI 3IR7A 2BJOA 1K9M2 2H85A 2V8JA 2OTJZ 4QTTA 1YHQ1 2RPRA 4Y52I 4A3CI 1VQ81 1K83I 3CPWZ 3TDHB 4NBCA 3CCLZ 3VB9A 1YI2Z 2R6MA 1K731 4NOZA 2VPYA 1VQ5Z 2QREB 1JWHC 1KQSZ 4RVDA 2E2II 1VQK1 3CCSZ 1Q811 1L1OC 2QKDA 1KRLA 1X3ZA 1VQ71 2GTHA 4A3DI 1YJN1 1P9NA 4MD9A 2NVQI 3GTOI 1VQMZ 1VQL1 2QLVB 3RZOI 3HOXI 5T64A 2IV2X 1YJ9Z 5D1OA 5C4XI 3M4OI 3NH4A 5AN9F 2EGTA 3G4S1 3I56Z 1VQ41 2JMOA 4E31A 1YIJZ 2JS4A 1Q822 3D2LA 3CMEZ 2QEX1 2JUBA 1NP6A 3CC21 3CCJ1 3H3VJ 3GTQI 2PM9A 4A3II 2W04A 4BY1I 2JR6A 2KPIA 4NBDA 1WW9A 3GKQA 4MH4A 2OTL1 1WIIA 3CQZI 2E2JI 2QA4Z 2P3YA 2JA7I 3GTKI 1X3WA 2O4HA 3VMIA 3NDJA 1VQOZ 4DQYB 1TWGI 2AKLA 4A3KI 3U50C 4A3LI 1K732 1N8R2 3MONA 2Q51A 2QR1B 3G6EZ
chains in the Genus database with same CATH topology
3CPWY 2OOXB 3JAMb 3KIFA 1JJ2Z 4NB9A 4E32A 4E2WA 4NBBA 1N2FA 2PK7A 2ZAEB 1Q812 3CCUZ 2Q4ZA 1VQ6Z 3CCEZ 5IT9b 1KQSY 4RV9A 1S72Z 2JA5I 5LL6f 1RQFA 1VQN1 3J81b 3EERA 2E9HA 3F3PC 1RO2A 4NBEA 3HOZI 3VMGA 1N8R1 2GTIA 1RO0A 3CC4Z 3CCQZ 1VQPZ 3GTPI 1ZB8A 1Y1VI 2DE7A 3J81f 1I50I 2JNYA 2OZKA 3GTJI 4BBRI 4Y7NI 3OW2Z 1M1K2 5T6BA 2IZ4A 5FLXb 2GU2A 5C4JI 3CC7Z 3VTNA 4E33A 1KD11 2VUMI 1NUIA 2KI7B 1KC81 3CMAZ 3HOYI 3FQMA 4NBFA 4MXUA 4RVGA 3CD6Z 3S1RI 3NH5A 1YIT1 1RLYA 2Y0SA 1M901 1WCMI 1VQ8Z 1VQ91 3CCM1 2VF1A 1YIJ1 1TWCI 1M1K1 1USPB 2QRDB 1ZH1A 4NBGA 1TWAI 4HGZA 3CCV1 3HOUI 2I3CA 2YADA 3FKII 5T67A 4S1TA 3NFZA 1VQKZ 4CL1A 1PFTA 3M3YI 3G711 3IX0A 1YUKA 1VQ7Z 1DL6A 4BY7I 2PMZA 1YJW1 2JA8I 1ZB9A 1YJNZ 3EEDA 4NFRA 3ESWA 3J80b 3IFUA 4A3JI 3J80f 5IP9I 1VQLZ 4NBAA 3S1QI 1SFOI 1R9TI 4DK1A 4XX2A 3S1MI 5FLMI 2F4MA 1Q7Y1 2V8KA 3I551 5A2Qb 3G4SZ 4EWCA 4DGLA 1VQ4Z 5A2Qf 4E2YA 1JJ2Y 3TE5B 3LUSA 1QF8A 2QEXZ 2O53A 1QVFZ 3Q87A 3CC2Z 3PO2I 5D1OB 2HU9A 3KIHA 4MD8A 3S15I 2OTJ1 3CCJZ 3MZLB 3T4NB 4E2ZA 1RO4A 3CCRZ 2V8IA 3MZKB 2VUGA 2RBLA 3CCL1 1YI21 4RVFA 3GTLI 3NH8A 2OTLZ 3JAMf 1VQ51 1W2BZ 1Q862 3HOWI 2NVYI 1KD12 3S17I 2IZ3A 1KC82 3OW2Y 3CCS1 5IT9f 2R7ZI 3GTGI 3J7A4 3RZDI 3D9XA 1M902 3CXCZ 2WAQA 2K5RA 2OOYB 1Y1WI 