2R7ZI

Cisplatin lesion containing rna polymerase ii elongation complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*CP*TP*TP*GUP*CP*CP*CP*TP*CP*CP*TP*CP*AP*T)-3'
publication title Mechanism of transcriptional stalling at cisplatin-damaged DNA.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r7zI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r7zI02
1ZB8A 4NBBA 3EERA 4Y7NI 2NVQI 4A3KI 4NOZA 2AKLA 3S17I 3S14I 1QYPA 2P3YA 4X6AI 2NVYI 4A3MI 3S15I 1K83I 3GTMS 4NBFA 3GTOI 3ESWA 5IP7I 3VMHA 4A3CI 5C44I 2JA7I 4A3LI 1I50I 4BY1I 2E2II 4NBGA 2VUMI 2R92I 1X3WA 1TWCI 3Q87A 3GTPI 2PK7A 3HOXI 3I4NI 3S1NI 2JA6I 1X3ZA 3U50C 2DE7A 3VB9A 2JS4A 4XX2A 2J6AA 2BJOA 2YU9I 3S1MI 3H0GI 3I4MI 4A3II 1NUIA 4NB8A 3HOZI 3HOVI 2NVTI 3M4OI 1Y1VS 4MH4A 2F4OA 1RO4A 1TWGI 4BBRI 3PO3S 1USPB 5C4XI 2R7ZI 4BY7I 3D6WA 5C3EI 4Y52I 3H3VJ 4NBDA 2K5RA 1WW9A 3I07A 1DL6A 4QTTA 1USPA 3S1QI 3PO2I 3HOWI 1R9TI 3M3YI 2DE5A 4NBAA 1I6HI 3K7AI 1TFIA 1ML8A 1WCMI 1SFOI 3HOUI 2R93I 1L1OC 2JA5I 1ZB9A 1YUAA 5IP9I 2NVXI 1TWAI 1Y1VI 3CQZI 3GTMI 4NB9A 4A3JI 3S16I 1TWHI 3GCFA 2RBLA 2JR6A 3VMIA 2JNYA 3GTLI 3GTJI 4NBHA 3GTGI 2F4MA 3RZDI 1TWFI 4NBEA 4A3FI 2JA8I 2HF1A 4A93I 4A3EI 2KPIA 4QTUA 1N2FA 4NBCA 5FLMI 2E2JI 3S2HI 4BBSI 3S2DI 4A3GI 2B63I 1LQLA 3GTKI 3RZOI 1RLYA 3LUSA 3GKQA 4A3DI 1PFTA 1I3QI 3GTQI 5CM2M 5C4JI 1Y1WI 2DE6A 3HOYI 3S1RI 3PO3I 2E2HI 4BXXI 3FKII 1VLAA 4A3BI 3VMGA
chains in the Genus database with same CATH superfamily
2O53A 3IF8A 2EGTA 2P3YA 4HH4A 2M48A 2GTHA 3J81b 2VPXA 1YHQ1 4S1TA 1ZH1A 1WJ2A 4A3CI 3CCR1 4BY1I 2E2II 3CCSZ 2VUMI 4RVFA 4MD7A 3I4NI 2JIRA 2JIQA 3S1NI 2VF1A 3MONA 1Q7Y2 3HKZA 2JS4A 2KI7B 3CD6Z 3S1MI 1NUIA 1SIWA 2Y0SA 1K9M2 3HOVI 3CC21 1VQ8Z 1NP6A 1K732 1RO4A 3PO3S 2R7ZI 4MRIA 4MD9A 4Y52I 3I07A 1M901 1QXFA 4QTTA 2YADA 2P28A 1YITZ 1Z03A 2WAQA 3NH8A 4MXUA 3K7AI 3HOUI 3CCS1 2NVXI 2OOYB 5IT9b 5D1PA 3IX0A 4RS4A 1JWHC 1Q812 1RO2A 3GCFA 2JR6A 2JNYA 1QVFZ 3CD61 3GTGI 3F3PC 4NBEA 2IZ4A 1NJI1 2G2KA 2JA8I 3NDJA 1VQLZ 1VQ81 2LFUA 5IT9f 3S2HI 1WIIA 5T6BA 4A3GI 1AA6A 1LQLA 2VPZA 3GKQA 3GTQI 2W04A 1Y1WI 1KC82 1M1K2 3FKII 2R6MA 2M6NA 4NFRA 1KQSY 2WB1A 3VMGA 1VQOZ 1KD12 2V3VA 2E9HA 4HGZA 3J80b 2NVQI 1K8A2 2JIOA 1RQFA 