2R7ZI

Cisplatin lesion containing rna polymerase ii elongation complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*CP*TP*TP*GUP*CP*CP*CP*TP*CP*CP*TP*CP*AP*T)-3'
publication title Mechanism of transcriptional stalling at cisplatin-damaged DNA.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r7zI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r7zI02
3VMIA 3ESWA 3HOVI 3HOUI 4A3EI 5CM2M 2BJOA 1K83I 2JA5I 1TWFI 3HOYI 2RBLA 3S1RI 3Q87A 4Y52I 4X6AI 3U50C 1USPA 1RLYA 2DE7A 2JR6A 4BXXI 2JA8I 3GTMI 3GTPI 3H0GI 1N2FA 1TWHI 3GTMS 3PO3I 3S1NI 3GTOI 4NB9A 1L1OC 2DE6A 3S17I 3H3VJ 1Y1VI 4NBGA 3PO3S 4A3MI 4A3BI 2YU9I 4NBAA 4NBEA 1SFOI 2NVTI 2NVQI 1QYPA 3GTQI 3HOWI 4MH4A 2E2JI 5C44I 1VLAA 3GTGI 3S2DI 3LUSA 4A3JI 1TWGI 2P3YA 1RO4A 3K7AI 4BY7I 3PO2I 4NBCA 1X3WA 4NBFA 2PK7A 2JA6I 3CQZI 1TWAI 3GKQA 3GTLI 3S14I 1YUAA 1R9TI 2NVYI 1I3QI 3D6WA 1PFTA 1WW9A 3M4OI 1USPB 1NUIA 4QTUA 3I4MI 2J6AA 2R7ZI 3HOZI 1ZB9A 1ML8A 4QTTA 3GCFA 3GTKI 5C3EI 4A93I 3S1MI 4A3II 3RZDI 5IP9I 4NBHA 4NOZA 3VMGA 1WCMI 3VB9A 5C4XI 2E2II 3S16I 1X3ZA 4BBRI 2JNYA 4XX2A 3I4NI 2HF1A 3I07A 3S1QI 2KPIA 1Y1WI 2JS4A 4A3GI 4BY1I 4BBSI 3S15I 4A3FI 1ZB8A 3M3YI 2E2HI 4A3CI 4A3KI 2NVXI 2VUMI 5IP7I 1DL6A 3FKII 1I50I 4NBDA 5C4JI 3GTJI 3RZOI 4Y7NI 2B63I 4NBBA 3S2HI 1TFIA 2F4MA 3EERA 4A3LI 1TWCI 1LQLA 4A3DI 2JA7I 3HOXI 4NB8A 2AKLA 2K5RA 3VMHA 2DE5A 1Y1VS 5FLMI 2F4OA 1I6HI 2R92I 2R93I
chains in the Genus database with same CATH superfamily
5T67A 3HOVI 1K83I 2GTHA 1N8R1 3G711 1QF8A 3CXCZ 2VPYA 3CD6Z 4Y52I 1USPA 2DE7A 1VQN1 3GTMI 3CCMZ 3TE5B 3GTPI 4AYBA 3H0GI 5AN9F 3JAMf 2O53A 1VQLZ 1YHQZ 1SFOI 2JIRA 2NAPA 1YUKA 4MONA 2QA4Z 3GTGI 3S2DI 2RIQA 4E2ZA 3PO2I 2G2KA 4CL1A 1X3WA 1K9M2 1VQ9Z 5D1PA 1VQ8Z 2QRCB 2V8IA 1RNIA 1YJW1 3M4OI 1USPB 3I4MI 1Q16A 2J6AA 2IZ4A 1ZH1A 2VUGA 5D1OA 1NJI2 4QTTA 5IT9f 3J80b 4DK1A 1YJN1 3GTKI 2JIQA 4RVDA 3G6EZ 3FQQA 1W2BZ 3D9XA 4A3II 4RVFA 3CME1 2VPZA 2V8KA 3CCJ1 3CCUZ 3VB9A 3I561 1KQSZ 2E9HA 1K732 2KPIA 4NFRA 3MONA 2VPWA 3M3YI 3CC41 2VUMI 5D1OB 1I50I 4NBDA 2B63I 4NBBA 3BG0B 1RO2A 3S2HI 1W2BY 2F4MA 1TWCI 4MRIA 2M6NA 4EWCA 2QEX1 1KC81 2PM9A 3HOXI 5FLMI 4NB8A 2K5RA 2DE5A 1Y1VS 2OTLZ 2HU9A 1S72Z 4E2YA 3MZLB 3CCR1 3ESWA 