1QYPA 3S16I 2F4OA 4HGYA 1K8A2 4MONA 1VQM1 1Q861 3P5JB 2M6NA 3IF8A 5FLXf 2P28A 5D1PA 2B63I 1TWFI 5C44I 2W03A 1YJ91 3K7AI 4BBSI 1YHQZ 1VQNZ 3HOVI 4HH4A 4MRIA 3I561 3I07A 4E30A 2R93I 3I4NI 1K9M1 1NJI2 1K8A1 3HKZA 3CME1 2NVXI 4NB8A 3VMHA 3I4MI 2RHBA 1VLAA 1Z03A 1ML8A 2M48A 3PO3S 3QWUA 2HF1A 5CM2M 2JA6I 1Q7Y2 1LQLA 2QRCB 4AYBA 2RIQA 4A3MI 2QA41 1NJI1 5C3EI 1YITZ 3NDIA 4A3BI 3S2HI 2YU9I 3BG0B 1VQ9Z 2J6AA 3CCMZ 1VQO1 5IP7I 3GTMS 2DE6A 1TWHI 3FQQA 3PO3I 4RS4A 1QVFY 1Z02A 4X6AI 4NH1C 2G2KA 2E2HI 3CCVZ 3S14I 1I6HI 1S7MA 3G6E1 3BG1B 3CCR1 3S1NI 1I3QI 1YUAA 4A3GI 3G71Z 4NBHA 4RVHA 1W2BY 2NVTI 1YJWZ 3GTMI 2RT9A 3CCU1 1VQ61 3CCE1 4E2XA 1S721 1Q821 2LIYA 1QVGY 3GCFA 1TFIA 1RNIA 2DE5A 3S2DI 3D6WA 1Z01A 3CC41 3CCQ1 1VQP1 4TNUA 3CXCY 2R92I 2LFUA 4A93I 2WB1A 2K3RA 3I55Z 3F3FC 4A3FI 1QVGZ 3CC71 4QTUA 1Y1VS 4A3EI 4MD7A 1X0TA 3CMA1 1USPA 3H0GI 3CD61 4BXXI 2BJOA 1K9M2 2H85A 2V8JA 2OTJZ 4QTTA 1YHQ1 2RPRA 4Y52I 4A3CI 1VQ81 1K83I 3CPWZ 3TDHB 4NBCA 3CCLZ 3VB9A 1YI2Z 2R6MA 1K731 4NOZA 1VQ5Z 2QREB 1JWHC 1KQSZ 4RVDA 2E2II 1VQK1 3CCSZ 1Q811 1L1OC 2QKDA 1KRLA 1X3ZA 1VQ71 2GTHA 4A3DI 1YJN1 1P9NA 4MD9A 2NVQI 3GTOI 1VQMZ 1VQL1 2QLVB 3RZOI 3HOXI 5T64A 1YJ9Z 5D1OA 5C4XI 3M4OI 3NH4A 5AN9F 2EGTA 3G4S1 3I56Z 1VQ41 2JMOA 4E31A 1YIJZ 2JS4A 1Q822 3CMEZ 2QEX1 2JUBA 1NP6A 3CC21 3CCJ1 3H3VJ 3GTQI 2PM9A 4A3II 2W04A 4BY1I 2JR6A 2KPIA 4NBDA 1WW9A 3GKQA 4MH4A 2OTL1 1WIIA 3CQZI 2E2JI 2QA4Z 2P3YA 2JA7I 3GTKI 1X3WA 2O4HA 3VMIA 3NDJA 1VQOZ 4DQYB 1TWGI 2AKLA 4A3KI 3U50C 4A3LI 1K732 1N8R2 3MONA 2Q51A 2QR1B 3G6EZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1M I;  5FLM I;  2HF1 A;  2F4M A;  5CM2 M;  2JA6 I;  1LQL A;  4NB9 A;  4NBB A;  2E2I I;  1N2F A;  2PK7 A;  1L1O C;  4A3M I;  5C3E I;  2JA5 I;  4A3B I;  3S2H I;  1X3Z A;  3LUS A;  2YU9 I;  3Q87 A;  2J6A A;  3PO2 I;  3EER A;  5IP7 I;  3GTM S;  4A3D I;  4NBE A;  3S15 I;  2NVQ I;  2DE6 A;  1TWH I;  3HOZ I;  3VMG A;  3PO3 I;  3GTO I;  3GTP I;  1RO4 A;  1ZB8 A;  1Y1V I;  2DE7 