4NOZA 5LL6f 2VPYA 1QYPA 3EEDA 1X0TA 4A3MI 3GTMS 3D9XA 2OTLZ 1VQPZ 3VMHA 4RVHA 2JA7I 3CCMZ 2I3CA 3TDHB 1VQL1 3CC2Z 2R92I 1X3WA 2GTIA 3Q87A 3GTPI 2PK7A 3J80f 4E2WA 2V8IA 5A2Qb 1X3ZA 2J6AA 4E31A 1P9NA 4A3II 4NB8A 3CMEZ 3QWUA 3BG0B 1Y1VS 4MH4A 4DK1A 4BBRI 1QF8A 1VQO1 4BY7I 5A2Qf 2RPRA 1VQMZ 2V8KA 3CCU1 3HOWI 2OTL1 1VQP1 1Q861 3M3YI 3J81f 3T4NB 1FDIA 4RV9A 4EWCA 1SFOI 3CCM1 5IP9I 3I551 1VQ9Z 1VQ6Z 1Y1VI 4A3JI 3S16I 1TWHI 2QRDB 2RBLA 1Z02A 1TWFI 2HF1A 1JJ2Y 4A3EI 1N2FA 3CME1 5FLMI 1M902 3JAMb 3S2DI 4MONA 2QREB 2RHBA 3MZKB 1RLYA 2VUGA 1PFTA 1I3QI 1VQM1 5C4JI 2JMOA 2DE6A 2W03A 3PO3I 2IZ3A 2IV2X 3KIHA 2QA4Z 1ZB8A 3JAMf 1YJNZ 1N8R1 2NAPA 3EERA 2QR1B 4DQYB 1VQ91 1VQ61 3S17I 1QVGZ 1NJI2 1KQSZ 3S14I 2RT9A 2LIYA 2NVYI 2PMZA 3S15I 1K83I 4NBFA 2QKDA 3GTOI 5IP7I 3CC4Z 1W2BY 5T67A 4A3LI 1I50I 3G71Z 4E2ZA 2OZKA 4E2XA 1VQ51 3CCJZ 1YUKA 3CXCZ 1TWCI 5AN9F 1YIJZ 3CCVZ 4HGYA 1QVGY 2JA6I 3U50C 2DE7A 3KIFA 4XX2A 2BJOA 5D1OB 3H0GI 4DGLA 3OW2Y 4CL1A 3CPWZ 3CCUZ 4AYBA 2NVTI 1Q821 3IFUA 5D1OA 3CXCY 3CMA1 2F4OA 2QEX1 1TWGI 1WZNA 2AYDA 1USPB 5C4XI 3G6EZ 2QA41 3D6WA 1YJN1 3H3VJ 2K5RA 3I55Z 1USPA 2QRCB 4E33A 3CPWY 3P5JB 3VTNA 3FQMA 1VQNZ 2JIPA 2H85A 2DE5A 4NBAA 1RNIA 3CC41 1TFIA 1ML8A 2R93I 3G711 2JA5I 3CCQZ 1YUAA 3CCJ1 1YJ91 1YIJ1 3CCV1 2RIQA 3GTMI 1VQ4Z 3VMIA 3GTLI 2V45A 3CCLZ 3NH4A 3RZDI 2V8JA 2VPWA 4A3FI 3TE5B 2KPIA 3NFZA 4NBCA 1YJWZ 2E2JI 5T64A 3G6E1 1JJ2Z 2B63I 3GTKI 3RZOI 4NH1C 1Q862 4RVDA 1VQKZ 1KRLA 1Q7Y1 2E2HI 1VQN1 1Z01A 2Q51A 4RVGA 2ZAEB 2O4HA 2OTJZ 1S72Z 3G4S1 1K9M1 4A3BI 3F3FC 3CCQ1 4NBBA 4Y7NI 1K731 1VQ5Z 2Q4ZA 4MD8A 2E7ZA 4A3KI 3IR7A 2AKLA 1VQ41 3BG1B 4X6AI 3CCL1 3ESWA 2QLVB 5C44I 3D2LA 2GU2A 4NBGA 3CC7Z 1YJW1 3I56Z 3CCEZ 3CMAZ 3HOXI 2QEXZ 3MZLB 1W2BZ 3VB9A 2YU9I 4E30A 3I4MI 1VQK1 1Q811 3HOZI 4E2YA 1S7MA 3M4OI 1N8R2 2OTJ1 1S721 4TNUA 3OW2Z 5C3EI 1YI2Z 4NBDA 2LEXA 1WW9A 1VQ7Z 1DL6A 1YJ9Z 3S1QI 3FQQA 1FDOA 3PO2I 2PM9A 1R9TI 3NDIA 1I6HI 1Y8CA 2HU9A 1WCMI 1KC81 1L1OC 1M1K1 1ZB9A 1QVFY 3NH5A 3CC71 3I561 1TWAI 3CCE1 3CQZI 1KD11 4NB9A 3J7A4 1YIT1 3GTJI 2K3RA 4NBHA 1K8A1 2F4MA 1Q822 1YHQZ 2JUBA 1Q16A 3CCRZ 4A93I 4QTUA 5FLXb 4E32A 3G4SZ 4BBSI 1YI21 1RO0A 1VQ71 3LUSA 4A3DI 2JIMA 5CM2M 2OOXB 3HOYI 3S1RI 4BXXI 1VLAA 5FLXf