2Q4ZA 4A3EI 1VQ5Z 2JA5I 3HOYI 3IF8A 1WZNA 1K8A1 2OOXB 1Q811 4X6AI 1RLYA 1Q821 2IV2X 3GTMS 3PO3I 3IX0A 3G4SZ 1VQ6Z 2Y0SA 3GTOI 1M1K2 1L1OC 2JUBA 2JMOA 1Y1VI 2JIMA 4NBGA 1YJ91 3OW2Z 2KI7B 4A3MI 3G71Z 1QVGZ 1QVFZ 2AYDA 1YI2Z 1VQ71 2QKDA 1VQNZ 5C44I 1VLAA 2LFUA 3CCLZ 4A3JI 4MXUA 2P3YA 1RO4A 3NDJA 2RT9A 4NBCA 2RHBA 1RQFA 2PK7A 4NBFA 3CQZI 1TWAI 3GKQA 1YIT1 3GTLI 1R9TI 2OZKA 3D6WA 1NUIA 3CMA1 3CCQ1 1WJ2A 3GCFA 4A93I 3S1MI 5T6BA 3OW2Y 3CCV1 3J81b 1K9M1 1YJWZ 1WCMI 5FLXb 1Z03A 3CXCY 4XX2A 1VQP1 1NJI1 3QWUA 1YJNZ 3S1QI 3NDIA 2YADA 3T4NB 1JWHC 1KRLA 1ZB8A 3CC71 1VQL1 2M48A 1DL6A 4A3KI 3I551 3FKII 3CCJZ 4DQYB 3GTJI 4Y7NI 4E33A 3I56Z 4RS4A 1TFIA 3NH5A 4HGYA 2GTIA 3IFUA 4A3DI 1K731 1I6HI 2VF1A 3VMIA 3CC4Z 1VQM1 1TWFI 2OOYB 1M902 2RBLA 3S1RI 1QXFA 3U50C 5T64A 2JR6A 2OTJ1 2JA8I 3CCE1 3CCS1 1WIIA 2QEXZ 1TWHI 3S1NI 3F3PC 3S17I 1P9NA 3CCU1 3CCRZ 3PO3S 2WB1A 1Q862 4A3BI 2YU9I 2LIYA 3J81f 1Z01A 4NBEA 5A2Qb 3VTNA 1VQ41 2R6MA 2NVTI 3CC21 2Q51A 3TDHB 2O4HA 1QYPA 3EEDA 2PMZA 1KQSY 2V3VA 3HOWI 4MH4A 2E2JI 3JAMb 4E31A 1TWGI 1VQK1 4BY7I 3J80f 1KD12 1M1K1 2V8JA 3S14I 1YUAA 4E2XA 1I3QI 1WW9A 2R7ZI 1Q7Y2 1VQ7Z 1ZB9A 1S7MA 1VQO1 5C3EI 1S721 1Y8CA 3RZDI 4NOZA 4E30A 2QRDB 1YITZ 4DGLA 3HKZA 3VMGA 3KIHA 5IT9b 3CMAZ 1YIJ1 3CCQZ 5C4XI 3S16I 1X3ZA 3I4NI 4MD9A 3S15I 3CPWZ 3CCVZ 4A3CI 1YI21 4RVGA 2ZAEB 1N8R2 1QVGY 5A2Qf 1QVFY 2I3CA 3CD61 3RZOI 2EGTA 3CCL1 1VQPZ 3EERA 1Z02A 4A3LI 3NH8A 2WAQA 1LQLA 3CCM1 3BG1B 2JA7I 2QREB 2JIOA 3VMHA 3FQMA 1RO0A 2F4OA 2R92I 3CC7Z 1X0TA 3HOUI 3I55Z 5CM2M 2BJOA 3CMEZ 1JJ2Z 3KIFA 3Q87A 1YHQ1 1FDIA 4BXXI 3CPWY 2QA41 1FDOA 1N2FA 4RV9A 1SIWA 4NB9A 2DE6A 3MZKB 2QLVB 3H3VJ 5LL6f 1VQ91 1VQ81 2QR1B 1VQMZ 4TNUA 4NBAA 4HH4A 4HGZA 1M901 2NVQI 4RVHA 3GTQI 2E7ZA 2OTJZ 3CCEZ 3CCSZ 2VPXA 3LUSA 3G6E1 3K7AI 1JJ2Y 4MD8A 2JA6I 2NVYI 1Q861 1PFTA 4QTUA 1NP6A 1VQ4Z 3CC2Z 2JIPA 3HOZI 1ML8A 5FLXf 3IR7A 4E32A 1VQKZ 4NH1C 5IP9I 4NBHA 2GU2A 1KD11 2W03A 2H85A 4MD7A 1YJ9Z 2V45A 1Q7Y1 2E2II 2RPRA 1VQOZ 3NFZA 2JNYA 4BBRI 1AA6A 2W04A 2HF1A 3I07A 3P5JB 1KC82 1Y1WI 2JS4A 4A3GI 4BY1I 4BBSI 2P28A 3J7A4 2IZ3A 2K3RA 4A3FI 2OTL1 2E2HI 2NVXI 3F3FC 5IP7I 3D2LA 1VQ51 1YIJZ 1K8A2 5C4JI 1Q812 2LEXA 1Q822 4E2WA 3NH4A 2AKLA 3G4S1 1VQ61 2R93I 4S1TA