A;  1I50 I;  2JNY A;  4X6A I;  3GTJ I;  4BBR I;  2RBL A;  2E2H I;  4Y7N I;  3S14 I;  1I6H I;  3GTL I;  3HOW I;  5C4J I;  3RZO I;  2NVY I;  3S1N I;  1I3Q I;  3HOX I;  3M4O I;  5C4X I;  3S17 I;  1YUA A;  2VUM I;  1NUI A;  4A3G I;  4NBH A;  3HOY I;  4NBF A;  2NVT I;  3GTM I;  2R7Z I;  3S1R I;  3GTG I;  2JS4 A;  1RLY A;  3RZD I;  1WCM I;  3GCF A;  2K5R A;  1TFI A;  1Y1W I;  1QYP A;  2DE5 A;  3S2D I;  3S16 I;  2F4O A;  1TWC I;  3D6W A;  3H3V J;  1USP B;  3GTQ I;  4NBG A;  2R92 I;  1TWA I;  4A3I I;  4A93 I;  3HOU I;  4BY1 I;  3FKI I;  2JR6 A;  2KPI A;  4NBD A;  1WW9 A;  3GKQ A;  4MH4 A;  4A3F I;  4QTU A;  3CQZ I;  1TWF I;  5C44 I;  2B63 I;  1Y1V S;  1PFT A;  3K7A I;  2E2J I;  3M3Y I;  2P3Y A;  4A3E I;  4BBS I;  2JA7 I;  3GTK I;  1DL6 A;  1X3W A;  3VMI A;  3HOV I;  1USP A;  3H0G I;  4BY7 I;  3I07 A;  2JA8 I;  4BXX I;  2R93 I;  1ZB9 A;  3I4N I;  2BJO A;  3ESW A;  4QTT A;  1TWG I;  4Y52 I;  4A3C I;  4A3J I;  2AKL A;  2NVX I;  4NB8 A;  3VMH A;  1K83 I;  4A3K I;  3I4M I;  3U50 C;  1VLA A;  4NBC A;  5IP9 I;  3VB9 A;  4NBA A;  4A3L I;  3S1Q I;  1SFO I;  1ML8 A;  4NOZ A;  3PO3 S;  1R9T I;  4XX2 A; 
#chains in the Genus database with same CATH topology
 3CPW Y;  2OOX B;  3JAM b;  3KIF A;  1JJ2 Z;  4NB9 A;  4E32 A;  4E2W A;  4NBB A;  1N2F A;  2PK7 A;  2ZAE B;  1Q81 2;  3CCU Z;  2Q4Z A;  1VQ6 Z;  3CCE Z;  5IT9 b;  1KQS Y;  4RV9 A;  1S72 Z;  2JA5 I;  5LL6 f;  1RQF A;  1VQN 1;  3J81 b;  3EER A;  2E9H A;  3F3P C;  1RO2 A;  4NBE A;  3HOZ I;  3VMG A;  1N8R 1;  2GTI A;  1RO0 A;  3CC4 Z;  3CCQ Z;  1VQP Z;  3GTP I;  1ZB8 A;  1Y1V I;  2DE7 A;  3J81 f;  1I50 I;  2JNY A;  2OZK A;  3GTJ I;  4BBR I;  4Y7N I;  3OW2 Z;  1M1K 2;  5T6B A;  2IZ4 A;  5FLX b;  2GU2 A;  5C4J I;  3CC7 Z;  3VTN A;  4E33 A;  1KD1 1;  2VUM I;  1NUI A;  2KI7 B;  1KC8 1;  3CMA Z;  3HOY I;  3FQM A;  4NBF A;  4MXU A;  4RVG A;  1AA6 A;  3S1R I;  3CD6 Z;  3NH5 A;  1YIT 1;  1RLY A;  2Y0S A;  1M90 1;  1WCM I;  1VQ8 Z;  1VQ9 1;  3CCM 1;  