chains in the Genus database with same CATH topology
2O53A 3IF8A 2EGTA 2P3YA 4HH4A 2M48A 2GTHA 3J81b 1YHQ1 4S1TA 1ZH1A 4A3CI 3CCR1 4BY1I 2E2II 3CCSZ 2VUMI 4RVFA 4MD7A 3I4NI 3S1NI 2VF1A 3MONA 1Q7Y2 3HKZA 2JS4A 2KI7B 3CD6Z 3S1MI 1NUIA 2Y0SA 1K9M2 3HOVI 3CC21 1VQ8Z 1NP6A 1K732 1RO4A 3PO3S 2R7ZI 4MRIA 4MD9A 4Y52I 3I07A 1M901 4QTTA 2YADA 2P28A 1YITZ 1Z03A 2WAQA 3NH8A 4MXUA 3K7AI 3HOUI 3CCS1 2NVXI 2OOYB 5IT9b 5D1PA 3IX0A 4RS4A 1JWHC 1Q812 1RO2A 3GCFA 2JR6A 2JNYA 1QVFZ 3CD61 3GTGI 3F3PC 4NBEA 2IZ4A 1NJI1 2G2KA 2JA8I 3NDJA 1VQLZ 1VQ81 2LFUA 5IT9f 3S2HI 1WIIA 5T6BA 4A3GI 1LQLA 3GKQA 3GTQI 2W04A 1Y1WI 1KC82 1M1K2 3FKII 2R6MA 2M6NA 4NFRA 1KQSY 2WB1A 3VMGA 1VQOZ 1KD12 2E9HA 4HGZA 3J80b 2NVQI 1K8A2 1RQFA 4NOZA 5LL6f 1QYPA 3EEDA 1X0TA 4A3MI 3GTMS 3D9XA 2OTLZ 1VQPZ 3VMHA 4RVHA 2JA7I 3CCMZ 2I3CA 3TDHB 1VQL1 3CC2Z 2R92I 1X3WA 2GTIA 3Q87A 3GTPI 2PK7A 3J80f 4E2WA 2V8IA 5A2Qb 1X3ZA 2J6AA 4E31A 1P9NA 4A3II 4NB8A 3CMEZ 3QWUA 3BG0B 1Y1VS 4MH4A 4DK1A 4BBRI 1QF8A 1VQO1 4BY7I 5A2Qf 2RPRA 1VQMZ 2V8KA 3CCU1 3HOWI 2OTL1 1VQP1 1Q861 3M3YI 3J81f 3T4NB 4RV9A 4EWCA 1SFOI 3CCM1 5IP9I 3I551 1VQ9Z 1VQ6Z 1Y1VI 4A3JI 3S16I 1TWHI 2QRDB 2RBLA 1Z02A 1TWFI 2HF1A 1JJ2Y 4A3EI 1N2FA 3CME1 5FLMI 1M902 3JAMb 3S2DI 4MONA 2QREB 2RHBA 3MZKB 1RLYA 2VUGA 1PFTA 1I3QI 1VQM1 5C4JI 2JMOA 2DE6A 2W03A 3PO3I 2IZ3A 3KIHA 2QA4Z 1ZB8A 3JAMf 1YJNZ 1N8R1 3EERA 2QR1B 4DQYB 1VQ91 1VQ61 3S17I 1QVGZ 1NJI2 1KQSZ 3S14I 2RT9A 2LIYA 2NVYI 2PMZA 3S15I 1K83I 4NBFA 2QKDA 3GTOI 5IP7I 3CC4Z 1W2BY 5T67A 4A3LI 1I50I 3G71Z 4E2ZA 2OZKA 4E2XA 1VQ51 3CCJZ 1YUKA 3CXCZ 1TWCI 5AN9F 1YIJZ 3CCVZ 4HGYA 1QVGY 2JA6I 3U50C 2DE7A 3KIFA 4XX2A 2BJOA 5D1OB 3H0GI 4DGLA 3OW2Y 4CL1A 3CPWZ 3CCUZ 4AYBA 2NVTI 1Q821 3IFUA 5D1OA 3CXCY 3CMA1 2F4OA 2QEX1 1TWGI 1USPB 5C4XI 3G6EZ 2QA41 3D6WA 1YJN1 3H3VJ 2K5RA 3I55Z 1USPA 2QRCB 4E33A 3CPWY 3P5JB 3VTNA 3FQMA 1VQNZ 2H85A 2DE5A 4NBAA 1RNIA 3CC41 1TFIA 1ML8A 2R93I 3G711 2JA5I 3CCQZ 1YUAA 3CCJ1 1YJ91 1YIJ1 3CCV1 2RIQA 3GTMI 1VQ4Z 3VMIA 3GTLI 3CCLZ 3NH4A 3RZDI 2V8JA 4A3FI 3TE5B 2KPIA 3NFZA 4NBCA 1YJWZ 2E2JI 5T64A 3G6E1 1JJ2Z 2B63I 3GTKI 3RZOI 4NH1C 1Q862 4RVDA 1VQKZ 1KRLA 1Q7Y1 2E2HI 1VQN1 1Z01A 2Q51A 4RVGA 2ZAEB 2O4HA 2OTJZ 1S72Z 