chains in the Genus database with same CATH topology
5T67A 3HOVI 1K83I 2GTHA 1N8R1 3G711 1QF8A 3CXCZ 3CD6Z 4Y52I 1USPA 2DE7A 1VQN1 3GTMI 3CCMZ 3TE5B 3GTPI 4AYBA 3H0GI 5AN9F 3JAMf 2O53A 1VQLZ 1YHQZ 1SFOI 1YUKA 4MONA 2QA4Z 3GTGI 3S2DI 2RIQA 4E2ZA 3PO2I 2G2KA 4CL1A 1X3WA 1K9M2 1VQ9Z 1VQ8Z 5D1PA 2QRCB 2V8IA 1RNIA 1YJW1 3M4OI 1USPB 3I4MI 2J6AA 2IZ4A 1ZH1A 2VUGA 5D1OA 1NJI2 4QTTA 5IT9f 3J80b 4DK1A 1YJN1 3GTKI 4RVDA 3G6EZ 3FQQA 1W2BZ 3D9XA 4A3II 4RVFA 3CME1 2V8KA 3CCJ1 3CCUZ 3VB9A 3I561 1KQSZ 2E9HA 1K732 2KPIA 4NFRA 3MONA 3M3YI 3CC41 2VUMI 5D1OB 1I50I 4NBDA 2B63I 4NBBA 3BG0B 1RO2A 3S2HI 1W2BY 2F4MA 1TWCI 4MRIA 2M6NA 4EWCA 2QEX1 1KC81 2PM9A 3HOXI 5FLMI 4NB8A 2K5RA 2DE5A 1Y1VS 2OTLZ 2HU9A 1S72Z 4E2YA 3MZLB 3CCR1 3ESWA 2Q4ZA 4A3EI 1VQ5Z 2JA5I 3HOYI 3IF8A 1K8A1 2OOXB 1Q811 4X6AI 1RLYA 1Q821 3GTMS 3PO3I 3IX0A 3G4SZ 1VQ6Z 2Y0SA 3GTOI 1M1K2 1L1OC 2JUBA 2JMOA 1Y1VI 4NBGA 1YJ91 3OW2Z 2KI7B 4A3MI 3G71Z 1QVGZ 1QVFZ 1YI2Z 1VQ71 2QKDA 1VQNZ 5C44I 1VLAA 2LFUA 3CCLZ 4A3JI 4MXUA 2P3YA 1RO4A 3NDJA 2RT9A 4NBCA 2RHBA 1RQFA 2PK7A 4NBFA 3CQZI 1TWAI 3GKQA 1YIT1 3GTLI 1R9TI 2OZKA 3D6WA 1NUIA 3CMA1 3CCQ1 3GCFA 4A93I 3S1MI 5T6BA 3OW2Y 3CCV1 3J81b 1K9M1 1YJWZ 1WCMI 5FLXb 1Z03A 3CXCY 4XX2A 1VQP1 1NJI1 3QWUA 1YJNZ 3S1QI 3NDIA 2YADA 3T4NB 1JWHC 1KRLA 1ZB8A 3CC71 1VQL1 2M48A 1DL6A 4A3KI 3I551 3FKII 3CCJZ 4DQYB 3GTJI 4Y7NI 4E33A 3I56Z 4RS4A 1TFIA 3NH5A 4HGYA 2GTIA 3IFUA 4A3DI 1K731 1I6HI 2VF1A 3VMIA 3CC4Z 1VQM1 1TWFI 2OOYB 1M902 2RBLA 3S1RI 3U50C 5T64A 2JR6A 2OTJ1 2JA8I 3CCE1 3CCS1 1WIIA 2QEXZ 1TWHI 3S1NI 3F3PC 3S17I 1P9NA 3CCU1 3CCRZ 3PO3S 2WB1A 1Q862 4A3BI 2YU9I 2LIYA 3J81f 1Z01A 4NBEA 5A2Qb 3VTNA 1VQ41 2R6MA 2NVTI 3CC21 2Q51A 3TDHB 2O4HA 1QYPA 3EEDA 2PMZA 1KQSY 3HOWI 4MH4A 2E2JI 3JAMb 4E31A 1TWGI 1VQK1 4BY7I 3J80f 1KD12 1M1K1 2V8JA 3S14I 1YUAA 4E2XA 1I3QI 1WW9A 2R7ZI 1Q7Y2 1VQ7Z 1ZB9A 1S7MA 1VQO1 5C3EI 1S721 3RZDI 4NOZA 4E30A 2QRDB 1YITZ 4DGLA 3HKZA 3VMGA 3KIHA 5IT9b 3CMAZ 1YIJ1 3CCQZ 5C4XI 3S16I 1X3ZA 3I4NI 4MD9A 3S15I 3CPWZ 3CCVZ 4A3CI 1YI21 4RVGA 2ZAEB 1N8R2 1QVGY 5A2Qf 1QVFY 2I3CA 3CD61 3RZOI 2EGTA 3CCL1 1VQPZ 3EERA 1Z02A 4A3LI 3NH8A 2WAQA 1LQLA 3CCM1 3BG1B 2JA7I 2QREB 3VMHA 3FQMA 1RO0A 2F4OA 2R92I 