2VF1 A;  1YIJ 1;  1TWC I;  1M1K 1;  1USP B;  2QRD B;  1ZH1 A;  4NBG A;  1SIW A;  1TWA I;  4HGZ A;  3CCV 1;  3HOU I;  2I3C A;  2YAD A;  3FKI I;  5T67 A;  4S1T A;  3NFZ A;  1FDO A;  1VQK Z;  4CL1 A;  1PFT A;  3M3Y I;  3G71 1;  3IX0 A;  1YUK A;  1VQ7 Z;  1DL6 A;  4BY7 I;  2PMZ A;  1YJW 1;  2JA8 I;  1ZB9 A;  1YJN Z;  3EED A;  4NFR A;  3ESW A;  3J80 b;  3IFU A;  4A3J I;  3J80 f;  5IP9 I;  1VQL Z;  4NBA A;  3S1Q I;  1SFO I;  1FDI A;  1R9T I;  4DK1 A;  4XX2 A;  3S1M I;  5FLM I;  2F4M A;  1Q7Y 1;  2V8K A;  3I55 1;  5A2Q b;  3G4S Z;  1WJ2 A;  4EWC A;  4DGL A;  2JIQ A;  1VQ4 Z;  5A2Q f;  4E2Y A;  1JJ2 Y;  3TE5 B;  3LUS A;  1QF8 A;  2QEX Z;  2O53 A;  1QVF Z;  3Q87 A;  3CC2 Z;  3PO2 I;  5D1O B;  2HU9 A;  3KIH A;  4MD8 A;  3S15 I;  2OTJ 1;  3CCJ Z;  3MZL B;  3T4N B;  4E2Z A;  1RO4 A;  3CCR Z;  2V8I A;  3MZK B;  2VUG A;  2RBL A;  2VPW A;  3CCL 1;  1YI2 1;  4RVF A;  3GTL I;  3NH8 A;  2OTL Z;  3JAM f;  1VQ5 1;  1W2B Z;  1Q86 2;  3HOW I;  2NVY I;  1KD1 2;  3S17 I;  2IZ3 A;  1KC8 2;  3OW2 Y;  3CCS 1;  5IT9 f;  2R7Z I;  1WZN A;  2JIR A;  3GTG I;  3J7A 4;  3RZD I;  3D9X A;  1M90 2;  3CXC Z;  2WAQ A;  2K5R A;  2OOY B;  1Y1W I;  2VPZ A;  1QYP A;  3S16 I;  2F4O A;  2NAP A;  4HGY A;  1K8A 2;  4MON A;  1VQM 1;  1Q86 1;  3P5J B;  2M6N A;  3IF8 A;  5FLX f;  2P28 A;  5D1P A;  2B63 I;  1TWF I;  2E7Z A;  2W03 A;  5C44 I;  1YJ9 1;  3K7A I;  4BBS I;  1YHQ Z;  1VQN Z;  2AYD A;  1QXF A;  3HOV I;  4HH4 A;  4MRI A;  3I56 1;  3I07 A;  2VPX A;  4E30 A;  2R93 I;  3I4N I;  1K9M 1;  1NJI 2;  1K8A 1;  3HKZ A;  3CME 1;  2NVX I;  4NB8 A;  3VMH A;  3I4M I;  2RHB A;  1VLA A;  1Z03 A;  1Q16 A;  1ML8 A;  2M48 A;  3PO3 S;  3QWU A;  2JIM A;  2HF1 A;  5CM2 M;  2V45 A;  2JA6 I;  1Q7Y 2;  1LQL A;  2JIO A;  2QRC B;  4AYB A;  2RIQ A;  4A3M I;  2QA4 1;  1NJI 1;  5C3E I;  1YIT Z;  3NDI A;  4A3B I;  3S2H I;  2YU9 I;  3BG0 B;  1VQ9 Z;  2J6A A;  3CCM Z;  1VQO 1;  5IP7 I;  3GTM S;  2DE6 A;  1TWH I;  3FQQ A;  3PO3 I;  4RS4 A;  1QVF Y;  