3G4S1 1K9M1 4A3BI 3F3FC 3CCQ1 4NBBA 4Y7NI 1K731 1VQ5Z 2Q4ZA 4MD8A 4A3KI 2AKLA 1VQ41 3BG1B 4X6AI 3CCL1 3ESWA 2QLVB 5C44I 2GU2A 4NBGA 3CC7Z 1YJW1 3I56Z 3CCEZ 3CMAZ 3HOXI 2QEXZ 3MZLB 1W2BZ 3VB9A 2YU9I 4E30A 3I4MI 1VQK1 1Q811 3HOZI 4E2YA 1S7MA 3M4OI 1N8R2 2OTJ1 1S721 4TNUA 3OW2Z 5C3EI 1YI2Z 4NBDA 1VQ7Z 1WW9A 1DL6A 1YJ9Z 3S1QI 3FQQA 3PO2I 2PM9A 1R9TI 3NDIA 1I6HI 2HU9A 1WCMI 1KC81 1L1OC 1M1K1 1ZB9A 1QVFY 3NH5A 3CC71 3I561 1TWAI 3CCE1 3CQZI 1KD11 4NB9A 3J7A4 1YIT1 3GTJI 2K3RA 4NBHA 1K8A1 2F4MA 1Q822 1YHQZ 2JUBA 3CCRZ 4A93I 4QTUA 5FLXb 4E32A 3G4SZ 4BBSI 1YI21 1RO0A 1VQ71 3LUSA 4A3DI 5CM2M 2OOXB 3HOYI 3S1RI 4BXXI 1VLAA 5FLXf
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZB8 A;  4NBB A;  3EER A;  4Y7N I;  2NVQ I;  4A3K I;  4NOZ A;  2AKL A;  3S17 I;  3S14 I;  1QYP A;  2P3Y A;  4X6A I;  2NVY I;  4A3M I;  3S15 I;  1K83 I;  3GTM S;  4NBF A;  3GTO I;  3ESW A;  5IP7 I;  3VMH A;  4A3C I;  5C44 I;  2JA7 I;  4A3L I;  1I50 I;  4BY1 I;  2E2I I;  4NBG A;  2VUM I;  2R92 I;  1X3W A;  1TWC I;  3Q87 A;  3GTP I;  2PK7 A;  3HOX I;  3I4N I;  3S1N I;  2JA6 I;  1X3Z A;  3U50 C;  2DE7 A;  3VB9 A;  2JS4 A;  4XX2 A;  2J6A A;  2BJO A;  2YU9 I;  3S1M I;  3H0G I;  3I4M I;  4A3I I;  1NUI A;  4NB8 A;  3HOZ I;  3HOV I;  2NVT I;  3M4O I;  1Y1V S;  4MH4 A;  2F4O A;  1RO4 A;  1TWG I;  4BBR I;  3PO3 S;  1USP B;  5C4X I;  2R7Z I;  4BY7 I;  3D6W A;  5C3E I;  4Y52 I;  3H3V J;  4NBD A;  2K5R A;  1WW9 A;  3I07 A;  1DL6 A;  4QTT A;  1USP A;  3S1Q I;  3PO2 I;  3HOW I;  1R9T I;  3M3Y I;  2DE5 A;  4NBA A;  1I6H I;  3K7A I;  1TFI A;  1ML8 A;  1WCM I;  1SFO I;  3HOU I;  2R93 I;  1L1O C;  2JA5 I;  1ZB9 A;  1YUA A;  5IP9 I;  2NVX I;  1TWA I;  1Y1V I;  3CQZ I;  3GTM I;  4NB9 A;  4A3J I;  3S16 I;  1TWH I;  3GCF A;  2RBL A;  2JR6 A;  3VMI A;  2JNY A;  3GTL I;  3GTJ I;  4NBH A;  3GTG I;  2F4M A;  3RZD I;  1TWF I;  4NBE A;  4A3F I;  2JA8 I;  2HF1 A;  4A93 I;  4A3E I;  2KPI A;  4QTU A;  1N2F A;  4NBC A;  5FLM I;  2E2J I;  3S2H I;  4BBS I;  3S2D I;  4A3G I;  2B63 I;  1LQL A;  3GTK I;  3RZO I;  1RLY A;  3LUS A;  3GKQ A;  4A3D I;  1PFT A;  1I3Q I;  3GTQ I;  5CM2 M;  5C4J I;  1Y1W I;  2DE6 A;  3HOY I;  3S1R I;  3PO3 I;  2E2H I;  4BXX I;  3FKI I;  1VLA A;  4A3B I;  3VMG A; 