3CC7Z 1X0TA 3HOUI 3I55Z 5CM2M 2BJOA 3CMEZ 1JJ2Z 3KIFA 3Q87A 1YHQ1 4BXXI 3CPWY 2QA41 1N2FA 4RV9A 4NB9A 2DE6A 3MZKB 2QLVB 3H3VJ 5LL6f 1VQ91 1VQ81 2QR1B 1VQMZ 4TNUA 4NBAA 4HH4A 4HGZA 1M901 2NVQI 4RVHA 3GTQI 2OTJZ 3CCEZ 3CCSZ 3LUSA 3G6E1 3K7AI 1JJ2Y 4MD8A 2JA6I 2NVYI 1Q861 1PFTA 4QTUA 1NP6A 1VQ4Z 3CC2Z 3HOZI 1ML8A 5FLXf 4E32A 1VQKZ 4NH1C 5IP9I 4NBHA 2GU2A 1KD11 2W03A 2H85A 4MD7A 1YJ9Z 1Q7Y1 2E2II 2RPRA 1VQOZ 3NFZA 2JNYA 4BBRI 2W04A 2HF1A 3I07A 3P5JB 1KC82 1Y1WI 2JS4A 4A3GI 4BY1I 4BBSI 2P28A 3J7A4 2IZ3A 2K3RA 4A3FI 2OTL1 2E2HI 2NVXI 3F3FC 5IP7I 1VQ51 1YIJZ 1K8A2 5C4JI 1Q812 1Q822 4E2WA 3NH4A 2AKLA 3G4S1 1VQ61 2R93I 4S1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMI A;  3ESW A;  3HOV I;  3HOU I;  4A3E I;  5CM2 M;  2BJO A;  1K83 I;  2JA5 I;  1TWF I;  3HOY I;  2RBL A;  3S1R I;  3Q87 A;  4Y52 I;  4X6A I;  3U50 C;  1USP A;  1RLY A;  2DE7 A;  2JR6 A;  4BXX I;  2JA8 I;  3GTM I;  3GTP I;  3H0G I;  1N2F A;  1TWH I;  3GTM S;  3PO3 I;  3S1N I;  3GTO I;  4NB9 A;  1L1O C;  2DE6 A;  3S17 I;  3H3V J;  1Y1V I;  4NBG A;  3PO3 S;  4A3M I;  4A3B I;  2YU9 I;  4NBA A;  4NBE A;  1SFO I;  2NVT I;  2NVQ I;  1QYP A;  3GTQ I;  3HOW I;  4MH4 A;  2E2J I;  5C44 I;  1VLA A;  3GTG I;  3S2D I;  3LUS A;  4A3J I;  1TWG I;  2P3Y A;  1RO4 A;  3K7A I;  4BY7 I;  3PO2 I;  4NBC A;  1X3W A;  4NBF A;  2PK7 A;  2JA6 I;  3CQZ I;  1TWA I;  3GKQ A;  3GTL I;  3S14 I;  1YUA A;  1R9T I;  2NVY I;  1I3Q I;  3D6W A;  1PFT A;  1WW9 A;  3M4O I;  1USP B;  1NUI A;  4QTU A;  3I4M I;  2J6A A;  2R7Z I;  3HOZ I;  1ZB9 A;  1ML8 A;  4QTT A;  3GCF A;  3GTK I;  5C3E I;  4A93 I;  3S1M I;  4A3I I;  3RZD I;  5IP9 I;  4NBH A;  4NOZ A;  3VMG A;  1WCM I;  3VB9 A;  5C4X I;  2E2I I;  3S16 I;  1X3Z A;  4BBR I;  2JNY A;  4XX2 A;  3I4N I;  2HF1 A;  3I07 A;  3S1Q I;  2KPI A;  1Y1W I;  2JS4 A;  4A3G I;  4BY1 I;  4BBS I;  3S15 I;  4A3F I;  1ZB8 A;  3M3Y I;  2E2H I;  4A3C I;  4A3K I;  2NVX I;  2VUM I;  5IP7 I;  1DL6 A;  3FKI I;  1I50 I;  4NBD A;  5C4J I;  3GTJ I;  3RZO I;  4Y7N I;  2B63 I;  4NBB A;  3S2H I;  1TFI A;  2F4M A;  3EER A;  4A3L I;  1TWC I;  1LQL A;  4A3D I;  2JA7 I;  3HOX I;  4NB8 A;  2AKL A;  2K5R A;  3VMH A;  2DE5 A;  1Y1V S;  5FLM I;  2F4O A;  1I6H I;  2R92 I;  2R93 I; 