1Z02 A;  4X6A I;  4NH1 C;  2G2K A;  2E2H I;  3CCV Z;  3S14 I;  1I6H I;  1S7M A;  3G6E 1;  3BG1 B;  3CCR 1;  3S1N I;  1I3Q I;  1YUA A;  4A3G I;  3G71 Z;  4NBH A;  4RVH A;  1W2B Y;  2NVT I;  1YJW Z;  3GTM I;  2RT9 A;  3CCU 1;  1VQ6 1;  3CCE 1;  4E2X A;  1S72 1;  1Q82 1;  2V3V A;  2LIY A;  1QVG Y;  3GCF A;  1TFI A;  1RNI A;  2DE5 A;  3S2D I;  1Y8C A;  3D6W A;  2LEX A;  1Z01 A;  3CC4 1;  3CCQ 1;  1VQP 1;  4TNU A;  3CXC Y;  2R92 I;  2LFU A;  4A93 I;  2WB1 A;  2K3R A;  3I55 Z;  3F3F C;  4A3F I;  1QVG Z;  3CC7 1;  4QTU A;  2JIP A;  1Y1V S;  4A3E I;  4MD7 A;  1X0T A;  3CMA 1;  1USP A;  3H0G I;  3CD6 1;  4BXX I;  3IR7 A;  2BJO A;  1K9M 2;  2H85 A;  2V8J A;  2OTJ Z;  4QTT A;  1YHQ 1;  2RPR A;  4Y52 I;  4A3C I;  1VQ8 1;  1K83 I;  3CPW Z;  3TDH B;  4NBC A;  3CCL Z;  3VB9 A;  1YI2 Z;  2R6M A;  1K73 1;  4NOZ A;  2VPY A;  1VQ5 Z;  2QRE B;  1JWH C;  1KQS Z;  4RVD A;  2E2I I;  1VQK 1;  3CCS Z;  1Q81 1;  1L1O C;  2QKD A;  1KRL A;  1X3Z A;  1VQ7 1;  2GTH A;  4A3D I;  1YJN 1;  1P9N A;  4MD9 A;  2NVQ I;  3GTO I;  1VQM Z;  1VQL 1;  2QLV B;  3RZO I;  3HOX I;  5T64 A;  2IV2 X;  1YJ9 Z;  5D1O A;  5C4X I;  3M4O I;  3NH4 A;  5AN9 F;  2EGT A;  3G4S 1;  3I56 Z;  1VQ4 1;  2JMO A;  4E31 A;  1YIJ Z;  2JS4 A;  1Q82 2;  3D2L A;  3CME Z;  2QEX 1;  2JUB A;  1NP6 A;  3CC2 1;  3CCJ 1;  3H3V J;  3GTQ I;  2PM9 A;  4A3I I;  2W04 A;  4BY1 I;  2JR6 A;  2KPI A;  4NBD A;  1WW9 A;  3GKQ A;  4MH4 A;  2OTL 1;  1WII A;  3CQZ I;  2E2J I;  2QA4 Z;  2P3Y A;  2JA7 I;  3GTK I;  1X3W A;  2O4H A;  3VMI A;  3NDJ A;  1VQO Z;  4DQY B;  1TWG I;  2AKL A;  4A3K I;  3U50 C;  4A3L I;  1K73 2;  1N8R 2;  3MON A;  2Q51 A;  2QR1 B;  3G6E Z; 
#chains in the Genus database with same CATH homology