#chains in the Genus database with same CATH topology
 2O53 A;  3IF8 A;  2EGT A;  2P3Y A;  4HH4 A;  2M48 A;  2GTH A;  3J81 b;  2VPX A;  1YHQ 1;  4S1T A;  1ZH1 A;  1WJ2 A;  4A3C I;  3CCR 1;  4BY1 I;  2E2I I;  3CCS Z;  2VUM I;  4RVF A;  4MD7 A;  3I4N I;  2JIR A;  2JIQ A;  3S1N I;  2VF1 A;  3MON A;  1Q7Y 2;  3HKZ A;  2JS4 A;  2KI7 B;  3CD6 Z;  3S1M I;  1NUI A;  1SIW A;  2Y0S A;  1K9M 2;  3HOV I;  3CC2 1;  1VQ8 Z;  1NP6 A;  1K73 2;  1RO4 A;  3PO3 S;  2R7Z I;  4MRI A;  4MD9 A;  4Y52 I;  3I07 A;  1M90 1;  1QXF A;  4QTT A;  2YAD A;  2P28 A;  1YIT Z;  1Z03 A;  2WAQ A;  3NH8 A;  4MXU A;  3K7A I;  3HOU I;  3CCS 1;  2NVX I;  2OOY B;  5IT9 b;  5D1P A;  3IX0 A;  4RS4 A;  1JWH C;  1Q81 2;  1RO2 A;  3GCF A;  2JR6 A;  2JNY A;  1QVF Z;  3CD6 1;  3GTG I;  3F3P C;  4NBE A;  2IZ4 A;  1NJI 1;  2G2K A;  2JA8 I;  3NDJ A;  1VQL Z;  1VQ8 1;  2LFU A;  5IT9 f;  3S2H I;  1WII A;  5T6B A;  4A3G I;  1AA6 A;  1LQL A;  2VPZ A;  3GKQ A;  3GTQ I;  2W04 A;  1Y1W I;  1KC8 2;  1M1K 2;  3FKI I;  2R6M A;  2M6N A;  4NFR A;  1KQS Y;  2WB1 A;  3VMG A;  1VQO Z;  1KD1 2;  2V3V A;  2E9H A;  4HGZ A;  3J80 b;  2NVQ I;  1K8A 2;  2JIO A;  1RQF A;  4NOZ A;  5LL6 f;  2VPY A;  1QYP A;  3EED A;  1X0T A;  4A3M I;  3GTM S;  3D9X A;  2OTL Z;  1VQP Z;  3VMH A;  4RVH A;  2JA7 I;  3CCM Z;  2I3C A;  3TDH B;  1VQL 1;  3CC2 Z;  2R92 I;  1X3W A;  2GTI A;  3Q87 A;  3GTP I;  2PK7 A;  3J80 f;  4E2W A;  2V8I A;  5A2Q b;  1X3Z A;  2J6A A;  4E31 A;  1P9N A;  4A3I I;  4NB8 A;  3CME Z;  3QWU A;  3BG0 B;  1Y1V S;  4MH4 A;  4DK1 A;  4BBR I;  1QF8 A;  1VQO 1;  4BY7 I;  5A2Q f;  2RPR A;  1VQM Z;  2V8K A;  3CCU 1;  3HOW I;  2OTL 1;  1VQP 1;  1Q86 1;  3M3Y I;  3J81 f;  3T4N B;  1FDI A;  4RV9 A;  4EWC A;  1SFO I;  3CCM 1;  5IP9 I;  3I55 1;  1VQ9 Z;  1VQ6 Z;  1Y1V I;  4A3J I;  3S16 I;  1TWH I;  2QRD B;  2RBL A;  1Z02 A;  1TWF I;  2HF1 A;  1JJ2 Y;  4A3E I;  1N2F A;  3CME 1;  5FLM I;  1M90 2;  3JAM b;  3S2D I;  4MON A;  2QRE B;  2RHB A;  3MZK B;  1RLY A;  2VUG A;  1PFT A;  1I3Q I;  1VQM 1;  5C4J I;  2JMO A;  2DE6 A;  2W03 A;  3PO3 I;  2IZ3 A;  2IV2 X;  3KIH A;  2QA4 Z;  1ZB8 A;  3JAM f;  1YJN Z;  1N8R 1;  2NAP A;  3EER A;  2QR1 