#chains in the Genus database with same CATH topology
 5T67 A;  3HOV I;  1K83 I;  2GTH A;  1N8R 1;  3G71 1;  1QF8 A;  3CXC Z;  2VPY A;  3CD6 Z;  4Y52 I;  1USP A;  2DE7 A;  1VQN 1;  3GTM I;  3CCM Z;  3TE5 B;  3GTP I;  4AYB A;  3H0G I;  5AN9 F;  3JAM f;  2O53 A;  1VQL Z;  1YHQ Z;  1SFO I;  2JIR A;  2NAP A;  1YUK A;  4MON A;  2QA4 Z;  3GTG I;  3S2D I;  2RIQ A;  4E2Z A;  3PO2 I;  2G2K A;  4CL1 A;  1X3W A;  1K9M 2;  1VQ9 Z;  5D1P A;  1VQ8 Z;  2QRC B;  2V8I A;  1RNI A;  1YJW 1;  3M4O I;  1USP B;  3I4M I;  1Q16 A;  2J6A A;  2IZ4 A;  1ZH1 A;  2VUG A;  5D1O A;  1NJI 2;  4QTT A;  5IT9 f;  3J80 b;  4DK1 A;  1YJN 1;  3GTK I;  2JIQ A;  4RVD A;  3G6E Z;  3FQQ A;  1W2B Z;  3D9X A;  4A3I I;  4RVF A;  3CME 1;  2VPZ A;  2V8K A;  3CCJ 1;  3CCU Z;  3VB9 A;  3I56 1;  1KQS Z;  2E9H A;  1K73 2;  2KPI A;  4NFR A;  3MON A;  2VPW A;  3M3Y I;  3CC4 1;  2VUM I;  5D1O B;  1I50 I;  4NBD A;  2B63 I;  4NBB A;  3BG0 B;  1RO2 A;  3S2H I;  1W2B Y;  2F4M A;  1TWC I;  4MRI A;  2M6N A;  4EWC A;  2QEX 1;  1KC8 1;  2PM9 A;  3HOX I;  5FLM I;  4NB8 A;  2K5R A;  2DE5 A;  1Y1V S;  2OTL Z;  2HU9 A;  1S72 Z;  4E2Y A;  3MZL B;  3CCR 1;  3ESW A;  2Q4Z A;  4A3E I;  1VQ5 Z;  2JA5 I;  3HOY I;  3IF8 A;  1WZN A;  1K8A 1;  2OOX B;  1Q81 1;  4X6A I;  1RLY A;  1Q82 1;  2IV2 X;  3GTM S;  3PO3 I;  3IX0 A;  3G4S Z;  1VQ6 Z;  2Y0S A;  3GTO I;  1M1K 2;  1L1O C;  2JUB A;  2JMO A;  1Y1V I;  2JIM A;  4NBG A;  1YJ9 1;  3OW2 Z;  2KI7 B;  4A3M I;  3G71 Z;  1QVG Z;  1QVF Z;  2AYD A;  1YI2 Z;  1VQ7 1;  2QKD A;  1VQN Z;  5C44 I;  1VLA A;  2LFU A;  3CCL Z;  4A3J I;  4MXU A;  2P3Y A;  1RO4 A;  3NDJ A;  2RT9 A;  4NBC A;  2RHB A;  1RQF A;  2PK7 A;  4NBF A;  3CQZ I;  1TWA I;  3GKQ A;  1YIT 1;  3GTL I;  1R9T I;  2OZK A;  3D6W A;  1NUI A;  3CMA 1;  3CCQ 1;  1WJ2 A;  3GCF A;  4A93 I;  3S1M I;  5T6B A;  3OW2 Y;  3CCV 1;  3J81 b;  1K9M 1;  1YJW Z;  1WCM I;  5FLX b;  1Z03 A;  3CXC Y;  4XX2 A;  1VQP 1;  1NJI 1;  3QWU A;  1YJN Z;  3S1Q I;  3NDI A;  2YAD A;  3T4N B;  1JWH C;  1KRL A;  1ZB8 A;  3CC7 1;  1VQL 1;  2M48 A;  1DL6 A;  4A3K I;  3I55 1;  3FKI I;  3CCJ Z;  4DQY B;  3GTJ I;  4Y7N I;  4E33 A;  3I56 Z;  4RS4 A;  1TFI A;  3NH5 