 3CPW Y;  2OOX B;  3JAM b;  3KIF A;  1JJ2 Z;  4NB9 A;  4E32 A;  4E2W A;  4NBB A;  1N2F A;  2PK7 A;  2ZAE B;  1Q81 2;  3CCU Z;  2Q4Z A;  1VQ6 Z;  3CCE Z;  5IT9 b;  1KQS Y;  4RV9 A;  1S72 Z;  2JA5 I;  5LL6 f;  1RQF A;  1VQN 1;  3J81 b;  3EER A;  2E9H A;  3F3P C;  1RO2 A;  4NBE A;  3HOZ I;  3VMG A;  1N8R 1;  2GTI A;  1RO0 A;  3CC4 Z;  3CCQ Z;  1VQP Z;  3GTP I;  1ZB8 A;  1Y1V I;  2DE7 A;  3J81 f;  1I50 I;  2JNY A;  2OZK A;  3GTJ I;  4BBR I;  4Y7N I;  3OW2 Z;  1M1K 2;  5T6B A;  2IZ4 A;  5FLX b;  2GU2 A;  5C4J I;  3CC7 Z;  3VTN A;  4E33 A;  1KD1 1;  2VUM I;  1NUI A;  2KI7 B;  1KC8 1;  3CMA Z;  3HOY I;  3FQM A;  4NBF A;  4MXU A;  4RVG A;  3CD6 Z;  3S1R I;  3NH5 A;  1YIT 1;  1RLY A;  2Y0S A;  1M90 1;  1WCM I;  1VQ8 Z;  1VQ9 1;  3CCM 1;  2VF1 A;  1YIJ 1;  1TWC I;  1M1K 1;  1USP B;  2QRD B;  1ZH1 A;  4NBG A;  1TWA I;  4HGZ A;  3CCV 1;  3HOU I;  2I3C A;  2YAD A;  3FKI I;  5T67 A;  4S1T A;  3NFZ A;  1VQK Z;  4CL1 A;  1PFT A;  3M3Y I;  3G71 1;  3IX0 A;  1YUK A;  1VQ7 Z;  1DL6 A;  4BY7 I;  2PMZ A;  1YJW 1;  2JA8 I;  1ZB9 A;  1YJN Z;  3EED A;  4NFR A;  3ESW A;  3J80 b;  3IFU A;  4A3J I;  3J80 f;  5IP9 I;  1VQL Z;  4NBA A;  3S1Q I;  1SFO I;  1R9T I;  4DK1 A;  4XX2 A;  3S1M I;  5FLM I;  2F4M A;  1Q7Y 1;  2V8K A;  3I55 1;  5A2Q b;  3G4S Z;  4EWC A;  4DGL A;  1VQ4 Z;  5A2Q f;  4E2Y A;  1JJ2 Y;  3TE5 B;  3LUS A;  1QF8 A;  2QEX Z;  2O53 A;  1QVF Z;  3Q87 A;  3CC2 Z;  3PO2 I;  5D1O B;  2HU9 A;  3KIH A;  4MD8 A;  3S15 I;  2OTJ 1;  3CCJ Z;  3MZL B;  3T4N B;  4E2Z A;  1RO4 A;  3CCR Z;  2V8I A;  3MZK B;  2VUG A;  2RBL A;  3CCL 1;  1YI2 1;  4RVF A;  3GTL I;  3NH8 A;  2OTL Z;  3JAM f;  1VQ5 1;  1W2B Z;  1Q86 2;  3HOW I;  2NVY I;  1KD1 2;  3S17 I;  2IZ3 A;  1KC8 2;  3OW2 Y;  3CCS 1;  5IT9 f;  2R7Z I;  3GTG I;  3J7A 4;  3RZD I;  3D9X A;  1M90 2;  3CXC Z;  2WAQ A;  2K5R A;  2OOY B;  1Y1W I;  1QYP A;  3S16 I;  2F4O A;  4HGY A;  1K8A 2;  4MON A;  1VQM 1;  1Q86 1;  3P5J B;  2M6N A;  3IF8 A;  5FLX f;  2P28 A;  5D1P A;  2B63 I;  1TWF I;  5C44 I;  2W03 A;  1YJ9 1;  3K7A I;  4BBS I;  1YHQ Z;  1VQN Z;  3HOV I;  4HH4 A;  4MRI A;  3I56 1;  3I07 A;  4E30 A;  2R93 I;  3I4N I;  1K9M 1;  1NJI 2;  1K8A 1;  3HKZ A;  3CME 1;  2NVX I;  4NB8 A;  3VMH A;  3I4M I;  2RHB