B;  4DQY B;  1VQ9 1;  1VQ6 1;  3S17 I;  1QVG Z;  1NJI 2;  1KQS Z;  3S14 I;  2RT9 A;  2LIY A;  2NVY I;  2PMZ A;  3S15 I;  1K83 I;  4NBF A;  2QKD A;  3GTO I;  5IP7 I;  3CC4 Z;  1W2B Y;  5T67 A;  4A3L I;  1I50 I;  3G71 Z;  4E2Z A;  2OZK A;  4E2X A;  1VQ5 1;  3CCJ Z;  1YUK A;  3CXC Z;  1TWC I;  5AN9 F;  1YIJ Z;  3CCV Z;  4HGY A;  1QVG Y;  2JA6 I;  3U50 C;  2DE7 A;  3KIF A;  4XX2 A;  2BJO A;  5D1O B;  3H0G I;  4DGL A;  3OW2 Y;  4CL1 A;  3CPW Z;  3CCU Z;  4AYB A;  2NVT I;  1Q82 1;  3IFU A;  5D1O A;  3CXC Y;  3CMA 1;  2F4O A;  2QEX 1;  1TWG I;  1WZN A;  2AYD A;  1USP B;  5C4X I;  3G6E Z;  2QA4 1;  3D6W A;  1YJN 1;  3H3V J;  2K5R A;  3I55 Z;  1USP A;  2QRC B;  4E33 A;  3CPW Y;  3P5J B;  3VTN A;  3FQM A;  1VQN Z;  2JIP A;  2H85 A;  2DE5 A;  4NBA A;  1RNI A;  3CC4 1;  1TFI A;  1ML8 A;  2R93 I;  3G71 1;  2JA5 I;  3CCQ Z;  1YUA A;  3CCJ 1;  1YJ9 1;  1YIJ 1;  3CCV 1;  2RIQ A;  3GTM I;  1VQ4 Z;  3VMI A;  3GTL I;  2V45 A;  3CCL Z;  3NH4 A;  3RZD I;  2V8J A;  2VPW A;  4A3F I;  3TE5 B;  2KPI A;  3NFZ A;  4NBC A;  1YJW Z;  2E2J I;  5T64 A;  3G6E 1;  1JJ2 Z;  2B63 I;  3GTK I;  3RZO I;  4NH1 C;  1Q86 2;  4RVD A;  1VQK Z;  1KRL A;  1Q7Y 1;  2E2H I;  1VQN 1;  1Z01 A;  2Q51 A;  4RVG A;  2ZAE B;  2O4H A;  2OTJ Z;  1S72 Z;  3G4S 1;  1K9M 1;  4A3B I;  3F3F C;  3CCQ 1;  4NBB A;  4Y7N I;  1K73 1;  1VQ5 Z;  2Q4Z A;  4MD8 A;  2E7Z A;  4A3K I;  3IR7 A;  2AKL A;  1VQ4 1;  3BG1 B;  4X6A I;  3CCL 1;  3ESW A;  2QLV B;  5C44 I;  3D2L A;  2GU2 A;  4NBG A;  3CC7 Z;  1YJW 1;  3I56 Z;  3CCE Z;  3CMA Z;  3HOX I;  2QEX Z;  3MZL B;  1W2B Z;  3VB9 A;  2YU9 I;  4E30 A;  3I4M I;  1VQK 1;  1Q81 1;  3HOZ I;  4E2Y A;  1S7M A;  3M4O I;  1N8R 2;  2OTJ 1;  1S72 1;  4TNU A;  3OW2 Z;  5C3E I;  1YI2 Z;  4NBD A;  2LEX A;  1WW9 A;  1VQ7 Z;  1DL6 A;  1YJ9 Z;  3S1Q I;  3FQQ A;  1FDO A;  3PO2 I;  2PM9 A;  1R9T I;  3NDI A;  1I6H I;  1Y8C A;  2HU9 A;  1WCM I;  1KC8 1;  1L1O C;  1M1K 1;  1ZB9 A;  1QVF Y;  3NH5 A;  3CC7 1;  3I56 1;  1TWA I;  3CCE 1;  3CQZ I;  1KD1 1;  4NB9 A;  3J7A 4;  1YIT 1;  3GTJ I;  2K3R A;  4NBH A;  1K8A 1;  2F4M A;  1Q82 2;  1YHQ Z;  2JUB A;  1Q16 A;  3CCR Z;  4A93 I;  4QTU A;  5FLX b;  4E32 A;  3G4S Z;  4BBS I;  1YI2 1;  1RO0 A;  1VQ7 1;  3LUS A;  4A3D I;  2JIM A;  5CM2 M;  2OOX B;  3HOY I;  3S1R I;  4BXX I;  1VLA A;  5FLX f; 