A;  4HGY A;  2GTI A;  3IFU A;  4A3D I;  1K73 1;  1I6H I;  2VF1 A;  3VMI A;  3CC4 Z;  1VQM 1;  1TWF I;  2OOY B;  1M90 2;  2RBL A;  3S1R I;  1QXF A;  3U50 C;  5T64 A;  2JR6 A;  2OTJ 1;  2JA8 I;  3CCE 1;  3CCS 1;  1WII A;  2QEX Z;  1TWH I;  3S1N I;  3F3P C;  3S17 I;  1P9N A;  3CCU 1;  3CCR Z;  3PO3 S;  2WB1 A;  1Q86 2;  4A3B I;  2YU9 I;  2LIY A;  3J81 f;  1Z01 A;  4NBE A;  5A2Q b;  3VTN A;  1VQ4 1;  2R6M A;  2NVT I;  3CC2 1;  2Q51 A;  3TDH B;  2O4H A;  1QYP A;  3EED A;  2PMZ A;  1KQS Y;  2V3V A;  3HOW I;  4MH4 A;  2E2J I;  3JAM b;  4E31 A;  1TWG I;  1VQK 1;  4BY7 I;  3J80 f;  1KD1 2;  1M1K 1;  2V8J A;  3S14 I;  1YUA A;  4E2X A;  1I3Q I;  1WW9 A;  2R7Z I;  1Q7Y 2;  1VQ7 Z;  1ZB9 A;  1S7M A;  1VQO 1;  5C3E I;  1S72 1;  1Y8C A;  3RZD I;  4NOZ A;  4E30 A;  2QRD B;  1YIT Z;  4DGL A;  3HKZ A;  3VMG A;  3KIH A;  5IT9 b;  3CMA Z;  1YIJ 1;  3CCQ Z;  5C4X I;  3S16 I;  1X3Z A;  3I4N I;  4MD9 A;  3S15 I;  3CPW Z;  3CCV Z;  4A3C I;  1YI2 1;  4RVG A;  2ZAE B;  1N8R 2;  1QVG Y;  5A2Q f;  1QVF Y;  2I3C A;  3CD6 1;  3RZO I;  2EGT A;  3CCL 1;  1VQP Z;  3EER A;  1Z02 A;  4A3L I;  3NH8 A;  2WAQ A;  1LQL A;  3CCM 1;  3BG1 B;  2JA7 I;  2QRE B;  2JIO A;  3VMH A;  3FQM A;  1RO0 A;  2F4O A;  2R92 I;  3CC7 Z;  1X0T A;  3HOU I;  3I55 Z;  5CM2 M;  2BJO A;  3CME Z;  1JJ2 Z;  3KIF A;  3Q87 A;  1YHQ 1;  1FDI A;  4BXX I;  3CPW Y;  2QA4 1;  1FDO A;  1N2F A;  4RV9 A;  1SIW A;  4NB9 A;  2DE6 A;  3MZK B;  2QLV B;  3H3V J;  5LL6 f;  1VQ9 1;  1VQ8 1;  2QR1 B;  1VQM Z;  4TNU A;  4NBA A;  4HH4 A;  4HGZ A;  1M90 1;  2NVQ I;  4RVH A;  3GTQ I;  2E7Z A;  2OTJ Z;  3CCE Z;  3CCS Z;  2VPX A;  3LUS A;  3G6E 1;  3K7A I;  1JJ2 Y;  4MD8 A;  2JA6 I;  2NVY I;  1Q86 1;  1PFT A;  4QTU A;  1NP6 A;  1VQ4 Z;  3CC2 Z;  2JIP A;  3HOZ I;  1ML8 A;  5FLX f;  3IR7 A;  4E32 A;  1VQK Z;  4NH1 C;  5IP9 I;  4NBH A;  2GU2 A;  1KD1 1;  2W03 A;  2H85 A;  4MD7 A;  1YJ9 Z;  2V45 A;  1Q7Y 1;  2E2I I;  2RPR A;  1VQO Z;  3NFZ A;  2JNY A;  4BBR I;  1AA6 A;  2W04 A;  2HF1 A;  3I07 A;  3P5J B;  1KC8 2;  1Y1W I;  2JS4 A;  4A3G I;  4BY1 I;  4BBS I;  2P28 A;  3J7A 4;  2IZ3 A;  2K3R A;  4A3F I;  2OTL 1;  2E2H I;  2NVX I;  3F3F C;  5IP7 I;  3D2L A;  1VQ5 1;  1YIJ Z;  1K8A 2;  5C4J I;  1Q81 2;  2LEX A;  1Q82 2;  4E2W A;  3NH4 A;  2AKL A;  3G4S 1;  1VQ6 1;  2R93 I;  4S1T A; 