A;  1VLA A;  1Z03 A;  1ML8 A;  2M48 A;  3PO3 S;  3QWU A;  2HF1 A;  5CM2 M;  2JA6 I;  1Q7Y 2;  1LQL A;  2QRC B;  4AYB A;  2RIQ A;  4A3M I;  2QA4 1;  1NJI 1;  5C3E I;  1YIT Z;  3NDI A;  4A3B I;  3S2H I;  2YU9 I;  3BG0 B;  1VQ9 Z;  2J6A A;  3CCM Z;  1VQO 1;  5IP7 I;  3GTM S;  2DE6 A;  1TWH I;  3FQQ A;  3PO3 I;  4RS4 A;  1QVF Y;  1Z02 A;  4X6A I;  4NH1 C;  2G2K A;  2E2H I;  3CCV Z;  3S14 I;  1I6H I;  1S7M A;  3G6E 1;  3BG1 B;  3CCR 1;  3S1N I;  1I3Q I;  1YUA A;  4A3G I;  3G71 Z;  4NBH A;  4RVH A;  1W2B Y;  2NVT I;  1YJW Z;  3GTM I;  2RT9 A;  3CCU 1;  1VQ6 1;  3CCE 1;  4E2X A;  1S72 1;  1Q82 1;  2LIY A;  1QVG Y;  3GCF A;  1TFI A;  1RNI A;  2DE5 A;  3S2D I;  3D6W A;  1Z01 A;  3CC4 1;  3CCQ 1;  1VQP 1;  4TNU A;  3CXC Y;  2R92 I;  2LFU A;  4A93 I;  2WB1 A;  2K3R A;  3I55 Z;  3F3F C;  4A3F I;  1QVG Z;  3CC7 1;  4QTU A;  1Y1V S;  4A3E I;  4MD7 A;  1X0T A;  3CMA 1;  1USP A;  3H0G I;  3CD6 1;  4BXX I;  2BJO A;  1K9M 2;  2H85 A;  2V8J A;  2OTJ Z;  4QTT A;  1YHQ 1;  2RPR A;  4Y52 I;  4A3C I;  1VQ8 1;  1K83 I;  3CPW Z;  3TDH B;  4NBC A;  3CCL Z;  3VB9 A;  1YI2 Z;  2R6M A;  1K73 1;  4NOZ A;  1VQ5 Z;  2QRE B;  1JWH C;  1KQS Z;  4RVD A;  2E2I I;  1VQK 1;  3CCS Z;  1Q81 1;  1L1O C;  2QKD A;  1KRL A;  1X3Z A;  1VQ7 1;  2GTH A;  4A3D I;  1YJN 1;  1P9N A;  4MD9 A;  2NVQ I;  3GTO I;  1VQM Z;  1VQL 1;  2QLV B;  3RZO I;  3HOX I;  5T64 A;  1YJ9 Z;  5D1O A;  5C4X I;  3M4O I;  3NH4 A;  5AN9 F;  2EGT A;  3G4S 1;  3I56 Z;  1VQ4 1;  2JMO A;  4E31 A;  1YIJ Z;  2JS4 A;  1Q82 2;  3CME Z;  2QEX 1;  2JUB A;  1NP6 A;  3CC2 1;  3CCJ 1;  3H3V J;  3GTQ I;  2PM9 A;  4A3I I;  2W04 A;  4BY1 I;  2JR6 A;  2KPI A;  4NBD A;  1WW9 A;  3GKQ A;  4MH4 A;  2OTL 1;  1WII A;  3CQZ I;  2E2J I;  2QA4 Z;  2P3Y A;  2JA7 I;  3GTK I;  1X3W A;  2O4H A;  3VMI A;  3NDJ A;  1VQO Z;  4DQY B;  1TWG I;  2AKL A;  4A3K I;  3U50 C;  4A3L I;  1K73 2;  1N8R 2;  3MON A;  2Q51 A;  2QR1 B;  3G6E Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...