#chains in the Genus database with same CATH homology
 2O53 A;  3IF8 A;  2EGT A;  2P3Y A;  4HH4 A;  2M48 A;  2GTH A;  3J81 b;  1YHQ 1;  4S1T A;  1ZH1 A;  4A3C I;  3CCR 1;  4BY1 I;  2E2I I;  3CCS Z;  2VUM I;  4RVF A;  4MD7 A;  3I4N I;  3S1N I;  2VF1 A;  3MON A;  1Q7Y 2;  3HKZ A;  2JS4 A;  2KI7 B;  3CD6 Z;  3S1M I;  1NUI A;  2Y0S A;  1K9M 2;  3HOV I;  3CC2 1;  1VQ8 Z;  1NP6 A;  1K73 2;  1RO4 A;  3PO3 S;  2R7Z I;  4MRI A;  4MD9 A;  4Y52 I;  3I07 A;  1M90 1;  4QTT A;  2YAD A;  2P28 A;  1YIT Z;  1Z03 A;  2WAQ A;  3NH8 A;  4MXU A;  3K7A I;  3HOU I;  3CCS 1;  2NVX I;  2OOY B;  5IT9 b;  5D1P A;  3IX0 A;  4RS4 A;  1JWH C;  1Q81 2;  1RO2 A;  3GCF A;  2JR6 A;  2JNY A;  1QVF Z;  3CD6 1;  3GTG I;  3F3P C;  4NBE A;  2IZ4 A;  1NJI 1;  2G2K A;  2JA8 I;  3NDJ A;  1VQL Z;  1VQ8 1;  2LFU A;  5IT9 f;  3S2H I;  1WII A;  5T6B A;  4A3G I;  1LQL A;  3GKQ A;  3GTQ I;  2W04 A;  1Y1W I;  1KC8 2;  1M1K 2;  3FKI I;  2R6M A;  2M6N A;  4NFR A;  1KQS Y;  2WB1 A;  3VMG A;  1VQO Z;  1KD1 2;  2E9H A;  4HGZ A;  3J80 b;  2NVQ I;  1K8A 2;  1RQF A;  4NOZ A;  5LL6 f;  1QYP A;  3EED A;  1X0T A;  4A3M I;  3GTM S;  3D9X A;  2OTL Z;  1VQP Z;  3VMH A;  4RVH A;  2JA7 I;  3CCM Z;  2I3C A;  3TDH B;  1VQL 1;  3CC2 Z;  2R92 I;  1X3W A;  2GTI A;  3Q87 A;  3GTP I;  2PK7 A;  3J80 f;  4E2W A;  2V8I A;  5A2Q b;  1X3Z A;  2J6A A;  4E31 A;  1P9N A;  4A3I I;  4NB8 A;  3CME Z;  3QWU A;  3BG0 B;  1Y1V S;  4MH4 A;  4DK1 A;  4BBR I;  1QF8 A;  1VQO 1;  4BY7 I;  5A2Q f;  2RPR A;  1VQM Z;  2V8K A;  3CCU 1;  3HOW I;  2OTL 1;  1VQP 1;  1Q86 1;  3M3Y I;  3J81 f;  3T4N B;  4RV9 A;  4EWC A;  1SFO I;  3CCM 1;  5IP9 I;  3I55 1;  1VQ9 Z;  1VQ6 Z;  1Y1V I;  4A3J I;  3S16 I;  1TWH I;  2QRD B;  2RBL A;  1Z02 A;  1TWF I;  2HF1 A;  1JJ2 Y;  4A3E I;  1N2F A;  3CME 1;  5FLM I;  1M90 2;  3JAM b;  3S2D I;  4MON A;  2QRE B;  2RHB A;  3MZK B;  1RLY A;  2VUG A;  1PFT A;  1I3Q I;  1VQM 1;  5C4J I;  2JMO A;  2DE6 A;  2W03 A;  3PO3 I;  2IZ3 A;  3KIH A;  2QA4 Z;  1ZB8 A;  3JAM f;  1YJN Z;  1N8R 1;  3EER A;  2QR1 B;  4DQY B;  1VQ9 1;  1VQ6 1;  3S17 I;  1QVG