#chains in the Genus database with same CATH homology
 5T67 A;  3HOV I;  1K83 I;  2GTH A;  1N8R 1;  3G71 1;  1QF8 A;  3CXC Z;  3CD6 Z;  4Y52 I;  1USP A;  2DE7 A;  1VQN 1;  3GTM I;  3CCM Z;  3TE5 B;  3GTP I;  4AYB A;  3H0G I;  5AN9 F;  3JAM f;  2O53 A;  1VQL Z;  1YHQ Z;  1SFO I;  1YUK A;  4MON A;  2QA4 Z;  3GTG I;  3S2D I;  2RIQ A;  4E2Z A;  3PO2 I;  2G2K A;  4CL1 A;  1X3W A;  1K9M 2;  1VQ9 Z;  1VQ8 Z;  5D1P A;  2QRC B;  2V8I A;  1RNI A;  1YJW 1;  3M4O I;  1USP B;  3I4M I;  2J6A A;  2IZ4 A;  1ZH1 A;  2VUG A;  5D1O A;  1NJI 2;  4QTT A;  5IT9 f;  3J80 b;  4DK1 A;  1YJN 1;  3GTK I;  4RVD A;  3G6E Z;  3FQQ A;  1W2B Z;  3D9X A;  4A3I I;  4RVF A;  3CME 1;  2V8K A;  3CCJ 1;  3CCU Z;  3VB9 A;  3I56 1;  1KQS Z;  2E9H A;  1K73 2;  2KPI A;  4NFR A;  3MON A;  3M3Y I;  3CC4 1;  2VUM I;  5D1O B;  1I50 I;  4NBD A;  2B63 I;  4NBB A;  3BG0 B;  1RO2 A;  3S2H I;  1W2B Y;  2F4M A;  1TWC I;  4MRI A;  2M6N A;  4EWC A;  2QEX 1;  1KC8 1;  2PM9 A;  3HOX I;  5FLM I;  4NB8 A;  2K5R A;  2DE5 A;  1Y1V S;  2OTL Z;  2HU9 A;  1S72 Z;  4E2Y A;  3MZL B;  3CCR 1;  3ESW A;  2Q4Z A;  4A3E I;  1VQ5 Z;  2JA5 I;  3HOY I;  3IF8 A;  1K8A 1;  2OOX B;  1Q81 1;  4X6A I;  1RLY A;  1Q82 1;  3GTM S;  3PO3 I;  3IX0 A;  3G4S Z;  1VQ6 Z;  2Y0S A;  3GTO I;  1M1K 2;  1L1O C;  2JUB A;  2JMO A;  1Y1V I;  4NBG A;  1YJ9 1;  3OW2 Z;  2KI7 B;  4A3M I;  3G71 Z;  1QVG Z;  1QVF Z;  1YI2 Z;  1VQ7 1;  2QKD A;  1VQN Z;  5C44 I;  1VLA A;  2LFU A;  3CCL Z;  4A3J I;  4MXU A;  2P3Y A;  1RO4 A;  3NDJ A;  2RT9 A;  4NBC A;  2RHB A;  1RQF A;  2PK7 A;  4NBF A;  3CQZ I;  1TWA I;  3GKQ A;  1YIT 1;  3GTL I;  1R9T I;  2OZK A;  3D6W A;  1NUI A;  3CMA 1;  3CCQ 1;  3GCF A;  4A93 I;  3S1M I;  5T6B A;  3OW2 Y;  3CCV 1;  3J81 b;  1K9M 1;  1YJW Z;  1WCM I;  5FLX b;  1Z03 A;  3CXC Y;  4XX2 A;  1VQP 1;  1NJI 1;  3QWU A;  1YJN Z;  3S1Q I;  3NDI A;  2YAD A;  3T4N B;  1JWH C;  1KRL A;  1ZB8 A;  3CC7 1;  1VQL 1;  2M48 A;  1DL6 A;  4A3K I;  3I55 1;  3FKI I;  3CCJ Z;  4DQY B;  3GTJ I;  4Y7N I;  4E33 A;  3I56 Z;  4RS4 A;  1TFI A;  3NH5 A;  4HGY A;  2GTI A;  3IFU A;  4A3D I;  1K73 1;  1I6H I;  2VF1 A;  3VMI A;  3CC4 Z;  1VQM 1;  1TWF I;  2OOY B;  1M90 2;  2RBL A;  3S1R I;  3U50 C;  5T64 A;  2JR6 A;  2OTJ 1;  2JA8 I;  3CCE 1;  3CCS 1;  1WII A;  2QEX Z;  1TWH I;  3S1N I;  3F3P C;  3S17 I;  1P9N A;  3CCU 1;  3CCR Z;  3PO3 S;  2WB1 A;  1Q86 2;  4A3B I;  2YU9 I;  2LIY A;  3J81 f;  1Z01 A;  4NBE A;  5A2Q b;  3VTN A;  1VQ4 1;  2R6M A;  2NVT I;  3CC2 1;  2Q51 A;  3TDH B;  2O4H A;  1QYP A;  3EED A;  2PMZ A;  1KQS Y;  3HOW I;  4MH4 A;  2E2J I;  3JAM b;  4E31 A;  1TWG I;  1VQK 1;  4BY7 I;  3J80 f;  1KD1 2;  1M1K 1;  2V8J A;  3S14 I;  1YUA A;  4E2X A;  1I3Q I;  1WW9 A;  2R7Z I;  1Q7Y 2;  1VQ7 Z;  1ZB9 A;  1S7M A;  1VQO 1;  5C3E I;  1S72 1;  3RZD I;  4NOZ A;  4E30 A;  2QRD B;  1YIT Z;  4DGL A;  3HKZ A;  3VMG A;  3KIH A;  5IT9 b;  3CMA Z;  1YIJ 1;  3CCQ Z;  5C4X I;  3S16 I;  1X3Z A;  3I4N I;  4MD9 A;  3S15 I;  3CPW Z;  3CCV Z;  4A3C I;  1YI2 1;  4RVG A;  2ZAE B;  1N8R 2;  1QVG Y;  5A2Q f;  1QVF Y;  2I3C A;  3CD6 1;  3RZO I;  2EGT A;  3CCL 1;  1VQP Z;  3EER A;  1Z02 A;  4A3L I;  3NH8 A;  2WAQ A;  1LQL A;  3CCM 1;  3BG1 B;  2JA7 I;  2QRE B;  3VMH A;  3FQM A;  1RO0 A;  2F4O A;  2R92 I;  3CC7 Z;  1X0T A;  3HOU I;  3I55 Z;  5CM2 M;  2BJO A;  3CME Z;  1JJ2 Z;  3KIF A;  3Q87 A;  1YHQ 1;  4BXX I;  3CPW Y;  2QA4 1;  1N2F A;  4RV9 A;  4NB9 A;  2DE6 A;  3MZK B;  2QLV B;  3H3V J;  5LL6 f;  1VQ9 1;  1VQ8 1;  2QR1 B;  1VQM Z;  4TNU A;  4NBA A;  4HH4 A;  4HGZ A;  1M90 1;  2NVQ I;  4RVH A;  3GTQ I;  2OTJ Z;  3CCE Z;  3CCS Z;  3LUS A;  3G6E 1;  3K7A I;  1JJ2 Y;  4MD8 A;  2JA6 I;  2NVY I;  1Q86 1;  1PFT A;  4QTU A;  1NP6 A;  1VQ4 Z;  3CC2 Z;  3HOZ I;  1ML8 A;  5FLX f;  4E32 A;  1VQK Z;  4NH1 C;  5IP9 I;  4NBH A;  2GU2 A;  1KD1 1;  2W03 A;  2H85 A;  4MD7 A;  1YJ9 Z;  1Q7Y 1;  2E2I I;  2RPR A;  1VQO Z;  3NFZ A;  2JNY A;  4BBR I;  2W04 A;  2HF1 A;  3I07 A;  3P5J B;  1KC8 2;  1Y1W I;  2JS4 A;  4A3G I;  4BY1 I;  4BBS I;  2P28 A;  3J7A 4;  2IZ3 A;  2K3R A;  4A3F I;  2OTL 1;  2E2H I;  2NVX I;  3F3F C;  5IP7 I;  1VQ5 1;  1YIJ Z;  1K8A 2;  5C4J I;  1Q81 2;  1Q82 2;  4E2W A;  3NH4 A;  2AKL A;  3G4S 1;  1VQ6 1;  2R93 I;  4S1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...