Z;  1NJI 2;  1KQS Z;  3S14 I;  2RT9 A;  2LIY A;  2NVY I;  2PMZ A;  3S15 I;  1K83 I;  4NBF A;  2QKD A;  3GTO I;  5IP7 I;  3CC4 Z;  1W2B Y;  5T67 A;  4A3L I;  1I50 I;  3G71 Z;  4E2Z A;  2OZK A;  4E2X A;  1VQ5 1;  3CCJ Z;  1YUK A;  3CXC Z;  1TWC I;  5AN9 F;  1YIJ Z;  3CCV Z;  4HGY A;  1QVG Y;  2JA6 I;  3U50 C;  2DE7 A;  3KIF A;  4XX2 A;  2BJO A;  5D1O B;  3H0G I;  4DGL A;  3OW2 Y;  4CL1 A;  3CPW Z;  3CCU Z;  4AYB A;  2NVT I;  1Q82 1;  3IFU A;  5D1O A;  3CXC Y;  3CMA 1;  2F4O A;  2QEX 1;  1TWG I;  1USP B;  5C4X I;  3G6E Z;  2QA4 1;  3D6W A;  1YJN 1;  3H3V J;  2K5R A;  3I55 Z;  1USP A;  2QRC B;  4E33 A;  3CPW Y;  3P5J B;  3VTN A;  3FQM A;  1VQN Z;  2H85 A;  2DE5 A;  4NBA A;  1RNI A;  3CC4 1;  1TFI A;  1ML8 A;  2R93 I;  3G71 1;  2JA5 I;  3CCQ Z;  1YUA A;  3CCJ 1;  1YJ9 1;  1YIJ 1;  3CCV 1;  2RIQ A;  3GTM I;  1VQ4 Z;  3VMI A;  3GTL I;  3CCL Z;  3NH4 A;  3RZD I;  2V8J A;  4A3F I;  3TE5 B;  2KPI A;  3NFZ A;  4NBC A;  1YJW Z;  2E2J I;  5T64 A;  3G6E 1;  1JJ2 Z;  2B63 I;  3GTK I;  3RZO I;  4NH1 C;  1Q86 2;  4RVD A;  1VQK Z;  1KRL A;  1Q7Y 1;  2E2H I;  1VQN 1;  1Z01 A;  2Q51 A;  4RVG A;  2ZAE B;  2O4H A;  2OTJ Z;  1S72 Z;  3G4S 1;  1K9M 1;  4A3B I;  3F3F C;  3CCQ 1;  4NBB A;  4Y7N I;  1K73 1;  1VQ5 Z;  2Q4Z A;  4MD8 A;  4A3K I;  2AKL A;  1VQ4 1;  3BG1 B;  4X6A I;  3CCL 1;  3ESW A;  2QLV B;  5C44 I;  2GU2 A;  4NBG A;  3CC7 Z;  1YJW 1;  3I56 Z;  3CCE Z;  3CMA Z;  3HOX I;  2QEX Z;  3MZL B;  1W2B Z;  3VB9 A;  2YU9 I;  4E30 A;  3I4M I;  1VQK 1;  1Q81 1;  3HOZ I;  4E2Y A;  1S7M A;  3M4O I;  1N8R 2;  2OTJ 1;  1S72 1;  4TNU A;  3OW2 Z;  5C3E I;  1YI2 Z;  4NBD A;  1VQ7 Z;  1WW9 A;  1DL6 A;  1YJ9 Z;  3S1Q I;  3FQQ A;  3PO2 I;  2PM9 A;  1R9T I;  3NDI A;  1I6H I;  2HU9 A;  1WCM I;  1KC8 1;  1L1O C;  1M1K 1;  1ZB9 A;  1QVF Y;  3NH5 A;  3CC7 1;  3I56 1;  1TWA I;  3CCE 1;  3CQZ I;  1KD1 1;  4NB9 A;  3J7A 4;  1YIT 1;  3GTJ I;  2K3R A;  4NBH A;  1K8A 1;  2F4M A;  1Q82 2;  1YHQ Z;  2JUB A;  3CCR Z;  4A93 I;  4QTU A;  5FLX b;  4E32 A;  3G4S Z;  4BBS I;  1YI2 1;  1RO0 A;  1VQ7 1;  3LUS A;  4A3D I;  5CM2 M;  2OOX B;  3HOY I;  3S1R I;  4BXX I;  1VLA A;  5FLX f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...